BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25435_g3_i2 len=3421 path=[25267:0-511 30022:512-648 25779:649-723
25940:724-2590 10188:2591-2593 10191:2594-2617 10215:2618-2699
10297:2700-2727 10325:2728-3420]

Length=3421
                                                                      Score     E

gb|AAC23542.1|  receptor protein kinase                                1151   0.0     Ipomoea trifida
ref|XP_009768621.1|  PREDICTED: receptor-like serine/threonine-pr...   1120   0.0     
ref|XP_009612738.1|  PREDICTED: receptor-like serine/threonine-pr...   1105   0.0     
ref|XP_009773537.1|  PREDICTED: receptor-like serine/threonine-pr...   1096   0.0     
ref|XP_009616770.1|  PREDICTED: receptor-like serine/threonine-pr...   1095   0.0     
ref|XP_010316637.1|  PREDICTED: receptor-like serine/threonine-pr...   1091   0.0     
ref|XP_011096222.1|  PREDICTED: uncharacterized protein LOC105175473   1067   0.0     
ref|XP_010317517.1|  PREDICTED: uncharacterized protein LOC101252749   1063   0.0     
ref|XP_006343406.1|  PREDICTED: receptor-like serine/threonine-pr...   1056   0.0     
ref|XP_007025869.1|  Receptor kinase 3                                 1014   0.0     
ref|XP_010106713.1|  Receptor-like serine/threonine-protein kinas...    990   0.0     
ref|XP_010646880.1|  PREDICTED: receptor-like serine/threonine-pr...    986   0.0     
ref|XP_002304966.1|  Brassica self-incompatibility locus family p...    986   0.0     Populus trichocarpa [western balsam poplar]
gb|KDP20852.1|  hypothetical protein JCGZ_21323                         985   0.0     
ref|XP_008364109.1|  PREDICTED: receptor-like serine/threonine-pr...    984   0.0     
ref|XP_010538687.1|  PREDICTED: receptor-like serine/threonine-pr...    979   0.0     
gb|KHN45740.1|  Receptor-like serine/threonine-protein kinase SD1-8     979   0.0     
ref|XP_009345819.1|  PREDICTED: receptor-like serine/threonine-pr...    978   0.0     
ref|XP_011011561.1|  PREDICTED: receptor-like serine/threonine-pr...    978   0.0     
ref|XP_010538685.1|  PREDICTED: receptor-like serine/threonine-pr...    975   0.0     
ref|XP_010052484.1|  PREDICTED: receptor-like serine/threonine-pr...    972   0.0     
ref|XP_002518601.1|  S-locus-specific glycoprotein S6 precursor, ...    969   0.0     Ricinus communis
ref|XP_007159231.1|  hypothetical protein PHAVU_002G220200g             965   0.0     
ref|XP_008227125.1|  PREDICTED: receptor-like serine/threonine-pr...    954   0.0     
ref|XP_010240988.1|  PREDICTED: receptor-like serine/threonine-pr...    952   0.0     
ref|XP_010268934.1|  PREDICTED: receptor-like serine/threonine-pr...    951   0.0     
ref|XP_003608281.1|  Serine/threonine protein kinase                    951   0.0     
ref|XP_002316682.1|  hypothetical protein POPTR_0011s03770g             949   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011008151.1|  PREDICTED: receptor-like serine/threonine-pr...    945   0.0     
ref|XP_004504969.1|  PREDICTED: uncharacterized protein LOC101504189    941   0.0     
ref|XP_004485681.1|  PREDICTED: receptor-like serine/threonine-pr...    936   0.0     
ref|XP_007148275.1|  hypothetical protein PHAVU_006G194600g             935   0.0     
ref|XP_006598304.1|  PREDICTED: uncharacterized protein LOC100797331    933   0.0     
ref|XP_010054468.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    932   0.0     
gb|AID21690.1|  ARK3p                                                   932   0.0     
gb|AID21647.1|  ARK3p                                                   929   0.0     
emb|CCI61483.1|  ARK3                                                   928   0.0     
gb|ADQ37352.1|  unknown                                                 927   0.0     
ref|XP_002867852.1|  At4g21380                                          927   0.0     
ref|XP_010449073.1|  PREDICTED: receptor-like serine/threonine-pr...    926   0.0     
gb|AID21659.1|  ARK3p                                                   925   0.0     
gb|ABN05291.1|  ARK3 protein                                            925   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439485.1|  PREDICTED: receptor-like serine/threonine-pr...    924   0.0     
gb|AID21587.1|  ARK3p                                                   924   0.0     
gb|ABV21214.1|  At4g21380                                               922   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|ADQ37363.1|  unknown                                                 921   0.0     
dbj|BAB69683.1|  receptor kinase 5                                      919   0.0     Brassica rapa
ref|XP_003593412.1|  Serine/threonine protein kinase                    918   0.0     
ref|XP_003541757.1|  PREDICTED: receptor-like serine/threonine-pr...    918   0.0     
gb|ADQ37383.1|  unknown                                                 917   0.0     
ref|XP_010665759.1|  PREDICTED: receptor-like serine/threonine-pr...    916   0.0     
ref|XP_004295386.1|  PREDICTED: uncharacterized protein LOC101313198    915   0.0     
ref|XP_009134691.1|  PREDICTED: receptor-like serine/threonine-pr...    914   0.0     
gb|AID21612.1|  ARK3p                                                   914   0.0     
emb|CDX79055.1|  BnaA01g11220D                                          913   0.0     
ref|NP_193869.1|  receptor kinase 3                                     913   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AID21633.1|  ARK3p                                                   912   0.0     
emb|CAA67145.1|  receptor-like kinase                                   912   0.0     Brassica oleracea
gb|AAB33487.1|  ARK3 product/receptor-like serine/threonine prote...    912   0.0     
ref|XP_010665760.1|  PREDICTED: receptor-like serine/threonine-pr...    911   0.0     
emb|CAA73133.1|  serine /threonine kinase                               910   0.0     Brassica oleracea
gb|KFK28717.1|  hypothetical protein AALP_AA7G037900                    910   0.0     
gb|KCW76538.1|  hypothetical protein EUGRSUZ_D00925                     907   0.0     
ref|XP_008227365.1|  PREDICTED: receptor-like serine/threonine-pr...    907   0.0     
ref|XP_006391515.1|  hypothetical protein EUTSA_v10018118mg             898   0.0     
gb|ADQ37374.1|  unknown                                                 893   0.0     
gb|AGN12878.1|  putative receptor kinase 3                              889   0.0     
ref|XP_006449173.1|  hypothetical protein CICLE_v100142551mg            878   0.0     
emb|CAA74661.1|  SFR1                                                   867   0.0     Brassica oleracea
ref|XP_006391517.1|  hypothetical protein EUTSA_v10018116mg             864   0.0     
emb|CCI61482.1|  SRK                                                    860   0.0     
gb|ADQ37392.1|  unknown                                                 859   0.0     
ref|XP_006391306.1|  hypothetical protein EUTSA_v10018108mg             853   0.0     
dbj|BAB40987.1|  SRKb                                                   852   0.0     Arabidopsis lyrata [lyrate rockcress]
ref|XP_006391514.1|  hypothetical protein EUTSA_v10018117mg             851   0.0     
ref|XP_010924050.1|  PREDICTED: receptor-like serine/threonine-pr...    849   0.0     
ref|XP_002886975.1|  predicted protein                                  850   0.0     
ref|XP_010415122.1|  PREDICTED: receptor-like serine/threonine-pr...    848   0.0     
gb|AGN12871.1|  putative receptor kinase 3                              847   0.0     
gb|AAB33486.1|  ARK2 product/receptor-like serine/threonine prote...    847   0.0     
gb|AFP33767.1|  SRK                                                     847   0.0     
emb|CDY39268.1|  BnaC06g27230D                                          845   0.0     
gb|AFP33766.1|  SRK                                                     844   0.0     
gb|AFP33761.1|  SRK                                                     844   0.0     
gb|AFP33768.1|  SRK                                                     843   0.0     
gb|AFP33770.1|  SRK                                                     843   0.0     
dbj|BAA23676.1|  receptor kinase 1                                      842   0.0     Brassica rapa
gb|AFP33758.1|  SRK                                                     842   0.0     
gb|KHN19083.1|  Receptor-like serine/threonine-protein kinase SD1-8     837   0.0     
ref|XP_008225015.1|  PREDICTED: receptor-like serine/threonine-pr...    867   0.0     
ref|XP_010924053.1|  PREDICTED: receptor-like serine/threonine-pr...    840   0.0     
gb|AID21577.1|  SRKp                                                    840   0.0     
gb|AGN12877.1|  putative S-locus receptor kinase                        838   0.0     
ref|XP_009105170.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    837   0.0     
ref|XP_010924049.1|  PREDICTED: receptor-like serine/threonine-pr...    836   0.0     
gb|AGC55015.1|  S-receptor kinase                                       837   0.0     
gb|ACO83273.1|  SRK                                                     833   0.0     Capsella rubella
ref|NP_176756.1|  receptor-like serine/threonine-protein kinase S...    833   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_004485682.1|  PREDICTED: receptor-like serine/threonine-pr...    832   0.0     
gb|ADQ37382.1|  unknown                                                 832   0.0     
ref|XP_009397154.1|  PREDICTED: receptor-like serine/threonine-pr...    830   0.0     
gb|AID21613.1|  SRKp                                                    829   0.0     
gb|AES63661.2|  G-type lectin S-receptor-like Serine/Threonine-ki...    827   0.0     
gb|AGC55017.1|  S-receptor kinase                                       825   0.0     
dbj|BAA92836.1|  S18 S-locus receptor kinase                            826   0.0     Brassica oleracea
gb|AFP33769.1|  SRK                                                     825   0.0     
emb|CDY66915.1|  BnaC03g72660D                                          825   0.0     
emb|CDX95304.1|  BnaC04g28540D                                          824   0.0     
gb|KEH36480.1|  G-type lectin S-receptor-like Serine/Threonine-ki...    822   0.0     
ref|NP_176755.1|  receptor-like serine/threonine-protein kinase S...    824   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AIB04258.1|  S-locus receptor kinase s-haplotype 1                   823   0.0     
ref|XP_008813304.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    847   0.0     
emb|CDY35375.1|  BnaA03g19850D                                          818   0.0     
emb|CAA74662.1|  SFR3                                                   818   0.0     Brassica oleracea
ref|XP_009115145.1|  PREDICTED: receptor-like serine/threonine-pr...    818   0.0     
ref|XP_010928033.1|  PREDICTED: receptor-like serine/threonine-pr...    830   0.0     
sp|Q09092.2|SRK6_BRAOV  RecName: Full=Putative serine/threonine-p...    817   0.0     Brassica oleracea var. viridis [collards]
ref|XP_009105614.1|  PREDICTED: uncharacterized protein LOC103831486    845   0.0     
ref|XP_010924052.1|  PREDICTED: receptor-like serine/threonine-pr...    814   0.0     
ref|XP_008775529.1|  PREDICTED: receptor-like serine/threonine-pr...    814   0.0     
ref|XP_010439487.1|  PREDICTED: receptor-like serine/threonine-pr...    812   0.0     
emb|CAA79355.1|  S-receptor kinase-like protein                         815   0.0     Brassica oleracea
ref|XP_009133539.1|  PREDICTED: receptor-like serine/threonine-pr...    814   0.0     
emb|CDY23167.1|  BnaA04g05920D                                          813   0.0     
ref|XP_009115144.1|  PREDICTED: receptor-like serine/threonine-pr...    814   0.0     
ref|XP_010268959.1|  PREDICTED: G-type lectin S-receptor-like ser...    812   0.0     
ref|XP_010910454.1|  PREDICTED: receptor-like serine/threonine-pr...    810   0.0     
ref|XP_010644282.1|  PREDICTED: G-type lectin S-receptor-like ser...    822   0.0     
dbj|BAA34233.1|  SRK23Bol                                               810   0.0     Brassica oleracea
dbj|BAA83905.1|  SRK13                                                  810   0.0     Brassica oleracea
ref|XP_010062923.1|  PREDICTED: G-type lectin S-receptor-like ser...    809   0.0     
gb|AAA33008.1|  serine/threonine kinase receptor                        809   0.0     Brassica napus [oilseed rape]
dbj|BAB40986.1|  SRKa                                                   808   0.0     Arabidopsis lyrata [lyrate rockcress]
ref|XP_002869890.1|  predicted protein                                  808   0.0     
dbj|BAA83906.1|  SRK13-b                                                808   0.0     Brassica oleracea
ref|XP_002534316.1|  S-locus-specific glycoprotein S6 precursor, ...    806   0.0     Ricinus communis
gb|AAF23832.1|AC007234_4  F1E22.15                                      834   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006370371.1|  S-locus protein kinase                             805   0.0     
gb|ABW24819.1|  S13-b receptor kinase                                   806   0.0     Brassica oleracea var. viridis [collards]
ref|XP_006284976.1|  hypothetical protein CARUB_v10006283mg             804   0.0     
gb|ADQ37372.1|  unknown                                                 806   0.0     
ref|XP_004957963.1|  PREDICTED: receptor-like serine/threonine-pr...    804   0.0     
ref|XP_007021210.1|  S-locus lectin protein kinase family protein...    803   0.0     
gb|ADQ37362.1|  unknown                                                 805   0.0     
dbj|BAC53784.1|  S-locus receptor kinase                                803   0.0     Brassica napus [oilseed rape]
emb|CDX96134.1|  BnaA07g25970D                                          803   0.0     
gb|KHN33626.1|  Receptor-like serine/threonine-protein kinase SD1-8     796   0.0     
gb|AFP33771.1|  SRK                                                     803   0.0     
dbj|BAE95182.1|  S-locus receptor kinase                                803   0.0     Brassica oleracea
dbj|BAF91400.1|  S-locus receptor kinase                                803   0.0     Brassica oleracea
dbj|BAF56997.1|  S receptor kinase                                      802   0.0     Brassica napus [oilseed rape]
dbj|BAF57003.1|  S receptor kinase                                      802   0.0     Brassica rapa
emb|CAA55950.1|  unnamed protein product                                801   0.0     Brassica oleracea
gb|EPS70219.1|  hypothetical protein M569_04543                         796   0.0     
ref|XP_009105220.1|  PREDICTED: receptor-like serine/threonine-pr...    800   0.0     
ref|XP_010910453.1|  PREDICTED: receptor-like serine/threonine-pr...    799   0.0     
dbj|BAF91394.1|  S-locus receptor kinase                                799   0.0     Brassica rapa
ref|XP_008813305.1|  PREDICTED: uncharacterized protein LOC103723979    826   0.0     
gb|KDO74340.1|  hypothetical protein CISIN_1g003254mg                   798   0.0     
ref|XP_006452072.1|  hypothetical protein CICLE_v10007451mg             798   0.0     
ref|XP_006475244.1|  PREDICTED: G-type lectin S-receptor-like ser...    798   0.0     
ref|XP_011029379.1|  PREDICTED: G-type lectin S-receptor-like ser...    796   0.0     
gb|AID21691.1|  SRKp                                                    797   0.0     
gb|KDP38978.1|  hypothetical protein JCGZ_00735                         795   0.0     
gb|KDP34761.1|  hypothetical protein JCGZ_10541                         795   0.0     
ref|XP_006377797.1|  hypothetical protein POPTR_0011s12930g             795   0.0     
ref|XP_009408779.1|  PREDICTED: receptor-like serine/threonine-pr...    794   0.0     
gb|KDP38970.1|  hypothetical protein JCGZ_00727                         792   0.0     
ref|XP_009377300.1|  PREDICTED: G-type lectin S-receptor-like ser...    793   0.0     
gb|KHN36756.1|  G-type lectin S-receptor-like serine/threonine-pr...    794   0.0     
ref|XP_009377299.1|  PREDICTED: G-type lectin S-receptor-like ser...    794   0.0     
dbj|BAE95185.1|  S-locus receptor kinase                                794   0.0     Brassica oleracea
ref|XP_006594796.1|  PREDICTED: G-type lectin S-receptor-like ser...    793   0.0     
ref|XP_011030934.1|  PREDICTED: G-type lectin S-receptor-like ser...    792   0.0     
dbj|BAF91397.1|  S-locus receptor kinase                                793   0.0     Brassica rapa
ref|XP_006370395.1|  hypothetical protein POPTR_0001s42210g             791   0.0     
emb|CAB41878.1|  SRK5 protein                                           792   0.0     Brassica oleracea
ref|XP_009402881.1|  PREDICTED: receptor-like serine/threonine-pr...    791   0.0     
dbj|BAE93137.1|  S-receptor kinase                                      792   0.0     Brassica rapa
dbj|BAA34911.1|  SRK45                                                  791   0.0     Brassica rapa
gb|EEC82243.1|  hypothetical protein OsI_26417                          792   0.0     Oryza sativa Indica Group [Indian rice]
gb|KDP38980.1|  hypothetical protein JCGZ_00737                         790   0.0     
ref|XP_010434187.1|  PREDICTED: receptor-like serine/threonine-pr...    784   0.0     
dbj|BAF91375.1|  S receptor kinase                                      791   0.0     Brassica rapa
ref|XP_009617832.1|  PREDICTED: G-type lectin S-receptor-like ser...    790   0.0     
ref|XP_009611412.1|  PREDICTED: G-type lectin S-receptor-like ser...    790   0.0     
dbj|BAF57002.1|  S receptor kinase                                      790   0.0     Brassica napus [oilseed rape]
emb|CAB41879.1|  SRK15 protein                                          790   0.0     Brassica oleracea
dbj|BAA07576.1|  receptor protein kinase SRK8                           790   0.0     Brassica rapa
dbj|BAE95187.1|  S-locus receptor kinase                                790   0.0     Brassica oleracea
dbj|BAF91395.1|  S-locus receptor kinase                                790   0.0     Brassica rapa
emb|CAA82930.1|  srk29                                                  790   0.0     Brassica oleracea
ref|XP_009402882.1|  PREDICTED: receptor-like serine/threonine-pr...    788   0.0     
gb|KCW76536.1|  hypothetical protein EUGRSUZ_D00923                     783   0.0     
dbj|BAF56998.1|  S receptor kinase                                      788   0.0     Brassica napus [oilseed rape]
dbj|BAE93138.1|  S-receptor kinase                                      788   0.0     Brassica rapa
ref|XP_006360116.1|  PREDICTED: G-type lectin S-receptor-like ser...    787   0.0     
dbj|BAF91385.1|  S-locus receptor kinase                                788   0.0     Brassica rapa
dbj|BAA83746.1|  SRK2-b                                                 786   0.0     Brassica oleracea
dbj|BAF91411.1|  S-locus receptor kinase                                786   0.0     Brassica oleracea
dbj|BAA06285.1|  S-receptor kinase SRK9                                 785   0.0     Brassica rapa
ref|XP_007021187.1|  Serine/threonine kinases,protein kinases,ATP...    784   0.0     
dbj|BAA21132.1|  S-receptor kinase                                      785   0.0     Brassica rapa
dbj|BAE92528.1|  BoSRK-28                                               785   0.0     Brassica oleracea
ref|XP_010247745.1|  PREDICTED: G-type lectin S-receptor-like ser...    784   0.0     
ref|XP_006594797.1|  PREDICTED: G-type lectin S-receptor-like ser...    781   0.0     
ref|XP_008651809.1|  PREDICTED: uncharacterized LOC100501883 isof...    783   0.0     
gb|AIZ68213.1|  receptor-like serine/threonine-protein kinase SD1-8     782   0.0     
dbj|BAA31252.1|  SRK29                                                  783   0.0     Brassica rapa
gb|KDP38975.1|  hypothetical protein JCGZ_00732                         781   0.0     
ref|XP_010247747.1|  PREDICTED: G-type lectin S-receptor-like ser...    783   0.0     
dbj|BAA34231.1|  SRK46Bra                                               782   0.0     Brassica rapa
dbj|BAF91378.1|  S receptor kinase                                      782   0.0     Brassica rapa
ref|XP_010324340.1|  PREDICTED: G-type lectin S-receptor-like ser...    781   0.0     
ref|XP_006370370.1|  hypothetical protein POPTR_0001s42050g             780   0.0     
ref|XP_011095279.1|  PREDICTED: G-type lectin S-receptor-like ser...    779   0.0     
dbj|BAA07577.2|  receptor protein kinase SRK12                          781   0.0     Brassica rapa
dbj|BAF91401.1|  S-locus receptor kinase                                781   0.0     Brassica oleracea
gb|AAA62232.1|  S-receptor kinase                                       780   0.0     Brassica napus [oilseed rape]
ref|XP_007021377.1|  S-locus lectin protein kinase family protein...    779   0.0     
ref|XP_011012090.1|  PREDICTED: G-type lectin S-receptor-like ser...    779   0.0     
dbj|BAC80024.1|  putative receptor protein kinase                       780   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_002518599.1|  S-locus-specific glycoprotein S6 precursor, ...    778   0.0     Ricinus communis
gb|ACU29643.1|  S-locus receptor kinase 25                              779   0.0     Arabidopsis lyrata [lyrate rockcress]
ref|XP_009800154.1|  PREDICTED: G-type lectin S-receptor-like ser...    778   0.0     
ref|XP_010240989.1|  PREDICTED: G-type lectin S-receptor-like ser...    777   0.0     
dbj|BAB21001.1|  S locus receptor kinase                                777   0.0     Brassica rapa
ref|XP_009398189.1|  PREDICTED: receptor-like serine/threonine-pr...    776   0.0     
dbj|BAE96738.1|  S receptor kinase                                      777   0.0     Brassica rapa
prf||2106157B  S-receptor kinase                                        777   0.0  
dbj|BAA92837.1|  S60 S-locus receptor kinase                            776   0.0     Brassica oleracea
ref|XP_007025879.1|  S-locus lectin protein kinase family protein...    774   0.0     
ref|XP_007021383.1|  S-locus lectin protein kinase family protein       773   0.0     
ref|XP_010918937.1|  PREDICTED: receptor-like serine/threonine-pr...    773   0.0     
ref|XP_008359300.1|  PREDICTED: G-type lectin S-receptor-like ser...    772   0.0     
gb|ADG01813.1|  SRK                                                     774   0.0     
emb|CAN77004.1|  hypothetical protein VITISV_027305                     772   0.0     Vitis vinifera
gb|ABF71368.1|  S receptor kinase SRK04                                 773   0.0     Arabidopsis halleri
ref|XP_010060465.1|  PREDICTED: G-type lectin S-receptor-like ser...    772   0.0     
ref|XP_009355538.1|  PREDICTED: G-type lectin S-receptor-like ser...    771   0.0     
dbj|BAF91396.1|  S-locus receptor kinase                                772   0.0     Brassica rapa
ref|XP_008359301.1|  PREDICTED: G-type lectin S-receptor-like ser...    771   0.0     
ref|XP_006452075.1|  hypothetical protein CICLE_v10007466mg             771   0.0     
dbj|BAF91412.1|  S-locus receptor kinase                                772   0.0     Brassica oleracea
ref|XP_010927571.1|  PREDICTED: receptor-like serine/threonine-pr...    771   0.0     
gb|AGC54823.1|  S-locus receptor kinase 13-15                           768   0.0     
ref|XP_011002478.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    798   0.0     
ref|XP_007021182.1|  S-locus lectin protein kinase family protein       779   0.0     
ref|XP_006475277.1|  PREDICTED: G-type lectin S-receptor-like ser...    770   0.0     
dbj|BAF91382.1|  S receptor kinase-54                                   771   0.0     Brassica rapa
ref|XP_006413094.1|  hypothetical protein EUTSA_v10027068mg             769   0.0     
dbj|BAE96737.1|  S receptor kinase                                      770   0.0     Brassica rapa
gb|KDO74346.1|  hypothetical protein CISIN_1g003391mg                   769   0.0     
ref|XP_009355540.1|  PREDICTED: G-type lectin S-receptor-like ser...    769   0.0     
emb|CBI20426.3|  unnamed protein product                                802   0.0     
ref|XP_009355541.1|  PREDICTED: G-type lectin S-receptor-like ser...    768   0.0     
ref|XP_011097953.1|  PREDICTED: G-type lectin S-receptor-like ser...    767   0.0     
ref|XP_002525781.1|  S-locus-specific glycoprotein S13 precursor,...    769   0.0     Ricinus communis
ref|XP_007149662.1|  hypothetical protein PHAVU_005G088700g             767   0.0     
ref|XP_008226742.1|  PREDICTED: G-type lectin S-receptor-like ser...    766   0.0     
gb|KDP38995.1|  hypothetical protein JCGZ_00752                         766   0.0     
gb|KDP38979.1|  hypothetical protein JCGZ_00736                         766   0.0     
ref|XP_007021380.1|  S-locus lectin protein kinase family protein       765   0.0     
ref|XP_011029382.1|  PREDICTED: G-type lectin S-receptor-like ser...    765   0.0     
ref|XP_006377792.1|  hypothetical protein POPTR_0011s12880g             762   0.0     
ref|XP_008366279.1|  PREDICTED: G-type lectin S-receptor-like ser...    764   0.0     
dbj|BAD53361.1|  putative receptor-like protein kinase ARK1             765   0.0     Oryza sativa Japonica Group [Japonica rice]
emb|CBI25711.3|  unnamed protein product                                756   0.0     
gb|ABF71379.1|  S receptor kinase SRK37                                 763   0.0     Arabidopsis lyrata [lyrate rockcress]
ref|XP_008779293.1|  PREDICTED: G-type lectin S-receptor-like ser...    764   0.0     
ref|XP_007021379.1|  S-locus lectin protein kinase family protein       763   0.0     
ref|XP_008226744.1|  PREDICTED: G-type lectin S-receptor-like ser...    763   0.0     
ref|XP_002317544.2|  hypothetical protein POPTR_0011s13180g             763   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011029380.1|  PREDICTED: G-type lectin S-receptor-like ser...    763   0.0     
dbj|BAE92526.1|  BrSRK-f2                                               763   0.0     Brassica rapa
ref|XP_007021202.1|  S-locus lectin protein kinase family protein...    762   0.0     
ref|XP_008226745.1|  PREDICTED: G-type lectin S-receptor-like ser...    761   0.0     
ref|XP_009778629.1|  PREDICTED: uncharacterized protein LOC104227947    787   0.0     
ref|XP_011030928.1|  PREDICTED: G-type lectin S-receptor-like ser...    760   0.0     
emb|CDP05413.1|  unnamed protein product                                767   0.0     
ref|XP_006362969.1|  PREDICTED: G-type lectin S-receptor-like ser...    761   0.0     
ref|XP_011097955.1|  PREDICTED: G-type lectin S-receptor-like ser...    759   0.0     
ref|XP_004487639.1|  PREDICTED: G-type lectin S-receptor-like ser...    759   0.0     
dbj|BAF91415.1|  S-locus receptor kinase                                759   0.0     
emb|CDP05414.1|  unnamed protein product                                764   0.0     
gb|KEH31157.1|  G-type lectin S-receptor-like Serine/Threonine-ki...    754   0.0     
gb|ADG01647.1|  SRK                                                     759   0.0     
gb|KDO74353.1|  hypothetical protein CISIN_1g003272mg                   758   0.0     
gb|ADG01646.1|  SRK                                                     759   0.0     
ref|XP_006413787.1|  hypothetical protein EUTSA_v10024419mg             758   0.0     
sp|P0DH86.1|SRK_ARATH  RecName: Full=G-type lectin S-receptor-lik...    759   0.0     
ref|XP_008454614.1|  PREDICTED: G-type lectin S-receptor-like ser...    757   0.0     
ref|XP_010064358.1|  PREDICTED: G-type lectin S-receptor-like ser...    755   0.0     
gb|ABU54595.1|  SRK                                                     758   0.0     
ref|XP_011013015.1|  PREDICTED: G-type lectin S-receptor-like ser...    756   0.0     
ref|XP_011030927.1|  PREDICTED: G-type lectin S-receptor-like ser...    756   0.0     
ref|XP_011002479.1|  PREDICTED: G-type lectin S-receptor-like ser...    769   0.0     
ref|XP_010927986.1|  PREDICTED: G-type lectin S-receptor-like ser...    755   0.0     
gb|ADG01648.1|  SRK                                                     756   0.0     
gb|ABP02072.1|  S-locus receptor kinase SRK7                            755   0.0     
gb|ADG01653.1|  SRK                                                     756   0.0     
gb|ADG01645.1|  SRK                                                     755   0.0     
gb|ADG01654.1|  SRK                                                     755   0.0     
ref|XP_008226746.1|  PREDICTED: G-type lectin S-receptor-like ser...    753   0.0     
ref|XP_007021189.1|  Serine/threonine kinases,protein kinases,ATP...    753   0.0     
ref|XP_010105613.1|  Receptor-like serine/threonine-protein kinas...    753   0.0     
ref|XP_010247744.1|  PREDICTED: G-type lectin S-receptor-like ser...    752   0.0     
ref|XP_006377788.1|  hypothetical protein POPTR_0011s12840g             752   0.0     
ref|XP_008454615.1|  PREDICTED: G-type lectin S-receptor-like ser...    752   0.0     
ref|XP_006370566.1|  hypothetical protein POPTR_0001s43850g             752   0.0     
gb|ADG01652.1|  SRK                                                     753   0.0     
gb|EYU19178.1|  hypothetical protein MIMGU_mgv1a020642mg                751   0.0     
ref|XP_010060466.1|  PREDICTED: G-type lectin S-receptor-like ser...    751   0.0     
ref|XP_007214023.1|  hypothetical protein PRUPE_ppa016527mg             752   0.0     
ref|XP_004244166.2|  PREDICTED: uncharacterized protein LOC101262029    796   0.0     
ref|XP_002528889.1|  ATP binding protein, putative                      775   0.0     
ref|XP_011014317.1|  PREDICTED: G-type lectin S-receptor-like ser...    749   0.0     
ref|XP_010106354.1|  G-type lectin S-receptor-like serine/threoni...    749   0.0     
gb|ABD59322.1|  S locus receptor kinase                                 748   0.0     
ref|XP_009355542.1|  PREDICTED: G-type lectin S-receptor-like ser...    748   0.0     
ref|XP_006592561.1|  PREDICTED: G-type lectin S-receptor-like ser...    748   0.0     
ref|XP_006370627.1|  hypothetical protein POPTR_0001s44380g             747   0.0     
ref|XP_006582212.1|  PREDICTED: G-type lectin S-receptor-like ser...    746   0.0     
ref|XP_004146866.1|  PREDICTED: receptor-like serine/threonine-pr...    746   0.0     
ref|XP_007025881.1|  S-locus lectin protein kinase family protein...    747   0.0     
gb|KDP38992.1|  hypothetical protein JCGZ_00749                         746   0.0     
ref|XP_006582211.1|  PREDICTED: G-type lectin S-receptor-like ser...    746   0.0     
gb|EYU36707.1|  hypothetical protein MIMGU_mgv1a001407mg                746   0.0     
ref|XP_010918938.1|  PREDICTED: receptor-like serine/threonine-pr...    744   0.0     
gb|KHN05773.1|  G-type lectin S-receptor-like serine/threonine-pr...    745   0.0     
ref|XP_008651810.1|  PREDICTED: uncharacterized LOC100501883 isof...    743   0.0     
gb|ACT67492.1|  S receptor protein kinase                               746   0.0     
ref|XP_007021381.1|  S-locus lectin protein kinase family protein       767   0.0     
ref|XP_008366485.1|  PREDICTED: receptor-like serine/threonine-pr...    771   0.0     
ref|XP_008386046.1|  PREDICTED: G-type lectin S-receptor-like ser...    743   0.0     
ref|XP_007212862.1|  hypothetical protein PRUPE_ppa021546mg             743   0.0     
ref|XP_011030955.1|  PREDICTED: uncharacterized protein LOC105130249    773   0.0     
ref|XP_010927531.1|  PREDICTED: G-type lectin S-receptor-like ser...    744   0.0     
ref|XP_010247749.1|  PREDICTED: G-type lectin S-receptor-like ser...    744   0.0     
ref|XP_008226732.1|  PREDICTED: G-type lectin S-receptor-like ser...    742   0.0     
ref|XP_008810813.1|  PREDICTED: receptor-like serine/threonine-pr...    742   0.0     
ref|XP_003532567.1|  PREDICTED: G-type lectin S-receptor-like ser...    743   0.0     
ref|XP_011013014.1|  PREDICTED: G-type lectin S-receptor-like ser...    743   0.0     
ref|XP_008386061.1|  PREDICTED: G-type lectin S-receptor-like ser...    742   0.0     
ref|NP_001168535.1|  uncharacterized LOC100382315 precursor             744   0.0     
ref|XP_003564365.1|  PREDICTED: receptor-like serine/threonine-pr...    743   0.0     
ref|XP_006475273.1|  PREDICTED: uncharacterized protein LOC102626595    771   0.0     
ref|XP_010062926.1|  PREDICTED: G-type lectin S-receptor-like ser...    740   0.0     
ref|XP_011048295.1|  PREDICTED: G-type lectin S-receptor-like ser...    740   0.0     
ref|XP_006452080.1|  hypothetical protein CICLE_v10007464mg             740   0.0     
ref|XP_007214794.1|  hypothetical protein PRUPE_ppa014934mg             739   0.0     
ref|XP_011073949.1|  PREDICTED: G-type lectin S-receptor-like ser...    739   0.0     
gb|KHG05572.1|  hypothetical protein F383_31410                         740   0.0     
ref|XP_006582209.1|  PREDICTED: G-type lectin S-receptor-like ser...    740   0.0     
gb|AFW84881.1|  putative S-locus receptor-like protein kinase fam...    743   0.0     
ref|XP_006582208.1|  PREDICTED: G-type lectin S-receptor-like ser...    739   0.0     
ref|XP_008657161.1|  PREDICTED: receptor-like serine/threonine-pr...    741   0.0     
ref|XP_008386047.1|  PREDICTED: G-type lectin S-receptor-like ser...    739   0.0     
ref|XP_009355544.1|  PREDICTED: G-type lectin S-receptor-like ser...    738   0.0     
ref|XP_010449074.1|  PREDICTED: receptor-like serine/threonine-pr...    734   0.0     
ref|XP_008386049.1|  PREDICTED: G-type lectin S-receptor-like ser...    738   0.0     
ref|XP_004970203.1|  PREDICTED: receptor-like serine/threonine-pr...    740   0.0     
ref|NP_001288457.1|  receptor-like serine/threonine-protein kinas...    739   0.0     
gb|AFP33765.1|  SRK                                                     739   0.0     
ref|XP_007212497.1|  hypothetical protein PRUPE_ppa017572mg             738   0.0     
ref|XP_007133104.1|  hypothetical protein PHAVU_011G152000g             738   0.0     
gb|AES68385.2|  S-locus lectin kinase family protein                    738   0.0     
ref|XP_008386059.1|  PREDICTED: G-type lectin S-receptor-like ser...    737   0.0     
ref|XP_008386058.1|  PREDICTED: G-type lectin S-receptor-like ser...    736   0.0     
gb|KCW67093.1|  hypothetical protein EUGRSUZ_F00872                     735   0.0     
ref|XP_006370403.1|  hypothetical protein POPTR_0001s42280g             735   0.0     
ref|XP_002458611.1|  hypothetical protein SORBIDRAFT_03g036650          736   0.0     
ref|XP_011014316.1|  PREDICTED: G-type lectin S-receptor-like ser...    736   0.0     
ref|XP_010060395.1|  PREDICTED: G-type lectin S-receptor-like ser...    734   0.0     
ref|XP_007214096.1|  hypothetical protein PRUPE_ppa015608mg             734   0.0     
ref|XP_006362970.1|  PREDICTED: G-type lectin S-receptor-like ser...    733   0.0     
ref|XP_004294087.1|  PREDICTED: G-type lectin S-receptor-like ser...    735   0.0     
ref|XP_009355543.1|  PREDICTED: G-type lectin S-receptor-like ser...    733   0.0     
ref|XP_011030922.1|  PREDICTED: G-type lectin S-receptor-like ser...    735   0.0     
ref|XP_003598134.1|  Serine/threonine protein kinase                    736   0.0     
ref|XP_007021124.1|  S-locus lectin protein kinase family protein...    733   0.0     
ref|XP_011030931.1|  PREDICTED: G-type lectin S-receptor-like ser...    732   0.0     
ref|XP_006475280.1|  PREDICTED: uncharacterized protein LOC102629172    758   0.0     
ref|XP_006593151.1|  PREDICTED: G-type lectin S-receptor-like ser...    731   0.0     
ref|XP_006370368.1|  hypothetical protein POPTR_0001s42030g             731   0.0     
ref|XP_004154883.1|  PREDICTED: receptor-like serine/threonine-pr...    747   0.0     
ref|XP_007025876.1|  S-locus lectin protein kinase family protein       731   0.0     
ref|XP_011030930.1|  PREDICTED: G-type lectin S-receptor-like ser...    731   0.0     
ref|XP_006475274.1|  PREDICTED: uncharacterized protein LOC102626881    758   0.0     
ref|XP_010647105.1|  PREDICTED: G-type lectin S-receptor-like ser...    731   0.0     
ref|XP_006593167.1|  PREDICTED: G-type lectin S-receptor-like ser...    729   0.0     
ref|XP_011030932.1|  PREDICTED: G-type lectin S-receptor-like ser...    730   0.0     
ref|XP_002317550.1|  hypothetical protein POPTR_0011s13250g             728   0.0     
ref|XP_006370398.1|  hypothetical protein POPTR_0001s42250g             728   0.0     
ref|XP_007159227.1|  hypothetical protein PHAVU_002G219900g             730   0.0     
ref|XP_011030920.1|  PREDICTED: G-type lectin S-receptor-like ser...    730   0.0     
gb|KDP38982.1|  hypothetical protein JCGZ_00739                         729   0.0     
ref|XP_006391305.1|  hypothetical protein EUTSA_v10018108mg             729   0.0     
ref|XP_010327263.1|  PREDICTED: uncharacterized protein LOC101244232    754   0.0     
ref|XP_009124785.1|  PREDICTED: receptor-like serine/threonine-pr...    729   0.0     
gb|KDP20843.1|  hypothetical protein JCGZ_21314                         728   0.0     
ref|XP_002315527.2|  hypothetical protein POPTR_0010s01980g             727   0.0     
gb|KDP38983.1|  hypothetical protein JCGZ_00740                         727   0.0     
ref|XP_010105620.1|  G-type lectin S-receptor-like serine/threoni...    725   0.0     
gb|KEH19660.1|  S-locus lectin kinase family protein                    727   0.0     
ref|XP_004961599.1|  PREDICTED: receptor-like serine/threonine-pr...    728   0.0     
ref|XP_002518600.1|  S-locus-specific glycoprotein S13 precursor,...    727   0.0     
dbj|BAB69682.1|  receptor kinase 3                                      728   0.0     
gb|KCW70077.1|  hypothetical protein EUGRSUZ_F03382                     727   0.0     
ref|XP_011095779.1|  PREDICTED: G-type lectin S-receptor-like ser...    726   0.0     
ref|XP_006377796.1|  hypothetical protein POPTR_0011s12920g             726   0.0     
gb|KEH16804.1|  S-locus lectin kinase family protein                    726   0.0     
ref|XP_010241038.1|  PREDICTED: G-type lectin S-receptor-like ser...    726   0.0     
ref|XP_006475243.1|  PREDICTED: G-type lectin S-receptor-like ser...    725   0.0     
ref|XP_006378116.1|  hypothetical protein POPTR_0010s02670g             726   0.0     
ref|XP_003566068.1|  PREDICTED: receptor-like serine/threonine-pr...    727   0.0     
ref|XP_006377798.1|  hypothetical protein POPTR_0011s12970g             726   0.0     
ref|XP_003593409.1|  Serine/threonine protein kinase                    726   0.0     
gb|KDO74333.1|  hypothetical protein CISIN_1g003832mg                   724   0.0     
ref|XP_007021134.1|  S-locus lectin protein kinase family protein...    725   0.0     
ref|XP_007148753.1|  hypothetical protein PHAVU_005G011200g             726   0.0     
ref|XP_011000517.1|  PREDICTED: G-type lectin S-receptor-like ser...    725   0.0     
ref|XP_002317537.2|  hypothetical protein POPTR_0011s12970g             725   0.0     
ref|XP_011030935.1|  PREDICTED: G-type lectin S-receptor-like ser...    723   0.0     
ref|XP_007021624.1|  S-locus lectin protein kinase family protein       724   0.0     
ref|XP_006475248.1|  PREDICTED: G-type lectin S-receptor-like ser...    723   0.0     
ref|XP_004295782.1|  PREDICTED: G-type lectin S-receptor-like ser...    742   0.0     
emb|CDM84490.1|  unnamed protein product                                724   0.0     
gb|KDP38984.1|  hypothetical protein JCGZ_00741                         721   0.0     
ref|XP_011002459.1|  PREDICTED: G-type lectin S-receptor-like ser...    721   0.0     
emb|CDO99674.1|  unnamed protein product                                722   0.0     
ref|XP_007149663.1|  hypothetical protein PHAVU_005G088800g             719   0.0     
ref|XP_011013157.1|  PREDICTED: G-type lectin S-receptor-like ser...    721   0.0     
ref|XP_010052475.1|  PREDICTED: G-type lectin S-receptor-like ser...    722   0.0     
ref|XP_004513948.1|  PREDICTED: G-type lectin S-receptor-like ser...    721   0.0     
ref|XP_003541760.1|  PREDICTED: G-type lectin S-receptor-like ser...    721   0.0     
ref|XP_011030936.1|  PREDICTED: G-type lectin S-receptor-like ser...    719   0.0     
ref|XP_007213654.1|  hypothetical protein PRUPE_ppa001414mg             720   0.0     
gb|EYU33571.1|  hypothetical protein MIMGU_mgv1a020014mg                719   0.0     
ref|XP_008383964.1|  PREDICTED: G-type lectin S-receptor-like ser...    720   0.0     
ref|XP_004513947.1|  PREDICTED: G-type lectin S-receptor-like ser...    718   0.0     
ref|XP_011002460.1|  PREDICTED: G-type lectin S-receptor-like ser...    718   0.0     
ref|XP_006449167.1|  hypothetical protein CICLE_v10014259mg             719   0.0     
ref|XP_002304971.2|  hypothetical protein POPTR_0004s02820g             718   0.0     
ref|XP_004487641.1|  PREDICTED: G-type lectin S-receptor-like ser...    717   0.0     
ref|XP_011030938.1|  PREDICTED: G-type lectin S-receptor-like ser...    717   0.0     
gb|KHN11180.1|  G-type lectin S-receptor-like serine/threonine-pr...    716   0.0     
ref|XP_010052477.1|  PREDICTED: G-type lectin S-receptor-like ser...    718   0.0     
ref|XP_006594644.1|  PREDICTED: G-type lectin S-receptor-like ser...    717   0.0     
ref|XP_007021201.1|  S-locus lectin protein kinase family protein...    717   0.0     
ref|XP_006388692.1|  hypothetical protein POPTR_0118s00210g             717   0.0     
ref|XP_006370405.1|  hypothetical protein POPTR_0001s42300g             716   0.0     
ref|XP_002315552.2|  hypothetical protein POPTR_0010s02630g             716   0.0     
ref|XP_006370402.1|  hypothetical protein POPTR_0001s42280g             715   0.0     
ref|XP_007025873.1|  Receptor kinase 3 isoform 1                        716   0.0     
ref|XP_010052476.1|  PREDICTED: G-type lectin S-receptor-like ser...    717   0.0     
ref|XP_011012851.1|  PREDICTED: G-type lectin S-receptor-like ser...    716   0.0     
ref|XP_009349779.1|  PREDICTED: uncharacterized protein LOC103941313    743   0.0     
gb|KDP38977.1|  hypothetical protein JCGZ_00734                         714   0.0     
ref|XP_006452103.1|  hypothetical protein CICLE_v10010341mg             712   0.0     
ref|XP_004513949.1|  PREDICTED: G-type lectin S-receptor-like ser...    713   0.0     
ref|XP_009377297.1|  PREDICTED: G-type lectin S-receptor-like ser...    713   0.0     
ref|XP_006356899.1|  PREDICTED: G-type lectin S-receptor-like ser...    713   0.0     
ref|XP_006370400.1|  hypothetical protein POPTR_0001s42260g             713   0.0     
ref|XP_003526146.1|  PREDICTED: G-type lectin S-receptor-like ser...    713   0.0     
ref|XP_008452314.1|  PREDICTED: G-type lectin S-receptor-like ser...    712   0.0     
ref|XP_010928107.1|  PREDICTED: receptor-like serine/threonine-pr...    736   0.0     
ref|XP_010647031.1|  PREDICTED: G-type lectin S-receptor-like ser...    713   0.0     
ref|XP_006582215.1|  PREDICTED: G-type lectin S-receptor-like ser...    712   0.0     
ref|XP_004513950.1|  PREDICTED: G-type lectin S-receptor-like ser...    712   0.0     
gb|KHN35584.1|  G-type lectin S-receptor-like serine/threonine-pr...    709   0.0     
ref|XP_009611413.1|  PREDICTED: G-type lectin S-receptor-like ser...    710   0.0     
gb|AAA97902.1|  secreted glycoprotein 2                                 696   0.0     
gb|KCW67242.1|  hypothetical protein EUGRSUZ_F01031                     709   0.0     
ref|XP_010052478.1|  PREDICTED: G-type lectin S-receptor-like ser...    711   0.0     
ref|XP_004504968.1|  PREDICTED: G-type lectin S-receptor-like ser...    718   0.0     
ref|XP_006356900.1|  PREDICTED: G-type lectin S-receptor-like ser...    709   0.0     
ref|XP_003526141.1|  PREDICTED: G-type lectin S-receptor-like ser...    709   0.0     
ref|XP_008452313.1|  PREDICTED: G-type lectin S-receptor-like ser...    709   0.0     
ref|XP_006378085.1|  hypothetical protein POPTR_0010s01930g             707   0.0     
ref|XP_009417412.1|  PREDICTED: receptor-like serine/threonine-pr...    734   0.0     
ref|XP_006383983.1|  hypothetical protein POPTR_0004s02820g             707   0.0     
ref|XP_011003375.1|  PREDICTED: G-type lectin S-receptor-like ser...    707   0.0     
ref|XP_009355685.1|  PREDICTED: uncharacterized protein LOC103946653    733   0.0     
ref|XP_008777589.1|  PREDICTED: receptor-like serine/threonine-pr...    727   0.0     
ref|XP_007021195.1|  S-locus lectin protein kinase family protein...    714   0.0     
gb|KEH31162.1|  G-type lectin S-receptor-like Serine/Threonine-ki...    703   0.0     
ref|XP_007133113.1|  hypothetical protein PHAVU_011G152400g             702   0.0     
ref|XP_006370399.1|  hypothetical protein POPTR_0001s42260g             701   0.0     
gb|KHN45738.1|  G-type lectin S-receptor-like serine/threonine-pr...    701   0.0     
ref|XP_010111027.1|  G-type lectin S-receptor-like serine/threoni...    708   0.0     
ref|XP_011030933.1|  PREDICTED: G-type lectin S-receptor-like ser...    700   0.0     
gb|KHN00064.1|  G-type lectin S-receptor-like serine/threonine-pr...    700   0.0     
emb|CBI20425.3|  unnamed protein product                                703   0.0     
ref|XP_011096221.1|  PREDICTED: uncharacterized protein LOC105175472    728   0.0     
ref|XP_007213469.1|  hypothetical protein PRUPE_ppa023906mg             700   0.0     
ref|XP_010060471.1|  PREDICTED: G-type lectin S-receptor-like ser...    701   0.0     
ref|XP_004295401.1|  PREDICTED: G-type lectin S-receptor-like ser...    700   0.0     
ref|XP_011013386.1|  PREDICTED: G-type lectin S-receptor-like ser...    699   0.0     
ref|XP_010060470.1|  PREDICTED: G-type lectin S-receptor-like ser...    700   0.0     



>gb|AAC23542.1| receptor protein kinase [Ipomoea trifida]
Length=853

 Score =  1151 bits (2978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/831 (70%), Positives = 681/831 (82%), Gaps = 24/831 (3%)
 Frame = +3

Query  726   PLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFL  905
             PL  N+TLVS+  +F+LGFF+P G S   YVGIWYKEI  +T+VWV NRD   R S G L
Sbjct  39    PLAGNRTLVSSDGLFELGFFTPNG-SDQSYVGIWYKEIEPKTVVWVGNRDGASRGSAGIL  97

Query  906   KIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
             KIGEDGNIHLVDG GN IWS +N   QS   NTVAQLLDSGNFV+RRE+DENPENYLWQS
Sbjct  98    KIGEDGNIHLVDGGGNFIWSPTN---QSAARNTVAQLLDSGNFVLRREDDENPENYLWQS  154

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FDYPTDTLLPGMKLGWDSKTG NRYIS+W+S  DP EG I+FKLDINGLPE FLRN+D I
Sbjct  155   FDYPTDTLLPGMKLGWDSKTGLNRYISAWKSLNDPGEGPISFKLDINGLPEIFLRNRDKI  214

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             +YRSG WNGV FSGVPEM+P   I FSF+ TKNE YYSFE+HNK L+SRL+V     LER
Sbjct  215   VYRSGPWNGVRFSGVPEMKPTATITFSFVMTKNERYYSFELHNKTLYSRLLVTRNGNLER  274

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             Y WIP ++IW++FW APKDQCD+Y+ECG+FG CDT+MSPVC C VGF+P++ QAW LRDG
Sbjct  275   YAWIPTSKIWSKFWYAPKDQCDSYKECGTFGFCDTNMSPVCQCLVGFRPKSPQAWDLRDG  334

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
             S GC RY EL+C  DGFL+MN+ KLP++S+SFVD TM+LDEC +MC  NCSCTAY+N NI
Sbjct  335   SDGCVRYHELECRKDGFLTMNFMKLPDTSSSFVDTTMNLDECMKMCKNNCSCTAYTNSNI  394

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQ----LLYVRVAASDAEQTGEVARGGNGFGKTKKV  1973
             SNGGSGCVIWT EL D       GG+     L+ R +ASD  Q G+    G+  G+TK++
Sbjct  395   SNGGSGCVIWTTELLDA---AVRGGRRWPSCLHPR-SASDVAQGGD---SGDASGRTKRI  447

Query  1974  ILACgivl---gigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKRE  2144
             I+ACGI +    +   L  L +LKRR+ +R + +N E+RG R+RS+D LMNA  I SKRE
Sbjct  448   IIACGIAVGVGILLFALSALFILKRRQSKRALGKNTELRGFRDRSQDLLMNAAVIPSKRE  507

Query  2145  HSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSK  2324
             +SGETM TDE+ELP+FDF+ I +ATDNFA+ NKLGQGGFG VYKGM V GEEIAVKRLSK
Sbjct  508   YSGETM-TDEFELPLFDFSTIVVATDNFADVNKLGQGGFGCVYKGM-VEGEEIAVKRLSK  565

Query  2325  NSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSS  2504
             NS QG EEFKNELRLIARLQHRNLV+LLGCCVD++EK+LIYEYMENKSLDS LF+K+RSS
Sbjct  566   NSGQGVEEFKNELRLIARLQHRNLVRLLGCCVDMEEKILIYEYMENKSLDSTLFNKQRSS  625

Query  2505  LLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGG  2684
             LL+W+ R+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLDKEMNPKISDFGMAR+FGG
Sbjct  626   LLNWQTRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGG  685

Query  2685  DETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEE  2864
             DET+A  TKR+VGTYGYMSPEYAMDGLFSVKSD FSFGVLVLE+V+G+KN+GFY  +N++
Sbjct  686   DETDANNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTGKKNRGFYNQNNQQ  745

Query  2865  NLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVM  3044
             NLLG AWRLW E RGSELLDS I  ES+S  + +VMRCIQVGLLCVQE+AEDRPNMA V+
Sbjct  746   NLLGHAWRLWRERRGSELLDSAIG-ESYS--LCEVMRCIQVGLLCVQEQAEDRPNMATVV  802

Query  3045  LMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             LML  +  +LPQPK PGFCL S+P  MDSS+++ ++  ++NQ+TVTMLD R
Sbjct  803   LMLGSESATLPQPKHPGFCLGSRPADMDSSTSNCDESCTVNQVTVTMLDGR  853



>ref|XP_009768621.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nicotiana sylvestris]
Length=907

 Score =  1120 bits (2897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/831 (68%), Positives = 667/831 (80%), Gaps = 21/831 (3%)
 Frame = +3

Query  726   PLTLNQTLVSAGEVFQLGFFSPGG-NSGGLYVGIWYKEIRDRTIVWVANRDKPLRNS-TG  899
             PLT +QTLVS+G++F+LGFFSPGG NS   Y GIWYKE +DRTIVWVANR  PL NS T 
Sbjct  90    PLTKDQTLVSSGQLFELGFFSPGGVNSDKWYAGIWYKEPQDRTIVWVANRANPLSNSPTS  149

Query  900   FLKIGEDGNIHLVDG-TGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYL  1076
              LK+ E+G + LVDG T NS+WSS    +Q+   +TVAQLLDSGNFVVR ENDE  E+Y 
Sbjct  150   VLKLTENGTLLLVDGQTRNSVWSS----DQTPATSTVAQLLDSGNFVVRPENDETEESYT  205

Query  1077  WQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNK  1256
             WQSFDYPTDTLLPGMKLGWDSK+G NR I+SW++ TDP+ GD TFK++ NGLPE FL NK
Sbjct  206   WQSFDYPTDTLLPGMKLGWDSKSGLNRNITSWKTATDPAPGDFTFKINTNGLPEIFLTNK  265

Query  1257  DIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQL  1436
               I+YRSG WNG+ FSGVPEM+P E+I F F    +E+YY FE+HNK L+SRL+VN+   
Sbjct  266   QEIVYRSGAWNGLRFSGVPEMKPTEIITFEFQFKSDEIYYMFELHNKRLYSRLLVNHNGR  325

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
             LERYTWIP N IW+RFW APKDQCD Y ECG  GICDT++SPVC C VGFKP+NQ AW L
Sbjct  326   LERYTWIPTNNIWSRFWYAPKDQCDGYTECGMSGICDTNLSPVCKCMVGFKPKNQVAWDL  385

Query  1617  RDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSN  1796
             RDGS GC R+ +LDC TD F  +   KLP+++ SFVD  M+LDEC+ MC +NCSCTAY+N
Sbjct  386   RDGSDGCVRFHKLDCETDSFNILRNMKLPDTTNSFVDKNMNLDECEAMCRKNCSCTAYTN  445

Query  1797  YNISNGGSGCVIWTAELFDIRQY-TAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKV  1973
              NIS  GSGCVIW+ EL D+RQY  AEGGQLLYVRVA+SDA Q+     GG G  KTK+V
Sbjct  446   SNISGSGSGCVIWSTELIDMRQYAAAEGGQLLYVRVASSDAAQS-----GGVGSSKTKRV  500

Query  1974  ILACgivlgigmv---lfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKRE  2144
             ++A GI +GI +V   +    L KRRK +  V    E +G  ERS++ LMNA  I SKRE
Sbjct  501   VIAAGITVGIAIVLFGVILYYLSKRRKYQGSVRTKSENKGISERSQELLMNAAIIPSKRE  560

Query  2145  HSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSK  2324
              SGET  T+E++LP+FDF+ +A+AT+NF++A KLGQGGFG VYKG+LV G+EIAVKRLSK
Sbjct  561   FSGETSATEEFDLPLFDFSTLAIATENFSDATKLGQGGFGCVYKGILVEGQEIAVKRLSK  620

Query  2325  NSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSS  2504
             NS QG EEFKNELRLIARLQHRNLV+LLGCCVD++EKMLIYEY+ENKSLDSILF+K++ S
Sbjct  621   NSGQGVEEFKNELRLIARLQHRNLVRLLGCCVDMEEKMLIYEYLENKSLDSILFNKQKCS  680

Query  2505  LLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGG  2684
             LLDW+RR+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLDK++ PKISDFGMAR+FGG
Sbjct  681   LLDWRRRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKDLTPKISDFGMARIFGG  740

Query  2685  DETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEE  2864
             DETE G TKR+VGTYGYMSPEYAMDGLFSVKSD FSFGVLVLE+V+G+KN+GFY  +N+ 
Sbjct  741   DETE-GNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTGKKNRGFYYQNNQL  799

Query  2865  NLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVM  3044
             NLLG AWRLW EGRGSELLD  +  E+ S    +VMRCIQVGLLCVQE+AEDRPNMA  +
Sbjct  800   NLLGHAWRLWKEGRGSELLDPAVG-ETFSPC--EVMRCIQVGLLCVQEQAEDRPNMATAV  856

Query  3045  LMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             LML  +  SLPQPK PGFCL  +PV  DS ST+Y +  ++NQ+TVTM+D R
Sbjct  857   LMLGSESASLPQPKTPGFCLGRRPVDSDSHSTNYEETCTVNQVTVTMIDGR  907



>ref|XP_009612738.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nicotiana tomentosiformis]
Length=858

 Score =  1105 bits (2859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/831 (67%), Positives = 667/831 (80%), Gaps = 23/831 (3%)
 Frame = +3

Query  726   PLTLNQTLVSAGEVFQLGFFSPGG-NSGGLYVGIWYKEIRDRTIVWVANRDKPLRNS-TG  899
             PLT +QTLVS+G++F+LGFF+PGG NS   YVGIWYKE +DRT VWVANR  PL NS T 
Sbjct  43    PLTKDQTLVSSGQLFELGFFNPGGVNSDKWYVGIWYKEPQDRTFVWVANRANPLSNSPTS  102

Query  900   FLKIGEDGNIHLVDG-TGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYL  1076
              LK+ E+G + L+DG T NS+WSS    +Q+   N VAQLLDSGNFVVR ENDE  +NY 
Sbjct  103   VLKLTENGTLLLIDGQTRNSVWSS----DQTPANNAVAQLLDSGNFVVRPENDETEQNYT  158

Query  1077  WQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNK  1256
             WQSFDYPTDTLLPGMKLGWDSK+G NR I+SW++ TDP+ GD TFK++ NGLPE FL NK
Sbjct  159   WQSFDYPTDTLLPGMKLGWDSKSGLNRNITSWKTATDPAPGDFTFKINTNGLPEVFLTNK  218

Query  1257  DIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQL  1436
               I+YRSG WNG+ FSGVPEM+P E+I+F F  T +E+YY FE+HNK L+SRL+VN+  +
Sbjct  219   QEIVYRSGAWNGLRFSGVPEMKPTEIISFEFQFTSDEIYYMFELHNKTLYSRLVVNH-NV  277

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
             LERY WIP N IWNRFW APKDQCD Y ECG  GICDT++SPVC C VGFKP+NQ AW L
Sbjct  278   LERYMWIPTNSIWNRFWYAPKDQCDGYTECGMSGICDTNLSPVCKCMVGFKPKNQVAWDL  337

Query  1617  RDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSN  1796
             RDGS GC R+ +LDC TD F  +   KLP++++SFVD  M+LDEC+ MC +NCSCTAY+N
Sbjct  338   RDGSDGCVRFHKLDCETDSFNILRNMKLPDTTSSFVDKNMNLDECEAMCRKNCSCTAYTN  397

Query  1797  YNISNGGSGCVIWTAELFDIRQY-TAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKV  1973
              NIS  GSGCVIW+ EL D+RQY  AEGGQ+LYVRVA+SDA ++     GG G  KTK+V
Sbjct  398   SNISGSGSGCVIWSTELIDMRQYAAAEGGQVLYVRVASSDAAES-----GGVGSSKTKRV  452

Query  1974  ILACgivlgigmv---lfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKRE  2144
             ++A GI +GI +V   +    L KRRK +  +    E +G  ERS++ L+NA  I SKRE
Sbjct  453   VIAAGITVGIAIVLFGVILYFLSKRRKYQGSIRTKSENKGISERSQELLVNAAIIPSKRE  512

Query  2145  HSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSK  2324
              SGET  T+E+ELP+FDF+ +AMAT+NF++A KLGQGGFG VYKG+LV G+EIAVKRLSK
Sbjct  513   FSGETA-TEEFELPLFDFSTLAMATENFSHATKLGQGGFGCVYKGILVEGQEIAVKRLSK  571

Query  2325  NSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSS  2504
             NS QG EEFKNELRLIARLQHRNLV+LLGCCVD++EKMLIYEY+ENKSLDSILF+K++  
Sbjct  572   NSGQGVEEFKNELRLIARLQHRNLVRLLGCCVDMEEKMLIYEYLENKSLDSILFNKQKCL  631

Query  2505  LLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGG  2684
             LLDW+ R+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLDK++ PKISDFGMAR+FGG
Sbjct  632   LLDWQMRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKDLTPKISDFGMARIFGG  691

Query  2685  DETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEE  2864
             DETE G TKR+VGTYGYMSPEYAMDGLFSVKSD FSFGVLVLE+V+G+KN+GFY  +N+ 
Sbjct  692   DETE-GNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTGKKNRGFYYQNNQL  750

Query  2865  NLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVM  3044
             NLLG AW+LW EGRGSELLD  +  E+ S    +VMRCIQVGLLCVQE+AEDRP MA V+
Sbjct  751   NLLGHAWKLWKEGRGSELLDPSVG-ETFSPC--EVMRCIQVGLLCVQEQAEDRPKMATVV  807

Query  3045  LMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             LML  +  SLPQPK PGFCL  +PV  DS ST+Y +  ++NQ+TVTM+D R
Sbjct  808   LMLGSESASLPQPKTPGFCLGRRPVDSDSHSTNYEETCTVNQVTVTMIDGR  858



>ref|XP_009773537.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nicotiana sylvestris]
Length=865

 Score =  1096 bits (2835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/831 (66%), Positives = 661/831 (80%), Gaps = 14/831 (2%)
 Frame = +3

Query  726   PLTLNQTLVSAGEVFQLGFFSPGG-NSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG-  899
             PLT+NQTLVS  + F+LGFF+PGG NS   Y+GIWY EI+D TIVWV NR+ P+ NS+  
Sbjct  41    PLTINQTLVSKEKKFKLGFFNPGGPNSDKWYIGIWYNEIQDSTIVWVGNRNNPVTNSSSH  100

Query  900   FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLW  1079
             FLKI ++GN+ LVDG GNSIWS++  +  +     +AQLLDSGN VVR ENDEN ENYLW
Sbjct  101   FLKISQNGNLVLVDGAGNSIWSANQESETAAKNTVIAQLLDSGNLVVRHENDENEENYLW  160

Query  1080  QSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKD  1259
             QSFDYPTDTLLPGMKLGWD K+G NR I+SW+SP DP+ G+ TFKLDINGLPEAFL NKD
Sbjct  161   QSFDYPTDTLLPGMKLGWDMKSGLNRNITSWKSPFDPASGNYTFKLDINGLPEAFLTNKD  220

Query  1260  IIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL  1439
              I YRSG WNGV FSGVPEM+P E++AF F   K++VYY+F++ +K + SRL+V +   L
Sbjct  221   DIFYRSGPWNGVGFSGVPEMKPTEIMAFEFQMKKDQVYYTFQVLDKKICSRLLVKHNGFL  280

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             ERYTWI  + IWNRFW APKDQCD Y ECG  GIC+ ++SPVC C VG+KP+NQ AW LR
Sbjct  281   ERYTWISTSNIWNRFWYAPKDQCDFYEECGVSGICNANLSPVCKCLVGYKPKNQVAWDLR  340

Query  1620  DGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
             DGS GC RY +L+C TD F ++   KLPE+S+SFVD TM+LDECK+ C  NCSCTAYS  
Sbjct  341   DGSDGCVRYHDLECETDVFNTLKNMKLPETSSSFVDTTMNLDECKKKCRYNCSCTAYSTA  400

Query  1800  NISNGGSGCVIWTAELFDIRQYT-AEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVI  1976
             NI+  GSGCVIWT EL D+RQY+ AEGGQ+LYVRVA+SDA Q+G V  G    GKTK++ 
Sbjct  401   NITGAGSGCVIWTTELVDMRQYSAAEGGQVLYVRVASSDAAQSGSVGSGDGS-GKTKRIA  459

Query  1977  LACgivlgigmvlfgllllkrrklrrgVT-----ENIEMRGTRERSRDPLMNATAISSKR  2141
             +A GI  G+ ++L G++ ++    RR +      +  E  G+ +RS+D L+N   I SKR
Sbjct  460   MATGITAGVVLLLVGVVTIRLLSKRRKLQGPILRKKTEQGGSNQRSQDLLVNTAIIPSKR  519

Query  2142  EHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLS  2321
             E S ET   DE ELP+FD +A+A+AT++F++ANKLGQGGFG VYKG++  G+EIAVKRLS
Sbjct  520   EISSETS-ADECELPLFDLSALAVATEDFSDANKLGQGGFGCVYKGIIDEGQEIAVKRLS  578

Query  2322  KNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRS  2501
             KNS QG EEFKNELRLIARLQHRNLV+LLGCCV+++EKMLIYEYMENKSLDSILF+K++S
Sbjct  579   KNSGQGVEEFKNELRLIARLQHRNLVRLLGCCVEMEEKMLIYEYMENKSLDSILFNKQKS  638

Query  2502  SLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFG  2681
              LLDW+RR+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLDKEMNPKISDFGMAR+FG
Sbjct  639   LLLDWQRRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFG  698

Query  2682  GDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNE  2861
             GDETE G TKR+VGTYGYMSPEYAMDGLFSVKSD FSFGVLVLE+V+G+KN+GFY  +N+
Sbjct  699   GDETE-GNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTGKKNRGFYYQNNQ  757

Query  2862  ENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAV  3041
              NLLG AWRLW EG  SELLD+ +  ES S    +VMRCIQVGLLCVQE+AEDRPNMA V
Sbjct  758   RNLLGHAWRLWREGTASELLDTAVG-ESFSPC--EVMRCIQVGLLCVQEQAEDRPNMATV  814

Query  3042  MLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             +LML  +  +LPQPK PGFCL  +PV   S +      ++NQ+TVTMLDAR
Sbjct  815   VLMLGSESATLPQPKHPGFCLGRRPVDEHSETIYEETCTVNQVTVTMLDAR  865


 Score = 53.9 bits (128),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCC+E  EKMLI      KSLD+ +F+  K   L+W +
Sbjct  599  QHRNLVRLLGCCVEMEEKMLIYEYMENKSLDSILFNKQKSLLLDWQR  645



>ref|XP_009616770.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nicotiana tomentosiformis]
Length=864

 Score =  1095 bits (2832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/831 (67%), Positives = 664/831 (80%), Gaps = 15/831 (2%)
 Frame = +3

Query  726   PLTLNQTLVSAGEVFQLGFFSPGG-NSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG-  899
             PLT+NQTLVS  + F+LGFF+PGG NSG  YVGIWY EI+D TIVWV NR+ P+ NS+  
Sbjct  41    PLTINQTLVSKEKKFKLGFFTPGGSNSGKSYVGIWYNEIQDSTIVWVGNRNNPVTNSSSH  100

Query  900   FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTV-AQLLDSGNFVVRRENDENPENYL  1076
              LKI ++GNI LVDG GNSIWS+ N  +QS   NTV AQLLDSGN VVR ENDEN ENYL
Sbjct  101   VLKISQNGNIVLVDGAGNSIWSA-NQESQSTAKNTVIAQLLDSGNLVVRYENDENEENYL  159

Query  1077  WQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNK  1256
             WQSFDYPTDTLLPGMKLGWD K+G NR I+SW+SP DP+ GD TFKLDINGLPEAFL NK
Sbjct  160   WQSFDYPTDTLLPGMKLGWDLKSGLNRNITSWKSPFDPAPGDYTFKLDINGLPEAFLTNK  219

Query  1257  DIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQL  1436
             D I YRSG WNGV FSGVPEM+P E++AF F  +K++VYY+F+I +K + SRL+V +  +
Sbjct  220   DDIFYRSGPWNGVGFSGVPEMKPTEIMAFEFQMSKDQVYYTFQILDKEICSRLLVKHNGV  279

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
             LERYTWI  + IWNRFW APKDQCD Y ECG  GIC+ ++SPVC C VG+KP+NQ AW L
Sbjct  280   LERYTWISTSNIWNRFWYAPKDQCDFYEECGVSGICNANLSPVCKCLVGYKPKNQVAWDL  339

Query  1617  RDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSN  1796
             RDGS GC RY +LDC TD F ++   KLPE+S+SFVD  M+LDEC++ C  NCSCTAY+ 
Sbjct  340   RDGSDGCVRYHDLDCETDVFNTLKNMKLPETSSSFVDTKMNLDECEKKCRYNCSCTAYTR  399

Query  1797  YNISNGGSGCVIWTAELFDIRQYT-AEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKV  1973
              NI+  GSGCVIWT EL D+RQY+ AEGGQ+LYVRVA+SDA Q+G V  G    GKTK++
Sbjct  400   SNITGAGSGCVIWTTELVDMRQYSAAEGGQVLYVRVASSDAAQSGSVGSGDGS-GKTKRI  458

Query  1974  ILACgivlgigmvlfgllllkrrklrrgVTENI----EMRGTRERSRDPLMNATAISSKR  2141
              +A GI  G+ ++L G++ ++    RR +   I      RG+ +RS+D L+N   I +KR
Sbjct  459   AMATGITAGVVLLLVGVVSIRFLSKRRKLQGPILRKKTERGSNQRSQDLLVNTAIIPNKR  518

Query  2142  EHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLS  2321
             E S ET   DE ELP+FD + +A+AT++F++ANKLGQGGFG VYKG++  G+EIAVKRLS
Sbjct  519   EISSETS-ADECELPLFDLSTLAVATEDFSDANKLGQGGFGCVYKGIIDEGQEIAVKRLS  577

Query  2322  KNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRS  2501
             KNS QG EEFKNELRLIARLQHRNLV+LLGCCV+++EKMLIYEYMENKSLDSILF+K++S
Sbjct  578   KNSGQGVEEFKNELRLIARLQHRNLVRLLGCCVEMEEKMLIYEYMENKSLDSILFNKQKS  637

Query  2502  SLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFG  2681
              LLDW+RR+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLDKEMNPKISDFGMAR+FG
Sbjct  638   LLLDWQRRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFG  697

Query  2682  GDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNE  2861
             GDETE G TKR+VGTYGYMSPEYAMDGLFSVKSD FSFGVLVLE+V+G+KN+GFY  +N+
Sbjct  698   GDETE-GNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTGKKNRGFYYQNNQ  756

Query  2862  ENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAV  3041
              NLLG AWRLW EG  SELLDS +  ES S    +VMRCIQVGLLCVQE+AEDRPNMA V
Sbjct  757   RNLLGHAWRLWREGTASELLDSAVG-ESFSPC--EVMRCIQVGLLCVQEQAEDRPNMATV  813

Query  3042  MLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             +LML  +  +LPQPK PGFCL  +PV   S +      ++NQ+TVTMLDAR
Sbjct  814   VLMLGSESATLPQPKHPGFCLGRRPVDEHSETIYEETCTVNQVTVTMLDAR  864


 Score = 53.9 bits (128),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCC+E  EKMLI      KSLD+ +F+  K   L+W +
Sbjct  598  QHRNLVRLLGCCVEMEEKMLIYEYMENKSLDSILFNKQKSLLLDWQR  644



>ref|XP_010316637.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Solanum lycopersicum]
Length=857

 Score =  1091 bits (2822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/830 (66%), Positives = 664/830 (80%), Gaps = 19/830 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGG-NSGGLYVGIWYKEIRDRTIVWVANRDKPLR-NSTGF  902
             LT +QTLVS+ ++F+LGFFSPGG NS   Y+GIWYKEI+DRTIVWVANR KPL  +ST  
Sbjct  39    LTKDQTLVSSDQLFELGFFSPGGANSDKWYIGIWYKEIQDRTIVWVANRAKPLSASSTSV  98

Query  903   LKIGEDGNIHLVDG-TGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLW  1079
             LKI E G + LVDG TGNS+WSS    +Q+   N VAQLLDSGNFV+R END+  ++YLW
Sbjct  99    LKITEIGTLLLVDGQTGNSVWSS----DQTPATNVVAQLLDSGNFVIRPENDDREQSYLW  154

Query  1080  QSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKD  1259
             QSFDYPT+TLLPGMKLGWDSK+G NR I+SW+S  DP+ GD TFK++ +G PE +L NK 
Sbjct  155   QSFDYPTNTLLPGMKLGWDSKSGMNRNITSWKSAIDPAPGDYTFKINTSGFPEIYLTNKQ  214

Query  1260  IIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL  1439
              IIYRSG WNG+ FSGVPEM+  ++I+F F    +E+ Y+F++HNK L+SRL V+++  L
Sbjct  215   EIIYRSGAWNGIRFSGVPEMKASDIISFEFQFKSDEITYTFKLHNKTLYSRLFVSHSGFL  274

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             ER+ WIP + +WNRFW APKDQCD Y ECG  GICDT++SP+C C VGFKPRNQ AW LR
Sbjct  275   ERFAWIPTSNLWNRFWYAPKDQCDGYTECGISGICDTNISPICKCMVGFKPRNQVAWDLR  334

Query  1620  DGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
             DGS GC R+  LDC TD F  +   KLP+++ SFVD TM+LDEC+ MC++NCSCTAY+N 
Sbjct  335   DGSDGCVRFHNLDCKTDKFNILKNMKLPDTTNSFVDTTMNLDECEAMCMKNCSCTAYTNS  394

Query  1800  NISNGGSGCVIWTAELFDIRQY-TAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVI  1976
             NIS  GSGCVIW++EL D+RQY  AEGGQ+LYVRVA+SDA Q G     GN   KTK V 
Sbjct  395   NISGSGSGCVIWSSELVDMRQYAVAEGGQVLYVRVASSDAVQIGGEG-SGNSSRKTKIVA  453

Query  1977  LACgivlgigmvl---fgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREH  2147
             +A G+ +GI +VL      +L KRRK +  +      RGT ERS++ LMNAT I SKRE 
Sbjct  454   IAAGVTVGIALVLFGLTLCILSKRRKHQSSIRTKSVNRGTSERSQELLMNATIIPSKREF  513

Query  2148  SGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKN  2327
             SGET  T+E+ELP+FD++ +A AT+NF++A KLGQGGFG VYK MLVG +E+AVKRLSKN
Sbjct  514   SGETS-TEEFELPLFDYSTLATATENFSDATKLGQGGFGCVYKAMLVG-QEVAVKRLSKN  571

Query  2328  SRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSL  2507
             S QG EEFKNELRLIARLQHRNLV+LLGCCVD++EKMLIYEY+ENKSLDSILF+K++SSL
Sbjct  572   SGQGVEEFKNELRLIARLQHRNLVRLLGCCVDMEEKMLIYEYLENKSLDSILFNKQKSSL  631

Query  2508  LDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGD  2687
             LDW++R+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLDK++ PKISDFGMAR+FGGD
Sbjct  632   LDWQKRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKDLTPKISDFGMARIFGGD  691

Query  2688  ETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEEN  2867
             ETE G TKR+VGTYGYMSPEYAMDGLFSVKSD FSFGVLVLE+V+G+KN+GFY  +N+ N
Sbjct  692   ETE-GNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTGKKNRGFYYQNNQLN  750

Query  2868  LLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVML  3047
             LLG AWRLW EG GSELLD     ES S    +VMRCIQVGLLCVQE+AEDRPNMA V+L
Sbjct  751   LLGHAWRLWKEGSGSELLDPSFG-ESFSP--SEVMRCIQVGLLCVQEQAEDRPNMATVVL  807

Query  3048  MLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             ML  +  SLPQPK PGFCL  +PV  DS ST+Y +  ++NQ+TVTM+D R
Sbjct  808   MLGSESASLPQPKNPGFCLGRRPVDSDSYSTNYEETCTVNQVTVTMIDPR  857


 Score = 55.5 bits (132),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCC++  EKMLI      KSLD+ +F+  K + L+W K
Sbjct  590  QHRNLVRLLGCCVDMEEKMLIYEYLENKSLDSILFNKQKSSLLDWQK  636



>ref|XP_011096222.1| PREDICTED: uncharacterized protein LOC105175473 [Sesamum indicum]
Length=1723

 Score =  1067 bits (2760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/826 (63%), Positives = 654/826 (79%), Gaps = 14/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             L  +QTLVSAG+ F+LGFFS    S   Y+GIWYK I  RTIVWVANRD PLRNS+G LK
Sbjct  908   LDKDQTLVSAGQEFELGFFSYA-RSNNWYIGIWYKNIEQRTIVWVANRDSPLRNSSGILK  966

Query  909   IG-EDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
             I  +DGN+ LVD  G S+WSS   N+  +  N+VA+LLD+GNFVVR EN+++PENYLWQS
Sbjct  967   ISPDDGNLLLVDEAGKSVWSS---NHSGMAKNSVAELLDNGNFVVRPENEQDPENYLWQS  1023

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FDYPT+TLLPGMK+GWDSKTG NRYI+SW+S  DPS GD +F++D+NG PE +L NK+ I
Sbjct  1024  FDYPTNTLLPGMKMGWDSKTGLNRYITSWKSADDPSSGDYSFQIDVNGFPEIYLMNKERI  1083

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
              YRSG WNG+ FSGVPEM+   + +F F+   +EV YSF++ NK+++SRL+V ++  L+R
Sbjct  1084  YYRSGPWNGLRFSGVPEMKSSTLFSFLFVMEPDEVSYSFDVSNKSVYSRLMVKHSGELQR  1143

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             + WIP  +IW+ FW APKDQCD YRECG +GICD + SPVC C  GF+P+N QAW+LRDG
Sbjct  1144  FIWIPATKIWSLFWYAPKDQCDRYRECGVYGICDANASPVCKCIQGFEPKNPQAWNLRDG  1203

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
             S GCFR  +LDC +DGFL++N+ KLPES T+FVD  M+LD+C+E+C +NCSC  YSN NI
Sbjct  1204  SDGCFRVSKLDCRSDGFLTLNHVKLPESGTAFVDKQMNLDQCQELCRKNCSCRGYSNINI  1263

Query  1806  SNGGSGCVIWTAELFDIRQY-TAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             + GG+GC IW  +L+D+RQY  AEGGQ  YVRV A+D E++G V    +   KT K+++A
Sbjct  1264  TGGGTGCAIWIDDLYDMRQYAVAEGGQDFYVRVPAADLERSGAVGTRDDS-NKTGKIVMA  1322

Query  1983  CgivlgigmvlfgllllkrrklrrgVTEN-IEMRGTRERSRDPLMNATAISSKREHSGET  2159
              GI +G+ +V   +  + +R   R   +N IE RG RERS+D L+N   I +KR+HSGET
Sbjct  1323  VGIAVGVLLVGLAVFFVWKRGKSRSAKKNIIEHRGPRERSQDFLLNVATIPNKRDHSGET  1382

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
                DE +LP+FD +++ +ATDNF+NANKLGQGGFG VYKGMLV G+ IAVKRLSKNS QG
Sbjct  1383  A-ADELDLPLFDLSSLLIATDNFSNANKLGQGGFGCVYKGMLVEGQVIAVKRLSKNSGQG  1441

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EFKNE++LIARLQHRNLV+LLGCC++++EKML+YEYMENKSLDSILF K +SS+LDW+
Sbjct  1442  IDEFKNEVKLIARLQHRNLVRLLGCCIEMEEKMLVYEYMENKSLDSILFKKDKSSMLDWE  1501

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
             RR+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLDKEMNPKISDFGMAR+FGGD+TEA
Sbjct  1502  RRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDQTEA  1561

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               TKR+VGTYGYMSPEYAMDGLFS+KSD FSFGVLVLE+VSG KN+GFY  +N  NLL  
Sbjct  1562  -NTKRVVGTYGYMSPEYAMDGLFSIKSDVFSFGVLVLEIVSGTKNRGFYQTNNHLNLLAY  1620

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             AW+L+ EGRG EL+D+  A ES+S    +VMRCIQVGLLCVQE AEDRPNM+ V+LML  
Sbjct  1621  AWKLYREGRGLELMDTA-AGESYS--ASEVMRCIQVGLLCVQEHAEDRPNMSTVVLMLSS  1677

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
                S+PQPK PG+CL  +P   DS S+  ++  ++NQ+TVTMLD R
Sbjct  1678  DFVSMPQPKHPGYCLGRRPADTDSFSSKPDESCTVNQVTVTMLDGR  1723


 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/835 (43%), Positives = 503/835 (60%), Gaps = 50/835 (6%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             +T++S G  F LGFF P G SG  YVGIWY+E+ + ++VWVANR++P+  + G L IG D
Sbjct  43    ETMISEGGRFALGFFGPQG-SGSRYVGIWYQEVGNESVVWVANRERPISGNGGVLTIGND  101

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             GN+ ++DG G+ +WS   TN      N+ A L+D+GN V+     EN    LWQSFD+PT
Sbjct  102   GNLMVMDGNGDVVWS---TNLSVRSSNSTAVLMDTGNLVLF--GSENLSRGLWQSFDHPT  156

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DT LP MK+  D +    R  +SWRS  DPS G+ +  +D    P+  + +     +RSG
Sbjct  157   DTYLPNMKVYMDVRGEERRVFTSWRSAFDPSPGNYSMGIDPRWSPQIVIWDGANRRWRSG  216

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLI---VNYTQLLERYT  1451
              W+G+ F+GVP M+   +  F  +   + V  ++ I++++  S LI   +N+  +    +
Sbjct  217   HWDGLTFTGVPGMKTSILSGFRLLTEADVVGKAYFIYSQSNGSDLIKFRINWEGIQRLES  276

Query  1452  WIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
             W+ E + W+     P D+CD Y  CG FG C+    P C C  GF P++   WS  + SG
Sbjct  277   WVDERKEWSLTQLHPGDECDRYNHCGPFGKCNEVEVPKCSCMEGFVPKDTYQWSRENWSG  336

Query  1632  GCFRYDELDC----------PTDGFLSMNYTKLPESSTSFVD--ATMSLDECKEMCVRNC  1775
             GC R   L C            D F++    KLP+    +VD      + +C+ MC++NC
Sbjct  337   GCVRQTNLQCMENNSLSVNKVNDDFVTATNVKLPD----YVDYVGREDIQQCQNMCLQNC  392

Query  1776  SCTAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASD--AEQTGEVARGGN  1949
             SCTAY+         GC+IW  +L D++Q+ AEG  L ++R A S+  A     V +   
Sbjct  393   SCTAYAFLE----RIGCMIWYRDLVDVQQFQAEGSTL-FIRRAHSELVAGDKSHVTKIVI  447

Query  1950  GFGKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAI  2129
                    ++L C  +  +         +  R     V  + E              +T  
Sbjct  448   ITIVIAGLLLVCVSIWLLVKRKTKCSEILHRNEMPKVGPSGEF-------------STDF  494

Query  2130  SSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAV  2309
             S   +   E       EL +F+FN +A AT+NF++ NKLGQGGFG VYKG L GG++IAV
Sbjct  495   SGPCDLGVEGQKPTGNELAMFNFNHVAAATNNFSSENKLGQGGFGHVYKGTLPGGQQIAV  554

Query  2310  KRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFD  2489
             KRLS+ S QG EEFKNE+ LIA+LQHRNLV+LLGCC++ +EKML+YEYM NKSLDS LFD
Sbjct  555   KRLSRKSGQGLEEFKNEIMLIAKLQHRNLVRLLGCCIEGEEKMLLYEYMPNKSLDSYLFD  614

Query  2490  KKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMA  2669
               + + L W +R++II G+ARGL+YLH+DSR RIIHRDLKASN+LLD+EMNPKISDFGMA
Sbjct  615   TDKKAQLAWSKRFSIIEGIARGLVYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMA  674

Query  2670  RLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYT  2849
             R+FGG++ EA  T R+VGTYGYM+PEYAM+GLFS+KSD +SFGVL+LE++SGR+N  F +
Sbjct  675   RIFGGNQNEA-NTNRVVGTYGYMAPEYAMEGLFSLKSDVYSFGVLLLEIISGRRNTSFRS  733

Query  2850  PSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPN  3029
              +   N++G AW LW  GR  EL+D  I++    E   QV+RC+ VGLLCVQ+ A+ RPN
Sbjct  734   -TKYSNIIGYAWDLWDRGRAMELVDPSISNSCSEE---QVVRCVNVGLLCVQDMADHRPN  789

Query  3030  MAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             M  V+LML  +  +L  PKQP F      +  D  +   +  S N +T+T +  R
Sbjct  790   MPTVVLMLESEKATLSLPKQPTFTSMRHNLNADMWNEIQDAVSSNSVTITAILGR  844


 Score = 65.9 bits (159),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCCIEG EKML+      KSLD+++FD  K+A+L W K
Sbjct  579  QHRNLVRLLGCCIEGEEKMLLYEYMPNKSLDSYLFDTDKKAQLAWSK  625


 Score = 54.7 bits (130),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 6/45 (13%)
 Frame = +2

Query  2     QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
             QHRNLVRLLGCCIE  EKML+      KSLD+ +F   K + L+W
Sbjct  1456  QHRNLVRLLGCCIEMEEKMLVYEYMENKSLDSILFKKDKSSMLDW  1500



>ref|XP_010317517.1| PREDICTED: uncharacterized protein LOC101252749 [Solanum lycopersicum]
Length=2711

 Score =  1063 bits (2748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/832 (64%), Positives = 655/832 (79%), Gaps = 21/832 (3%)
 Frame = +3

Query  726   PLTLNQTLVSAGEVFQLGFFSPGG-NSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG-  899
             PLT+++TLVS  + F+LGFF+PGG NS   YVGIWYKEI++ TIVWVANR+ P+ NS+  
Sbjct  1892  PLTISKTLVSQKKKFELGFFTPGGPNSDKWYVGIWYKEIKETTIVWVANRENPVINSSTS  1951

Query  900   -FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYL  1076
               LKI EDG + + DG GN  WS + + N +     +A+LLDSGNFVV  EN+E     +
Sbjct  1952  PVLKITEDGRLVIDDGDGNYTWSLNLSKNNT---TFIAKLLDSGNFVVLTENEEI---MV  2005

Query  1077  WQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNK  1256
             WQSFDYPTDTLLPGMKLGWDSKTG NR I+SW+SP DPS G+ TFKLD++GLPEA+L N+
Sbjct  2006  WQSFDYPTDTLLPGMKLGWDSKTGLNRNITSWKSPFDPSSGNYTFKLDVHGLPEAYLTNR  2065

Query  1257  DIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQL  1436
             D + YRSG WNGV FSGVPEM+P ++I F F   K+EVYY+FE+ +K + SRL+V +   
Sbjct  2066  DKVFYRSGPWNGVGFSGVPEMKPTDIIVFEFQMNKDEVYYTFEVLDKEICSRLLVRHNGF  2125

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
             LERYTWIP + IWN+FW APKDQCD Y ECG  GIC+ ++SPVC C VG+KP+NQ AW L
Sbjct  2126  LERYTWIPTSNIWNKFWYAPKDQCDFYEECGVSGICNANLSPVCKCLVGYKPKNQVAWDL  2185

Query  1617  RDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSN  1796
             RDGS GC RY +LDC TD F  +   KLP+SS+SFVD  M+L+EC++MC  NCSCTAY+ 
Sbjct  2186  RDGSDGCVRYHDLDCETDVFNILKNMKLPQSSSSFVDTKMNLEECEKMCRYNCSCTAYTT  2245

Query  1797  YNISNGGSGCVIWTAELFDIRQYT-AEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKV  1973
              N++  GSGCVIWT EL D+RQY+ AEGGQ LYVR A+SDA ++G V    +G GKTK++
Sbjct  2246  ANVTGSGSGCVIWTKELVDMRQYSAAEGGQFLYVRAASSDAAKSGNVG-SEDGSGKTKRI  2304

Query  1974  ILACgivlgigmvlfgllllkrrklrrgVTEN-----IEMRGTRERSRDPLMNATAISSK  2138
              +A GI  G+ +VL G++ +     R+ + E+      E RG+ ERS+D L+N   I SK
Sbjct  2305  AMATGITAGVVLVLIGIVSICFLSKRKKLLESPIRKKTEQRGSIERSQDLLVNTAIIPSK  2364

Query  2139  REHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRL  2318
             R+ SGET + DE+ELP+FD + +A+AT++F++ANKLGQGGFG VYKG++  G+EIAVKRL
Sbjct  2365  RDISGET-VADEFELPLFDLSTLAVATEDFSDANKLGQGGFGCVYKGIIDEGQEIAVKRL  2423

Query  2319  SKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKR  2498
             SKNS QG EEFKNELRLIARLQHRNLV+LLGCCV+++EKMLIYEYMENKSLDSILF+K++
Sbjct  2424  SKNSGQGIEEFKNELRLIARLQHRNLVRLLGCCVEMEEKMLIYEYMENKSLDSILFNKQK  2483

Query  2499  SSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLF  2678
             SSLLDW+RR++IICG+ARGLLYLHQDSRFRIIHRDLKASN+LLDKEM PKISDFGMAR+F
Sbjct  2484  SSLLDWQRRFSIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKEMIPKISDFGMARIF  2543

Query  2679  GGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSN  2858
             GGDETE G TKR+VGTYGYMSPEYAMDGLFSVKSD FSFGVLVLE+V+G+KN+GFY  +N
Sbjct  2544  GGDETE-GNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTGKKNRGFYFQNN  2602

Query  2859  EENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAA  3038
             E NLLG AW+LW EG  SELLDS +  ES S    +V+RCIQVGLLCVQE+AEDRPNMA 
Sbjct  2603  ERNLLGHAWKLWREGGASELLDSSVG-ESFSPC--EVIRCIQVGLLCVQEQAEDRPNMAT  2659

Query  3039  VMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             V+LML  +  ++PQPK PGFCL  +PV   S +      ++NQ+T+TMLD R
Sbjct  2660  VVLMLGSETATMPQPKHPGFCLGRRPVDEHSETIYEETFTVNQVTITMLDPR  2711


 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/840 (43%), Positives = 502/840 (60%), Gaps = 55/840 (7%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPL--RNSTGF  902
             L+LNQTLVSAG++F+LGFFSP  NS  LY+GIW+K I  + IVWVANR+ PL   +S  F
Sbjct  42    LSLNQTLVSAGKIFELGFFSPS-NSRSLYLGIWFKNIPRQRIVWVANRENPLPASDSAAF  100

Query  903   LKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGN-TVAQLLDSGNFVVRRENDENPENYLW  1079
             LKIG DGN+ ++DG  N IWS+    N SV  N T   L D G F+++   D      LW
Sbjct  101   LKIGGDGNLRIMDGNQNIIWST----NISVQSNKTTVVLTDEGEFILK---DSVSGTSLW  153

Query  1080  QSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFL-RNK  1256
              SF+YP DTLL GM +G+++++G    +SSW++  DPS G  T  L +   P+ F   N 
Sbjct  154   DSFNYPCDTLLLGMNIGYNTRSGVKLVLSSWQAENDPSPGKFTIGLSVEMPPQIFTWNNY  213

Query  1257  DIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNE--VYYSFEIHNKNLFSRLIVNYT  1430
                 +R   W+G  F GVP+ E         +  K +   ++SF   N +    L++  +
Sbjct  214   SRPYWRGVPWDGGNFLGVPDDEKGYASDIKVIVNKQQESAFFSFNNFNVSDVIILVLKPS  273

Query  1431  QLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAW  1610
              LL    W+ +   W+ FW AP + CD Y  CG + +CD   SPVC C  GF P++   W
Sbjct  274   GLLNMMEWLEDLNAWHVFWEAPANPCDVYGTCGPYSVCDMGKSPVCDCLRGFAPKSTDEW  333

Query  1611  SLRDGSGGCFRYDELDCP------------TDGFLSMNYTKLPESSTSFVDATMSLDECK  1754
                + +GGC R  +L C             +D FL +   KLP+  T F D    +  CK
Sbjct  334   IRGNWTGGCVRRTKLLCEISASGNTIKGSESDNFLQLREMKLPDHYTYFYDYEAQI--CK  391

Query  1755  EMCVRNCSCTAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEV  1934
             E C+ NCSC AY+  +    G  C++WT+EL D++Q+   G  L ++RVA+S+     EV
Sbjct  392   EWCLNNCSCAAYAYPD----GVKCMVWTSELIDVQQFPYNGVDL-FLRVASSEL-ALDEV  445

Query  1935  ARGGNGFGKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLM  2114
                     K K +I+   +   + + +FG +  + +          + R  R    + L 
Sbjct  446   TT------KAKLIIIFTTVSSVLILAIFGCIFYRWKA---------KQRANRRNRVNDLT  490

Query  2115  NATAISSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGG  2294
              A +  +    S + ++ ++  L + DF  + +ATDNF+  NK+G GGFG VYKG L  G
Sbjct  491   PAVSSQNSENASTDNLLEEQPLLTLLDFAKLGIATDNFSETNKIGAGGFGPVYKGKLEDG  550

Query  2295  EEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLD  2474
             + +AVKRLS +S QG EEFKNE+ LI++LQHRNLV++L  CV   EK+L+YEYM N+SLD
Sbjct  551   QLVAVKRLSSHSGQGIEEFKNEILLISKLQHRNLVRVLAYCVHGQEKLLVYEYMANRSLD  610

Query  2475  SILFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKIS  2654
             ++LFD K+S  L W +R+N+I G+ARGLLYLH+DS  R+IHRDLKASNVLLD EMNPKIS
Sbjct  611   TLLFDSKKSYQLPWTKRFNMIQGIARGLLYLHRDSCLRVIHRDLKASNVLLDDEMNPKIS  670

Query  2655  DFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKN  2834
             DFG+AR F   + E   T RI GT+GYMSPEYAM GLFS KSD +SFGVL+LE+VSG+KN
Sbjct  671   DFGLARTFQVTQ-ELANTNRIAGTFGYMSPEYAMGGLFSEKSDVYSFGVLLLEIVSGKKN  729

Query  2835  QGFYTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKA  3014
              GFY   N  NLL  AW+L  E +  +L+D  I   S S     V+RCI +GLLCVQ+ A
Sbjct  730   SGFYDHENHLNLLSYAWKLQTESKELDLMDKSILDSSSSA---TVLRCIHIGLLCVQDHA  786

Query  3015  EDRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
              DRP+M +V+LML    T LP PK+P F +  + +  D+ S     QS+N +TV++ + R
Sbjct  787   VDRPSMPSVVLML-NSETDLPLPKEPTF-IFQRWLNSDTQSQISKAQSVNDITVSVAEGR  844


 Score = 55.1 bits (131),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2     QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
             QHRNLVRLLGCC+E  EKMLI      KSLD+ +F+  K + L+W +
Sbjct  2445  QHRNLVRLLGCCVEMEEKMLIYEYMENKSLDSILFNKQKSSLLDWQR  2491



>ref|XP_006343406.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Solanum tuberosum]
Length=1642

 Score =  1056 bits (2730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/832 (64%), Positives = 651/832 (78%), Gaps = 21/832 (3%)
 Frame = +3

Query  726   PLTLNQTLVSAGEVFQLGFFSPGG-NSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG-  899
             PLT+++TLVS  + F+LGFF+PGG NS   YVGIWYKEI++ TIVWVANR+ P+ NS+  
Sbjct  42    PLTISKTLVSQQKKFELGFFTPGGPNSDKWYVGIWYKEIKETTIVWVANRENPVTNSSSP  101

Query  900   -FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYL  1076
               LKI +DG + + +  GN   S ++ NN +     +A+LLDSGNFVV  E DE     +
Sbjct  102   PVLKITQDGRLVIDNRDGNYTLSLNSANNNTT---FIAKLLDSGNFVVLTEKDEI---MV  155

Query  1077  WQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNK  1256
             WQSFDYPTDTLLPGMKLGWDSKTG NR I+SW+SP DPS G+ TFKLD+NGLPEA+L N+
Sbjct  156   WQSFDYPTDTLLPGMKLGWDSKTGFNRNITSWKSPFDPSPGNYTFKLDVNGLPEAYLTNR  215

Query  1257  DIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQL  1436
             D I YRSG WNGV FSGVPEM+P ++I F F   K+EVYY+FE+ +K + SRL+V +   
Sbjct  216   DTIFYRSGPWNGVGFSGVPEMKPTDIIVFEFQMNKDEVYYTFEVLDKKICSRLLVKHNGF  275

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
             LERYTWIP + IWN+FW APKDQCD Y ECG  GIC+ ++SPVC C VG+KP+NQ AW L
Sbjct  276   LERYTWIPTSNIWNKFWYAPKDQCDLYEECGVSGICNANLSPVCKCLVGYKPKNQVAWDL  335

Query  1617  RDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSN  1796
             RDGS GC RY +LDC TD F  +   KLP+SS+SFVD  M+L+EC++MC  NCSCTAY+ 
Sbjct  336   RDGSDGCIRYHDLDCETDVFNILKNMKLPQSSSSFVDTKMNLEECEKMCRYNCSCTAYTT  395

Query  1797  YNISNGGSGCVIWTAELFDIRQYT-AEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKV  1973
              N++  GSGCVIWT EL D+RQY+ AEGGQ LYVR A+SDA ++G V    +G GKTK++
Sbjct  396   ANVTGSGSGCVIWTKELVDMRQYSAAEGGQFLYVRAASSDAAKSGNVG-SEDGSGKTKRI  454

Query  1974  ILACgivlgigmvlfgllllkrrklrrgVTE-----NIEMRGTRERSRDPLMNATAISSK  2138
              +A GI  G+ +VL G++ +     R+ + E       E RG+ ERS+D L+N   I SK
Sbjct  455   AMATGITAGVVLVLIGVVSICILSKRKKLLEGPIRNKAEQRGSIERSQDLLVNTGIIPSK  514

Query  2139  REHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRL  2318
             RE S ET + DE+ELP+FD + +AMAT++F++ANKLGQGGFG VYKG++  G+EIAVKRL
Sbjct  515   REISSET-VADEFELPLFDLSTLAMATEDFSDANKLGQGGFGCVYKGIIDEGQEIAVKRL  573

Query  2319  SKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKR  2498
             SKNS QG EEFKNELRLIARLQHRNLV+LLGCCV+++EKMLIYEYMENKSLDSILF+K++
Sbjct  574   SKNSGQGVEEFKNELRLIARLQHRNLVRLLGCCVEMEEKMLIYEYMENKSLDSILFNKQK  633

Query  2499  SSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLF  2678
             SSLLDW+RR+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLDKEM PKISDFGMAR+F
Sbjct  634   SSLLDWQRRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKEMIPKISDFGMARIF  693

Query  2679  GGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSN  2858
             GGDETE G TKR+VGTYGYMSPEYAMDGLFSVKSD FSFGVLVLE+V+G+KN+GFY  +N
Sbjct  694   GGDETE-GNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTGKKNRGFYFQNN  752

Query  2859  EENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAA  3038
             E NLLG AW+LW EG  SELLDS +  ES S    +V+RCIQVGLLCVQE+AEDRPNMA 
Sbjct  753   ERNLLGHAWKLWREGGASELLDSSVG-ESFSPC--EVIRCIQVGLLCVQEQAEDRPNMAT  809

Query  3039  VMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             V+LML  +  ++PQPK PGFCL  +PV   S +      ++NQ+T+TMLD R
Sbjct  810   VVLMLGSETATMPQPKHPGFCLGRRPVDEHSETIYEETFTVNQVTITMLDPR  861


 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/817 (45%), Positives = 508/817 (62%), Gaps = 52/817 (6%)
 Frame = +3

Query  789   PGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGEDGNIHLVDGTGNSIWSS  968
             PG  S   YVGIWY  I + T+VWVANR+ P+  + G L I         D TG+ +  +
Sbjct  863   PGNYSNNRYVGIWYYNIPELTVVWVANRENPVNGTYGVLSI---------DPTGSLVILN  913

Query  969   SNTNNQSVPGN-TVAQLLDSGNFVVRRENDENPENYLWQSFDYPTDTLLPGMKLGWDSKT  1145
              NT   +   N + AQLLDSGNFV  R  D   E  +WQSFD+PT+T+LP MK G D KT
Sbjct  914   RNTKIFAWKTNISSAQLLDSGNFVFFR--DMKKEVIVWQSFDHPTNTILPDMKFGIDKKT  971

Query  1146  GRNRYISSWRSPTDPSEGDITFKLDINGL-PEAFLRNKDIIIYRSGGWNGVAFSGVPEME  1322
             G NR ++SW+S  DP  G+  +K++ING+ P+ FL      I+R+G W G+ +SGVP M 
Sbjct  972   GLNRSLTSWKSMNDPGSGEYVYKIEINGIVPQVFLYKNSNRIWRTGPWTGLGWSGVPGMR  1031

Query  1323  PKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIPENRIWNRFWNAPKD  1502
             P  +    ++  ++EV   F + +  + SRL++N + ++    W    + W +FW+AP+D
Sbjct  1032  PGFIFNSKYVDNESEVSVLFTMKDP-VISRLVLNESGVMSILNWQEGAKKWVQFWSAPED  1090

Query  1503  QCDNYRECGSFGICDT-DMSPV-CGCPVGFKPRNQQAWSLRDGSGGCFRY-DELDCPT-D  1670
              CD+Y  CG F  C+  ++    C C +G++P   ++W LRDGS GC R  DE  C   +
Sbjct  1091  SCDDYVHCGKFSNCNLYNLGEFECKCLIGYEPWENRSWYLRDGSQGCLRKEDENVCRNGE  1150

Query  1671  GFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGSGCVIWTAELF  1850
             GF  ++  K+P++  + ++ ++ L EC+++C+ NCSC+AY++ N+S GG GC+ W  EL 
Sbjct  1151  GFAKLSNVKVPDTYNARLNRSIGLQECEKLCLNNCSCSAYASANVSIGGIGCITWYGELI  1210

Query  1851  DIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFG--KTKKVILACgivlgigmvlfgl  2024
             D R++T +GGQ LY+RV+AS   Q    ++  NG+   +T  ++  C   + I +     
Sbjct  1211  DTREFT-DGGQDLYIRVSASTLAQ---FSKNNNGYHMKRTIAIVTICIGAILIALSFACC  1266

Query  2025  lllkrrklrrgVTENIEMRGTRERSRDPLMNATAI-----SSKREHSGETMITDEY-ELP  2186
                            + +R  R    D   +   +     S +    G  M   E+ ++ 
Sbjct  1267  ---------------LVIRKRRRDKEDQFTSLNTLTRNLASYENSSRGNEMDGSEHVDVL  1311

Query  2187  IFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNELR  2366
             IFD + I  +TD+F++ANKLG+GGFGSVYKG L  G+EIAVKRLSKNS QG EEFKNE+ 
Sbjct  1312  IFDLSTIISSTDDFSDANKLGEGGFGSVYKGQLNNGQEIAVKRLSKNSGQGVEEFKNEVT  1371

Query  2367  LIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIICGV  2546
             LIAR+QHRNLV+LLGCC+   EKMLIYEY+ NK LDS +FDK + S LDW++R+ II G+
Sbjct  1372  LIARVQHRNLVRLLGCCIQRGEKMLIYEYLPNKGLDSFIFDKTKGSQLDWRKRFEIIVGI  1431

Query  2547  ARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIVGT  2726
             ARGL YLH DSR RIIHRDLKASNVLLD  M+PKISDFG AR+FGGD+ EA  T R+VGT
Sbjct  1432  ARGLSYLHHDSRVRIIHRDLKASNVLLDASMHPKISDFGTARIFGGDQIEA-NTNRVVGT  1490

Query  2727  YGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGEGR  2906
             YGYMSPEYAM+G FSVKSD FSFGVL+LE+++GRKN   Y   +  NL+G  W  W + +
Sbjct  1491  YGYMSPEYAMEGHFSVKSDVFSFGVLLLEIITGRKNTTHYQ-DHSLNLVGNVWDSWNDDK  1549

Query  2907  GSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQPK  3086
               +++D  +     S    +V+RCIQ+GLLCVQ  A +RP M+ V+ ML  + T L  P 
Sbjct  1550  AIDVVDPSLGDWYESS---EVLRCIQIGLLCVQSYANERPMMSQVVFMLCNE-TKLSNPG  1605

Query  3087  QPGFCLASKPVKMDSSSTSYN-DQSLNQLTVTMLDAR  3194
             QPGF   S+       S+S +   S+N +++T   AR
Sbjct  1606  QPGFVFRSRNSSSLPYSSSASIGNSVNDISITAQHAR  1642


 Score = 64.7 bits (156),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 6/47 (13%)
 Frame = +2

Query  2     QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
             QHRNLVRLLGCCI+ GEKMLI      K LD+F+FD TK ++L+W K
Sbjct  1377  QHRNLVRLLGCCIQRGEKMLIYEYLPNKGLDSFIFDKTKGSQLDWRK  1423


 Score = 55.8 bits (133),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCC+E  EKMLI      KSLD+ +F+  K + L+W +
Sbjct  595  QHRNLVRLLGCCVEMEEKMLIYEYMENKSLDSILFNKQKSSLLDWQR  641



>ref|XP_007025869.1| Receptor kinase 3 [Theobroma cacao]
 gb|EOY28491.1| Receptor kinase 3 [Theobroma cacao]
Length=840

 Score =  1014 bits (2622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/822 (62%), Positives = 610/822 (74%), Gaps = 25/822 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             NQTLVS G+VF+ GFF+   N G  YVGIWYK I  RT VW+ANRDKPL NS+G  K+ E
Sbjct  41    NQTLVSPGDVFEFGFFTLE-NPGEWYVGIWYKNIPVRTYVWIANRDKPLANSSGIFKL-E  98

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRREN-DENPENYLWQSFDY  1094
             D NI L+D   N +WSS+ T       N +AQLLDSGN V+R  N ++   +YLWQSFDY
Sbjct  99    DRNIVLLDQGQNLVWSSNITKGD----NPLAQLLDSGNLVLREANINDETNHYLWQSFDY  154

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PTDTLLP MKLGWD   G NR++++WR+  DPS GD +FKLD +G PE FL NK    YR
Sbjct  155   PTDTLLPDMKLGWDLNAGFNRFLTAWRTKGDPSSGDFSFKLDYHGFPEIFLWNKQRREYR  214

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             SG WNG+ FSGVPEM+P + I+F+F+  ++EVYYSF I NKNLFSRLIV  T  L+R TW
Sbjct  215   SGPWNGLRFSGVPEMKPLDYISFNFVTNQDEVYYSFSITNKNLFSRLIVTPTGTLQRLTW  274

Query  1455  IPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGG  1634
             IP+   WN FW APKDQCDNYRECG +GICD++ SPVC CP GF P+NQQAW+LRDGSGG
Sbjct  275   IPDTEQWNPFWYAPKDQCDNYRECGQYGICDSNASPVCKCPKGFSPKNQQAWNLRDGSGG  334

Query  1635  CFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNG  1814
             C R  +LDC  D FL +   KLPE ++SFVD  M+L +C  +C RNCSCTAYSN +I NG
Sbjct  335   CIRKTDLDCTKDKFLHLPNMKLPEGTSSFVDKNMTLKDCAALCSRNCSCTAYSNSDIRNG  394

Query  1815  GSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgiv  1994
             G GCVIW  +L D+RQYT  GGQ L+VR+AASD    G       G   +  V+L   I 
Sbjct  395   GKGCVIWIGDLIDMRQYTDGGGQDLFVRLAASDLGDGGNTTALIIGITVSAGVLLLGLIA  454

Query  1995  lgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDE  2174
               +                      I  +G  ERS+D L+N   ISSK+E S E+   DE
Sbjct  455   YVVWKRKAMQNKG-----------KIGKKGPHERSQDFLLNEVVISSKKEFSAESQ-PDE  502

Query  2175  YELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFK  2354
              ELP+FDF+ IA ATDNF++  KLGQGGFG VY G LV G+EIAVKRLSKNS QG EEFK
Sbjct  503   LELPLFDFDTIATATDNFSDEKKLGQGGFGCVYMGRLVEGQEIAVKRLSKNSGQGTEEFK  562

Query  2355  NELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNI  2534
             NE+RLIARLQHRNLV+LLGCC+++DEKML+YEYME++SLDS+LF+K RSSLL+W+RR+NI
Sbjct  563   NEVRLIARLQHRNLVRLLGCCIEMDEKMLVYEYMEHRSLDSVLFNKARSSLLNWQRRFNI  622

Query  2535  ICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKR  2714
             ICG ARGLLYLHQDSRFRIIHRDLKASN+LLD EMNPKISDFGMAR+FGGD+TEA  TKR
Sbjct  623   ICGTARGLLYLHQDSRFRIIHRDLKASNILLDGEMNPKISDFGMARIFGGDQTEA-NTKR  681

Query  2715  IVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLW  2894
             +VGTYGYMSPEYAMDGLFS KSD FSFGVLVLEVVSG+KN+GFY  ++E NLLG AWRLW
Sbjct  682   VVGTYGYMSPEYAMDGLFSAKSDVFSFGVLVLEVVSGKKNRGFYHSNSELNLLGHAWRLW  741

Query  2895  GEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSL  3074
              EG+G +L+DS +    +++   +V+RCIQVGLLCVQE+AEDRP+M+ V+LML  +  ++
Sbjct  742   KEGKGMDLIDSAVGDSYNAQ---EVLRCIQVGLLCVQERAEDRPSMSTVVLMLNSETATM  798

Query  3075  PQPKQPGFCLASKPVKMDSSSTSYNDQS--LNQLTVTMLDAR  3194
             PQPK PGFCL  +      SS S  D+S  +NQ+TVTMLDAR
Sbjct  799   PQPKTPGFCLGRRSTLETDSSNSKQDESCTVNQVTVTMLDAR  840


 Score = 55.1 bits (131),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCCIE  EKML+      +SLD+ +F+  + + LNW +
Sbjct  572  QHRNLVRLLGCCIEMDEKMLVYEYMEHRSLDSVLFNKARSSLLNWQR  618



>ref|XP_010106713.1| Receptor-like serine/threonine-protein kinase SD1-8 [Morus notabilis]
 gb|EXC11581.1| Receptor-like serine/threonine-protein kinase SD1-8 [Morus notabilis]
Length=833

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/824 (60%), Positives = 616/824 (75%), Gaps = 29/824 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             LT N+TLVSA EVF+ G F PG  S G Y+GIWYK+I   T VWVANRD PL NS+  LK
Sbjct  37    LTNNRTLVSASEVFEFGLFRPG--SKGWYLGIWYKKIPTETYVWVANRDTPLLNSSATLK  94

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
               + G++ L+D +GN  WS++ T       N V QLLDSGN VVR END++PENYLWQSF
Sbjct  95    FDDHGSLVLLDPSGNITWSANQTRTAQ---NLVLQLLDSGNLVVREENDDDPENYLWQSF  151

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
              YPTDTLLPGMKLGWD   G   Y+SSW++ +DPS GD +FKLD  G PE FLRN  +I 
Sbjct  152   HYPTDTLLPGMKLGWD--FGFETYLSSWKTTSDPSTGDYSFKLDPRGFPEIFLRNNQVIT  209

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG  FSGVPEM P + I FSF+  ++EVYY+F I N  L SRL+V  + +L+R+
Sbjct  210   YRSGPWNGNRFSGVPEMAPVKGIQFSFVDREDEVYYTFSISNNYLLSRLVVGPSGVLDRF  269

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TW+  ++ WN FW APKDQCD+Y+ECG +G+CD++ SPVC C   F PRN QAW LRDGS
Sbjct  270   TWVESSQTWNTFWYAPKDQCDDYKECGPYGVCDSNASPVCKCLKAFAPRNPQAWELRDGS  329

Query  1629  GGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
              GC R  EL C +D   +    KLPESS++FVD  MSL+EC+++C+ NCSCTAY+N +I 
Sbjct  330   DGCVRRTELGCNSDKIWTAKNVKLPESSSAFVDRNMSLEECRKLCLENCSCTAYANADIE  389

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             NGG+GCV W+ EL DIR Y AEGGQ+LYVR+AA+D E         N +   K +I+   
Sbjct  390   NGGTGCVTWSGELIDIRDY-AEGGQVLYVRLAAADLE---------NDWTPKKIIIIVAV  439

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
              V    ++    ++ +R+       EN E RG RE+S+D L+N    S +  +SGE    
Sbjct  440   AVGICVLLSVLFVVWRRK-----AKENTETRGPREKSQDLLLNEMVNSKREGYSGER-DK  493

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             DE +LP+FD+  +AMAT+NF++ NKLGQGGFGSVYKGMLV G+EIAVKRL+KNS QG EE
Sbjct  494   DELDLPLFDYRTMAMATNNFSDENKLGQGGFGSVYKGMLVEGQEIAVKRLAKNSAQGIEE  553

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             FKNE+RLIA+LQH NLV+LLG C+++D+KMLIYEYMEN+SLDSILF+K +SSLLDW++R+
Sbjct  554   FKNEVRLIAKLQHINLVRLLGFCIEMDDKMLIYEYMENRSLDSILFNKAKSSLLDWQKRF  613

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLD+EM PKISDFGMAR+F  D+T+A T 
Sbjct  614   NIICGIARGLLYLHQDSRFRIIHRDLKASNILLDREMTPKISDFGMARMFSRDQTQANTI  673

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
              R+VGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLE+VSG+KN+GFY  ++E NLLG AW 
Sbjct  674   -RVVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEIVSGKKNRGFYHANSELNLLGHAWN  732

Query  2889  LWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGT  3068
             LW EG+  EL+DS I  ES+S    +V+RCIQVGLLCVQE+AEDRPNM +V+L L  +  
Sbjct  733   LWKEGKALELVDSSIG-ESYS--ASEVLRCIQVGLLCVQERAEDRPNMCSVVLTLGSETA  789

Query  3069  SLPQPKQPGFCLASKPVKMDSSSTSYNDQS--LNQLTVTMLDAR  3194
             ++PQPK PGF L   PV  +S S+   DQS  +NQ+TVT++D R
Sbjct  790   TMPQPKNPGFSLCRTPVDTNSWSSKQEDQSCTVNQVTVTVIDGR  833



>ref|XP_010646880.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Vitis vinifera]
Length=847

 Score =   986 bits (2550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/833 (61%), Positives = 622/833 (75%), Gaps = 27/833 (3%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKP-LRNST  896
             N  +T  QTLVSAG  F+LGFFSPG +    YVGIWYK I    +VWVANRD P L NS+
Sbjct  34    NQSITNGQTLVSAGGDFELGFFSPGDSK--WYVGIWYKNIPKERVVWVANRDNPILTNSS  91

Query  897   G-FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENY  1073
             G  +KIG+ GNI ++D   +  WS+    N+S   N VAQLLD+GN VVR + D +PENY
Sbjct  92    GSVVKIGDRGNIVIMDEDLHVFWST----NESTAVNPVAQLLDTGNLVVREDKDADPENY  147

Query  1074  LWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRN  1253
             LWQSFDY TDTLLPGMKLGWD KTG NRY++SW+S  DPS GD +FKLD  G PE F+ N
Sbjct  148   LWQSFDYLTDTLLPGMKLGWDQKTGSNRYLTSWKSKEDPSSGDYSFKLDPRGFPEIFIWN  207

Query  1254  KDIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQ  1433
             K    YRSG WNGV FSGVPEM+   V  F F   ++  YYS+E+ NK++ SRL+V+   
Sbjct  208   KQEKKYRSGPWNGVRFSGVPEMKSSSVFTFDFEWNQDGAYYSYELTNKSITSRLMVSSAG  267

Query  1434  LLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWS  1613
              L+RYTWI   ++WN +W APKDQCD+YRECG +GICDT+ SPVC CP GF+P+N QAW+
Sbjct  268   SLQRYTWIETRQVWNLYWFAPKDQCDDYRECGPYGICDTNSSPVCKCPRGFEPKNPQAWN  327

Query  1614  LRDGSGGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAY  1790
             LRDGS GC R  E DC   DGFL++   KLPE+ +SFVD +MSL +C+  C +NCSCT Y
Sbjct  328   LRDGSDGCSRKTEFDCNNGDGFLALKRMKLPETGSSFVDKSMSLKDCEMTCRKNCSCTGY  387

Query  1791  SNYNISNGGSGCVIWTAELFDIRQYT-AEGGQLLYVRVAASDAEQTGEVARGGNGFGKTK  1967
             +N  I++   GC+IWT +L D+R+Y   EGGQ LY+RVAAS+           NG  KT 
Sbjct  388   ANPEITS-DKGCIIWTTDLLDMREYAEGEGGQDLYIRVAASELGSE-------NGSNKTV  439

Query  1968  KVI-LACgivlgigmvlfgllllkrrklrrgVTEN--IEMRGTRERSRDPLMNATAISSK  2138
             K+I + C  V    ++L   +    ++ +  +  N     RG  ERS D ++N   I SK
Sbjct  440   KIIKVTCITVGSAVLLLGLGICYLWKRKKMKIMWNGKTRQRGLSERSHDYILNEAVIPSK  499

Query  2139  REHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRL  2318
             R+++ E   TDE ELP+FDF  I +AT+NF++ NKLGQGGFG VYKGML+ GEEIAVKRL
Sbjct  500   RDYTDEVK-TDELELPLFDFGTIVLATNNFSDTNKLGQGGFGCVYKGMLLEGEEIAVKRL  558

Query  2319  SKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKR  2498
             +KNS QG EEF NE+RLIARLQHRNLV+LLGCCV+++EKMLIYEYM+N+SLDSILFD+K+
Sbjct  559   AKNSGQGIEEFMNEVRLIARLQHRNLVQLLGCCVEMEEKMLIYEYMQNRSLDSILFDEKK  618

Query  2499  SSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLF  2678
             SSLLDW RR+NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLD EMNPKISDFGMAR+F
Sbjct  619   SSLLDWGRRFNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDGEMNPKISDFGMARIF  678

Query  2679  GGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSN  2858
             G D+TEA  TKR+VGTYGYMSPEYAMDGLFSVKSD FSFGVLVLE++SG+KN+GFY  ++
Sbjct  679   GRDQTEA-NTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIISGKKNRGFYHLND  737

Query  2859  EENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAA  3038
             E NLLG AWRLW EG+G EL+DS + SES + +   V+RCIQVGLLCVQE AEDRP M++
Sbjct  738   EHNLLGHAWRLWREGKGLELMDSSV-SESCAPY--DVLRCIQVGLLCVQEHAEDRPVMSS  794

Query  3039  VMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             V+LML  +  +LP PK PGFCL  K V+ DSSS+   +  ++NQ+TVT++DAR
Sbjct  795   VVLMLSSETATLPLPKNPGFCLGRKLVETDSSSSKQEETFTVNQVTVTVMDAR  847


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCC+E  EKMLI      +SLD+ +FD  K + L+WG+
Sbjct  580  QHRNLVQLLGCCVEMEEKMLIYEYMQNRSLDSILFDEKKSSLLDWGR  626



>ref|XP_002304966.1| Brassica self-incompatibility locus family protein [Populus trichocarpa]
 gb|EEE85477.1| Brassica self-incompatibility locus family protein [Populus trichocarpa]
Length=834

 Score =   986 bits (2550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/820 (61%), Positives = 621/820 (76%), Gaps = 28/820 (3%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             QTL+S  + F+LGFF+PG NS   YVGIWYK I  RT VWVANRDKPL NS+G  KI  +
Sbjct  41    QTLISTSQGFELGFFTPG-NSRNWYVGIWYKNI-PRTYVWVANRDKPLSNSSGTFKIF-N  97

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
              +I L D  G  +WSS+ TN +    N V QLLDSGN V++ +  E+ + +LWQSFDYPT
Sbjct  98    QSIALFDLAGKVVWSSNQTNAR----NPVMQLLDSGNLVLKEQVSESGQ-FLWQSFDYPT  152

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DTLLP MKLGWD  TG +RY+SSW+S  DP  GD +FKL+ +G PE FL   + I YRSG
Sbjct  153   DTLLPDMKLGWDLNTGLDRYLSSWKSSEDPGTGDFSFKLEYHGFPEVFLWKDNEIEYRSG  212

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG  FSGVPEM+P + ++F+F+  ++EVYYSF I  KNL+SRL V  + LL+R+ WIP
Sbjct  213   PWNGQRFSGVPEMKPVDYLSFNFITEQDEVYYSFHIATKNLYSRLTVTSSGLLQRFAWIP  272

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
             E + WN+FW APKDQCDNY+ECG++GICD++ SPVC C  GF+P+N QAW LRDGSGGC 
Sbjct  273   ETQQWNKFWYAPKDQCDNYKECGAYGICDSNASPVCKCLKGFQPKNHQAWDLRDGSGGCV  332

Query  1641  RYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGS  1820
             R   L+C  D FL M   KLP+S+TSFVD +MSL  C+ +C RNCSCTAY+N NISNGGS
Sbjct  333   RKTNLECLKDKFLHMKNMKLPQSTTSFVDRSMSLKNCELLCSRNCSCTAYANSNISNGGS  392

Query  1821  GCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlg  2000
             GCVIWT ELFD+RQY  EGGQ LYVR+AASD          G+G G    +I+   + +G
Sbjct  393   GCVIWTGELFDLRQY-PEGGQDLYVRLAASDI---------GDG-GSADTIIICIAVGIG  441

Query  2001  igmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEYE  2180
             I ++      + +RK    V    + +G +ERS+D L+N   I +K+++SGE   TDE E
Sbjct  442   ILILSLTGFSIWKRKRLLSVCNGTQQKGPQERSQDLLLNEVVI-NKKDYSGEKS-TDELE  499

Query  2181  LPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNE  2360
             LP+FDF+ IA AT NF + NKLG+GGFG V+KG LV G+E+AVKRLSK S QG EEFKNE
Sbjct  500   LPLFDFSTIAAATGNFCDENKLGEGGFGCVHKGRLVEGQEVAVKRLSKKSGQGTEEFKNE  559

Query  2361  LRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIIC  2540
             +RLIARLQHRNLV+LLGCC+++DEK+LIYE+MEN+SLDS+LF+K +SSLL+W+RR+NIIC
Sbjct  560   VRLIARLQHRNLVRLLGCCIEMDEKILIYEFMENRSLDSVLFNKAKSSLLNWQRRFNIIC  619

Query  2541  GVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIV  2720
             G ARGLLYLHQDSRFRIIHRDLKASN+LLD E  PKISDFGMAR+FGGD+T+A  T+RIV
Sbjct  620   GTARGLLYLHQDSRFRIIHRDLKASNILLDGEWTPKISDFGMARIFGGDQTQA-NTRRIV  678

Query  2721  GTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGE  2900
             GTYGYMSPEYAMDGLFSVKSD FSFGVLVLE+V G KN+GFY  ++E NLLG  WR W +
Sbjct  679   GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVCGEKNRGFYHSNSELNLLGNVWRQWKD  738

Query  2901  GRGSELLD-SVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLP  3077
             G G E+LD SV +S S SE    V+RCIQVGLLCVQE+AEDRP MA+ +LML  +  S+P
Sbjct  739   GNGLEVLDISVGSSYSPSE----VLRCIQVGLLCVQERAEDRPTMASAVLMLSSETASMP  794

Query  3078  QPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             QPK PG+CL   P + DSSS+  ++  ++NQ+TVT+LDAR
Sbjct  795   QPKTPGYCLGRSPFETDSSSSKQDESFTVNQVTVTVLDAR  834


 Score = 55.1 bits (131),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCCIE  EK+LI      +SLD+ +F+  K + LNW +
Sbjct  567  QHRNLVRLLGCCIEMDEKILIYEFMENRSLDSVLFNKAKSSLLNWQR  613



>gb|KDP20852.1| hypothetical protein JCGZ_21323 [Jatropha curcas]
Length=837

 Score =   985 bits (2547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/823 (61%), Positives = 604/823 (73%), Gaps = 26/823 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             LT +QTL+S  + F+LGFFSPG NS   YVGIWYK I DRT VWVANRD PL NS+G  K
Sbjct  40    LTSDQTLLSPNQNFKLGFFSPG-NSKNWYVGIWYKNIPDRTYVWVANRDNPLTNSSGIFK  98

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  + +I L+D   N IWSS+ T   S     V QLLD+GN V+R  N    + YLWQSF
Sbjct  99    I-SNQSIVLLDHAENLIWSSNETKANS----PVMQLLDTGNLVLREANVN--DEYLWQSF  151

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D PTDTLL  MKLGWD   G +RYISSW+S  DPS GD +FKLD +G PE FL N     
Sbjct  152   DCPTDTLLADMKLGWDLNKGLDRYISSWKSADDPSTGDFSFKLDYHGFPEVFLWNDQEKA  211

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEMEP + ++F+F+    EV YSF I  K++FSRL V  +  L+RY
Sbjct  212   YRSGPWNGLRFSGVPEMEPLDYLSFNFVTNPEEVSYSFHISAKSIFSRLTVTSSGQLQRY  271

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWIP+ ++WN FW APKDQCD Y ECG FGICD++ SPVC C  GF+P N QAWSLRDGS
Sbjct  272   TWIPDRQVWNSFWYAPKDQCDKYMECGPFGICDSNASPVCKCMRGFEPSNPQAWSLRDGS  331

Query  1629  GGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
              GC R   L C  D FL +   K+PESSTSFVD  +S   C+ +C+RNCSCTAY+N +I+
Sbjct  332   DGCVRKTNLQCVNDKFLHLKNIKIPESSTSFVDRNISTKGCELLCLRNCSCTAYANSDIT  391

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             NGG+GCVIW  EL DIRQYT  GGQ LYVR+AASD            G GK    I+   
Sbjct  392   NGGTGCVIWVGELLDIRQYTEGGGQDLYVRLAASDV-----------GNGKNTATIIIGI  440

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
              V    ++L        ++ R      ++ +G +ERS+D L+N   ISSKR+HSGE    
Sbjct  441   AVGVAILLLVLGGCFIWKRRRLQSARRVQ-KGIQERSQDLLLNEVVISSKRDHSGEKD-K  498

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             DE ELP+FDF  IA+ATDNF++ NKLGQGGFG VYKG LV G+E+AVKRLS+NS QG EE
Sbjct  499   DELELPLFDFGTIAIATDNFSDENKLGQGGFGLVYKGTLVEGQEVAVKRLSRNSGQGIEE  558

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             FKNE++LIARLQHRNLV+LLGCC+++DEKMLIYE MEN+SLDS+LF+K +  LL+W+RR+
Sbjct  559   FKNEVKLIARLQHRNLVRLLGCCIEMDEKMLIYECMENRSLDSVLFNKAKCPLLNWQRRF  618

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             NIICG+ARGLLYLHQDSRFRIIHRDLKASNVLLD E NPKISDFGMAR+FGGD+TEA  T
Sbjct  619   NIICGIARGLLYLHQDSRFRIIHRDLKASNVLLDAEWNPKISDFGMARIFGGDQTEA-NT  677

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             KR+VGTYGYMSPEYAMDGLFSVKSD FSFGVLVLE+V+G KN+GFY  ++E NLLG AWR
Sbjct  678   KRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTGNKNRGFYHSNSELNLLGHAWR  737

Query  2889  LWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGT  3068
             LW  G+  ELLD  + +   S    +V+RC+QVGLLCVQE+AEDRP M++V+LML  +  
Sbjct  738   LWKAGKALELLDPSVGNSFSSS---EVLRCVQVGLLCVQERAEDRPTMSSVVLMLSSETA  794

Query  3069  SLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             ++PQPK PG+CL   P + DSSS   ++  ++NQ+TVTMLDAR
Sbjct  795   TMPQPKTPGYCLGRNPFETDSSSGKQDESFTINQVTVTMLDAR  837


 Score = 55.5 bits (132),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCCIE  EKMLI      +SLD+ +F+  K   LNW +
Sbjct  570  QHRNLVRLLGCCIEMDEKMLIYECMENRSLDSVLFNKAKCPLLNWQR  616



>ref|XP_008364109.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Malus domestica]
Length=877

 Score =   984 bits (2545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/832 (61%), Positives = 627/832 (75%), Gaps = 36/832 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNST-GFLKIG  914
             +QTLVS+G VF+LG F PG  S G Y+GIWYK I+ +T+VWVANRD PL NS+   +K G
Sbjct  69    SQTLVSSGNVFELGLFQPG--SSGWYLGIWYKNIQPQTVVWVANRDSPLSNSSSATIKFG  126

Query  915   EDGNIHLVD-GTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRE--NDENPEN-YLWQ  1082
             + GN+ LVD G+GN  WSS+ T  Q+V  N + QLLDSGN V+R E  N  NP++ +LWQ
Sbjct  127   DRGNLVLVDEGSGNVTWSSNET--QAV--NPIVQLLDSGNLVLREEDSNRNNPKDEFLWQ  182

Query  1083  SFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDI  1262
             SFDYPT+TLLP MKLGW+  +  +RYI+SW+S  DPS GD +FKLD  G PE FLRNK +
Sbjct  183   SFDYPTNTLLPDMKLGWNLSSNLDRYITSWKSTEDPSVGDYSFKLDYRGFPEIFLRNKQV  242

Query  1263  IIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHN--KNLFSRLIVNYTQL  1436
             ++YRSG WNG  FSGVPEM     + FSF+    EVYY+F I N  K L+SRLIV+    
Sbjct  243   VVYRSGPWNGERFSGVPEMTVSNGLQFSFVSNSQEVYYTFSIKNDSKPLYSRLIVSQDGY  302

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
             L+RYTWI   +IWN+FW APKDQCD+YRECG +G+CD++ SPVC C  GF+P+N QAW+L
Sbjct  303   LQRYTWIESRKIWNQFWYAPKDQCDSYRECGPYGVCDSNASPVCKCLKGFQPKNLQAWNL  362

Query  1617  RDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSN  1796
             RDGS GC R  EL+C  D FL +   KLPES  +FVD  + L+ C++ C  NCSCTAY N
Sbjct  363   RDGSDGCVRKTELECSKDKFLGLGNMKLPESGGAFVDMGIDLEACRKKCSENCSCTAYGN  422

Query  1797  YNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVI  1976
               I NGG+GCVIW+ EL D+RQY AEGGQ LYVR AAS+ +          G GK K+V+
Sbjct  423   ARIENGGTGCVIWSGELMDLRQY-AEGGQHLYVRFAASELD----------GNGKMKRVL  471

Query  1977  LACgivlgigmvlfgllllkrrklrrgVTEN--IEMRGTRERSRDPLMNATAISSKREHS  2150
             +  GI +G G++L  L++    K + G+T    IE +G+ ERS+D L+N   ISSKREH 
Sbjct  472   IIVGITVGTGILLAALVICFVWKRKSGITRKGRIEQKGSFERSQDFLLNEVVISSKREHY  531

Query  2151  GETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNS  2330
                   DE ELP+ DFN +A+ATDNF++ N+LGQGGFG VYKG  V G+ +AVKRLSKNS
Sbjct  532   SGERSNDELELPLLDFNTVAVATDNFSDENQLGQGGFGCVYKGT-VEGQLVAVKRLSKNS  590

Query  2331  RQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLL  2510
              QG EEFKNE++LIARLQHRNLV+LLGCCVD+DEKMLIYEYMENKSLDS+LF   + S+L
Sbjct  591   GQGTEEFKNEVKLIARLQHRNLVRLLGCCVDMDEKMLIYEYMENKSLDSVLFSNAKRSML  650

Query  2511  DWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDE  2690
             DW +R++IICG+ARGLLYLHQDSRFRIIHRDLKASN+LLD E+ PKISDFGMAR+FG D+
Sbjct  651   DWPKRFDIICGIARGLLYLHQDSRFRIIHRDLKASNILLDGELTPKISDFGMARIFGNDQ  710

Query  2691  TEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENL  2870
             TEA  T+R+VGTYGYMSPEYAMDGLFSVKSD FSFGVLVLE++SG+KN+GFY  +NE NL
Sbjct  711   TEA-NTRRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIISGKKNRGFYYANNELNL  769

Query  2871  LGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLM  3050
             LG AW+LW EG+GSE++D  +  +S+S  V  V+RCIQVGLLCVQE+AEDRP MA+V+LM
Sbjct  770   LGHAWKLWTEGKGSEIIDPSVG-DSYSPSV--VLRCIQVGLLCVQERAEDRPTMASVVLM  826

Query  3051  LIGKGTSLPQPKQPGFCLA--SKPVKMDSSSTSYNDQS--LNQLTVTMLDAR  3194
             L  +  ++PQPK PGFCL     PV+ DSSS    DQS  +NQ+TVTM+D R
Sbjct  827   LSSETATMPQPKNPGFCLERNKNPVETDSSSGK-QDQSCTVNQVTVTMVDGR  877


 Score = 57.4 bits (137),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCC++  EKMLI      KSLD+ +F   KR+ L+W K
Sbjct  608  QHRNLVRLLGCCVDMDEKMLIYEYMENKSLDSVLFSNAKRSMLDWPK  654



>ref|XP_010538687.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Tarenaya hassleriana]
Length=848

 Score =   979 bits (2532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/837 (59%), Positives = 609/837 (73%), Gaps = 42/837 (5%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG  899
             N  ++ N+TLVS G VF+LGFF P  +    Y+GIWYK I  RT VWVANRD PL NS+G
Sbjct  42    NLTVSENRTLVSPGGVFELGFFKPSDSRNSWYLGIWYKTIPKRTYVWVANRDNPLSNSSG  101

Query  900   FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLW  1079
              LKI  D N+ L D   N +WS++ T     P   VA+LLD+GNFV R   + NP+ +LW
Sbjct  102   TLKIS-DRNLALFDQADNPVWSTNLTGEVKSP---VAELLDNGNFVFRDSENNNPDEFLW  157

Query  1080  QSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKD  1259
             QSFD+PTDTLLP MKLGWD +TG +RYI+SWRSP DPS GD  FKL+  G PE FL N+D
Sbjct  158   QSFDHPTDTLLPEMKLGWDLRTGFDRYITSWRSPDDPSTGDFLFKLESRGFPEIFLWNRD  217

Query  1260  IIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL  1439
               +YRSG WNGV FSGVPEM+P + + F+F  +K+EV YSF + N +++SRL V+ + LL
Sbjct  218   SRVYRSGPWNGVRFSGVPEMQPLKYMTFNFTASKDEVTYSFHVTNSSIYSRLSVSSSGLL  277

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             +R+TWIP  + WNRFW APKDQCDN++ECGS+G CDT+ SPVC C  GF+PRN QAW+LR
Sbjct  278   QRFTWIPTEQEWNRFWYAPKDQCDNFKECGSYGYCDTNTSPVCNCIRGFEPRNPQAWALR  337

Query  1620  DGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
             DGSGGC R   L C  D FL +   KLPE++ + VD T+   EC+E C RNC CTA++N 
Sbjct  338   DGSGGCVRKTRLSCGGDKFLRLRKMKLPETTAAMVDRTVGTKECEERCRRNCECTAFANT  397

Query  1800  NISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASD--------AEQTGEVARGGNGF  1955
             +I NGGSGCVIW  +L DIR Y ++GGQ L+VR++ASD        A  TG V   G  F
Sbjct  398   DIRNGGSGCVIWVGDLLDIRAY-SDGGQDLFVRLSASDLGDESSRNALVTGLVVSFGVLF  456

Query  1956  GKTKKVILACgivlgigmvlfgllllkrrklrrgVTENI-EMRGTRERSRDPLMNATAIS  2132
               +   I  C                         T +I E     ERSRD LM    IS
Sbjct  457   LGS---IFFCLWKRKQKK-----------------TRSIAEPNANPERSRDLLMKEAVIS  496

Query  2133  SKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVK  2312
             S+R  S E    +E ELP+F+   IAMAT+NF+++NKLGQGGFGSVYKG L+ G+EIAVK
Sbjct  497   SRRHVSSEGK-REEIELPLFELEVIAMATENFSDSNKLGQGGFGSVYKGRLLDGQEIAVK  555

Query  2313  RLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDK  2492
             RLSK S QG +EFKNE+RLIARLQHRNLV+LLGCCV+++EKML+YEYMEN+SLDS LFDK
Sbjct  556   RLSKTSVQGVDEFKNEVRLIARLQHRNLVRLLGCCVEMNEKMLVYEYMENRSLDSSLFDK  615

Query  2493  KRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMAR  2672
              RSS LDWK R++I+CG+ARGLLYLHQDSRFRIIHRDLKASNVLLD+EMNPKISDFGMAR
Sbjct  616   TRSSKLDWKTRFSIVCGIARGLLYLHQDSRFRIIHRDLKASNVLLDREMNPKISDFGMAR  675

Query  2673  LFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTP  2852
             +FGGDETEA  T+++VGTYGYM+PEYAMDG FSVKSD FSFGVLVLE+VSG++N+GFY  
Sbjct  676   IFGGDETEA-NTRKVVGTYGYMAPEYAMDGTFSVKSDVFSFGVLVLEIVSGKRNRGFYNS  734

Query  2853  SNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNM  3032
             + E NLLG AWR W EG+G E++D VI     +    +V+RCIQ+GLLCVQE+AEDRP M
Sbjct  735   NTELNLLGSAWRYWKEGKGIEIVDPVIGDSYPNH---EVLRCIQIGLLCVQERAEDRPTM  791

Query  3033  AAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             ++V+LML  +  ++PQP+QPG+C+   P++ DSSS+   D    ++NQ+TVT++DAR
Sbjct  792   SSVVLMLGSETATMPQPRQPGYCVGRSPLETDSSSSRQPDDESWTVNQVTVTVIDAR  848


 Score = 58.2 bits (139),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRLLGCC+E  EKML+      +SLD+ +FD T+ ++L+W
Sbjct  579  QHRNLVRLLGCCVEMNEKMLVYEYMENRSLDSSLFDKTRSSKLDW  623



>gb|KHN45740.1| Receptor-like serine/threonine-protein kinase SD1-8 [Glycine 
soja]
Length=853

 Score =   979 bits (2530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/827 (60%), Positives = 616/827 (74%), Gaps = 15/827 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEI--RDRTIVWVANRDKPLRNSTGF  902
             L  NQTL+S   +F+LGFFS   ++   Y+GIWYK I  RDRT+VWVANRD PL+ S GF
Sbjct  37    LRTNQTLLSPNAIFELGFFSYTNST--WYLGIWYKTIHDRDRTVVWVANRDIPLQTSLGF  94

Query  903   LKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQ  1082
             LKI + GN+ +++ +   IWSS+ T   + P N + QL DSGN V++  N+ +P+  LWQ
Sbjct  95    LKINDQGNLVIINQSQKPIWSSNQTT--TTPSNLILQLFDSGNLVLKEPNENDPKKILWQ  152

Query  1083  SFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPT-DPSEGDITFKLDINGLPEAFLRNKD  1259
             SFDYPTDTLLPGMKLGW+  TG  ++I+SWR+   DPS GD +FKLD  GLPE FL NK+
Sbjct  153   SFDYPTDTLLPGMKLGWNFDTGIEKHITSWRATNEDPSSGDFSFKLDPRGLPEIFLWNKN  212

Query  1260  IIIYRSGGWNGVAFSGVPEMEPK-EVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQL  1436
               IYRSG WNG  FSGVPEM+P  + I F+F   ++E YY+F I N +LFSRL VN    
Sbjct  213   QRIYRSGPWNGERFSGVPEMQPNTDSIKFTFFVDQHEAYYTFSIVNVSLFSRLSVNSIGE  272

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
             L+R TWI   ++WN+FW APKDQCDNY+ECG++G+CDT+ SPVC C  GF+PRN QAW+L
Sbjct  273   LQRLTWIQSTQVWNKFWYAPKDQCDNYKECGAYGVCDTNASPVCQCIKGFRPRNPQAWNL  332

Query  1617  RDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSN  1796
             RDGS GC R  EL C +DGFL M   KLPE++  FV+ +M + EC E+C +NCSC+ Y+N
Sbjct  333   RDGSDGCVRNTELKCGSDGFLRMQNVKLPETTLVFVNRSMGIVECGELCKKNCSCSGYAN  392

Query  1797  YNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVI  1976
               I NGGSGCV+W  EL D+R+Y + GGQ LYVR+AASD +  G            K V 
Sbjct  393   VEIVNGGSGCVMWVGELLDVRKYPS-GGQDLYVRLAASDVDDIGIEGGSHKTSDTIKAVG  451

Query  1977  LACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGE  2156
             +  G+   I + L   +L K+RKL+  +    + RG  ERS+D LMN    SS RE +GE
Sbjct  452   IIVGVAAFILLALAIFILWKKRKLQCILKWKTDKRGFSERSQDLLMNEGVFSSNREQTGE  511

Query  2157  TMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQ  2336
             + + D+ ELP+FDFN I MAT+NF++ NKLGQGGFG VYKG L+ G+ IAVKRLSKNS Q
Sbjct  512   SNM-DDLELPLFDFNTITMATNNFSDENKLGQGGFGIVYKGRLMEGQNIAVKRLSKNSGQ  570

Query  2337  GAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
             G +EFKNE++LI +LQHRNLV+LLGC + +DEKML+YEYMEN+SLD+ILFDK + S LDW
Sbjct  571   GIDEFKNEVKLIVKLQHRNLVRLLGCSIQMDEKMLVYEYMENRSLDAILFDKTKRSSLDW  630

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
             +RR+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLDKEMNPKISDFGMAR+FG D+TE
Sbjct  631   QRRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGTDQTE  690

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             A T  R+VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE++SG+KN+GFY+ + E NLLG
Sbjct  691   ANTM-RVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIISGKKNRGFYSANKELNLLG  749

Query  2877  LAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              AW+LW E    EL+D  I   S+SE   +V+RCIQVGLLCVQE+AEDRP MA+V+LML 
Sbjct  750   HAWKLWKEENALELIDPSI-DNSYSE--SEVLRCIQVGLLCVQERAEDRPTMASVVLMLS  806

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
                 S+ QPK PGFCL   P++ DSSS+   +  ++NQ+TVTMLDAR
Sbjct  807   SDTASMSQPKNPGFCLGRNPMETDSSSSKQEESCTVNQVTVTMLDAR  853


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGC I+  EKML+      +SLD  +FD TKR+ L+W +
Sbjct  586  QHRNLVRLLGCSIQMDEKMLVYEYMENRSLDAILFDKTKRSSLDWQR  632



>ref|XP_009345819.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Pyrus x bretschneideri]
Length=850

 Score =   978 bits (2529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/831 (61%), Positives = 624/831 (75%), Gaps = 36/831 (4%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNST-GFLKIGE  917
             QTLVS+G VF+LG F PG  S G Y+GIWYK I+ +T+VWVANRD PL NS+   +K+G+
Sbjct  43    QTLVSSGNVFELGLFQPG--SSGWYLGIWYKNIQPQTVVWVANRDSPLSNSSSATIKVGD  100

Query  918   DGNIHLVD-GTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRE--NDENPEN-YLWQS  1085
              GN+ LVD G+GN  WSS+ T  Q+V  N + QLLDSGN V+R E  N  NP++ +LWQS
Sbjct  101   RGNLVLVDEGSGNVTWSSNET--QAV--NPIVQLLDSGNLVLREEDSNRNNPKDEFLWQS  156

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FD+PT+TLLP MKLGW+  +  +RYI+SW+S  DPS GD +FKLD +G PE FLRNK +I
Sbjct  157   FDHPTNTLLPDMKLGWNLSSNLDRYITSWKSTEDPSVGDYSFKLDYHGFPEIFLRNKQVI  216

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHN--KNLFSRLIVNYTQLL  1439
             IYRSG WNG  FSGVPEM     + FSF+    EVYY+F I +  K L+SRLIV+    L
Sbjct  217   IYRSGPWNGERFSGVPEMTVSNGLQFSFVYNSQEVYYTFSIKDDWKPLYSRLIVSQDGYL  276

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             +RY WI   +IWN+FW APKDQCD+YRECG +G+CD++ SPVC C  GF+P+N QAW+LR
Sbjct  277   QRYMWIESRKIWNQFWYAPKDQCDSYRECGPYGVCDSNASPVCECLKGFQPKNLQAWNLR  336

Query  1620  DGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
             DGS GC R  EL+C  D FL +   KLPES  +FVD  M L+ C++ C  NCSCTAY N 
Sbjct  337   DGSDGCVRKTELECSKDKFLDLGNMKLPESGGAFVDMGMDLEACRKKCSENCSCTAYGNA  396

Query  1800  NISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVIL  1979
              I NGG+GCVIW  EL D+R+Y AE GQ LYVR+AAS+ +          G GK K+V++
Sbjct  397   RIENGGTGCVIWNGELMDLRRY-AEDGQHLYVRLAASELD----------GNGKMKRVLI  445

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTEN--IEMRGTRERSRDPLMNATAISSKREHSG  2153
               GI +G  ++L  L +    K + G+T    IE RG+ ERS+D L+N   ISSKREH  
Sbjct  446   IVGITVGTSILLAALGIFFVWKRKSGITRKGRIEQRGSFERSQDFLLNEVVISSKREHYS  505

Query  2154  ETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSR  2333
                  DE ELP+ DFNA+A+AT+NFA+ N+LGQGGFG VYKG  V G+ +AVKRLSKNS 
Sbjct  506   GERSNDELELPLLDFNAVAVATNNFADENQLGQGGFGCVYKGT-VEGQLVAVKRLSKNSG  564

Query  2334  QGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLD  2513
             QG EEFKNE++LIARLQHRNLV+LLGCCVD+DEKMLIYEYMENKSLDS+LF   + S+LD
Sbjct  565   QGTEEFKNEVKLIARLQHRNLVRLLGCCVDMDEKMLIYEYMENKSLDSVLFSNAKRSMLD  624

Query  2514  WKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDET  2693
             W +R++IICG+ARGLLYLHQDSRFRIIHRDLKASN+LLD E+ PKISDFGMAR+FG D+T
Sbjct  625   WPKRFDIICGIARGLLYLHQDSRFRIIHRDLKASNILLDGELTPKISDFGMARIFGNDQT  684

Query  2694  EAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLL  2873
             EA  TKR+VG YGYMSPEYAMDGLFS+KSD FSFGVLVLE++SG+KN+GFY  +NE NLL
Sbjct  685   EA-NTKRVVGKYGYMSPEYAMDGLFSIKSDVFSFGVLVLEIISGKKNRGFYYANNELNLL  743

Query  2874  GLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLML  3053
             G AW+LW EG+GSE++D  +  +S+S  V  V+RC+QVGLLCVQE+AEDRP MA+V+LML
Sbjct  744   GHAWKLWTEGKGSEIIDPSVG-DSYSPSV--VLRCMQVGLLCVQERAEDRPTMASVVLML  800

Query  3054  IGKGTSLPQPKQPGFCLA--SKPVKMDSSSTSYNDQS--LNQLTVTMLDAR  3194
               +  ++PQPK PGFCL     PV+ DSSS    DQS  +NQ+TVTMLD R
Sbjct  801   SSETATMPQPKNPGFCLERHKNPVETDSSS-GMQDQSCTVNQVTVTMLDGR  850


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCC++  EKMLI      KSLD+ +F   KR+ L+W K
Sbjct  581  QHRNLVRLLGCCVDMDEKMLIYEYMENKSLDSVLFSNAKRSMLDWPK  627



>ref|XP_011011561.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Populus euphratica]
Length=834

 Score =   978 bits (2527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/820 (61%), Positives = 614/820 (75%), Gaps = 28/820 (3%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             QTL+S  + F+LGFF+PG NS   YVGIWYK I  RT VWVANRD P+ NS+G  KI  +
Sbjct  41    QTLISTSQCFELGFFTPG-NSRNWYVGIWYKNI-PRTYVWVANRDNPISNSSGTFKIF-N  97

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
              +I L D  GN +WSS+ TN +    N V QLLDSGN V++ E +     +LWQSFDYPT
Sbjct  98    QSIALFDLAGNLVWSSNQTNVR----NPVMQLLDSGNLVLK-EQESGSGQFLWQSFDYPT  152

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DTLLP MKLGW   TG +RY+SSW+S  DP  GD +FKL+ +G PE FL     I YRSG
Sbjct  153   DTLLPDMKLGWALNTGLDRYLSSWKSSDDPGTGDFSFKLEYHGFPEVFLWKDHEIEYRSG  212

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG  FSGVPEM+P + ++F+F+  ++EVYYSF I  KNL+SRL V  + LL+R+ WIP
Sbjct  213   PWNGQRFSGVPEMKPLDYLSFNFITAQDEVYYSFHIATKNLYSRLTVTSSGLLQRFAWIP  272

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
             E + WN+FW APKDQCDNYRECG++GICD++ SPVC C  GF+P+N QAW LRDGSGGC 
Sbjct  273   ETQQWNKFWYAPKDQCDNYRECGAYGICDSNASPVCKCLKGFQPKNHQAWDLRDGSGGCV  332

Query  1641  RYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGS  1820
             R   L+C  D FL M   KLP+S+TSFVD +MSL  C+ +C RNCSCTAY+N NISNGGS
Sbjct  333   RKTNLECLEDKFLHMKNMKLPQSTTSFVDRSMSLKNCELLCSRNCSCTAYANSNISNGGS  392

Query  1821  GCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlg  2000
             GCVIWT ELFD+RQY  EGGQ LYVR+AASD          G+G G    +I+   + +G
Sbjct  393   GCVIWTGELFDLRQY-PEGGQDLYVRLAASDI---------GDG-GSADTIIICIAVGIG  441

Query  2001  igmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEYE  2180
             I ++      + +RK  R V    +  G +ERS+D L+N   I +K+++SGE    DE E
Sbjct  442   ILILSLTGFSIWKRKRLRSVCNGTQQEGPQERSQDLLLNEVVI-NKKDYSGEKS-KDELE  499

Query  2181  LPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNE  2360
             LP+FDF  IA AT NF + NKLG+GGFG V+KG LV G+E+AVKRLSK S QG EEFKNE
Sbjct  500   LPLFDFCTIAAATGNFCDENKLGEGGFGCVHKGRLVEGQEVAVKRLSKKSGQGTEEFKNE  559

Query  2361  LRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIIC  2540
             +RLIAR+QHRNLV+LLGCC + DEK+LIYE+MEN+SLDS+LF+K +SSLL+W+RR+NIIC
Sbjct  560   VRLIARVQHRNLVRLLGCCFEKDEKILIYEFMENRSLDSVLFNKAKSSLLNWQRRFNIIC  619

Query  2541  GVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIV  2720
             G ARGLLYLHQDSRFRIIHRDLKASN+LLD+E  PKISDFGMAR+FGGD+T+A  T+RIV
Sbjct  620   GTARGLLYLHQDSRFRIIHRDLKASNILLDREWTPKISDFGMARIFGGDQTQA-NTRRIV  678

Query  2721  GTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGE  2900
             GTYGYMSPEYAMDGLFSVKSD FSFGVLVLE+V G KN+GFY  ++E NLLG  WR W +
Sbjct  679   GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVCGEKNRGFYHSNSELNLLGNVWRQWKD  738

Query  2901  GRGSELLD-SVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLP  3077
             G G E+LD S  +S S SE    V+RCIQVGLLCVQE+AEDRP MA+V+LML  +  S+P
Sbjct  739   GNGLEVLDKSAGSSYSPSE----VLRCIQVGLLCVQERAEDRPTMASVVLMLSSETASMP  794

Query  3078  QPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             QPK PG+CL   P + DSSS+  ++  ++NQ+TVT+LDAR
Sbjct  795   QPKTPGYCLGKNPFETDSSSSKQDESFTVNQVTVTVLDAR  834



>ref|XP_010538685.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Tarenaya hassleriana]
Length=850

 Score =   975 bits (2520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/839 (58%), Positives = 609/839 (73%), Gaps = 44/839 (5%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG  899
             N  ++ N+TLVS G VF+LGFF P  +    Y+GIWYK I  RT VWVANRD PL NS+G
Sbjct  42    NLTVSENRTLVSPGGVFELGFFKPSDSRNSWYLGIWYKTIPKRTYVWVANRDNPLSNSSG  101

Query  900   FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLW  1079
              LKI  D N+ L D   N +WS++ T     P   VA+LLD+GNFV R   + NP+ +LW
Sbjct  102   TLKIS-DRNLALFDQADNPVWSTNLTGEVKSP---VAELLDNGNFVFRDSENNNPDEFLW  157

Query  1080  QSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKD  1259
             QSFD+PTDTLLP MKLGWD +TG +RYI+SWRSP DPS GD  FKL+  G PE FL N+D
Sbjct  158   QSFDHPTDTLLPEMKLGWDLRTGFDRYITSWRSPDDPSTGDFLFKLESRGFPEIFLWNRD  217

Query  1260  IIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL  1439
               +YRSG WNGV FSGVPEM+P + + F+F  +K+EV YSF + N +++SRL V+ + LL
Sbjct  218   SRVYRSGPWNGVRFSGVPEMQPLKYMTFNFTASKDEVTYSFHVTNSSIYSRLSVSSSGLL  277

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             +R+TWIP  + WNRFW APKDQCDN++ECGS+G CDT+ SPVC C  GF+PRN QAW+LR
Sbjct  278   QRFTWIPTEQEWNRFWYAPKDQCDNFKECGSYGYCDTNTSPVCNCIRGFEPRNPQAWALR  337

Query  1620  DGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
             DGSGGC R   L C  D FL +   KLPE++ + VD T+   EC+E C RNC CTA++N 
Sbjct  338   DGSGGCVRKTRLSCGGDKFLRLRKMKLPETTAAMVDRTVGTKECEERCRRNCECTAFANT  397

Query  1800  NISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASD--------AEQTGEVARGGNGF  1955
             +I NGGSGCVIW  +L DIR Y ++GGQ L+VR++ASD        A  TG V   G  F
Sbjct  398   DIRNGGSGCVIWVGDLLDIRAY-SDGGQDLFVRLSASDLGDESSRNALVTGLVVSFGVLF  456

Query  1956  GKTKKVILACgivlgigmvlfgllllkrrklrrgVTENI-EMRGTRERSRDPLMNATAIS  2132
               +   I  C                         T +I E     ERSRD LM    IS
Sbjct  457   LGS---IFFCLWKRKQKK-----------------TRSIAEPNANPERSRDLLMKEAVIS  496

Query  2133  SKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVK  2312
             S+R  S E    +E ELP+F+   IAMAT+NF+++NKLGQGGFGSVYKG L+ G+EIAVK
Sbjct  497   SRRHVSSEGK-REEIELPLFELEVIAMATENFSDSNKLGQGGFGSVYKGRLLDGQEIAVK  555

Query  2313  RLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILF--  2486
             RLSK S QG +EFKNE+RLIARLQHRNLV+LLGCCV+++EKML+YEYMEN+SLDS LF  
Sbjct  556   RLSKTSVQGVDEFKNEVRLIARLQHRNLVRLLGCCVEMNEKMLVYEYMENRSLDSSLFVS  615

Query  2487  DKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGM  2666
             DK RSS LDWK R++I+CG+ARGLLYLHQDSRFRIIHRDLKASNVLLD+EMNPKISDFGM
Sbjct  616   DKTRSSKLDWKTRFSIVCGIARGLLYLHQDSRFRIIHRDLKASNVLLDREMNPKISDFGM  675

Query  2667  ARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFY  2846
             AR+FGGDETEA  T+++VGTYGYM+PEYAMDG FSVKSD FSFGVLVLE+VSG++N+GFY
Sbjct  676   ARIFGGDETEA-NTRKVVGTYGYMAPEYAMDGTFSVKSDVFSFGVLVLEIVSGKRNRGFY  734

Query  2847  TPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRP  3026
               + E NLLG AWR W EG+G E++D VI     +    +V+RCIQ+GLLCVQE+AEDRP
Sbjct  735   NSNTELNLLGSAWRYWKEGKGIEIVDPVIGDSYPNH---EVLRCIQIGLLCVQERAEDRP  791

Query  3027  NMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              M++V+LML  +  ++PQP+QPG+C+   P++ DSSS+   D    ++NQ+TVT++DAR
Sbjct  792   TMSSVVLMLGSETATMPQPRQPGYCVGRSPLETDSSSSRQPDDESWTVNQVTVTVIDAR  850



>ref|XP_010052484.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Eucalyptus grandis]
 gb|KCW76535.1| hypothetical protein EUGRSUZ_D00923 [Eucalyptus grandis]
Length=854

 Score =   972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/832 (58%), Positives = 617/832 (74%), Gaps = 17/832 (2%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNS-T  896
             N  +  +QTL SA +VFQLGFF+P  ++   YVGIWYK I DRT VWVANRD P+ NS T
Sbjct  33    NESIASDQTLASANDVFQLGFFTP--DNANYYVGIWYKNIPDRTYVWVANRDGPVANSST  90

Query  897   GFLKIGEDGN--IHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPEN  1070
                KIG+ GN  + L     N +WSS+ T   S P N VAQLLD+GN VVR   DE+  +
Sbjct  91    VVFKIGDKGNNVVILDQANKNILWSSNQTRANSSPVNPVAQLLDNGNLVVREAGDESSSD  150

Query  1071  YLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLR  1250
             YLWQSFD+PTDTLLP MKLGWD   G +R+++SW++P DPS GD +FK+D +G PE FL 
Sbjct  151   YLWQSFDFPTDTLLPEMKLGWDLTQGLDRFLNSWKTPQDPSSGDFSFKIDYHGYPEVFLW  210

Query  1251  NKDIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYT  1430
             +K   +YRSG WNG+ FSGVPEM+    + F+F+  + +VYYSFE++  N+ SRL VN T
Sbjct  211   DKSTKLYRSGPWNGIRFSGVPEMQSSSTMDFTFVSDQQQVYYSFEVNTPNIISRLTVNST  270

Query  1431  QLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAW  1610
               L+RYTW+ +++ W+ FW APKDQCD++ ECG +G CDT+ SP+C C  GF P+N QAW
Sbjct  271   GTLQRYTWVEDSKSWSMFWEAPKDQCDHFSECGPYGFCDTNASPICNCTRGFSPKNLQAW  330

Query  1611  SLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAY  1790
             +LRDGS GC R  ELDC +DGFL +   KLPESS + VD  MSLD+C++ C +NCSCT Y
Sbjct  331   NLRDGSAGCVRRTELDCSSDGFLLLKGMKLPESSNTVVDMAMSLDDCRKGCAKNCSCTGY  390

Query  1791  SNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVA---RGGNGFGK  1961
             S+ NISNG +GCV+W  EL D+R Y    GQ  YV+++ASD    G +       NG G 
Sbjct  391   SSANISNGEAGCVMWFGELLDMRHYVG-AGQDFYVKLSASDIVAFGGLVTQNSSSNGLGT  449

Query  1962  TKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKR  2141
                V +A G  + +  +   L+  ++  L   +  N E +G RERS+D L+N   ISSKR
Sbjct  450   LAIVGIAAGGSVLLLALTAFLMWKRKTSLNPHI-RNTEPQGARERSQDFLLNEVVISSKR  508

Query  2142  EHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLS  2321
             E+S E    +E ELP+F FNAIA+AT NF++ NKLGQGGFG VY+  +  G  +AVKRLS
Sbjct  509   EYSRENK-PEELELPLFAFNAIALATKNFSDENKLGQGGFGCVYECRIEEGPVVAVKRLS  567

Query  2322  KNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRS  2501
             KNS QG EEFKNE++LIARLQHRNLV+L+GCCV++DEK+LIYEYME+KSLDS+LF K +S
Sbjct  568   KNSGQGMEEFKNEVQLIARLQHRNLVRLIGCCVEMDEKILIYEYMEHKSLDSVLFSKTKS  627

Query  2502  SLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFG  2681
             S+L+W+RR+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLD E+NPKISDFGMAR+FG
Sbjct  628   SMLNWERRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDGELNPKISDFGMARIFG  687

Query  2682  GDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNE  2861
              D+ EA  TKR+VGTYGYM+PEYAMDG FS KSD FSFGVLVLE++SG+KN+GFY  +NE
Sbjct  688   RDQVEA-NTKRVVGTYGYMAPEYAMDGQFSEKSDVFSFGVLVLEIISGKKNRGFYYANNE  746

Query  2862  ENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAV  3041
              NLLG +W+LW EG+G ELLD+ +  +++S  +++V+RCIQVGLLCVQE  +DRP M++V
Sbjct  747   LNLLGHSWKLWKEGKGLELLDTAVG-DAYS--MNEVLRCIQVGLLCVQEHVDDRPVMSSV  803

Query  3042  MLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             +LML  +  ++P PK PGFCL  + ++ DSSS+ ++   ++NQ+TVTMLDAR
Sbjct  804   VLMLSSENPTMPHPKNPGFCLG-RAIETDSSSSKHDGTCTVNQVTVTMLDAR  854


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRL+GCC+E  EK+LI      KSLD+ +F  TK + LNW
Sbjct  588  QHRNLVRLIGCCVEMDEKILIYEYMEHKSLDSVLFSKTKSSMLNW  632



>ref|XP_002518601.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus 
communis]
 gb|EEF43988.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus 
communis]
Length=834

 Score =   969 bits (2506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/823 (60%), Positives = 600/823 (73%), Gaps = 37/823 (4%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             QTL+S  + F+LGFF+PG NS   YVGIWYK I DRT VWVANRD PL NS+G  KI  +
Sbjct  44    QTLLSTRQKFELGFFTPG-NSKNWYVGIWYKNISDRTYVWVANRDNPLTNSSGIFKIF-N  101

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
              +I L D   N IWSS    NQ    N V QLLD+G+ V+R  N  N   YLWQSFDYPT
Sbjct  102   QSIVLFDQGNNLIWSS----NQIKATNPVMQLLDTGDLVLREANVNN--QYLWQSFDYPT  155

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DTLLP MKLGWD     +RY+SSW+S  DP  GD +FKLD +G PE FL N    IYRSG
Sbjct  156   DTLLPDMKLGWDLNKSLHRYLSSWKSKDDPGAGDYSFKLDYHGFPEIFLWNDGRKIYRSG  215

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ FSGVPEM+P + I+F F+  ++EV+YSF I + + +SRL V  +  L+RYTWIP
Sbjct  216   PWNGLRFSGVPEMKPLDYISFDFVTNQSEVFYSFHISSNSTYSRLTVTSSGELQRYTWIP  275

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
             E + WN FW APKDQCD+Y+ECG +GICD++ SPVC C  GF+P+N QAW+LRDGSGGC 
Sbjct  276   ERQDWNSFWYAPKDQCDDYKECGPYGICDSNASPVCKCMRGFEPKNLQAWNLRDGSGGCV  335

Query  1641  RYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGS  1820
             R  +L C  D FL +   KLPESSTSFVD  +SL  C+E+C+RNCSCTAY+N +ISNGG+
Sbjct  336   RKTDLQCMNDKFLHLKNIKLPESSTSFVDRIISLKICEELCLRNCSCTAYANSDISNGGT  395

Query  1821  GCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARG----GNGFGKTKKVILACg  1988
             GCV+W  EL D+RQYT  GGQ LYVR+AASD      VA        G G     + AC 
Sbjct  396   GCVLWFGELLDMRQYTEGGGQDLYVRLAASDIGDGKNVAALIIGISVGIGTLLLGLAACF  455

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
             I     +                     E +G +ERS++ L+N   ISSKR++SGE    
Sbjct  456   IWKRRSVRK-------------------EQKGVQERSQNLLLNEVVISSKRDYSGEKD-K  495

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             DE ELP+FDF  IA ATDNF++ NKLGQGGFG VYKG LV G+ +AVKRLSK S QG EE
Sbjct  496   DELELPLFDFGTIATATDNFSDENKLGQGGFGCVYKGRLVEGQVVAVKRLSKTSVQGIEE  555

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             FKNE+ LIARLQHRNLV+LLGCC++ +EK+LIYEYME++SLDS++F+  + SLL+W+RR+
Sbjct  556   FKNEVNLIARLQHRNLVRLLGCCIETNEKVLIYEYMEHRSLDSVIFNNAKRSLLNWQRRF  615

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             NI+CG+ARGLLY+HQDSRFRIIHRDLKASN+LLD E NPKISDFGMAR+FGGD+TEA +T
Sbjct  616   NIVCGIARGLLYMHQDSRFRIIHRDLKASNILLDGEWNPKISDFGMARIFGGDQTEA-ST  674

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             KR+VGTYGYMSPEYAMDG FSVKSD FSFGVLVLE+VSG KN+GFY  ++E NLLG AWR
Sbjct  675   KRVVGTYGYMSPEYAMDGHFSVKSDVFSFGVLVLEIVSGNKNRGFYHSNSELNLLGHAWR  734

Query  2889  LWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGT  3068
             LW E +G E+LDS + S        +V+RCIQVGLLCVQE+AEDRP M++V+LML  +  
Sbjct  735   LWKEEKGLEILDSSVGSSFSPS---EVLRCIQVGLLCVQERAEDRPTMSSVVLMLSSENA  791

Query  3069  SLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             ++P PK PGFCL   P + DSSS   ++  ++NQ+TVTMLDAR
Sbjct  792   TMPHPKTPGFCLGRNPFETDSSSGKQDESYTVNQVTVTMLDAR  834


 Score = 57.8 bits (138),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCCIE  EK+LI      +SLD+ +F+  KR+ LNW +
Sbjct  567  QHRNLVRLLGCCIETNEKVLIYEYMEHRSLDSVIFNNAKRSLLNWQR  613



>ref|XP_007159231.1| hypothetical protein PHAVU_002G220200g [Phaseolus vulgaris]
 gb|ESW31225.1| hypothetical protein PHAVU_002G220200g [Phaseolus vulgaris]
Length=843

 Score =   965 bits (2495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/828 (60%), Positives = 615/828 (74%), Gaps = 21/828 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRD--RTIVWVANRDKPLRNSTGF  902
             L  NQTL+S   +F+LGFFS   ++   Y+ IWYK I D  +T+VWVANRD PL+NS GF
Sbjct  31    LQTNQTLLSPNAIFELGFFSYTNST--WYLAIWYKTIHDTEKTVVWVANRDTPLQNSIGF  88

Query  903   LKIGEDGNIHLVDGTGNSIWSSSNTNNQSVP-GNTVAQLLDSGNFVVRRENDENPENYLW  1079
             LKI + GN+ +V+ +   +WSS    N S P  N V +LLDSGN V+R EN+ +P  +LW
Sbjct  89    LKIDDKGNLLIVNQSHKPVWSS----NHSTPITNPVLELLDSGNLVLREENENDPTRFLW  144

Query  1080  QSFDYPTDTLLPGMKLGWDSKTGRNRYISSWR-SPTDPSEGDITFKLDINGLPEAFLRNK  1256
             QSFDYPTDTLLPGMKLGW+  TG  ++I+SWR +  DPS GD +FKLD  GLPE FL NK
Sbjct  145   QSFDYPTDTLLPGMKLGWNFDTGMEKHITSWRVTNQDPSSGDFSFKLDCRGLPEIFLWNK  204

Query  1257  DIIIYRSGGWNGVAFSGVPEMEP-KEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQ  1433
             D IIYRSG WNG  FSGVPEM+P  + I F+F   +++VYY+F I N +LFSRL VN   
Sbjct  205   DQIIYRSGPWNGDRFSGVPEMQPVTDSIKFTFYADQHQVYYTFSIGNNSLFSRLSVNSVG  264

Query  1434  LLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWS  1613
              L+R TWI   ++WN+FW APKDQCDNYRECG++G+CDT+ SPVC C  GF+PRNQ AW+
Sbjct  265   QLQRLTWIQSTQVWNKFWYAPKDQCDNYRECGAYGVCDTNASPVCQCITGFRPRNQPAWN  324

Query  1614  LRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYS  1793
             LRDGS GC R   L C +D FL M   KLP++++ FV+ +M L EC ++C RNCSCTAY+
Sbjct  325   LRDGSEGCVRKTGLSCGSDRFLHMQRVKLPDTTSVFVNRSMGLVECGDLCQRNCSCTAYA  384

Query  1794  NYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKV  1973
             N  I NGGSGCV+W  EL D+R Y + GGQ LYVR+AASD    G+  +  +     + +
Sbjct  385   NIEIRNGGSGCVMWVGELLDVRGYPS-GGQDLYVRLAASDVGIEGDSGKTSD---TIRDI  440

Query  1974  ILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSG  2153
              +  G+   I + L   +L K+RKL+  +    E RG  ERS+D L+N   +SS RE SG
Sbjct  441   GIVVGVAGFILLALGIFILWKKRKLQPILKGKTEKRGFSERSQDFLINEGVLSSDREQSG  500

Query  2154  ETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSR  2333
             E+ + D+ ELP+FDFN I MAT+NF+  NKLGQGGFGSVYKG L  G+ IAVKRLSK S 
Sbjct  501   ESNM-DDLELPLFDFNTITMATNNFSEENKLGQGGFGSVYKGSLKEGQHIAVKRLSKTSG  559

Query  2334  QGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLD  2513
             QG EEFKNE++LI +LQHRNLV+LLGC + +DEKML+YEYMEN+SLD+ILFDK + S LD
Sbjct  560   QGIEEFKNEVKLIVKLQHRNLVRLLGCSIQMDEKMLVYEYMENRSLDAILFDKAKKSSLD  619

Query  2514  WKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDET  2693
             W+ R+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLDKEMNPKISDFGMAR+FG D+ 
Sbjct  620   WQMRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGTDQI  679

Query  2694  EAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLL  2873
             EA T  RIVGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE+VSG+KN+GFY  + E NLL
Sbjct  680   EANTM-RIVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSGKKNRGFYLANKELNLL  738

Query  2874  GLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLML  3053
             G AW+LW EG   EL DS I + + +    +V RCIQVGLLCVQE+AEDRP M++V+LML
Sbjct  739   GHAWKLWIEGNAWELSDSSIDTLNSAS---EVQRCIQVGLLCVQERAEDRPTMSSVVLML  795

Query  3054  IGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
                  S+ QPK PGFCL + P++ +SSS+   +  ++NQ+TVTMLDAR
Sbjct  796   SSDTASMSQPKNPGFCLGTNPMETESSSSKQEESCTVNQVTVTMLDAR  843



>ref|XP_008227125.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Prunus mume]
Length=865

 Score =   954 bits (2466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/832 (59%), Positives = 616/832 (74%), Gaps = 33/832 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNST-GFLKIG  914
             NQTLVSAG VF+LGFF PG  SG  Y+GIWYK I+++T+VWVANRD P+ NS+   LK+G
Sbjct  54    NQTLVSAGGVFELGFFKPGATSG-WYLGIWYKNIQEKTVVWVANRDNPISNSSSATLKLG  112

Query  915   EDGNIHLVDG-TGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRREN---DENPENYLWQ  1082
             + GN+ L+DG  GN  WSS+ T   S     + QLLDSGN V+R  N   +   + +LWQ
Sbjct  113   DHGNLVLLDGENGNITWSSNETQATS----PIVQLLDSGNLVLRDGNLNRNGPTDQFLWQ  168

Query  1083  SFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDI  1262
             SFDYPTDTLLP MKLGW+  +  +RYI+SW+S  DPS GDI+FKLD  G PE FLR K  
Sbjct  169   SFDYPTDTLLPDMKLGWNLSSNLDRYITSWKSTEDPSTGDISFKLDYRGFPEIFLRKKQS  228

Query  1263  IIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEI--HNKNLFSRLIVNYTQL  1436
             I YRSG WNG  FSGVPEM P + I F+F+    EVYYSF +  ++++ +SRLIVN    
Sbjct  229   ITYRSGPWNGERFSGVPEMTPSDGIQFNFVANSEEVYYSFSVRSNSESFYSRLIVNPNGE  288

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
             L+R TWI    IWN+FW APKDQCD+Y ECG +GICD++ SPVC C  GF+P+N Q W L
Sbjct  289   LQRLTWIESRNIWNKFWYAPKDQCDDYSECGPYGICDSNASPVCKCLKGFEPKNLQTWDL  348

Query  1617  RDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSN  1796
             RDGS GC R  +L+C  D FL++   KL ES  +FVD  MSL+ CK+ C+ +C+CTAYS+
Sbjct  349   RDGSDGCVRKTDLECSKDKFLALGNMKLAESGGAFVDMNMSLEACKKKCLESCNCTAYSD  408

Query  1797  YNIS-NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKV  1973
               IS  GGSGCV+WT +L D+RQY AEGGQ  YVR+AAS+ +          G GKTK++
Sbjct  409   ARISAGGGSGCVMWTGDLLDMRQY-AEGGQHFYVRLAASELD----------GDGKTKRL  457

Query  1974  ILACgivlgigmvlfgllllkrrklrrgVTEN--IEMRGTRERSRDPLMNATAISSKREH  2147
             I+  GIV+GIG++L GL +    K +  +     IE +G  ERS+D L+N   I+SK+E 
Sbjct  458   IMIVGIVVGIGILLAGLAICFVWKRKLAIMNRGRIEQKGPNERSQDFLLNGVVITSKKES  517

Query  2148  SGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKN  2327
                    DE ELP+ D++ +A+ATDNF++ N+LGQGGFG VYKG LV GE +A+KRLSKN
Sbjct  518   YSGERGNDELELPLLDYSTVAVATDNFSDENQLGQGGFGCVYKGTLVEGEVVAIKRLSKN  577

Query  2328  SRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSL  2507
             S QG EEFKNE++LIARLQHRNLV+LLGCCVD+DEKMLIYEYMENKSLDS+LF + + S+
Sbjct  578   SGQGTEEFKNEVKLIARLQHRNLVRLLGCCVDMDEKMLIYEYMENKSLDSVLFSQAKRSM  637

Query  2508  LDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGD  2687
             LDW++R+ IICG+ARGLLYLHQDSRFRIIHRDLKASN+LLD E+ PKISDFGMAR+FG D
Sbjct  638   LDWQKRFEIICGIARGLLYLHQDSRFRIIHRDLKASNILLDGELTPKISDFGMARIFGRD  697

Query  2688  ETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEEN  2867
             +TEA  T+R+VGTYGYMSPEYAMDGLFS+KSD FSFGVLVLE++SG+KN+GFY  +NE N
Sbjct  698   QTEA-NTRRVVGTYGYMSPEYAMDGLFSIKSDVFSFGVLVLEIISGKKNRGFYYSNNELN  756

Query  2868  LLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVML  3047
             LLG AW+LW EG GSE++D  +     S F  +V+RC+QVGLLCVQE+AEDRP M++V+L
Sbjct  757   LLGHAWKLWTEGNGSEIIDPSVGD---SYFPSEVLRCMQVGLLCVQERAEDRPTMSSVVL  813

Query  3048  MLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             ML  +  ++PQPK PGFCL      +++ S+S       ++N +TVTMLD R
Sbjct  814   MLSSETATMPQPKTPGFCLERNKNPLETDSSSSKQDQSCTVNHVTVTMLDGR  865


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCC++  EKMLI      KSLD+ +F   KR+ L+W K
Sbjct  596  QHRNLVRLLGCCVDMDEKMLIYEYMENKSLDSVLFSQAKRSMLDWQK  642



>ref|XP_010240988.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nelumbo nucifera]
Length=867

 Score =   952 bits (2460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/845 (57%), Positives = 607/845 (72%), Gaps = 29/845 (3%)
 Frame = +3

Query  723   PPLTLN--QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNST  896
             P L+L   QTLVS    F+LGFF+PG +S   YVGIWYK+I  +T+VWVANR+ P+ +S+
Sbjct  31    PTLSLKDGQTLVSTDGNFELGFFTPG-SSKYRYVGIWYKKIPIKTVVWVANRNSPIPDSS  89

Query  897   GFLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYL  1076
             G L IG DGN+ L++      W+++ T+    P   VAQLL SGN VVR  +D +P++YL
Sbjct  90    GVLSIGTDGNLVLLNQQARIFWTANATSKARNP---VAQLLGSGNLVVRDGSDTDPQDYL  146

Query  1077  WQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNK  1256
             WQSFDYPTDTLLPGMKLGWD KTG NRY++SW+SP DPS GD +FK+D +G P+AFL   
Sbjct  147   WQSFDYPTDTLLPGMKLGWDLKTGLNRYLTSWKSPNDPSVGDYSFKIDPHGFPQAFLFQG  206

Query  1257  DIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQL  1436
              I IYRSG WNG+ FSGVPEM+  ++++F F   + EVYY + +   ++FSRL+VN T L
Sbjct  207   LIPIYRSGPWNGIQFSGVPEMKSNDIVSFDFTFNEEEVYYKYTVKKSSVFSRLMVNTTGL  266

Query  1437  LERYTW-IPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWS  1613
             L+RYTW +  N  W  FW A KDQCD Y+ CG +GICD++ SP+C C  GF+P+NQ+ W 
Sbjct  267   LQRYTWELGVNSFWILFWYARKDQCDGYKNCGPYGICDSNTSPICECIQGFRPQNQKTWD  326

Query  1614  LRDGSGGCFRYDELDCPTD-GFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAY  1790
             LRDGS GC R     C  D GFL++   KLP+SS +FVD +MSL+EC   C  NCSCTAY
Sbjct  327   LRDGSDGCVRKTNYVCQKDDGFLTLKGMKLPDSSKAFVDESMSLEECATQCRSNCSCTAY  386

Query  1791  SNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASD---AEQTGEVAR-------  1940
             +N NI+  GSGCV W  EL D+R+Y  EGGQ LYVRVAAS+   AE T    R       
Sbjct  387   ANTNINGEGSGCVFWVVELIDLREYLQEGGQDLYVRVAASELDAAEGTKADKRRRIILIT  446

Query  1941  ---GGNGFGKTKKVILACgivlgigmvlfgllllkrrklrrgVTEN--IEMRGTRERSRD  2105
                GG G       I+   +                   R+   E+  I  +  RE+S+D
Sbjct  447   SIIGGLGLLALAFSIIYLIVWRWRKTRSQWKKDTMHPLWRKRKAEDRSIRRKSIREKSQD  506

Query  2106  PLMNATAISSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGML  2285
                   AI+S RE   +    D+ ELP+FDF+ I  ATDNF++ANKLG+GGFGSVYKG L
Sbjct  507   LQAVDGAIASTRECYSDESNNDDIELPLFDFDTIETATDNFSDANKLGKGGFGSVYKGEL  566

Query  2286  VGGEEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENK  2465
               G+EIAVKRLSKNS QGAEEFKNE+ LIARLQHRNLV+LLGCC++  EK+L+YEYM+NK
Sbjct  567   DDGQEIAVKRLSKNSGQGAEEFKNEVMLIARLQHRNLVRLLGCCIECQEKILVYEYMQNK  626

Query  2466  SLDSILFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNP  2645
             SLDSI+F+K +S++LDW++R+NII G+ARGLLYLHQDSRFRI+HRDLKASN+LLD +MNP
Sbjct  627   SLDSIIFNKTKSTILDWRKRFNIIVGIARGLLYLHQDSRFRIVHRDLKASNILLDGDMNP  686

Query  2646  KISDFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSG  2825
             KISDFGMAR+FGGD+TEA  TKR+VGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLE++SG
Sbjct  687   KISDFGMARIFGGDQTEA-NTKRVVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEIISG  745

Query  2826  RKNQGFYTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQ  3005
             +KN+GFY  +N+ NLLG AW LW EGR  EL+D+ +    H+    +V+RCIQVGLLCVQ
Sbjct  746   KKNRGFYYSNNQHNLLGHAWTLWKEGRALELVDTSVGDSYHTY---EVLRCIQVGLLCVQ  802

Query  3006  EKAEDRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQS--LNQLTVT  3179
             E+AEDRP M+ V+LML  +  ++PQPK+PGFCL    ++M S+S      S  +N++TVT
Sbjct  803   ERAEDRPIMSTVVLMLSSETATMPQPKEPGFCLGRNFMEMMSTSNKQEQDSCTINEVTVT  862

Query  3180  MLDAR  3194
             ML+AR
Sbjct  863   MLEAR  867


 Score = 55.5 bits (132),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCCIE  EK+L+      KSLD+ +F+ TK   L+W K
Sbjct  599  QHRNLVRLLGCCIECQEKILVYEYMQNKSLDSIIFNKTKSTILDWRK  645



>ref|XP_010268934.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nelumbo nucifera]
Length=855

 Score =   951 bits (2458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/824 (57%), Positives = 612/824 (74%), Gaps = 16/824 (2%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             +QTLVS+G  F+LGFF+P  NS   YVGIWY +I  RT+VWVANR+ P+ + TG L  G 
Sbjct  43    SQTLVSSGGNFKLGFFTPD-NSKYSYVGIWYNKISIRTVVWVANRNDPITDLTGVLSFGT  101

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             DGN+ L++     +WS++ +  Q    N +AQLLDSGN V+R  +D NP+NYLWQSFDYP
Sbjct  102   DGNLVLLNRQATVLWSTNTSKVQ----NPIAQLLDSGNLVIREASDPNPQNYLWQSFDYP  157

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
             TDTLLPGMKLGW+ KT  NR+++SW+SP DPS GD +F++D +GLPE FL N+   +YRS
Sbjct  158   TDTLLPGMKLGWNLKTRLNRFLTSWKSPDDPSMGDFSFRIDPHGLPEIFLMNRLDTVYRS  217

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW-  1454
             G WNG+ FSGVPEM P E+++F F   + EVYYSF I++ ++FSRL+VN T LL+R+TW 
Sbjct  218   GPWNGIQFSGVPEMRPSEIVSFDFTFNEEEVYYSFTINSDSVFSRLMVNSTGLLQRFTWQ  277

Query  1455  IPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGG  1634
             +  N  W  FW APKDQCD+Y+ CG +GICD++ SP+C C  GFKP+NQ+AW LRDGS G
Sbjct  278   LGVNSDWILFWYAPKDQCDDYKNCGPYGICDSNASPICECVKGFKPKNQKAWDLRDGSDG  337

Query  1635  CFRYDELDCPTD-GFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             C    E  C  D GFL +   KLP+SS +FV+ +M+L EC+  C ++CSCTAY+N NI+ 
Sbjct  338   CVVQTEFVCQKDDGFLKLTGMKLPDSSRAFVNQSMNLQECEAECQKSCSCTAYANTNITG  397

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgi  1991
             GGSGCV W  +L D+R+Y  +GG+ LYVRVAAS+     E ++  N   K + VILA  I
Sbjct  398   GGSGCVFWIGDLIDLREYIMDGGEDLYVRVAASELGGEAEGSKSDNNSNKKRLVILATSI  457

Query  1992  vlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRD-PLMNATAIS-SKREHSGETMI  2165
                +G++   L  +     RR +  +   RGTRE+S+D  L++   +  S  ++S ++ +
Sbjct  458   TASLGVLALALSSIYLTWKRRTIRSS--ERGTREKSQDLQLLDLDVVKPSNMDYSDQSKM  515

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
              +  +LP+FDF  IA ATDNF++A KLG+GGFGSVYKG LV G EIAVKRL+K+S QG E
Sbjct  516   DEIDQLPLFDFYTIATATDNFSDARKLGKGGFGSVYKGELVDGREIAVKRLAKDSGQGTE  575

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE+ LIARLQHRNLV+LLGCCVD  EK+LIYEYM N+SLD I+FDK +S++LDW +R
Sbjct  576   EFKNEVVLIARLQHRNLVRLLGCCVDCQEKILIYEYMHNRSLDCIIFDKTKSTILDWPKR  635

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             + II G+ARG+LYLHQDSRFRI+HRDLKASN+LLD EMNPKISDFGMAR+FGGD+TEA  
Sbjct  636   FRIIGGIARGVLYLHQDSRFRIVHRDLKASNILLDGEMNPKISDFGMARIFGGDQTEA-N  694

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T R+VGT+GYMSPEYAMDGLFSVKSD FSFGVLVLE++SG KN+GFY  +N+ NLLG AW
Sbjct  695   TNRVVGTFGYMSPEYAMDGLFSVKSDVFSFGVLVLEIISGMKNRGFYHTNNQYNLLGHAW  754

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK-  3062
              LW EG   +L+D+ +    H+    +V+RCIQV LLCVQE+AEDRP M+ V+LML  + 
Sbjct  755   ALWREGTTLKLVDTSMGECYHTY---EVLRCIQVALLCVQERAEDRPTMSNVVLMLSSET  811

Query  3063  GTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
              T LPQPK+PGFCL    ++++SSS      +LNQ++VTML+AR
Sbjct  812   ATVLPQPKEPGFCLGRSLLEIESSSNRQESCTLNQVSVTMLEAR  855


 Score = 54.3 bits (129),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCC++  EK+LI      +SLD  +FD TK   L+W K
Sbjct  588  QHRNLVRLLGCCVDCQEKILIYEYMHNRSLDCIIFDKTKSTILDWPK  634



>ref|XP_003608281.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES90478.1| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=852

 Score =   951 bits (2457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/829 (59%), Positives = 614/829 (74%), Gaps = 19/829 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             L++NQTL S   +FQL FFS   N+   Y+GI Y    D+T+VWVANR+ PL+N T FLK
Sbjct  36    LSINQTLFSPKGIFQLTFFSY--NNFSWYLGIRYNIDHDKTVVWVANRNTPLQNPTAFLK  93

Query  909   IGEDGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDEN-PENYLWQ  1082
             +   GN+ +++ +  +IWSS+ TN N ++  N + QLLDSGN VV  E +EN P N+LWQ
Sbjct  94    LTNTGNLIIINESNKTIWSSNQTNQNSTLNTNPILQLLDSGNLVVTTEPNENDPTNFLWQ  153

Query  1083  SFDYPTDTLLPGMKLGWDSKTGRNRYISSWR-SPTDPSEGDITFKLDINGLPEAFLRNKD  1259
             SFDYPTDTLLPGMKLGW+  T    +I+SW+ +  DPS GDI+FK+D +G+PE FL NK+
Sbjct  154   SFDYPTDTLLPGMKLGWNFDTNTETHINSWKQTDQDPSIGDISFKMDYHGVPEIFLWNKN  213

Query  1260  IIIYRSGGWNGVAFSGVPEMEP-KEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQL  1436
               +YRSG WNG  FSGVPEM+P  + I FSF+  ++EVYYSF I  ++LFSRL VN    
Sbjct  214   RRVYRSGPWNGKRFSGVPEMQPVTDSIQFSFVENEHEVYYSFSIGKESLFSRLSVNSLGE  273

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
             L+R TWI    IW +FW APKDQCDNY+ECG FG+CDT+ SPVC C  GF+P+N QAW+L
Sbjct  274   LQRLTWINSRNIWTKFWYAPKDQCDNYKECGPFGVCDTNASPVCNCIKGFRPKNHQAWNL  333

Query  1617  RDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSN  1796
             RDGS GC R +ELDC +D FL M   KLPE+S+ FV+ +MSL EC ++C RNCSCT Y+N
Sbjct  334   RDGSDGCLRNNELDCESDKFLHMVNVKLPETSSVFVNRSMSLVECGDLCKRNCSCTGYAN  393

Query  1797  YNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVI  1976
               I +GG GCV+W  EL DIR Y A GGQ L+VR+AASD    G+   GG+   K  + I
Sbjct  394   IEIVDGGIGCVMWLDELIDIRIYPA-GGQDLFVRLAASDV---GDDGVGGSSDHKIARAI  449

Query  1977  -LACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSG  2153
              +  G    I +VL    L +++KL+  +    E RG+ ERS+D LM     +S RE + 
Sbjct  450   GIMVGGATIIFLVLGTCYLWRKKKLQCLLKGKREKRGSLERSQDLLMTEGVYTSNREQTS  509

Query  2154  ETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSR  2333
             E  + D+ ELP FDFN I MAT+NF+  NKLGQGGFG VYKG L+ G+EIAVKRLSKNS 
Sbjct  510   EKNM-DDLELPFFDFNTITMATNNFSEENKLGQGGFGIVYKGRLIEGQEIAVKRLSKNSG  568

Query  2334  QGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLD  2513
             QG +EFKNE+RLI +LQHRNLV+LLGC   +DEKML+YEYMEN+SLD+ILFDK +   LD
Sbjct  569   QGVDEFKNEVRLIVKLQHRNLVRLLGCSFQMDEKMLVYEYMENRSLDAILFDKAKRFSLD  628

Query  2514  WKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDET  2693
             W+ R+NII G+ARGLLYLHQDSRFRIIHRDLKASN+LLD EMNPKISDFGMAR+FG D+T
Sbjct  629   WQTRFNIISGIARGLLYLHQDSRFRIIHRDLKASNILLDGEMNPKISDFGMARIFGTDQT  688

Query  2694  EAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLL  2873
             EA T  R+VGTYGYMSPEYAMDG+FSVKSD FSFGVLV+E++SG+KN+GFY+ + E NLL
Sbjct  689   EANTV-RVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVMEIISGKKNRGFYSANKELNLL  747

Query  2874  GLAWRLWGEGRGSELLD-SVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLM  3050
             G +W+LW EG   EL+D S++ S S +E    V RCIQVGLLCVQE+AEDRP M++V+LM
Sbjct  748   GHSWKLWNEGNALELIDSSIVNSYSPAE----VFRCIQVGLLCVQERAEDRPTMSSVVLM  803

Query  3051  LIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             L  +  ++ QPK PGFCL S PV+ DSSS+  ++  ++NQ+TVTM+D R
Sbjct  804   LSSETATIAQPKNPGFCLGSNPVETDSSSSKQDESCTVNQVTVTMVDGR  852



>ref|XP_002316682.1| hypothetical protein POPTR_0011s03770g [Populus trichocarpa]
 gb|EEE97294.1| hypothetical protein POPTR_0011s03770g [Populus trichocarpa]
Length=831

 Score =   949 bits (2453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/835 (58%), Positives = 601/835 (72%), Gaps = 65/835 (8%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             QTL+S  + F+LGFF+PG NS   YVGIWYK I  RT VWVANRD PL NS+G  KI  +
Sbjct  45    QTLISTSQDFELGFFTPG-NSRNWYVGIWYKNI-PRTYVWVANRDNPLTNSSGTFKI-LN  101

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
              +I L D   N IWSS+ TN +    N V QLLDSGN V+R +  ++ + +LWQSFDYPT
Sbjct  102   QSIVLFDRAENLIWSSNQTNAR----NPVMQLLDSGNLVLRDQESDSGQ-FLWQSFDYPT  156

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DTLLP MK GWD  TG NR++ SW+S  DP  GD +FKL+ +G PEAFL     I YRSG
Sbjct  157   DTLLPDMKFGWDLNTGVNRFLRSWKSSDDPGTGDFSFKLEYHGFPEAFLLKDQEIKYRSG  216

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG  FSGVPEMEP + ++F+F+  ++EVYYSF I NK+L+SRL V  + LL+R+ W+P
Sbjct  217   PWNGQRFSGVPEMEPVDYMSFNFITNQDEVYYSFHISNKSLYSRLSVTSSGLLQRFAWVP  276

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
             E + W++FW APKDQCD+YRECG +GICD++ SPVC C  GF+P+N QAW+LRDGS GC 
Sbjct  277   ETQQWSQFWYAPKDQCDDYRECGPYGICDSNASPVCKCMKGFQPKNIQAWNLRDGSSGCV  336

Query  1641  RYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGS  1820
             R  +L+C  D FL M   KLPES T++VD  MSL +C+ MC RNCSCTAY+N NISNGGS
Sbjct  337   RRTDLNCLKDKFLHMRNMKLPESETTYVDRNMSLKDCELMCSRNCSCTAYANSNISNGGS  396

Query  1821  GCVIWTAELFDIRQYTAEGGQLLYVRVAASD----------------AEQTGEVARGGNG  1952
             GCV WT ELFD+RQY  +GGQ LYVR+AASD                      +A  G  
Sbjct  397   GCVFWTGELFDMRQY-PKGGQDLYVRLAASDIGDGSSAGTIIIGIAVGIGILILALSGFS  455

Query  1953  FGKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAIS  2132
               K K+++  C                                  ++RS+D L+N   IS
Sbjct  456   IWKRKRLLSVC---------------------------------PQDRSQDFLLNGVVIS  482

Query  2133  SKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVK  2312
              K++++GE    DE ELP+ DF+ IA AT+NFA+ NKLG+GGFG V+KG LV G+E+AVK
Sbjct  483   -KKDYTGERS-PDELELPLLDFSTIATATNNFADENKLGEGGFGRVHKGRLVEGQEVAVK  540

Query  2313  RLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDK  2492
             RLSKNS QG EEFKNE+RLIAR+QHRNLV+LLGCCV+ DEK+LIYE+MEN+SLD +LF+K
Sbjct  541   RLSKNSVQGTEEFKNEVRLIARVQHRNLVRLLGCCVEKDEKILIYEFMENRSLDFVLFNK  600

Query  2493  KRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMAR  2672
              +SSLL+W+RR+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLD E  PKISDFGMAR
Sbjct  601   AKSSLLNWQRRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDHEWTPKISDFGMAR  660

Query  2673  LFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTP  2852
             +FGGD+ +A T  R+VGTYGYMSPEYAMDGLFS KSD FSFGVLVLE+V G KN+GFY  
Sbjct  661   MFGGDQIQANTV-RVVGTYGYMSPEYAMDGLFSAKSDVFSFGVLVLEIVCGEKNRGFYHS  719

Query  2853  SNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNM  3032
              +E NLLG  WR W +G+G E+LD+ + + S+S    +V+RCIQVGLLCVQEKAEDRP M
Sbjct  720   FSELNLLGHVWRQWKDGKGLEVLDTSVGN-SYSPC--EVLRCIQVGLLCVQEKAEDRPTM  776

Query  3033  AAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             ++ +LML  +  ++PQP+ PG+CL   P + DSSS+  ++  S+N +TVT+LDAR
Sbjct  777   SSAVLMLSSETATMPQPRTPGYCLGRSPFETDSSSSKQDESFSVNHVTVTVLDAR  831



>ref|XP_011008151.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Populus euphratica]
Length=839

 Score =   945 bits (2442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/835 (58%), Positives = 597/835 (71%), Gaps = 57/835 (7%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             QTL+S  + F+LGFF+PG NS   YVGIWYK I  RT VWVANRD PL NS+G  KI  +
Sbjct  45    QTLISTSQDFELGFFTPG-NSRNWYVGIWYKNI-PRTYVWVANRDNPLTNSSGTFKI-LN  101

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
              +I L D   N IWSS+ TN +    N V QLLDSGN V+R + +     +LWQSFDYPT
Sbjct  102   QSIVLFDRAENLIWSSNQTNAR----NPVMQLLDSGNLVLR-DQESGSGQFLWQSFDYPT  156

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DTLLP MK GWD  TG NR++ SW+S  DP  GD +FKLD +G PEAFL     I YRSG
Sbjct  157   DTLLPDMKFGWDLNTGVNRFLRSWKSSDDPGTGDFSFKLDYHGFPEAFLLKDQEIKYRSG  216

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG  FSGVPEMEP + ++F+F+  ++EVYYSF I NK+L+SRL V  + LL+R+ W+P
Sbjct  217   PWNGQRFSGVPEMEPVDYMSFNFITNQDEVYYSFHISNKSLYSRLGVTSSGLLQRFAWVP  276

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
             E + W++FW APKDQCD+YRECG +GICD++ SPVC C  GF+P+N QAW+LRDGS GC 
Sbjct  277   ETQQWSQFWYAPKDQCDDYRECGPYGICDSNASPVCKCMKGFQPKNIQAWNLRDGSSGCV  336

Query  1641  RYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGS  1820
             R   L+C  D F  M   KLPES T++V+   SL +C+ MC RNCSCTAY+N NISNGGS
Sbjct  337   RRTYLNCLKDKFWHMRNVKLPESVTTYVNRNTSLKDCELMCSRNCSCTAYANSNISNGGS  396

Query  1821  GCVIWTAELFDIRQYTAEGGQLLYVRVAASD----------------AEQTGEVARGGNG  1952
             GCV WT EL D+RQY + GGQ LYVR+AASD                      +A  G  
Sbjct  397   GCVFWTGELIDMRQYPS-GGQDLYVRLAASDIGDGRSADTIIIGIAVGIGILILALSGFS  455

Query  1953  FGKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAIS  2132
               K K+++  C                           N   +G ++RS+D L+N   IS
Sbjct  456   IWKRKRLLSVCNG-------------------------NTPQKGPQDRSQDFLLNGVVIS  490

Query  2133  SKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVK  2312
              K +++GE   TDE ELP+FDF+ IA AT+NFA+ NKLG+GGFG VYKG LV G+E+AVK
Sbjct  491   -KTDYTGERS-TDELELPLFDFSTIATATNNFADENKLGEGGFGRVYKGRLVEGQEVAVK  548

Query  2313  RLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDK  2492
             RLSKNS QG EEFKNE+RLIAR+QHRNLV+LLGCC + DEK+LIYE+MEN+SLD +LF+K
Sbjct  549   RLSKNSVQGTEEFKNEVRLIARVQHRNLVRLLGCCFEKDEKILIYEFMENRSLDFVLFNK  608

Query  2493  KRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMAR  2672
              +SSLL+W+RR+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLD E  PKISDFGMAR
Sbjct  609   AKSSLLNWQRRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDHEWTPKISDFGMAR  668

Query  2673  LFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTP  2852
             +F GD+ +A T  R+VGTYGYMSPEYAMDG FS KSD FSFGVLVLE+V G KN+GFY  
Sbjct  669   IFAGDQIQANTV-RVVGTYGYMSPEYAMDGRFSAKSDVFSFGVLVLEIVCGEKNRGFYHS  727

Query  2853  SNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNM  3032
              +E NLLG  WR W +G+G E+LD+ + + S+S    +V+RCIQVGLLCVQEKAEDRP M
Sbjct  728   FSELNLLGHVWRQWKDGKGLEVLDTSVGN-SYSPC--EVLRCIQVGLLCVQEKAEDRPTM  784

Query  3033  AAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             ++ +LML  +  ++PQP+ PG+CL   P + DSSS+  ++  S+NQ+TVT+LDAR
Sbjct  785   SSAVLMLSSETATMPQPRTPGYCLGRSPFETDSSSSKQDESFSVNQVTVTVLDAR  839



>ref|XP_004504969.1| PREDICTED: uncharacterized protein LOC101504189 [Cicer arietinum]
Length=1717

 Score =   941 bits (2431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/826 (57%), Positives = 610/826 (74%), Gaps = 14/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             L  N+TL+S   +FQL FFS   N+   Y+GI Y     +T+VWVANR+ P++N   FLK
Sbjct  902   LKTNETLLSPNGIFQLSFFS--FNNFTWYLGIRYTIDHKKTVVWVANRNTPIQNFNAFLK  959

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             + + G + ++D +  +IW+S+     +   N + QLLDSGN VV+  N+ +P  ++WQSF
Sbjct  960   LTDAGKLIIIDQSQKTIWASNQRTKNATFNNPILQLLDSGNLVVKESNENDPTKFIWQSF  1019

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWR-SPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             DYPTDTLLPGMKLGW+  T    +I+SW+ +  DPS GDI+FK+D +GLPE FL +K   
Sbjct  1020  DYPTDTLLPGMKLGWNFDTNTETFINSWKVTDQDPSFGDISFKMDYHGLPEIFLLDKGRR  1079

Query  1266  IYRSGGWNGVAFSGVPEMEP-KEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLE  1442
             IYRSG WNG  FSGVPEM+P  + I F+F+  ++EV+Y+F I N++LFSRL VN    L+
Sbjct  1080  IYRSGPWNGKRFSGVPEMQPVTDSIKFNFVENEHEVFYTFSIGNESLFSRLSVNSLGKLQ  1139

Query  1443  RYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRD  1622
             R TWI   ++W+ FW APKDQCDNYRECG +GICDT+ SPVC C  GF+P+N QAW+LRD
Sbjct  1140  RLTWIQSGQLWSTFWYAPKDQCDNYRECGPYGICDTNASPVCQCVKGFRPKNHQAWNLRD  1199

Query  1623  GSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             GS GC R +ELDC +D FL +   KLPE+S+ FV+ +MS+ EC E C RNCSCT Y+N  
Sbjct  1200  GSDGCVRNNELDCGSDRFLKLVNVKLPETSSVFVNRSMSVFECGEFCKRNCSCTGYANIE  1259

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             I +GGSGCV+W  EL DIR Y + GGQ L+VR++ASD E+  + AR  +     K + + 
Sbjct  1260  IVDGGSGCVMWLDELIDIRLYPS-GGQDLFVRLSASDVEE--DEARESSDHKTAKAIGIM  1316

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRG-TRERSRDPLMNATAISSKREHSGET  2159
              G    I +++    L +++KL+       E R  + ERS+D LM     +S RE SGE 
Sbjct  1317  VGGAAIIFLIIGICFLWRKKKLQCLFKMKSEKRAASLERSQDLLMTEGVFTSNREQSGEN  1376

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
              + D+ ELP FDFN I +AT+NF+  NKLGQGGFG VYKG L+ G+EIAVKRLSKNS QG
Sbjct  1377  NL-DDLELPFFDFNTITLATNNFSEENKLGQGGFGIVYKGRLIEGQEIAVKRLSKNSGQG  1435

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EFKNE++LI +LQHRNLV+LLGC + IDEKML+YEY+EN+SLD+ILF+K + +LLDW+
Sbjct  1436  VDEFKNEVKLIVKLQHRNLVRLLGCSIQIDEKMLVYEYLENRSLDAILFNKTKRALLDWQ  1495

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
             RR+ IICG+ARGLLYLHQDSRFRIIHRDLKASN+LLDKEMNPKISDFGMAR+FG D+TEA
Sbjct  1496  RRFKIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGTDQTEA  1555

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
              T  R+VGTYGYMSPEYAMDG+FSVKSD FSFGVLV+E++SG+KN+GFY+ + E NLLG 
Sbjct  1556  NTV-RVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVMEIISGKKNRGFYSANKELNLLGH  1614

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
              W LW EG+  EL+DS I   S+S+   +V+RCIQVGLLCVQE+AEDRP M++V+LML  
Sbjct  1615  GWNLWTEGKALELIDSSI-DNSYSQ--SEVLRCIQVGLLCVQERAEDRPTMSSVVLMLSS  1671

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             +  ++ QPK PGFCL S P++ DSSS+   +  ++NQ+TVTMLD R
Sbjct  1672  ETATITQPKNPGFCLGSNPIETDSSSSKQEESCTVNQVTVTMLDGR  1717


 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/805 (45%), Positives = 478/805 (59%), Gaps = 56/805 (7%)
 Frame = +3

Query  744   TLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGEDG  923
             TLVS G  F++GFFS   NS   YVGIWY  I     VWVANR+KP+RN  G + I  DG
Sbjct  49    TLVSEGLKFEMGFFS-FDNSSSRYVGIWYHNIPTSAYVWVANREKPIRNREGSITIKNDG  107

Query  924   NIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPTD  1103
             N+ ++D   + +WSS N + Q+   N+   L + GN V+   +D      +WQSF+ PTD
Sbjct  108   NLVVLDDNNSEVWSS-NISIQT--KNSSVVLRNDGNLVL---SDAEVGKEIWQSFEEPTD  161

Query  1104  TLLPGMKLGWDSKTG----RNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIY  1271
             T LPGMK+      G    +N    SW+S  DPS G+ T  +D +  P+  +   +   +
Sbjct  162   TYLPGMKVPASGGNGIEKNQNPTFWSWKSTKDPSFGNYTMSVDSDASPQIVVFEGEKRRW  221

Query  1272  RSGGWNGVAFSGVPEMEPKEVIAFSF-MRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             RSG W+G  F+GVP M    +  F      K   Y+ +E  N +   R  + +     + 
Sbjct  222   RSGYWDGRVFTGVPNMTGSYLFGFRLNTNDKGGRYFVYEALNNSDKIRFQIGWDGYERQL  281

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
              W  + + WN     P  +C+ Y  CG F +CD   S VC C  GF+P +  +W   + S
Sbjct  282   RWNEDEKEWNVLQTEPSKKCEFYNSCGGFAVCDVSHSQVCRCIQGFEPTDMNSWKNGNWS  341

Query  1629  GGCFRYDELDCPT-------DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTA  1787
              GC R   L   T       DGFL     KLP+ +   V+A +  +EC+  C++N SCTA
Sbjct  342   KGCKRMTPLKAETGSNSSGEDGFLVQRDLKLPDFA-HLVNA-VDTNECENNCLKNSSCTA  399

Query  1788  YSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTK  1967
             Y+N      G GC+IW  EL D+ Q     G  L +R+A SD          G+G  KTK
Sbjct  400   YANAI----GIGCMIWFGELADV-QSLENYGNALNIRLADSDL---------GDGKKKTK  445

Query  1968  K-VILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKRE  2144
               +ILA G+ L    +   L+   +RK +   T      G  +   +P+ +    +   E
Sbjct  446   IWIILAVGVGLICLGIFAWLIWRFKRKFKVSSTTCSNTNGDDQPISEPIRSKDLSA---E  502

Query  2145  HSGETMIT------DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIA  2306
              SG   ++         EL +F F++I +AT+NF+  NKLGQGGFG VYKG L  GE+IA
Sbjct  503   FSGSVDLSLVGNPLSGAELSLFSFSSIVIATNNFSEENKLGQGGFGPVYKGKLPEGEQIA  562

Query  2307  VKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILF  2486
             VKRLSK S QG+EEFKNE+ LIA+LQH NLV+LLGC +  +EK+L+YEYM NKSLD  LF
Sbjct  563   VKRLSKQSSQGSEEFKNEMMLIAKLQHVNLVRLLGCSIQGEEKLLVYEYMPNKSLDFFLF  622

Query  2487  DKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGM  2666
             D  + + LDW RR+ II G+ARGLLYLH+DSR RIIHRDLKASN+LLD+ MNPKISDFG+
Sbjct  623   DPVKQTKLDWTRRFEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDENMNPKISDFGL  682

Query  2667  ARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGF-  2843
             AR+FGG++ EA T  R+VGTYGYMSPEYAM+GLFS+KSD +SFGVL+LE+VSGRKN  F 
Sbjct  683   ARIFGGNQNEANTA-RVVGTYGYMSPEYAMEGLFSIKSDVYSFGVLLLEIVSGRKNTSFR  741

Query  2844  --YTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAE  3017
               Y PS    L+G AWRLW E R  EL+D +I   S      + MRCI +G+LCVQ+ A 
Sbjct  742   HSYDPS----LIGYAWRLWSEERVMELVDPLIRDSSPKS---KAMRCIHIGMLCVQDSAT  794

Query  3018  DRPNMAAVMLMLIGKGTSLPQPKQP  3092
              RPNM++V+LML  + T+LP P QP
Sbjct  795   HRPNMSSVLLMLESESTTLPLPSQP  819


 Score = 58.2 bits (139),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGC I+G EK+L+      KSLD F+FDP K+ +L+W +
Sbjct  588  QHVNLVRLLGCSIQGEEKLLVYEYMPNKSLDFFLFDPVKQTKLDWTR  634



>ref|XP_004485681.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Cicer arietinum]
Length=851

 Score =   936 bits (2420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/832 (57%), Positives = 606/832 (73%), Gaps = 24/832 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNST-GFL  905
             L  NQTL S    F LGF  PG NS  +Y+ IWYK I+DR +VWVANRD PL NST GFL
Sbjct  34    LRTNQTLESTKGTFVLGFI-PGTNSN-IYLAIWYKNIQDRVVVWVANRDNPLHNSTNGFL  91

Query  906   KIGEDGNIHLV---DGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRREN-DENPENY  1073
             KIG++GNI L+   D   N +WSS    NQ+   N + QLL++GN V+R  N +ENP N+
Sbjct  92    KIGDNGNIVLLNSSDSDNNLVWSS----NQTTAKNPILQLLENGNLVLRETNVNENPTNF  147

Query  1074  LWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWR-SPTDPSEGDITFKLDINGLPEAFLR  1250
             LWQSFDYPTDTLLP M +GW+  T   ++++SW+ +  DPS GD +FK+D +GLPE FLR
Sbjct  148   LWQSFDYPTDTLLPDMNMGWNFDTKMEKHLTSWKITGEDPSTGDYSFKIDFHGLPEIFLR  207

Query  1251  NKDIIIYRSGGWNGVAFSGVPEMEP-KEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNY  1427
             N + IIYRSG WNG  FSGVPEM+P  + I F+F   ++ V YSF I N+++FSRL+VN 
Sbjct  208   NGENIIYRSGPWNGERFSGVPEMQPDTDSIVFNFSTNEHGVNYSFSIGNRSIFSRLVVNS  267

Query  1428  TQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQA  1607
                L+R TW+  ++ W +FW APKDQCD+Y+ECG +G+CD++ SPVC C  GF P+N+QA
Sbjct  268   IGELQRLTWVESSKTWTKFWYAPKDQCDDYKECGPYGVCDSNASPVCECVKGFSPKNEQA  327

Query  1608  WSLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTA  1787
             W LRDGS GC R   LDC +D F  M   KLPE+S+ FV+ TMS+ EC ++C RNCSCT 
Sbjct  328   WKLRDGSEGCVRKTNLDCESDKFFRMENVKLPETSSVFVNKTMSIVECGDLCHRNCSCTG  387

Query  1788  YSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTK  1967
             Y+N  ++NGGSGCV+W  +L DIR Y ++GGQ LYVR+AAS+ + +G  +       + +
Sbjct  388   YANVYVTNGGSGCVMWIGQLVDIRTY-SDGGQDLYVRLAASEIDNSGSASDSHKTNHRAE  446

Query  1968  KVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREH  2147
               I+   I   + ++   ++L  +RKL   +    + RG+ +RSRD LMN    SS R  
Sbjct  447   --IVGITISAVVIILGLAIILCNKRKLLSRLNGKTDQRGSLQRSRDLLMNEMVFSSNRGS  504

Query  2148  SGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKN  2327
             SGE  + D+ ELP+FDFN I +AT+NF  ANKLGQGGFGSVYKG L+ G+ IAVKRLS+ 
Sbjct  505   SGERDM-DDLELPMFDFNTITIATNNFYEANKLGQGGFGSVYKGRLIEGQVIAVKRLSQT  563

Query  2328  SRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSL  2507
             S QG EEFKNE++LI +LQHRNLV+LLGCC++ DEK+L+YEYMEN+SLDSILFDK R  L
Sbjct  564   SGQGVEEFKNEVKLIVKLQHRNLVRLLGCCIEKDEKLLVYEYMENRSLDSILFDKTRKPL  623

Query  2508  LDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGD  2687
             LDW RR+NIICG+ARGLLYLH DSR RIIHRDLKASN+LLD EMNPKISDFGMAR+FG D
Sbjct  624   LDWTRRFNIICGIARGLLYLHHDSRLRIIHRDLKASNILLDSEMNPKISDFGMARIFGKD  683

Query  2688  ETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEEN  2867
             +TEA T  R+VGTYGYMSPEYAMDG FSVKSD FSFGVLVLE+++G KN+GFY  +++ N
Sbjct  684   QTEANTL-RVVGTYGYMSPEYAMDGNFSVKSDVFSFGVLVLEIITGNKNRGFYYANDDMN  742

Query  2868  LLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVML  3047
             LL  AW  W EG   EL+DS I   S S    +V+RCI VGLLCVQE+AEDRP M +V+L
Sbjct  743   LLKNAWSQWREGNALELIDSSI---SDSYTPSEVLRCIHVGLLCVQERAEDRPTMPSVLL  799

Query  3048  MLIGKGTSLPQPKQPGFCL--ASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             ML  +   +P+P+ PGF L  +  P + DSSS+ +++  S+NQ+TVT+L+AR
Sbjct  800   MLSSETALMPEPRSPGFSLGKSKNPQETDSSSSKHDETWSVNQVTVTLLNAR  851


 Score = 57.8 bits (138),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCCIE  EK+L+      +SLD+ +FD T++  L+W +
Sbjct  582  QHRNLVRLLGCCIEKDEKLLVYEYMENRSLDSILFDKTRKPLLDWTR  628



>ref|XP_007148275.1| hypothetical protein PHAVU_006G194600g [Phaseolus vulgaris]
 gb|ESW20269.1| hypothetical protein PHAVU_006G194600g [Phaseolus vulgaris]
Length=841

 Score =   935 bits (2417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/824 (56%), Positives = 597/824 (72%), Gaps = 21/824 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             NQTLVS  +VF LGFFS   +S   Y+GIWY  I +  +VWVANRD PL NSTGFL IGE
Sbjct  34    NQTLVSPTQVFALGFFSRTNSS--WYLGIWYHNISNGPVVWVANRDNPLHNSTGFLTIGE  91

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             + N+ L   +G  +WSS    N +   N + QLLD+GN V+R  N  +P NYLWQSFDYP
Sbjct  92    NKNMILTTPSGEPVWSS----NVTKANNPILQLLDTGNLVLREANVTDPANYLWQSFDYP  147

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWR-SPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             TDTLLPGMK+GW+  TG  ++++SW+    DPS GD +FK+D  G+PE FL N++  IYR
Sbjct  148   TDTLLPGMKMGWNLDTGVEKHLTSWKVEGKDPSSGDYSFKIDPRGIPEIFLMNENDRIYR  207

Query  1275  SGGWNGVAFSGVPEMEP-KEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYT  1451
             SG WNG  FSGVPEM+P  + I F F    + V+YSF I N+++ SRLIV    +L+R T
Sbjct  208   SGPWNGERFSGVPEMQPDTDSIMFDFSYDNHGVHYSFSIGNRSILSRLIVTSGGVLKRRT  267

Query  1452  WIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
             W+P +  W  FW APKDQCDN++ CGS G+CD++ SPVC C  GF P+NQQAWSLRDGS 
Sbjct  268   WVPSSNTWTTFWYAPKDQCDNFKACGSNGLCDSNASPVCTCMRGFSPKNQQAWSLRDGSE  327

Query  1632  GCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             GC R   LDC TD FL +   KLPE+S+ F + +M+L+ECK++C RNCSCTAY+N  ++N
Sbjct  328   GCVRNTNLDCGTDKFLHLEDVKLPETSSVFANRSMNLEECKDLCRRNCSCTAYANIEVTN  387

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEV--ARGGNGFGKTKKVILAC  1985
             GG+GCV W+AEL D+R+Y + GGQ L+VR+AASDA+ TG    +   N  G+   +  + 
Sbjct  388   GGTGCVTWSAELIDMRKYPS-GGQDLFVRLAASDADDTGSAGGSHKTNHIGEIAGITASA  446

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              +V+   +++F              T     RG+ +RSR+ L +    S+ RE+SGE  +
Sbjct  447   AVVIVGLVMIFWKKRKVLSISNLKTTP----RGSFQRSRELLTSDGVFSTNRENSGERNM  502

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
              D+ ELP+FDFN + MAT+NF+  NKLGQGGFG VY+G L+ G +IAVKRLSKNS QG E
Sbjct  503   -DDIELPMFDFNTLTMATNNFSEENKLGQGGFGIVYRGRLMEGRDIAVKRLSKNSVQGVE  561

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LI RLQHRNLV+L GCCV++DEK+L+YE+MEN+SL SILFDK +  +LDW RR
Sbjct  562   EFKNEVKLIVRLQHRNLVRLFGCCVEMDEKLLVYEHMENRSLYSILFDKAKKHMLDWNRR  621

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++IICG+ARG+LYLH DSR RIIHRDLKASN+LLD EMNPKISDFGMARLFG ++TE G 
Sbjct  622   FSIICGIARGILYLHHDSRLRIIHRDLKASNILLDSEMNPKISDFGMARLFGANQTE-GN  680

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T R+VGTYGYMSPEYAMDG FSVKSD FSFGVL LE+++G+KN+GFY  +++ NLLG AW
Sbjct  681   TLRVVGTYGYMSPEYAMDGTFSVKSDVFSFGVLALEIITGKKNRGFYYSNDDMNLLGNAW  740

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W +G   EL+DS +    +S    +V+RCI VGLLCVQE+AEDRP M++VMLML  + 
Sbjct  741   RQWRDGSALELVDSSLG---NSYSPAEVLRCIHVGLLCVQERAEDRPTMSSVMLMLSSES  797

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
               +PQP+ PGF +   P + DS S+  ++  S+NQ+TVT+LDAR
Sbjct  798   ALMPQPRNPGFSVGKNPAETDSCSSKQDESWSVNQVTVTLLDAR  841



>ref|XP_006598304.1| PREDICTED: uncharacterized protein LOC100797331 [Glycine max]
Length=1803

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/828 (57%), Positives = 598/828 (72%), Gaps = 23/828 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRD-RTIVWVANRDKPLRNSTGFL  905
             L  NQTLVS   +F LGFF PG NS   Y+G WY  I D +T+VWVANRD PL NS+GFL
Sbjct  993   LLTNQTLVSPSHIFALGFF-PGTNST-WYLGAWYNNITDDKTVVWVANRDNPLENSSGFL  1050

Query  906   KIGEDGNIHLVDGTG-NSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQ  1082
              IGE+GNI L + +  N +WSS  T       N V QLLD+GN ++R  N  +P  YLWQ
Sbjct  1051  TIGENGNIVLRNPSKKNPVWSSDATK----ANNPVLQLLDTGNLILREANITDPTKYLWQ  1106

Query  1083  SFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSP-TDPSEGDITFKLDINGLPEAFLRNKD  1259
             SFDYPTDTLLPGMK+GW+  TG  ++++SW++  +DPS GD +FK+D  G+PE FL +  
Sbjct  1107  SFDYPTDTLLPGMKMGWNLDTGAEKHLTSWKNTGSDPSSGDYSFKIDTRGIPEIFLSDDQ  1166

Query  1260  IIIYRSGGWNGVAFSGVPEMEP-KEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQL  1436
              I YRSG WNG  FSGVPEM+P  + I F F   K+ VYYSF I N+++ SRL+V     
Sbjct  1167  NIAYRSGPWNGERFSGVPEMQPDTDSITFDFSYDKHGVYYSFSIGNRSILSRLVVTSGGE  1226

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
             L+R TW+P ++ W  FW APKDQCD YR CG +G+CD++ SPVC C  GF+PRNQQAW+L
Sbjct  1227  LKRLTWVPSSKTWTTFWYAPKDQCDGYRACGPYGLCDSNASPVCTCVGGFRPRNQQAWNL  1286

Query  1617  RDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSN  1796
             RDGS GC R  +LDC +D FL +   KLPE++  F + +M+L EC+++C+R+CSCTAY+N
Sbjct  1287  RDGSDGCERNTDLDCGSDKFLHVKNVKLPETTYVFANGSMNLRECQDLCLRDCSCTAYAN  1346

Query  1797  YNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVI  1976
               I+NGGSGCV W+ EL D+R Y A GGQ LYVR+AASD +     +   N  G+   + 
Sbjct  1347  IQITNGGSGCVTWSGELEDMRLYPA-GGQHLYVRLAASDVDDIVGGSHKKNHTGEVVGIT  1405

Query  1977  LACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGE  2156
             ++  +++   +V+F                    RG+  RSRD L +    S+ RE+SGE
Sbjct  1406  ISAAVIILGLVVIFWKKRKLFSISNVKTAP----RGSFRRSRDLLTSERMFSTNRENSGE  1461

Query  2157  TMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQ  2336
               + D+ ELP+FDFN I MATDNF+ ANKLGQGGFG VY+G L+ G++IAVKRLSKNS Q
Sbjct  1462  RNM-DDIELPMFDFNTITMATDNFSEANKLGQGGFGIVYRGRLMEGQDIAVKRLSKNSVQ  1520

Query  2337  GAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
             G EEFKNE++LI RLQHRNLV+L GCC+++DEK+L+YEYMEN+SLDSILFDK +  +LDW
Sbjct  1521  GVEEFKNEVKLIVRLQHRNLVRLFGCCIEMDEKLLVYEYMENRSLDSILFDKAKKPILDW  1580

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
             KRR+NIICG+ARGLLYLH DSRFRIIHRDLKASN+LLD EMNPKISDFGMARLFG ++TE
Sbjct  1581  KRRFNIICGIARGLLYLHHDSRFRIIHRDLKASNILLDSEMNPKISDFGMARLFGTNQTE  1640

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             A T  R+VGTYGYMSPEYAMDG FSVKSD FSFGVLVLE+++G+KN+GFY  + + NLLG
Sbjct  1641  ANTL-RVVGTYGYMSPEYAMDGNFSVKSDVFSFGVLVLEIITGKKNRGFYYSNEDMNLLG  1699

Query  2877  LAWRLWGEGRGSELLDSVIA-SESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLML  3053
              AWR W +G   EL+DS I  S S SE    V+RCI VGLLCVQE+AEDRP M++V+LML
Sbjct  1700  NAWRQWRDGSTLELIDSSIGDSCSQSE----VLRCIHVGLLCVQERAEDRPTMSSVLLML  1755

Query  3054  IGKGTSLPQPKQPGFCLASKPVKM-DSSSTSYNDQSLNQLTVTMLDAR  3194
               +   +PQP+ PGF +   PV+   SSS      S+NQ+TVT+LDAR
Sbjct  1756  SSESAIMPQPRNPGFSIGKNPVETDSSSSKKDQSWSVNQVTVTLLDAR  1803


 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/852 (41%), Positives = 492/852 (58%), Gaps = 73/852 (9%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             ++TLVS    F +GFFS   NS   YVGIWY  I    ++WVANRDKP+  + G + I  
Sbjct  45    HETLVSEELNFAMGFFS-SDNSSSRYVGIWYDNIPGPEVIWVANRDKPINGTGGAITISN  103

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             DGN+ ++DG  N +WSS+ +N  S   N+ A L D GN V+  E     +  +WQSF+ P
Sbjct  104   DGNLVVLDGAMNHVWSSNVSNINSNNKNSSASLHDDGNLVLTCE-----KKVVWQSFENP  158

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
             TDT +PGMK+     +  + + +SW+S TDPS+G+ T  +D  GLP+  +   +   +RS
Sbjct  159   TDTYMPGMKVPVGGLSTSHVF-TSWKSATDPSKGNYTMGVDPEGLPQIVVWEGEKRRWRS  217

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFM-RTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             G W+G  F G+  +    +  F+     K   Y+ +   N     R  + +      + W
Sbjct  218   GYWDGRMFQGL-SIAASYLYGFTLNGDGKGGRYFIYNPLNGTDKVRFQIGWDGYEREFRW  276

Query  1455  IPENRIWNRFWNAPKDQCDNYRECGSFGICD-------TDMSPVCGCPVGFKPRNQQAWS  1613
               + + W+     P  +CD Y +CGSF  CD       +D+ PVC C  GF+P+++  W 
Sbjct  277   NEDEKSWSEIQKGPFHECDVYNKCGSFAACDLLTLSPSSDLVPVCTCIRGFEPKHRDQWE  336

Query  1614  LRDGSGGCFRYDELDCP--------------TDGFLSMNYTKLPESSTSFVDATMSLDEC  1751
               + SGGC R   L                  DGFL     KLP+ +       +  ++C
Sbjct  337   KGNWSGGCTRMTPLKAQRINVTSSGTQVSVGEDGFLDRRSMKLPDFAR-----VVGTNDC  391

Query  1752  KEMCVRNCSCTAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGE  1931
             +  C+ N SCTAY+N      G GC++W  +L DI Q+   GG  L++R+A SD +    
Sbjct  392   ERECLSNGSCTAYANV-----GLGCMVWHGDLVDI-QHLESGGNTLHIRLAHSDLDDVK-  444

Query  1932  VARGGNGFGKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPL  2111
                      K + VI++      I + +F  L+ + +   + +     +   +     P+
Sbjct  445   ---------KNRIVIISTTGAGLICLGIFVWLVWRFKGKLKVLPTVSSVSCCKSSDALPV  495

Query  2112  MNAT-AISSKREHSGETMITDE------YELPIFDFNAIAMATDNFANANKLGQGGFGSV  2270
              +A  +     E SG   ++ E       E P+F+F+ I++AT+NF+  NKLGQGGFG V
Sbjct  496   FDANKSREMSAEFSGSADLSLEGNQLSGPEFPVFNFSCISIATNNFSEENKLGQGGFGPV  555

Query  2271  YKGMLVGGEEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYE  2450
             YKG L GGE+IAVKRLS+ S QG EEFKNE+ LIA+LQHRNLV+L+GC +  +EK+L YE
Sbjct  556   YKGKLPGGEQIAVKRLSRRSGQGLEEFKNEMMLIAKLQHRNLVRLMGCSIQGEEKLLAYE  615

Query  2451  YMENKSLDSILFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLD  2630
             YM NKSLD  LFD  +   L W+RR  II G+ARGLLYLH+DSR RIIHRDLKASN+LLD
Sbjct  616   YMPNKSLDCFLFDPVKQKQLAWRRRVEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLD  675

Query  2631  KEMNPKISDFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVL  2810
             + MNPKISDFG+AR+FGG++ EA  T R+VGTYGYM+PEYAM+GLFSVKSD +SFGVL+L
Sbjct  676   ENMNPKISDFGLARIFGGNQNEA-NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLL  734

Query  2811  EVVSGRKNQGFYTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVG  2990
             E++SGR+N  F   S++ +L+G AW LW E +  ELLD  I   S     ++ +RCI +G
Sbjct  735   EILSGRRNTSF-RHSDDSSLIGYAWHLWNEHKAMELLDPCIRDSSPR---NKALRCIHIG  790

Query  2991  LLCVQEKAEDRPNMAAVMLMLIGKGTSLPQPKQPGFC----LASKPVKMDSSSTSYNDQS  3158
             +LCVQ+ A  RPNM+AV+L L  + T+LP P QP          +   MD    S     
Sbjct  791   MLCVQDSAAHRPNMSAVVLWLESEATTLPIPTQPLITSMRRTEDREFYMDGLDVS-----  845

Query  3159  LNQLTVTMLDAR  3194
              N LTVTM+  R
Sbjct  846   -NDLTVTMVVGR  856


 Score = 57.4 bits (137),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRL+GC I+G EK+L       KSLD F+FDP K+ +L W
Sbjct  593  QHRNLVRLMGCSIQGEEKLLAYEYMPNKSLDCFLFDPVKQKQLAW  637



>ref|XP_010054468.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like serine/threonine-protein 
kinase SD1-8 [Eucalyptus grandis]
Length=846

 Score =   932 bits (2410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/826 (57%), Positives = 609/826 (74%), Gaps = 25/826 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNST-GFLKIG  914
             +QTL SA +VFQLGFF+   ++   YVGIWYK I DRT VWVANRD P+ NS+    KIG
Sbjct  39    DQTLASANDVFQLGFFTL--DNAHYYVGIWYKNIPDRTYVWVANRDTPVTNSSSAVFKIG  96

Query  915   EDGN-IHLVDGTGNSI-WSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             + GN + ++D    +I WSS+ T   S P N VA+LLD+GN V+R   DE+  NYLWQSF
Sbjct  97    DKGNNVVILDQANKTILWSSNQTRANSSPVNPVARLLDNGNLVIREAGDESNSNYLWQSF  156

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD   G NR+++SW++P DPS GD +FK+D +G PE FL +K   +
Sbjct  157   DFPTDTLLPEMKLGWDLTRGLNRFLNSWKTPQDPSSGDFSFKIDYHGYPEIFLWDKSTKL  216

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHN-KNLFSRLIVNYTQLLER  1445
             YRSG WNG+ FSGVPEM+    I F+F+  + +VYYSFE++  ++      +N T  L+R
Sbjct  217   YRSGPWNGIRFSGVPEMQSSSAIDFTFVSNQQQVYYSFELNTPEHNLEAXPLNSTGTLQR  276

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             +TW+ +++ W+ FW APKDQCD++ ECG +GICDT+ SPVC C  GF P+N QAW+ RDG
Sbjct  277   FTWVEDSKSWSMFWEAPKDQCDHFSECGPYGICDTNASPVCNCTPGFSPKNLQAWNFRDG  336

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
             S GC R  +L+C +DGFL     KLPESS + VD  MS+D+C++ C +NCSCT YS+ NI
Sbjct  337   SAGCVRRTDLNCSSDGFLLFKGMKLPESSNTIVDMEMSVDDCQKGCAKNCSCTGYSSANI  396

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
             SNG +GCV+W  +L DIR Y   GGQ  YV+++ASD         G NG G    V +A 
Sbjct  397   SNGKAGCVMWFGDLLDIRHYVG-GGQDFYVKLSASDI--------GDNGLGTLAIVGIAA  447

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSR--DPLMNATAISSKREHSGET  2159
             G  + +      L+  ++  L   +  N E +G RERS+  D L+N    SSKR+++GE 
Sbjct  448   GGSVLLLAFTAFLMWKRKTSLNSHI-RNTEQQGARERSQGQDFLLNEVVSSSKRDYTGEN  506

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
                +  ELP+F FNAIA+AT NF++ NKLGQGGFGSVY+  +  G  +AVKRLSKNS QG
Sbjct  507   K-PEVLELPLFAFNAIALATKNFSDENKLGQGGFGSVYQCRIEEGPVVAVKRLSKNSGQG  565

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              EEFKNE++LIARLQHRNLV+L+GCCV++DEK+LIYEYME+KSLDS+LF K +SS+L+W+
Sbjct  566   VEEFKNEVQLIARLQHRNLVRLIGCCVEMDEKILIYEYMEHKSLDSVLFSKTKSSMLNWE  625

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
             RR+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLD E+NPKISDFGMAR+FG D+ EA
Sbjct  626   RRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDGELNPKISDFGMARIFGRDQVEA  685

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               TKR+VGTYGYM+PEYAMDGLFS KSD FSFGVLVLE++SG+KN+GFY P++E NLL  
Sbjct  686   -NTKRVVGTYGYMAPEYAMDGLFSEKSDVFSFGVLVLEIISGKKNRGFYYPNDERNLLEH  744

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             +W+ W EG+G ELLDS +  +++S  +++V+RCIQVGLLCVQE+A DRP M +V+LML  
Sbjct  745   SWKFWKEGKGLELLDSAVG-DAYS--MNEVLRCIQVGLLCVQERANDRPVMLSVVLMLSS  801

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             +  ++P PK PGF L  + ++ DSSS+ ++   ++NQ+TVTM DAR
Sbjct  802   ENPTMPHPKIPGFRLG-RAIETDSSSSKHDGTCTVNQVTVTMPDAR  846


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRL+GCC+E  EK+LI      KSLD+ +F  TK + LNW
Sbjct  580  QHRNLVRLIGCCVEMDEKILIYEYMEHKSLDSVLFSKTKSSMLNW  624



>gb|AID21690.1| ARK3p [Arabidopsis lyrata]
Length=852

 Score =   932 bits (2410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/826 (56%), Positives = 592/826 (72%), Gaps = 19/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG NS   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  42    ISSNNTIVSPGNVFELGFFKPGSNSR-WYLGIWYKTISKRTYVWVANRDTPLSSSIGTLK  100

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I ++ N+ ++D +   +WS+ N     V    VA+LLD+GNFV+R   + +P+  LWQSF
Sbjct  101   ISDNNNLVVLDQSDTPVWST-NLTGGDVRSPLVAELLDNGNFVLRDSKNNSPDGVLWQSF  159

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR+I SW+SP DPS GD  FKL+  G PE FL N++  +
Sbjct  160   DFPTDTLLPEMKLGWDLKTGFNRFIRSWKSPDDPSSGDFWFKLEAEGFPEVFLWNRESRV  219

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  ++ EV YSF +   +++SRL ++ T LL+R+
Sbjct  220   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSREEVTYSFRVTKSDIYSRLSLSSTGLLQRF  279

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y+ECG +G CD++ SPVC C  GFKP+N Q W LRDGS
Sbjct  280   TWIETAQNWNQFWYAPKDQCDDYKECGVYGYCDSNTSPVCNCIKGFKPKNPQVWGLRDGS  339

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+++C+CTA++N +I
Sbjct  340   DGCVRKTVLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLKDCNCTAFANTDI  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV WT ELFDIR Y A+GGQ LY+R+AA+D E   +  R     G +  V +  
Sbjct  400   RGGGSGCVTWTGELFDIRNY-AKGGQDLYIRLAATDLED--KRNRSAKIIGSSIGVSVLI  456

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              +   I  +               V +         RSRD LMN   ISS+R  S E   
Sbjct  457   LLSFIIFFLWKKKQKRSILIETATVDQ--------VRSRDLLMNEVVISSRRHISRENN-  507

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F  +AMATDNF+  NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG +
Sbjct  508   TDDLELPLMEFEEVAMATDNFSTVNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGTD  567

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN SLDS LFDK RSS L+W+ R
Sbjct  568   EFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNWQMR  627

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M PKISDFGMAR+FG DETEA +
Sbjct  628   FDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKYMTPKISDFGMARIFGRDETEA-S  686

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY    + NLLG  W
Sbjct  687   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGCVW  746

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE+AEDRP M+ V+LML  + 
Sbjct  747   RNWKEGKGLEIIDPIITESSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVVLMLGSES  806

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             T++PQPK PG+CL   P+  DSSS+   D    ++NQ+TV++LDAR
Sbjct  807   TTIPQPKSPGYCLGRSPLDTDSSSSKQRDDESWTVNQITVSVLDAR  852


 Score = 54.7 bits (130),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLL CC++ GEKMLI       SLD+ +FD ++ ++LNW
Sbjct  580  QHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNW  624



>gb|AID21647.1| ARK3p [Arabidopsis lyrata]
Length=851

 Score =   929 bits (2402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/826 (55%), Positives = 592/826 (72%), Gaps = 19/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG NS   Y+GIWYK+I  RT VWVANRD PL +S G LK
Sbjct  41    ISSNNTIVSPGNVFELGFFKPGSNSR-WYLGIWYKKISKRTYVWVANRDTPLSSSIGTLK  99

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I ++ N+ ++D +   +WS+ N     V    V +LLD+GNFV+R   + +P+  LWQSF
Sbjct  100   ISDNNNLVVLDQSDTPVWST-NLTGGDVRSPLVVELLDNGNFVLRDSKNNSPDGVLWQSF  158

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR+I SW+SP DPS GD  FKL+  G PE FL N++  +
Sbjct  159   DFPTDTLLPEMKLGWDLKTGFNRFIRSWKSPDDPSSGDFWFKLEAEGFPEVFLWNRESRV  218

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  ++ EV YSF +   +++SRL ++ T LL+R+
Sbjct  219   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSREEVTYSFRVTKSDIYSRLSLSSTGLLQRF  278

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y+ECG +G CD++ SPVC C  GFKP+N Q W LRDGS
Sbjct  279   TWIETAQNWNQFWYAPKDQCDDYKECGVYGYCDSNTSPVCNCIKGFKPKNPQVWGLRDGS  338

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+++C+CTA++N +I
Sbjct  339   DGCVRKTVLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLKDCNCTAFANTDI  398

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV WT ELFDIR Y A+GGQ LY+R+AA+D E   +  R     G +  V +  
Sbjct  399   RGGGSGCVTWTGELFDIRNY-AKGGQDLYIRLAATDLED--KRNRSAKIIGSSIGVSVLI  455

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              +   I  +               V +         RSRD LMN   ISS+R H      
Sbjct  456   LLSFIIFFLWKKKQKRSILIETATVDQ--------VRSRDLLMNEVVISSRR-HIARENN  506

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F  +AMAT+NF+ ANKLGQGGFG VYKG L+ G+E+AVKRLSK S QG +
Sbjct  507   TDDLELPLMEFEEVAMATNNFSKANKLGQGGFGIVYKGKLLDGQEMAVKRLSKTSVQGTD  566

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN SLDS LFDK RSS L+W+ R
Sbjct  567   EFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNWQMR  626

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMAR+FG DETEA +
Sbjct  627   FDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEA-S  685

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY    + NLLG  W
Sbjct  686   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGCVW  745

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE+AEDRP M+ V+LML  + 
Sbjct  746   RNWKEGKGLEIIDPIITESSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVVLMLGSES  805

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             T++PQPK PG+CL   P+  DSSS+   D    ++NQ+TV++LDAR
Sbjct  806   TTIPQPKSPGYCLGRSPLDTDSSSSKQRDDESWTVNQITVSVLDAR  851


 Score = 54.7 bits (130),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLL CC++ GEKMLI       SLD+ +FD ++ ++LNW
Sbjct  579  QHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNW  623



>emb|CCI61483.1| ARK3 [Arabidopsis halleri]
 gb|AID21598.1| ARK3p [Arabidopsis halleri]
Length=851

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/826 (56%), Positives = 589/826 (71%), Gaps = 20/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG  S   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  42    ISSNNTIVSPGNVFELGFFKPGLKSR-WYLGIWYKTISKRTYVWVANRDTPLSSSIGTLK  100

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ ++D +   +WS+ N          VA+LLD+GNFV+R   + NP+  LWQSF
Sbjct  101   I-SDHNLVVLDQSDTPVWST-NLTGGDARSPLVAELLDNGNFVLRDSKNNNPDGVLWQSF  158

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR+I SW+SP DPS GD  FKL+  G PE FL N++  +
Sbjct  159   DFPTDTLLPEMKLGWDLKTGFNRFIRSWKSPDDPSSGDFWFKLETEGFPEVFLWNRESRV  218

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  +K EV YSF +   +++SRL ++ T LL+R+
Sbjct  219   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSKEEVTYSFRVTKSDIYSRLSLSSTGLLQRF  278

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y+ECG +G CD++ SPVC C  GFKP+N Q W LRDGS
Sbjct  279   TWIETAQNWNQFWYAPKDQCDDYKECGIYGYCDSNTSPVCNCIKGFKPKNPQVWGLRDGS  338

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+++C+CTA++N +I
Sbjct  339   DGCVRKTVLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLKDCNCTAFANTDI  398

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV WT ELFDIR Y A+GGQ LYVR+AA+D E   +  R     G +  V +  
Sbjct  399   RGGGSGCVTWTGELFDIRNY-AKGGQDLYVRLAATDLED--KRNRSAKIIGSSIGVSVLI  455

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              +   I  +               V +         RSRD LMN   ISS+R  S E   
Sbjct  456   LLSFIIFFLWKKKQKRSILIETATVDQ--------VRSRDLLMNEVVISSRRHISRENN-  506

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F  +AMATDNF+  NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG +
Sbjct  507   TDDLELPLMEFEEVAMATDNFSTVNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGTD  566

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN SLDS LFDK RSS L+W+ R
Sbjct  567   EFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNWQMR  626

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M PKISDFGMAR+FG DETEA +
Sbjct  627   FDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKYMTPKISDFGMARIFGRDETEA-S  685

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY    + NLLG  W
Sbjct  686   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGCVW  745

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE+AEDRP M+ V+LML  + 
Sbjct  746   RNWKEGKGLEIIDPIITESSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVVLMLGSES  805

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             T++PQPK PG+CL   P+  DSSS+   D    ++NQ+TV++LDAR
Sbjct  806   TTIPQPKSPGYCLGRSPLDTDSSSSKQRDDESWTVNQITVSVLDAR  851


 Score = 54.7 bits (130),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLL CC++ GEKMLI       SLD+ +FD ++ ++LNW
Sbjct  579  QHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNW  623



>gb|ADQ37352.1| unknown [Arabidopsis lyrata]
Length=852

 Score =   927 bits (2397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/826 (56%), Positives = 592/826 (72%), Gaps = 19/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG NS   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  42    ISSNNTIVSPGNVFELGFFKPGSNSR-WYLGIWYKTISKRTYVWVANRDTPLSSSIGTLK  100

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I ++ N+ ++D +   +WS+ N     V    VA+LLD+GNFV+R   + +P+  LWQSF
Sbjct  101   ISDNNNLVVLDQSDTPVWST-NLTGGDVRSPLVAELLDNGNFVLRDSKNNSPDGVLWQSF  159

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR+I SW+SP DPS GD  FKL+  G PE FL N++  +
Sbjct  160   DFPTDTLLPEMKLGWDLKTGFNRFIRSWKSPDDPSSGDFWFKLEAEGFPEVFLWNRESRV  219

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  ++ EV YSF +   +++SRL ++   LL+R+
Sbjct  220   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSREEVTYSFRVTKSDIYSRLSLSSRGLLQRF  279

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y+ECG +G CD++ SPVC C  GFKP+N Q W LRDGS
Sbjct  280   TWIETAQNWNQFWYAPKDQCDDYKECGVYGYCDSNTSPVCNCIKGFKPKNPQVWGLRDGS  339

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+++C+CTA++N +I
Sbjct  340   DGCVRKTVLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLKDCNCTAFANTDI  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV WT ELFDIR Y A+GGQ LYVR+AA+D E   +  R     G +  V +  
Sbjct  400   RGGGSGCVTWTGELFDIRNY-AKGGQDLYVRLAATDLED--KRNRSAKITGSSIGVTVLL  456

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              + L I ++               V +         RSRD LMN   ISS+R H      
Sbjct  457   LLSLLIFLLWRRKQKRSILIETPIVDQ--------VRSRDLLMNEVVISSRR-HIYRENN  507

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F  +AMATDNF+  NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG +
Sbjct  508   TDDLELPLMEFEEVAMATDNFSTVNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGTD  567

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN SLDS LFDK RSS L+W+ R
Sbjct  568   EFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNWQMR  627

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M PKISDFGMAR+FG DETEA +
Sbjct  628   FDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKYMTPKISDFGMARIFGRDETEA-S  686

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY    + NLLG  W
Sbjct  687   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGCVW  746

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE+AEDRP M+ V+LML  + 
Sbjct  747   RNWKEGKGIEIIDPIITESSSTFKQHEILRCIQIGLLCVQERAEDRPTMSLVVLMLGSES  806

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             T++PQPK PG+CL   P+  DSSS+   D    ++NQ+TV++LDAR
Sbjct  807   TTIPQPKSPGYCLGRSPLDTDSSSSKQRDDESWTVNQITVSVLDAR  852


 Score = 54.7 bits (130),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLL CC++ GEKMLI       SLD+ +FD ++ ++LNW
Sbjct  580  QHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNW  624



>ref|XP_002867852.1| At4g21380 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44111.1| At4g21380 [Arabidopsis lyrata subsp. lyrata]
Length=852

 Score =   927 bits (2395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/826 (55%), Positives = 592/826 (72%), Gaps = 19/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG NS   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  42    ISSNNTIVSPGNVFELGFFKPGSNSR-WYLGIWYKTISKRTYVWVANRDTPLSSSIGTLK  100

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I ++ N+ ++D +   +WS+ N     V    VA+LLD+GNFV+R   + +P+  LWQSF
Sbjct  101   ISDNNNLVVLDQSDTPVWST-NLTGGDVRSPLVAELLDNGNFVLRDSKNNSPDGVLWQSF  159

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR+I SW+SP DPS GD  FKL+  G PE FL N++  +
Sbjct  160   DFPTDTLLPEMKLGWDLKTGFNRFIRSWKSPDDPSSGDFWFKLEAEGFPEVFLWNRESRV  219

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  ++ EV YSF +   +++SRL ++ T LL+R+
Sbjct  220   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSREEVTYSFRVTKSDIYSRLSLSSTGLLQRF  279

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y+ECG +G CD++ SPVC C  GFKP+N Q W LRDGS
Sbjct  280   TWIQTAQNWNQFWYAPKDQCDDYKECGVYGYCDSNTSPVCNCIKGFKPKNPQVWGLRDGS  339

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+++C+CTA++N +I
Sbjct  340   DGCVRKTVLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLKDCNCTAFANTDI  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV WT ELFDIR Y A+GGQ LY+R+AA+D E   +  R     G +  V +  
Sbjct  400   RGGGSGCVTWTGELFDIRNY-AKGGQDLYIRLAATDLED--KRNRSAKIIGSSIGVSVLI  456

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              +   I  +               V +         RSRD LMN   ISS+R  S E   
Sbjct  457   LLSFIIFFLWKKKQKRSILIETATVDQ--------VRSRDLLMNEVVISSRRHISRENN-  507

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F  +AMATDNF+  NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG +
Sbjct  508   TDDLELPLMEFEEVAMATDNFSTVNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGTD  567

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN+SLDS LFDK RSS L+W+ R
Sbjct  568   EFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENRSLDSHLFDKSRSSKLNWQMR  627

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M PKISDFGMAR+FG DETEA +
Sbjct  628   FDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKYMTPKISDFGMARIFGRDETEA-S  686

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY    + NLLG  W
Sbjct  687   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGCVW  746

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S      +++RCIQ+GLLCVQE+AEDRP M++++LML  + 
Sbjct  747   RNWKEGKGLEIIDPIITDSSSPFMQHEILRCIQIGLLCVQERAEDRPMMSSMVLMLGSET  806

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             TS+P PK P +C+   P++ DSSS+   D    ++NQ+TV++LDAR
Sbjct  807   TSIPPPKPPDYCVGRSPLETDSSSSKKRDDESWTVNQITVSVLDAR  852


 Score = 56.6 bits (135),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QH NLVRLL CC++ GEKMLI      +SLD+ +FD ++ ++LNW
Sbjct  580  QHINLVRLLACCVDAGEKMLIYEYLENRSLDSHLFDKSRSSKLNW  624



>ref|XP_010449073.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Camelina sativa]
Length=853

 Score =   926 bits (2393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/826 (56%), Positives = 598/826 (72%), Gaps = 19/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS G VF+LGFF PG  S   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  43    ISSNKTIVSPGNVFELGFFKPGSRSR-WYLGIWYKTISKRTYVWVANRDNPLSSSIGTLK  101

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ ++D +   +WS+ N    SV    VA+LLD+GNFV+R  N+ N + YLWQSF
Sbjct  102   IS-DNNLVVLDQSKTPVWST-NLTGGSVGSPVVAELLDNGNFVLRDSNNNNLDEYLWQSF  159

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR+I SW+S  DPS GD +FKL+  G PE FL N++  +
Sbjct  160   DFPTDTLLPEMKLGWDLKTGFNRFIRSWKSSDDPSSGDYSFKLETRGFPEVFLWNREARV  219

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNGV FSGVPEM+  + + F+F  +K EV YSF++   +++SRL ++ T +LER+
Sbjct  220   YRSGPWNGVRFSGVPEMQRFDYMVFNFTASKEEVTYSFQVTKSDIYSRLSLSSTGVLERF  279

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WNRFW APKDQCD+Y+ECG +G CD++ SPVC C  GFKPRN Q W LRDGS
Sbjct  280   TWIEAAQTWNRFWYAPKDQCDDYKECGVYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGS  339

Query  1629  GGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   +GF  +   KLP+++ + VD  + + EC++ C+++C+CTA++N +I
Sbjct  340   DGCVRKTLLTCGGKEGFARLKKMKLPDTTAASVDRGIGVKECEQKCLKDCNCTAFANTDI  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
                GSGCVIWT EL DIR Y A+GGQ LYVR+AA+D E   +  R       +  VI   
Sbjct  400   RGAGSGCVIWTGELLDIRNY-AKGGQDLYVRLAATDLED--KRNRSAKIICSSIGVISVL  456

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              ++  I   L+     +   +   + + +       RSRD LMN   ISS+R H      
Sbjct  457   LLLSFIIFCLWKRKQKQSLAIETPIVDQV-------RSRDLLMNEVVISSRR-HISRDNN  508

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F+ +AMAT+NF+N NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG +
Sbjct  509   TDDLELPLMEFDEVAMATNNFSNDNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGTD  568

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD++EKMLIYEY+EN SLDS LFDKK+SS L+W+ R
Sbjct  569   EFKNEVKLIARLQHINLVRLLACCVDVNEKMLIYEYLENLSLDSHLFDKKQSSKLNWQMR  628

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMAR+FG D+TEA  
Sbjct  629   FDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDDTEA-I  687

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY    + NLLG  W
Sbjct  688   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGCVW  747

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W E +G E++D +I   S +    +++RCIQ+GLLCVQE+AEDRP M+ V+LML  + 
Sbjct  748   RNWKERKGLEIIDPIITDSSSTFKQHEILRCIQIGLLCVQERAEDRPTMSLVVLMLGSES  807

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             T++PQPKQPG+CL   P+  DSSS+  +D    ++NQ+T+++LDAR
Sbjct  808   TTIPQPKQPGYCLGRSPLDTDSSSSKQHDNEPWTVNQITISVLDAR  853



>gb|AID21659.1| ARK3p [Arabidopsis lyrata]
Length=853

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/826 (56%), Positives = 592/826 (72%), Gaps = 19/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG NS   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  43    ISSNNTIVSPGNVFELGFFKPGSNSR-WYLGIWYKTISKRTYVWVANRDTPLSSSIGTLK  101

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I ++ N+ ++D +   +WS+ N     V    VA+LLD+GNFV+R   + +P+  LWQSF
Sbjct  102   ISDNNNLVVLDQSDTPVWST-NLTGGDVRSPLVAELLDNGNFVLRDSKNNSPDGVLWQSF  160

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR+I SW+SP DPS GD  FKL+  G PE FL N++  +
Sbjct  161   DFPTDTLLPEMKLGWDLKTGFNRFIRSWKSPDDPSSGDFWFKLEAEGFPEVFLWNRESRV  220

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  ++ EV YSF +   +++SRL ++ T LL+R+
Sbjct  221   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSREEVTYSFRVTKSDIYSRLSLSSTGLLQRF  280

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y+ECG +G CD++ SPVC C  GFKP+N Q W LRDGS
Sbjct  281   TWIETAQNWNQFWYAPKDQCDDYKECGVYGYCDSNTSPVCNCIKGFKPKNPQVWGLRDGS  340

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+++C+CTA++N +I
Sbjct  341   DGCVRKTVLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLKDCNCTAFANTDI  400

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV WT ELFDIR Y A+GGQ LYVR+AA+D E   +  R     G +  V +  
Sbjct  401   RGGGSGCVTWTGELFDIRNY-AKGGQDLYVRLAATDLED--KRNRSAKIIGSSIGVTVLL  457

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              + L I ++               V +         RSRD LMN   ISS+R  S E   
Sbjct  458   LLSLLIFLLWRRKQKRSILIETPIVDQ--------VRSRDLLMNEVVISSRRHISRENN-  508

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F  +AMAT+NF+ ANKLGQGGFG VYKG    G+E+AVKRLSK S QG +
Sbjct  509   TDDLELPLMEFEEVAMATNNFSKANKLGQGGFGIVYKGKFFDGQEMAVKRLSKTSVQGTD  568

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN SLDS LFDK RSS L+W+ R
Sbjct  569   EFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNWQMR  628

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMAR+FG DETEA +
Sbjct  629   FDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEA-S  687

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++ G++N+GFY    + NLLG  W
Sbjct  688   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIICGKRNKGFYNSDRDLNLLGCVW  747

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE+AEDRP M+ V+LML  + 
Sbjct  748   RNWKEGKGLEIIDPIITESSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVVLMLGSES  807

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             T++PQPK PG+CL   P+  DSSS+   D    ++NQ+TV++LDAR
Sbjct  808   TTIPQPKSPGYCLGRSPLDTDSSSSKQRDDESWTVNQITVSVLDAR  853


 Score = 54.7 bits (130),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLL CC++ GEKMLI       SLD+ +FD ++ ++LNW
Sbjct  581  QHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNW  625



>gb|ABN05291.1| ARK3 protein [Arabidopsis thaliana]
Length=850

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/826 (56%), Positives = 598/826 (72%), Gaps = 19/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG +S   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  40    ISSNNTIVSPGNVFELGFFKPGLDSR-WYLGIWYKAISKRTYVWVANRDTPLSSSIGTLK  98

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ ++D +   +WS+ N     V    VA+LLD+GNFV+R   +  P+  LWQSF
Sbjct  99    IS-DNNLVVLDQSDTPVWST-NLTGGDVRSPLVAELLDNGNFVLRDSKNSAPDGVLWQSF  156

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD+KTG NR+I SW+SP DPS GD +FKL+  G PE FL N++  +
Sbjct  157   DFPTDTLLPEMKLGWDAKTGFNRFIRSWKSPDDPSSGDFSFKLETEGFPEIFLWNRESRM  216

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  +K EV YSF +   +++SRL ++ T LL+R+
Sbjct  217   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSKEEVTYSFRVTKSDVYSRLSISSTGLLQRF  276

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD Y+ECG +G CD++ SPVC C  GFKPRN Q W LRDGS
Sbjct  277   TWIETAQNWNQFWYAPKDQCDEYKECGVYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGS  336

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++ + VD  + L EC++ C+++C+CTA++N +I
Sbjct  337   DGCVRKTLLSCGGGDGFVRLKKMKLPDTTMASVDRGIGLKECEQKCLKDCNCTAFANTDI  396

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
                GSGCVIWT ELFDIR Y A+GGQ LYVR+AA+D E         +   ++ K+I + 
Sbjct  397   RGSGSGCVIWTGELFDIRNY-AKGGQDLYVRLAATDLE---------DKRNRSAKIIGSS  446

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
               V  + ++ F + +L +RK +R +         + RSRD L N   ISS+R  S E   
Sbjct  447   IGVSVLLLLSFIVFILWKRKQKRSILSETPTVDHQVRSRDLLKNEVVISSRRHISRENN-  505

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F  +AMAT+NF  ANKLGQGGFG VYKG L+ G+E+AVKRLSK S QG +
Sbjct  506   TDDLELPLMEFEEVAMATNNFCTANKLGQGGFGIVYKGKLLDGQEMAVKRLSKTSVQGTD  565

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN SLDS LFDK RSS L+W+ R
Sbjct  566   EFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNWQMR  625

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             Y+II G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMAR+FG DETEA  
Sbjct  626   YDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEA-N  684

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++ G++N+GFY    + NLLG  W
Sbjct  685   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIICGKRNKGFYNSDRDLNLLGCVW  744

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE+AEDRP M+ V+LML  + 
Sbjct  745   RNWKEGKGLEIIDPIITDSSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVVLMLGSES  804

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             T++PQPK PG+CL   P+  DSSS+   D    S+NQ+TV++LDAR
Sbjct  805   TTIPQPKSPGYCLGRSPLDTDSSSSKQRDDECWSVNQITVSVLDAR  850


 Score = 54.3 bits (129),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLL CC++ GEKMLI       SLD+ +FD ++ ++LNW
Sbjct  578  QHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNW  622



>ref|XP_010439485.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Camelina sativa]
Length=853

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/826 (56%), Positives = 595/826 (72%), Gaps = 19/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS G+VF+LGFF PG +S   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  43    ISSNKTIVSPGDVFELGFFKPGSSSR-WYLGIWYKTISKRTYVWVANRDNPLSSSVGTLK  101

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ ++D +   +WS+ N    SV    VA+LLD+GNFV+R  N  N + YLWQSF
Sbjct  102   IS-DNNLVVLDQSETPVWST-NLTGGSVRSPVVAELLDNGNFVLRDSNSNNLDEYLWQSF  159

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG +R+I SW++  DPS GD +FKL+  G PE FL N++  +
Sbjct  160   DFPTDTLLPEMKLGWDLKTGFSRFIRSWKNSDDPSSGDYSFKLETGGFPEIFLWNRESRV  219

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNGV FSGVPEM+  + + F+F  +K EV YSF +   +++SRL ++ T +LER+
Sbjct  220   YRSGPWNGVQFSGVPEMQRFDYMVFNFTASKEEVTYSFRVTKDDIYSRLSLSSTGVLERF  279

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WNRFW APKDQCD+Y+ECG +G CD++ SPVC C  GFKPRN Q W LRDGS
Sbjct  280   TWIEAAQTWNRFWYAPKDQCDDYKECGVYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGS  339

Query  1629  GGCFRYDELDC-PTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   +GF  +   KLP+++ + VD  + + EC++ C+++C+CTA++N +I
Sbjct  340   DGCVRKTLLTCGGKEGFARLKKMKLPDTTAASVDRGIGVKECEQKCLKDCNCTAFANTDI  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
                GSGCVIWT EL DIR Y A+GGQ LYVR+AA+D E   +  R     G +  VI   
Sbjct  400   RGAGSGCVIWTGELLDIRNY-AKGGQDLYVRLAATDIED--KRNRSAKIIGSSIGVISVL  456

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              I+  I   L+     +   +   + + +       RSRD LMN   ISS+R  S E   
Sbjct  457   LILSFIIFCLWKRKQKQSAAIETPIVDQV-------RSRDLLMNEVVISSRRHISRENN-  508

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F  +AMAT+NF+N NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG +
Sbjct  509   TDDLELPLMEFEEVAMATNNFSNENKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGTD  568

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD+DEKMLIYEY+ N SLDS LFDKKRSS L+W+ R
Sbjct  569   EFKNEVKLIARLQHINLVRLLACCVDVDEKMLIYEYLANLSLDSHLFDKKRSSKLNWQMR  628

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLD+ M PKISDFGMAR+FG D+TEA  
Sbjct  629   FDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDQYMTPKISDFGMARIFGRDDTEA-I  687

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY    + NLLG  W
Sbjct  688   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGCVW  747

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D  I + S +    +++RCIQ+GLLCVQE+AEDRP M+ V+LML  + 
Sbjct  748   RNWKEGKGLEIIDPSITNSSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVVLMLGSES  807

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQSL---NQLTVTMLDAR  3194
             TS+PQPK PG+C+   P+  DSSS+   D  L   NQ+TV++LD R
Sbjct  808   TSIPQPKPPGYCMGRSPLDTDSSSSKRRDDELWTVNQITVSVLDGR  853



>gb|AID21587.1| ARK3p [Arabidopsis halleri]
Length=851

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/826 (56%), Positives = 589/826 (71%), Gaps = 20/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG  S   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  42    ISSNNTIVSPGNVFELGFFKPGLKSR-WYLGIWYKTISKRTYVWVANRDTPLSSSIGTLK  100

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ ++D +   +WS+ N     +    VA+LLD+GNFV+R   + NP+  LWQSF
Sbjct  101   I-SDNNLIVLDQSDTPVWST-NLTGGDMRSTVVAELLDNGNFVLRDSKNNNPDGVLWQSF  158

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR+I SW+SP DPS GD  FKL+  G PE FL N++  +
Sbjct  159   DFPTDTLLPEMKLGWDLKTGFNRFIRSWKSPDDPSSGDFWFKLETEGFPEVFLWNRESRV  218

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  +K EV YSF +   +++SRL ++ T +L+R+
Sbjct  219   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSKEEVTYSFRVTKSDIYSRLSLSSTGMLQRF  278

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y+ECG +G CD++ SPVC C  GFKP+N Q W LRDGS
Sbjct  279   TWIETAQNWNQFWYAPKDQCDDYKECGIYGYCDSNTSPVCNCIKGFKPKNPQVWGLRDGS  338

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+++C+CTA++N +I
Sbjct  339   DGCVRKTVLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLKDCNCTAFANTDI  398

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV WT EL DIR Y A+GGQ LYVR+AA+D E   +  R     G +  V +  
Sbjct  399   RGGGSGCVTWTGELSDIRNY-AKGGQDLYVRLAATDLED--KRNRSAKIIGSSIGVSVLI  455

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              +   I  +               V +         RSRD LMN   ISS+R  S E   
Sbjct  456   LLSFIIFFLWKKKQKRSILIETATVDQ--------VRSRDLLMNEVVISSRRHISRENN-  506

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F  +AMATDNF+  NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG +
Sbjct  507   TDDLELPLMEFEEVAMATDNFSTVNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGTD  566

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EF+NE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN SLDS LFDK RSS L+W+ R
Sbjct  567   EFRNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNWQMR  626

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M PKISDFGMAR+FG DETEA +
Sbjct  627   FDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKYMTPKISDFGMARIFGRDETEA-S  685

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY    + NLLG  W
Sbjct  686   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGCVW  745

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE+AEDRP M+ V+LML  + 
Sbjct  746   RNWKEGKGLEIIDPIITESSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVVLMLGSES  805

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             T++PQPK PG+CL   P+  DSSS+   D    ++NQ+TV++LDAR
Sbjct  806   TTIPQPKSPGYCLGRSPLDTDSSSSKQRDDESWTVNQITVSVLDAR  851


 Score = 54.3 bits (129),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLL CC++ GEKMLI       SLD+ +FD ++ ++LNW
Sbjct  579  QHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNW  623



>gb|ABV21214.1| At4g21380 [Arabidopsis thaliana]
Length=850

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/826 (56%), Positives = 603/826 (73%), Gaps = 19/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG +S   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  40    ISSNNTIVSPGNVFELGFFKPGLDSR-WYLGIWYKAISKRTYVWVANRDTPLSSSIGTLK  98

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ ++D +   +WS+ N     V    VA+LLD+GNFV+R   + + + +LWQSF
Sbjct  99    IF-DSNLVVLDQSDTPVWST-NLTGGDVRSPLVAELLDNGNFVLRDSKNNDSDGFLWQSF  156

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD+KTG NR+I SW+SP DPS GD +FKL+  G PE FL N++  +
Sbjct  157   DFPTDTLLPEMKLGWDAKTGFNRFIRSWKSPDDPSSGDFSFKLETEGFPEIFLWNRESRM  216

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  +K EV YSF +   +++SRL ++ + LL+R+
Sbjct  217   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSKEEVTYSFRVTKSDVYSRLSISSSGLLQRF  276

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD Y+ECG +G CD++ SPVC C  GFKPRN Q W LRDGS
Sbjct  277   TWIETAQNWNQFWYAPKDQCDEYKECGVYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGS  336

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+R+C+CTA++N +I
Sbjct  337   DGCVRKTLLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLRDCNCTAFANTDI  396

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
                GSGCV WT ELFDIR Y A+GGQ LYVR+AA+D E         +   ++ K+I + 
Sbjct  397   RGSGSGCVTWTGELFDIRNY-AKGGQDLYVRLAATDLE---------DKRNRSAKIIGSS  446

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
               V  + ++ F +  L +RK +R +     +   + RSRD LMN   ISS+R  S E   
Sbjct  447   IGVSVLLLLGFIIFFLWKRKQKRSILIETPIVDHQVRSRDLLMNEVVISSRRHISRENN-  505

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F  +AMAT+NF+NANKLGQGGFG VYKG L+ G+E+AVKRLSK S QG +
Sbjct  506   TDDLELPLMEFEEVAMATNNFSNANKLGQGGFGIVYKGKLLDGQEMAVKRLSKTSVQGTD  565

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN SLDS LFDK RSS L+W+ R
Sbjct  566   EFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNWQMR  625

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMAR+FG DETEA  
Sbjct  626   FDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEA-N  684

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG++S+KSD FSFGVL+LE++SG++N+GFY    + NLLG  W
Sbjct  685   TRKVVGTYGYMSPEYAMDGIYSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGCVW  744

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE+AE+RP M+ V+LML  + 
Sbjct  745   RNWKEGKGLEIIDPIITGSSSTFRQHEILRCIQIGLLCVQERAEERPTMSLVVLMLGSES  804

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             T++PQPK PG+CL   P+  DSSS+   D    ++NQ+TV++L+AR
Sbjct  805   TTIPQPKSPGYCLGRSPLDTDSSSSKQRDDESWTVNQITVSVLEAR  850


 Score = 54.7 bits (130),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLL CC++ GEKMLI       SLD+ +FD ++ ++LNW
Sbjct  578  QHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNW  622



>gb|ADQ37363.1| unknown [Arabidopsis lyrata]
Length=852

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/826 (55%), Positives = 588/826 (71%), Gaps = 19/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG NS   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  42    ISSNNTIVSPGNVFELGFFKPGSNSR-WYLGIWYKTISKRTYVWVANRDTPLSSSIGTLK  100

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I ++ N+ ++D +   +WS+ N     V    VA+LLD+GNFV+R   + +P+  LWQSF
Sbjct  101   ISDNNNLVVLDQSDTPVWST-NLTGGDVRSPLVAELLDNGNFVLRDSKNNSPDGVLWQSF  159

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR+I SW+SP DPS GD  FKL+  G PE FL N++  +
Sbjct  160   DFPTDTLLPEMKLGWDLKTGFNRFIRSWKSPDDPSSGDFWFKLEAEGFPEVFLWNRESRV  219

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  ++ EV YSF +   +++SRL ++ T LL+R+
Sbjct  220   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSREEVTYSFRVTKSDIYSRLSLSSTGLLQRF  279

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y+ECG +G CD++ SPVC C  GFKP+N Q W LRDGS
Sbjct  280   TWIETAQNWNQFWYAPKDQCDDYKECGVYGYCDSNTSPVCNCIKGFKPKNPQVWGLRDGS  339

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+++C+CTA++N +I
Sbjct  340   DGCVRKTVLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLKDCNCTAFANTDI  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV WT ELFDIR Y A+GGQ LY+R+AA+D E   +  R     G +  V +  
Sbjct  400   RGGGSGCVTWTGELFDIRNY-AKGGQDLYIRLAATDLED--KRNRSAKIIGSSIGVSVLI  456

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              +   I  +               V +         RSRD LMN   ISS+R H      
Sbjct  457   LLSFIIFFLWKKKQKRSILIETATVDQ--------VRSRDLLMNEVVISSRR-HIYRENN  507

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F  +A+ATDNF+  NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG +
Sbjct  508   TDDLELPLMEFEEVAIATDNFSTVNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGTD  567

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN SLDS LFDK RSS L+W+ R
Sbjct  568   EFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNWQMR  627

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M PKISDFGMAR+FG DETEA +
Sbjct  628   FDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKYMTPKISDFGMARIFGRDETEA-S  686

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY    + NLLG  W
Sbjct  687   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGCVW  746

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RC Q+GLLCVQE+AEDRP M+ V+LML  + 
Sbjct  747   RNWKEGKGLEIIDPIITESSSTFRQHEILRCTQIGLLCVQERAEDRPTMSLVVLMLGTES  806

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              ++P PK PG+CL   P+  DSSS+   D    ++NQ+TV++LDAR
Sbjct  807   MTIPPPKPPGYCLGRSPLDTDSSSSKQRDDESWTVNQITVSVLDAR  852


 Score = 54.7 bits (130),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLL CC++ GEKMLI       SLD+ +FD ++ ++LNW
Sbjct  580  QHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRSSKLNW  624



>dbj|BAB69683.1| receptor kinase 5 [Brassica rapa]
Length=838

 Score =   919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/827 (56%), Positives = 603/827 (73%), Gaps = 23/827 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+ S G +F+LGFF P  +S   Y+GIWYK I  RT VWVANRD PL  STG LK
Sbjct  30    ISSNKTISSPGNIFELGFFKPSSSSR-WYLGIWYKAISKRTYVWVANRDHPLSTSTGTLK  88

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ +VDG+  ++WS++ T    V    VA+LLD+GN V+R  N+ +P+  LWQSF
Sbjct  89    I-SDSNLVVVDGSDTAVWSTNLTGGGDVRSPVVAELLDNGNLVLRDSNNNDPDGVLWQSF  147

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR++ SW+SP DPS GD +FKL+  G PEAFL NK   +
Sbjct  148   DFPTDTLLPEMKLGWDLKTGFNRFLRSWKSPDDPSSGDYSFKLETRGFPEAFLWNKASQV  207

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P + I F+F  +  EV YSF I   N++SRL ++ T  L+R+
Sbjct  208   YRSGPWNGIRFSGVPEMQPFDYIEFNFTTSNQEVTYSFHITKDNMYSRLSLSSTGSLQRF  267

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD Y+ECG+FG CD++  PVC C  GF+PRN QAW+LRDGS
Sbjct  268   TWIEAIQNWNQFWYAPKDQCDEYKECGTFGYCDSNTYPVCNCMRGFEPRNPQAWALRDGS  327

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++ + VD  + + EC+E C  +C+CTA++N +I
Sbjct  328   DGCVRKTALSCNGGDGFVRLKKMKLPDTAATSVDRGIGIKECEEKCKSDCNCTAFANTDI  387

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV+WT ++ D R Y A+GGQ LYVR+AA+D E T           +  K+I +C
Sbjct  388   RGGGSGCVVWTGDILDTRNY-AKGGQDLYVRLAATDLEDTTN---------RNAKIIGSC  437

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
               V  + ++ F      +RK +     +I +  +  RS+D LMN   I S+R  S E   
Sbjct  438   IGVSVLLLLCFIFYRFWKRKQK----RSIAIETSFVRSQDLLMNEVVIPSRRHISRENK-  492

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD++ELP+ DF A+A+ATDNF NANKLGQGGFG VYKG L+ G+EIAVKRLSK S QG +
Sbjct  493   TDDFELPLMDFEAVAIATDNFTNANKLGQGGFGIVYKGRLLDGQEIAVKRLSKMSVQGTD  552

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDK RS  L+W++R
Sbjct  553   EFKNEVKLIARLQHINLVRLLGCCVDEGEKMLIYEYLENLSLDSHLFDKTRSCKLNWQKR  612

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETEA  
Sbjct  613   FDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-N  671

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS KSD FSFGVL+LE++SG++N+GFY   ++ NLLG  W
Sbjct  672   TRKVVGTYGYMSPEYAMDGIFSTKSDVFSFGVLLLEIISGKRNKGFYNSDHDLNLLGCVW  731

Query  2886  RLWGEGRGSELLDSVIASESHSEFVD-QVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK  3062
             R W +G+G +++D +I   S S +   +++RCI++GLLCVQE+A DRP M++V++ML  +
Sbjct  732   RNWKKGKGLDIVDPIILDSSPSTYRPLEILRCIKIGLLCVQERANDRPTMSSVVMMLGSE  791

Query  3063  GTSLPQPKQPGFCLASKPVKMDSSSTSY-NDQ--SLNQLTVTMLDAR  3194
              T++PQP+ PG+C+   P+  DSSS++  ND+  S+NQ+TV+++D R
Sbjct  792   TTAIPQPEPPGYCVGRSPLDTDSSSSNQRNDESWSVNQMTVSVIDPR  838


 Score = 57.8 bits (138),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+  +LNW K
Sbjct  565  QHINLVRLLGCCVDEGEKMLIYEYLENLSLDSHLFDKTRSCKLNWQK  611



>ref|XP_003593412.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES63663.1| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=852

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/832 (58%), Positives = 600/832 (72%), Gaps = 25/832 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNST-GFL  905
             L  NQTL S  + F LGF  PG NS  +Y+ IWYK I D T+VWVANRD PL+NST   L
Sbjct  36    LLTNQTLESPNQTFVLGFI-PGTNSNNIYLAIWYKNIED-TVVWVANRDNPLQNSTNSHL  93

Query  906   KIGEDGNIHLV----DGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENY  1073
             KIG++GNI L+    D   N IWSS+ T         V QL D+GN V+R  N  +P  Y
Sbjct  94    KIGDNGNIVLLNSSSDSDNNLIWSSNQT---KATNPLVLQLFDNGNLVLRETNVNDPTKY  150

Query  1074  LWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSP-TDPSEGDITFKLDINGLPEAFLR  1250
             LWQSFDYPTDTLLP M +GW+      ++++SW++   DPS G  +FK+D +GLPE FLR
Sbjct  151   LWQSFDYPTDTLLPSMNIGWNFDKNTEKHLTSWKNTGEDPSTGHYSFKIDYHGLPEIFLR  210

Query  1251  NKDIIIYRSGGWNGVAFSGVPEME-PKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNY  1427
             N D IIYRSG WNG  FSGVPEM+   + I F+F   ++ V YSF I N ++FSRL+V+ 
Sbjct  211   NDDNIIYRSGPWNGERFSGVPEMQHDTDSIVFNFSSNQHGVNYSFTIGNPSIFSRLVVDS  270

Query  1428  TQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQA  1607
                L+R TWI   + W  FW APKDQCD+YRECG +G+CDT+ SPVC C  GF P+N+QA
Sbjct  271   GGQLQRRTWIQSMKTWTNFWYAPKDQCDSYRECGPYGLCDTNGSPVCQCVKGFSPKNEQA  330

Query  1608  WSLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTA  1787
             W LRDGS GC R   L+C +D FL M   KLPE+S+ FV+ TM + EC +MC RNCSCT 
Sbjct  331   WKLRDGSDGCVRNKNLECESDKFLRMENVKLPETSSVFVNKTMGIKECGDMCHRNCSCTG  390

Query  1788  YSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTK  1967
             Y+N  ++NGGSGCV+W  EL DIR Y  +GGQ L+VR+AAS+ + +G  + GG+     K
Sbjct  391   YANVYVTNGGSGCVMWIGELNDIRDY-PDGGQDLFVRLAASELDNSG--STGGSHKKNHK  447

Query  1968  KVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREH  2147
               I+   I   + ++  G LL  RRKL     +  + RG+ +RSRD LMN    SSKRE 
Sbjct  448   AEIIGITISAAVIILGLGFLLCNRRKLLSNGKK--DNRGSLQRSRDLLMNEVVFSSKRET  505

Query  2148  SGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKN  2327
             SGE  + DE +LP+FDFN I +AT+NF  ANKLGQGGFGSVY+G L+ G+EIAVKRLS+ 
Sbjct  506   SGERNM-DELDLPMFDFNTIILATNNFLEANKLGQGGFGSVYRGRLIEGQEIAVKRLSQT  564

Query  2328  SRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSL  2507
             S QG EEFKNE++LIA+LQHRNLV+LLGCCVD DEK+L+YEYMEN+SLDSILFDK R  L
Sbjct  565   SEQGVEEFKNEVKLIAKLQHRNLVRLLGCCVDRDEKLLVYEYMENRSLDSILFDKARKPL  624

Query  2508  LDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGD  2687
             LDWK+R++IICG+ RGLLYLH DSR RIIHRDLKASN+LLD +MNPKISDFGMAR+FG D
Sbjct  625   LDWKKRFDIICGIVRGLLYLHHDSRLRIIHRDLKASNILLDGKMNPKISDFGMARIFGRD  684

Query  2688  ETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEEN  2867
             +TEA T  R+VGTYGYMSPEYAMDG FSVKSD FSFGVLVLE++SG+KN+GFY   ++ N
Sbjct  685   QTEANTL-RVVGTYGYMSPEYAMDGNFSVKSDVFSFGVLVLEIISGKKNRGFYYADDDMN  743

Query  2868  LLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVML  3047
             LL  AW  W EG   EL+DS I + S++E   +V+RCI VGLLCVQE+AEDRP M +V+L
Sbjct  744   LLRNAWGQWREGNALELIDSSIGN-SYTE--SEVLRCIHVGLLCVQERAEDRPTMPSVLL  800

Query  3048  MLIGKGTSLPQPKQPGFCL--ASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             ML  +   +P+P+ PGF L  +  P + DSSS+  ++  S+NQ+TVT+LDAR
Sbjct  801   MLGSETALMPEPRSPGFSLGRSRNPQETDSSSSKQDETWSVNQVTVTLLDAR  852


 Score = 54.3 bits (129),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCC++  EK+L+      +SLD+ +FD  ++  L+W K
Sbjct  583  QHRNLVRLLGCCVDRDEKLLVYEYMENRSLDSILFDKARKPLLDWKK  629



>ref|XP_003541757.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Glycine max]
Length=850

 Score =   918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/830 (57%), Positives = 598/830 (72%), Gaps = 21/830 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             L  NQTL+S  +VF LGFF PG NS   Y+G WY  I DRTIVWVANRD PL NS GFL 
Sbjct  34    LLTNQTLISPSQVFALGFF-PGTNST-WYLGTWYNNINDRTIVWVANRDNPLENSNGFLT  91

Query  909   IGEDGNIHLVDGTGNS--IWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQ  1082
             I E+GNI L + +     +WSS+ T   +     V QLLD+GN V+R  N  +P  YLWQ
Sbjct  92    IAENGNIVLTNPSMKKYPVWSSNATTKANNNNR-VLQLLDTGNLVLREANITDPTKYLWQ  150

Query  1083  SFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSP-TDPSEGDITFKLDINGLPEAFLRNKD  1259
             SFDYPTDTLLPGMK+GW+  TG  ++++SW++  +DPS GD +FK+D  G+PE FLR+  
Sbjct  151   SFDYPTDTLLPGMKMGWNLDTGVEKHLTSWKATGSDPSSGDYSFKIDTRGIPEIFLRDDQ  210

Query  1260  IIIYRSGGWNGVAFSGVPEMEPK-EVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQL  1436
              I YRSG WNG  FSGVPEM+P  + I F F   K+ VYY F I ++++ SRL++     
Sbjct  211   NITYRSGPWNGERFSGVPEMQPNTDTITFDFSYDKDGVYYLFSIGSRSILSRLVLTSGGE  270

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
             L+R TW+P    W +FW A KDQCD YRECG +G+CD++ SPVC C  GF+PRN QAW+L
Sbjct  271   LQRLTWVPSRNTWTKFWYARKDQCDGYRECGPYGLCDSNASPVCTCVGGFRPRNLQAWNL  330

Query  1617  RDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSN  1796
             RDGS GC R  +LDC  D FL +   KLPE++  F + TM+L EC+++C +NCSCTAY+N
Sbjct  331   RDGSDGCVRNTDLDCGRDKFLHLENVKLPETTYVFANRTMNLRECEDLCRKNCSCTAYAN  390

Query  1797  YNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVI  1976
               I+NGGSGCV WT EL D+R Y A GGQ LYVR+AASD +  G     G G  K   + 
Sbjct  391   IEITNGGSGCVTWTGELIDMRLYPA-GGQDLYVRLAASDVDDIGS----GGGSHKKNHIG  445

Query  1977  LACgivlgigmvlfgllllkrrklrrgVTENIEM--RGTRERSRDPLMNAT-AISSKREH  2147
                GI +   +++ GL+++  +K +     N++   RG+ +RSRD L       S+ R++
Sbjct  446   EVVGITISAAVIILGLVVIFWKKRKLLSISNVKAGPRGSFQRSRDLLTTVQRKFSTNRKN  505

Query  2148  SGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKN  2327
             SGE  + D+ ELP+FDFN I MATDNF+ ANKLGQGGFG VY+G L+ G++IAVKRLSK+
Sbjct  506   SGERNM-DDIELPMFDFNTITMATDNFSEANKLGQGGFGIVYRGRLMEGQDIAVKRLSKS  564

Query  2328  SRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSL  2507
             S QG EEFKNE++LI RLQHRNLV+L GCC+++ E++L+YEYMEN+SLDSILFDK +  +
Sbjct  565   SMQGVEEFKNEIKLIVRLQHRNLVRLFGCCIEMHERLLVYEYMENRSLDSILFDKAKKPI  624

Query  2508  LDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGD  2687
             LDWKRR+NIICG+ARGLLYLH DSRFRIIHRDLKASN+LLD EMNPKISDFGMARLFG +
Sbjct  625   LDWKRRFNIICGIARGLLYLHHDSRFRIIHRDLKASNILLDSEMNPKISDFGMARLFGSN  684

Query  2688  ETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEEN  2867
             +TEA T+ R+VGTYGYMSPEYAMDG FSVKSD FSFGVLVLE+++G+KN+GFY  + + N
Sbjct  685   QTEANTS-RVVGTYGYMSPEYAMDGNFSVKSDVFSFGVLVLEIITGKKNRGFYYSNEDMN  743

Query  2868  LLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVML  3047
             LLG AWR W +G   EL+DS   S   S    +V+RCI VGLLCVQE+AEDRP M++V+L
Sbjct  744   LLGNAWRQWRDGSALELIDS---STGDSYSPSEVLRCIHVGLLCVQERAEDRPTMSSVLL  800

Query  3048  MLIGKGTSLPQPKQPGFCLASKPVKM-DSSSTSYNDQSLNQLTVTMLDAR  3194
             ML  +   +PQP+ PGF +   P +   SSS      S+NQ+TVT+LDAR
Sbjct  801   MLSSESVLMPQPRNPGFSIGKNPAETDSSSSKKDESWSVNQVTVTLLDAR  850



>gb|ADQ37383.1| unknown [Arabidopsis lyrata]
Length=850

 Score =   917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/828 (55%), Positives = 598/828 (72%), Gaps = 25/828 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF P  NS   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  42    ISSNNTIVSPGNVFELGFFKPASNSR-WYLGIWYKTISKRTYVWVANRDTPLSSSIGTLK  100

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I ++ N+ ++D +   +WS+ N     V    VA+LLD+GNFV+R   + +P+  LWQSF
Sbjct  101   ISDNNNLVVLDQSDTPVWST-NLTGGDVRSPLVAELLDNGNFVLRDSKNNSPDGVLWQSF  159

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR+I SW+SP DPS GD  FKL+  G PE FL N++  +
Sbjct  160   DFPTDTLLPEMKLGWDLKTGFNRFIRSWKSPDDPSSGDFWFKLEAEGFPEVFLWNRESRV  219

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  ++ EV YSF +   +++SRL ++ T LL+R+
Sbjct  220   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSREEVTYSFRVTKSDIYSRLSLSSTGLLQRF  279

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y+ECG +G CD++ SPVC C  GFKP+N Q W LRDGS
Sbjct  280   TWIETAQNWNQFWYAPKDQCDDYKECGVYGYCDSNTSPVCNCIKGFKPKNPQVWGLRDGS  339

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+++C+CTA++N +I
Sbjct  340   DGCVRKTVLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLKDCNCTAFANTDI  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARG--GNGFGKTKKVIL  1979
               GGSGCV WT ELFDIR Y A+GGQ LY+R+AA+D E     +    G+  G +  ++L
Sbjct  400   RGGGSGCVTWTGELFDIRNY-AKGGQDLYIRLAATDLEDKRNRSAKIIGSSIGVSVLILL  458

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
             +      I   L+     +   +   + + +       RSRD LMN   ISS+R  S E 
Sbjct  459   S-----FIIFFLWKRKQKRSILIETPIVDQV-------RSRDLLMNEVVISSRRHISRED  506

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
               T++ ELP+ ++ A+A+AT+NF+N  KLGQGGFG VYKG L+ G+EIAVKRLSK S QG
Sbjct  507   K-TEDLELPLMEYEAVAIATENFSN--KLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQG  563

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EFKNE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN SLDS LFDKKRSS L+W+
Sbjct  564   NDEFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKKRSSNLNWQ  623

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
              R++I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M PKISDFGMAR+FG DETEA
Sbjct  624   MRFDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKYMTPKISDFGMARIFGRDETEA  683

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY    + NLLG 
Sbjct  684   -NTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGC  742

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
              WR W EG+G E++D +I   S +    +++RCIQ+GLLCVQE+AEDRP M+ V+LML  
Sbjct  743   VWRNWKEGKGLEIIDPIITDSSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVVLMLGS  802

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             + T++PQPK PG+CL   P++ DSSS+   D    ++NQ+T+++LDAR
Sbjct  803   ESTTIPQPKPPGYCLGRSPLETDSSSSKQRDDESWTVNQITISVLDAR  850



>ref|XP_010665759.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=867

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/837 (55%), Positives = 610/837 (73%), Gaps = 29/837 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEI-RDRTIVWVANRDKPLRNSTGFL  905
             L++NQTL+S+   F+LGFFS G N    YVGIWYK+I  +  IVWVANRD P  +++  L
Sbjct  45    LSINQTLISSANKFELGFFSRG-NPRKYYVGIWYKDIPSEGIIVWVANRDAPSWSNSCTL  103

Query  906   KIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
              IG   N+ +++   + +W S  +  Q    N V QLLDSGN V+R   D NP+NY+WQS
Sbjct  104   MIGNQSNLVILNDGSHVVWHSDKSTAQ----NPVLQLLDSGNLVIREAEDHNPDNYIWQS  159

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FD+PTDTL+PG KLGW+ KTG +R+++SW+ P DP  G+ TF +D +G PE ++R+ + I
Sbjct  160   FDHPTDTLIPGQKLGWNLKTGLDRFLTSWKDPDDPGSGNYTFNIDYHGDPEIYMRDGEQI  219

Query  1266  IYRSGGWNGVAFSGVPEMEP-KEVIAFSFMRTKNEVYYSFEIH-NKNLFSRLIVNYTQLL  1439
             IYRSG W G  FSGVPEM        F+F R ++EVYY+FE+     + SRL V +   L
Sbjct  220   IYRSGPWVGQRFSGVPEMATTNNRFNFTFYRGEDEVYYTFELPPGGEVKSRLTVTFDGFL  279

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             +R+TW+P    W R+W A  D CD+YR CGS+G+C+T     C CP GF+P++QQAW LR
Sbjct  280   KRWTWVPTTNQWVRYWYARVDDCDSYRVCGSYGVCNTSGFFDCQCPQGFEPKDQQAWDLR  339

Query  1620  DGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
             DGS GC R  ELDC  DGFL +   KLPES T+FV+  ++LD+C++MC RNCSCTA++N 
Sbjct  340   DGSSGCARKTELDCGNDGFLKLVNMKLPESRTAFVNDGLNLDQCRDMCKRNCSCTAFANS  399

Query  1800  NISNG-GSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVI  1976
              +  G G+GCVIWT  L D+R Y  +GGQ LY+R+AASD   TG     GN   K KK+ 
Sbjct  400   EVIRGVGNGCVIWTDNLTDMRDY-VQGGQDLYIRLAASDLGATGS----GNRSDKIKKIA  454

Query  1977  LACgivlgigmv-----lfgllllkrrklrrgVTENIEMR----GTRERSRDPLMNATAI  2129
             +  GI +   M+        +   KR +    +    + R    GT ERS++ L++   +
Sbjct  455   MGVGISIASAMILVGLITLIISKRKRAQNMLLIRRTADTRASRAGTAERSQEILLSGQLM  514

Query  2130  SSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAV  2309
             SSKR++SGET   D+ +LPI+D   +A+AT+NF  ANKLGQGGFG VYKG+L+ G+E+AV
Sbjct  515   SSKRDYSGETKNLDDVDLPIYDLYTLAVATNNFDEANKLGQGGFGRVYKGVLLDGQEVAV  574

Query  2310  KRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFD  2489
             KRLSK S QGA+EFKNELRLIA+LQHRNLV+LLGCCV++DEKMLIYEY++N+SLD+ LF 
Sbjct  575   KRLSKESGQGADEFKNELRLIAKLQHRNLVRLLGCCVEMDEKMLIYEYLKNRSLDAFLFH  634

Query  2490  KKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMA  2669
             K+R+++L+W+ R+NIICG+ARGLLYLHQDSR+RI+HRD+KASN+LLD +MNPKISDFGMA
Sbjct  635   KERNTVLNWQARFNIICGIARGLLYLHQDSRYRIVHRDMKASNILLDGDMNPKISDFGMA  694

Query  2670  RLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYT  2849
             R+FGGD+TE G T+R+VGTYGYM+PEYAMDGLFS+KSD FSFGVLVLE++SG KN+GFY 
Sbjct  695   RIFGGDQTE-GNTRRVVGTYGYMAPEYAMDGLFSIKSDVFSFGVLVLEIISGTKNRGFYN  753

Query  2850  PSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPN  3029
               +E NLLG +W+LW EG+G+ELLD V+  ES S  + +V+RC+QVGLLCVQE+AEDRP 
Sbjct  754   ADHELNLLGYSWKLWREGKGTELLDKVMG-ESFS--IHEVLRCLQVGLLCVQERAEDRPT  810

Query  3030  MAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQS--LNQLTVTMLDAR  3194
             MA+V+LML  +  SLP PK PGFC+   P + DSSS+  +D S  +NQ+TVT L+AR
Sbjct  811   MASVVLMLGSESASLPLPKLPGFCMGWNPNETDSSSSKQDDVSFTVNQVTVTTLNAR  867


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 30/45 (67%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRLLGCC+E  EKMLI      +SLD F+F   +   LNW
Sbjct  599  QHRNLVRLLGCCVEMDEKMLIYEYLKNRSLDAFLFHKERNTVLNW  643



>ref|XP_004295386.1| PREDICTED: uncharacterized protein LOC101313198 [Fragaria vesca 
subsp. vesca]
Length=1664

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/832 (57%), Positives = 594/832 (71%), Gaps = 52/832 (6%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             QTLVSAGEVF+LGFF  G  S   Y+GIWYK+I  RT+VWVANRD PL N++  LKIG  
Sbjct  42    QTLVSAGEVFELGFFELGRPSR-WYLGIWYKKIEQRTVVWVANRDNPLPNNSSSLKIGYA  100

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             GN+ L+D +GN  WSS+N+    V  N + QLLDSGN V++   + NP  +LWQSFD+PT
Sbjct  101   GNLSLLDDSGNVFWSSNNSQVVGVSKNPILQLLDSGNLVLKEATEINPSKFLWQSFDHPT  160

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DTLLP MKLGW+ KTG +RYISSW+S  DPS GD TFKLD +G PE FLR K  I YRSG
Sbjct  161   DTLLPEMKLGWNLKTGLDRYISSWKSLDDPSTGDYTFKLDYHGFPEVFLRQKYTIQYRSG  220

Query  1281  GWNGVAFSGVPEM-EPKEVIAFSFMRTKNEVYYSF----EIHNKNLFSRLIVNYTQLLER  1445
              WNG+ FSGVPEM      I F F+  + EVYYSF    +  +  L SRLIV+ +  L R
Sbjct  221   PWNGLRFSGVPEMNSANNGIGFKFVVNEEEVYYSFSEQGDTTDPALNSRLIVDQSGKLLR  280

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
              TWI   +IWN+FW APKDQCD Y ECG +G+CD + SPVC C  GF+P+N  AWSLRDG
Sbjct  281   LTWIESRKIWNQFWYAPKDQCDYYSECGPYGVCDANASPVCQCMKGFRPKNPSAWSLRDG  340

Query  1626  SGGCFRYDELDC-PTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             S GC R  EL+C   D F  +   KLPES  + V+  MSL+ECK  C+ NCSC+ +S+  
Sbjct  341   SDGCERETELECGRADKFRKVKNVKLPESGGAVVEMEMSLEECKAKCLGNCSCSGFSSAR  400

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVIL-  1979
             I NGGSGCV+W  +L D+R Y A+GGQ  Y+R+AAS+ +          G GKTKK+I+ 
Sbjct  401   IQNGGSGCVMWFGKLIDMRSY-ADGGQEFYLRLAASELD----------GDGKTKKIIMI  449

Query  1980  -ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGE  2156
                 + + + +    +++  +R+         E +G  ERS+D L+N+  +S+K  +SG+
Sbjct  450   VGIAVGIAVLLSAGLIIICFKRRNSGSTLTRRESKGPLERSQDFLLNSVVVSTKEHYSGD  509

Query  2157  TMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQ  2336
                 D+ ELP+FD +++A+AT+NF++ NKLGQGGFG VYKG LV G  IAVKRLSKNS Q
Sbjct  510   RS-NDDLELPLFDVSSVAVATNNFSDENKLGQGGFGCVYKG-LVEGHFIAVKRLSKNSGQ  567

Query  2337  GAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
             G EEFKNE++LIARLQHRNLV+LLGCCVD+DEKMLIYEYMENKSLDS LFDK +  LLDW
Sbjct  568   GTEEFKNEVKLIARLQHRNLVRLLGCCVDVDEKMLIYEYMENKSLDSFLFDKAKRYLLDW  627

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
             K+R+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLD E++PKISDFGMAR+FG D+TE
Sbjct  628   KKRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDGELDPKISDFGMARIFGQDQTE  687

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             A  TK++VGTYGYMSPEYAMDGLFS+KSD FSFGVLVLE+V                   
Sbjct  688   A-NTKKVVGTYGYMSPEYAMDGLFSIKSDVFSFGVLVLEIV-------------------  727

Query  2877  LAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
               W LW EGR  +++DS + + S SE   +VMRCIQVGLLCVQE+AEDRP M++V+LML 
Sbjct  728   --WELWNEGRALDIIDSSVGN-SFSE--TEVMRCIQVGLLCVQERAEDRPTMSSVVLMLS  782

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQS--LNQLTVTMLDAR*LIH  3206
              +  SLPQPK PGFCL  K  +   SS+S  D+S  +NQ+T+T+L+ R L+H
Sbjct  783   SETASLPQPKNPGFCLGRKETE---SSSSKQDESCTVNQVTITVLNPRQLLH  831


 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/831 (46%), Positives = 515/831 (62%), Gaps = 38/831 (5%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKP-LRNST  896
             N  LT  QTLVS+ + F+LGFF+PG +S   ++GIWYK I   T VWVANR+ P L  S+
Sbjct  866   NQVLTNEQTLVSSSQSFELGFFTPG-SSNNSFLGIWYKNILPLTAVWVANRNVPILPGSS  924

Query  897   GFLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNT-VAQLLDSGNFVVRREN--DENPE  1067
                         +      ++WS     N SV  N+ + QLLD GN ++R E+  D+   
Sbjct  925   SASVSLSSSGFWISTNESLNLWSV----NVSVALNSPMLQLLDDGNLILRNESGADDAEG  980

Query  1068  NYLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDING-LPEAF  1244
               +WQSFDY TDTLLPGMKLGW+  TG NR ++SW S +DPS G+ TF +D +   P+  
Sbjct  981   LVIWQSFDYITDTLLPGMKLGWNLVTGLNRNMTSWSSSSDPSTGEFTFSVDRHDEAPQLV  1040

Query  1245  LRNKDIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVN  1424
             +      + R G W+GV FSG  E++   V    F  +  EVYY+FE+ +K+  +R ++N
Sbjct  1041  VWKGSEKLNRWGPWDGVRFSGSEELQSNPVWTPIFNISSEEVYYTFEVVDKSTLTRFVMN  1100

Query  1425  YTQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQ  1604
                  E +T+   N  W       +  CD Y  CG +G CD+   P C C  GF P++ Q
Sbjct  1101  QDGSAEYFTYRASNNQWGGVVTLKQSSCDVYGTCGPYGSCDSK-GPSCECLKGFDPKSPQ  1159

Query  1605  AWSLRDGSGGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSC  1781
              W +   +GGC R  +LDC   DGF+     KLP++S  F + ++SL +C+  C++NCSC
Sbjct  1160  EWQMFTWTGGCVRNWDLDCKNGDGFVRYEGLKLPDNSFLFANRSLSLKDCEGECLKNCSC  1219

Query  1782  TAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGK  1961
              AY+ ++I   G  CV+W  EL D+R Y  + G+ +Y+R+A  + E   +  +       
Sbjct  1220  MAYTRFDIHARGGDCVMWFDELVDMRNY-PDVGEEIYIRMARKEIESIADDKKKKRVKMV  1278

Query  1962  TKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKR  2141
                V+                  L    +   +   + +R T+ R R     A    +  
Sbjct  1279  VTIVM----------------SSLGGMLIFGFIICIVRIRKTKRRLR----RAETRENPY  1318

Query  2142  EHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLS  2321
             +   E M  ++  L I DF+ I+ ATD F+ ANK+G+GGFG+VYKG+L  G+EIAVKRLS
Sbjct  1319  QVHMEEMQEEDLALSILDFDTISAATDRFSIANKIGEGGFGTVYKGVLPSGQEIAVKRLS  1378

Query  2322  KNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRS  2501
              +S QG +EFKNE+ LIA+LQHRNLVKLLGCC+  +EKMLIYEY+ NKSLD  LFD+ RS
Sbjct  1379  VHSGQGLQEFKNEVALIAKLQHRNLVKLLGCCIQREEKMLIYEYLPNKSLDQFLFDRTRS  1438

Query  2502  SLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFG  2681
              +L W++R++I+ G+ARGLLYLHQDSR RIIHRDLKASN+LLD EM  KISDFG AR+FG
Sbjct  1439  EVLTWRKRFDIVMGIARGLLYLHQDSRLRIIHRDLKASNILLDSEMKSKISDFGTARIFG  1498

Query  2682  GDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNE  2861
             G++TE   T+R++GTYGYMSPEYAM G FSVKSD FSFGVLVLE++SGRKN GF+ P ++
Sbjct  1499  GEQTEE-MTRRVIGTYGYMSPEYAMGGHFSVKSDVFSFGVLVLEIISGRKNSGFHHPEHD  1557

Query  2862  ENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAV  3041
              NLLG AW LW EG   +LLD+ I   S    V++V RCIQV LL VQ++ +DRP M+ V
Sbjct  1558  LNLLGYAWNLWNEGNPLQLLDAQIEKSSS---VNEVTRCIQVALLSVQQRVDDRPTMSTV  1614

Query  3042  MLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             +LML  +   +PQPK+PGF      +  D+SST  N  ++N +TVT+LD R
Sbjct  1615  LLMLSNENYLMPQPKEPGFITGLLSMG-DTSSTGKNLHTVNDVTVTILDGR  1664


 Score = 61.6 bits (148),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCC++  EKMLI      KSLD+F+FD  KR  L+W K
Sbjct  583  QHRNLVRLLGCCVDVDEKMLIYEYMENKSLDSFLFDKAKRYLLDWKK  629


 Score = 57.4 bits (137),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2     QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
             QHRNLV+LLGCCI+  EKMLI      KSLD F+FD T+   L W K
Sbjct  1399  QHRNLVKLLGCCIQREEKMLIYEYLPNKSLDQFLFDRTRSEVLTWRK  1445



>ref|XP_009134691.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Brassica rapa]
Length=882

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/828 (55%), Positives = 601/828 (73%), Gaps = 22/828 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+ S G +F+LGFF P  +S   Y+GIWYK I  RT  WVANRD PL +S G LK
Sbjct  71    ISSNKTISSPGNIFELGFFKPSSSSR-WYLGIWYKAISKRTYAWVANRDHPLSSSIGTLK  129

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ +VDG+  ++WS++ T    V    VA+LLD+GN V+R  N+ +P+  LWQSF
Sbjct  130   I-SDSNLVVVDGSDTAVWSTNLTGGGDVRSPVVAELLDNGNLVLRDSNNNDPDGVLWQSF  188

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR++ SW+SP DPS GD +FKL+  G PEAFL NK   +
Sbjct  189   DFPTDTLLPEMKLGWDLKTGFNRFLRSWKSPDDPSSGDYSFKLETRGFPEAFLWNKASQV  248

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P + I F+F  +  EV YSF I   N++SRL ++ T  L+R+
Sbjct  249   YRSGPWNGIRFSGVPEMQPFDYIEFNFTTSNQEVTYSFHITKDNMYSRLSLSSTGSLQRF  308

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD Y+ECG+FG CD++  PVC C  GF+PRN QAW LRDGS
Sbjct  309   TWIEAIQNWNQFWYAPKDQCDEYKECGTFGYCDSNTYPVCNCMRGFEPRNPQAWGLRDGS  368

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++ + VD  + + EC+E C  +C+CTA++N +I
Sbjct  369   DGCVRKTALSCNGGDGFVRLKKMKLPDTAATSVDRGIGIKECEEKCKSDCNCTAFANTDI  428

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV+WT ++ D R Y A+GGQ LYVR+AA+D E T           +  K+I +C
Sbjct  429   RGGGSGCVVWTGDILDTRNY-AKGGQDLYVRLAATDLEDTTN---------RNAKIIGSC  478

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRE-RSRDPLMNATAISSKREHSGETM  2162
               V  + ++ F      +RK +R +   IE     + RS+D LMN   I S+R  S E  
Sbjct  479   IGVSVLLLLCFIFYRFWKRKQKRSIA--IETSFVDQVRSQDLLMNEVVIPSRRHISRENK  536

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
              TD+ ELP+ DF A+A+ATDNF NANKLGQGGFG VYKG L+ G+EIAVKRLSK S QG 
Sbjct  537   -TDDLELPLMDFEAVAIATDNFTNANKLGQGGFGIVYKGRLLDGQEIAVKRLSKMSVQGT  595

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
             +EFKNE++LIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDK RS  L+W++
Sbjct  596   DEFKNEVKLIARLQHINLVRLLGCCVDEGEKMLIYEYLENLSLDSHLFDKTRSCKLNWQK  655

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R++I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETEA 
Sbjct  656   RFDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-  714

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
              T+++VGTYGYMSPEYAMDG+FS KSD FSFGVL+LE++SG++N+GFY   ++ NLLG  
Sbjct  715   NTRKVVGTYGYMSPEYAMDGIFSTKSDVFSFGVLLLEIISGKRNKGFYNSDHDLNLLGCV  774

Query  2883  WRLWGEGRGSELLDSVIASESHSEFVD-QVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             WR W +G+G +++D +I   S S +   +++RCI++GLLCVQE+A DRP M++V+++L  
Sbjct  775   WRNWKKGKGLDIVDPIILDSSPSTYRPLEILRCIKIGLLCVQERANDRPTMSSVVMLLGS  834

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSY-NDQ--SLNQLTVTMLDAR  3194
             +  ++PQP+QPG+C+   P+  DSSS++  ND+  S+NQ+TV+++D R
Sbjct  835   ETAAIPQPEQPGYCVGRSPLDTDSSSSNQRNDESWSVNQMTVSVIDPR  882


 Score = 57.8 bits (138),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+  +LNW K
Sbjct  609  QHINLVRLLGCCVDEGEKMLIYEYLENLSLDSHLFDKTRSCKLNWQK  655



>gb|AID21612.1| ARK3p [Arabidopsis halleri]
Length=846

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/826 (56%), Positives = 591/826 (72%), Gaps = 22/826 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG NS   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  39    ISSNNTIVSPGNVFELGFFKPGSNSR-WYIGIWYKTISKRTYVWVANRDTPLSSSIGTLK  97

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ ++D +   +WS+ N          VA+LLD+GNFV+R   + NP+  LWQSF
Sbjct  98    IS-DHNLVVLDQSDTPVWST-NLTGGDARSPLVAELLDNGNFVLRDSKNNNPDGVLWQSF  155

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR+I SW+SP DPS GD  FKL+  G PE FL N++  +
Sbjct  156   DFPTDTLLPEMKLGWDLKTGFNRFIRSWKSPDDPSSGDFWFKLEAEGFPEVFLWNRESRV  215

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  ++ EV YSF +   +++SRL ++ T LL+R+
Sbjct  216   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSREEVTYSFRVTKSDIYSRLSLSSTGLLQRF  275

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y+ECG +G CD++ SPVC C  GF+P+N Q W LRDGS
Sbjct  276   TWIETAQNWNQFWYAPKDQCDDYKECGIYGYCDSNTSPVCNCIKGFRPKNPQVWGLRDGS  335

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+++C+CTA++N +I
Sbjct  336   DGCVRKTVLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLKDCNCTAFANTDI  395

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV WT EL DIR Y A+GGQ LYVR+AA+D E   +  R     G +  V +  
Sbjct  396   RGGGSGCVTWTGELSDIRNY-AKGGQDLYVRLAATDLED--KRNRSAKIIGSSIGVSVLL  452

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              I   +  +               V +         RSRD LMN   ISS+R  S E   
Sbjct  453   LISFIVFFLWKRKQKRSILIETPIVDQ--------VRSRDLLMNEVVISSRRHISREDK-  503

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T++ ELP+ ++ A+A+AT+NF+N  KLGQGGFG VYKG L+ G+EIAVKRLSK S QG +
Sbjct  504   TEDLELPLMEYEAVAIATENFSN--KLGQGGFGIVYKGRLLDGQEIAVKRLSKTSIQGND  561

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN SLDS LFD+KRSS L+W+ R
Sbjct  562   EFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDRKRSSNLNWQMR  621

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M PKISDFGMAR+FG DETEA  
Sbjct  622   FDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKYMTPKISDFGMARIFGRDETEA-N  680

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LEV+SG++N+GFY    + NLLG AW
Sbjct  681   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEVISGKRNKGFYNSDRDLNLLGCAW  740

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S S    +++RCIQ+GLLCVQE+AEDRP M+ V+LML  + 
Sbjct  741   RNWKEGKGLEIVDPIIIDSSSSFRQHEILRCIQIGLLCVQERAEDRPTMSLVVLMLGSEA  800

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             T++PQPK PG+C+   P++ DSSS+   D    ++NQ+TV++LDAR
Sbjct  801   TTIPQPKPPGYCMGRSPLETDSSSSKQRDDESWTVNQITVSVLDAR  846



>emb|CDX79055.1| BnaA01g11220D [Brassica napus]
Length=846

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/828 (55%), Positives = 601/828 (73%), Gaps = 22/828 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+ S G +F+LGFF P  +S   Y+GIWYK I  RT  WVANRD PL +S G LK
Sbjct  35    ISSNKTISSPGNIFELGFFKPSSSSR-WYLGIWYKAISKRTYAWVANRDHPLSSSIGTLK  93

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ +VDG+  ++WS++ T    V    VA+LLD+GN V+R  N+ +P+  LWQSF
Sbjct  94    I-SDSNLVVVDGSDTAVWSTNLTGGGDVRSPVVAELLDNGNLVLRDSNNNDPDGVLWQSF  152

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR++ SW+SP DPS GD +FKL+  G PEAFL NK   +
Sbjct  153   DFPTDTLLPEMKLGWDLKTGFNRFLRSWKSPDDPSSGDYSFKLETRGFPEAFLWNKASQV  212

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P + I F+F  +  EV YSF I   N++SRL ++ T  L+R+
Sbjct  213   YRSGPWNGIRFSGVPEMQPFDYIEFNFTTSNQEVTYSFHITKDNMYSRLSLSSTGSLQRF  272

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD Y+ECG+FG CD++  PVC C  GF+PRN QAW LRDGS
Sbjct  273   TWIEAIQNWNQFWYAPKDQCDEYKECGTFGYCDSNTYPVCNCMRGFEPRNPQAWGLRDGS  332

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++ + VD  + + EC+E C  +C+CTA++N +I
Sbjct  333   DGCVRKTALSCNGGDGFVRLKKMKLPDTAATSVDRGIGIKECEEKCKSDCNCTAFANTDI  392

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV+WT ++ D R Y A+GGQ LYVR+AA+D E T           +  K+I +C
Sbjct  393   RGGGSGCVVWTGDILDTRNY-AKGGQDLYVRLAATDLEDTTN---------RNAKIIGSC  442

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRE-RSRDPLMNATAISSKREHSGETM  2162
               V  + ++ F      +RK +R +   IE     + RS+D LMN   I S+R  S E  
Sbjct  443   IGVSVLLLLCFIFYRFWKRKQKRSIA--IETSFVDQVRSQDLLMNEVVIPSRRHISRENK  500

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
              TD+ ELP+ DF A+A+ATDNF NANKLGQGGFG VYKG L+ G+EIAVKRLSK S QG 
Sbjct  501   -TDDLELPLMDFEAVAIATDNFTNANKLGQGGFGIVYKGRLLDGQEIAVKRLSKMSVQGT  559

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
             +EFKNE++LIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDK RS  L+W++
Sbjct  560   DEFKNEVKLIARLQHINLVRLLGCCVDEGEKMLIYEYLENLSLDSHLFDKTRSCKLNWQK  619

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R++I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETEA 
Sbjct  620   RFDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-  678

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
              T+++VGTYGYMSPEYAMDG+FS KSD FSFGVL+LE++SG++N+GFY   ++ NLLG  
Sbjct  679   NTRKVVGTYGYMSPEYAMDGIFSTKSDVFSFGVLLLEIISGKRNKGFYNSDHDLNLLGCV  738

Query  2883  WRLWGEGRGSELLDSVIASESHSEFVD-QVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             WR W +G+G +++D +I   S S +   +++RCI++GLLCVQE+A DRP M++V++ML  
Sbjct  739   WRNWKKGKGLDIVDPIILDSSPSTYRPLEILRCIKIGLLCVQERANDRPTMSSVVMMLGS  798

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSY-NDQ--SLNQLTVTMLDAR  3194
             +  ++PQP+QPG+C+   P+  DSSS++  ND+  S+NQ+TV+++D R
Sbjct  799   ETAAIPQPEQPGYCVGRSPLDTDSSSSNQRNDESWSVNQMTVSVIDPR  846


 Score = 57.8 bits (138),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+  +LNW K
Sbjct  573  QHINLVRLLGCCVDEGEKMLIYEYLENLSLDSHLFDKTRSCKLNWQK  619



>ref|NP_193869.1| receptor kinase 3 [Arabidopsis thaliana]
 sp|O81905.1|SD18_ARATH RecName: Full=Receptor-like serine/threonine-protein kinase SD1-8; 
AltName: Full=Arabidopsis thaliana receptor kinase 3; 
AltName: Full=S-domain-1 (SD1) receptor kinase 8; Short=SD1-8; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA20203.1| receptor-like serine/threonine protein kinase ARK3 [Arabidopsis 
thaliana]
 emb|CAB81245.1| receptor-like serine/threonine protein kinase ARK3 [Arabidopsis 
thaliana]
 dbj|BAC43479.1| putative receptor-like serine/threonine protein kinase ARK3 [Arabidopsis 
thaliana]
 gb|AAP04019.1| putative receptor serine/threonine protein kinase ARK3 [Arabidopsis 
thaliana]
 gb|AEE84446.1| receptor kinase 3 [Arabidopsis thaliana]
Length=850

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/826 (56%), Positives = 600/826 (73%), Gaps = 19/826 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG +S   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  40    ISSNNTIVSPGNVFELGFFKPGLDSR-WYLGIWYKAISKRTYVWVANRDTPLSSSIGTLK  98

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ ++D +   +WS+ N     V    VA+LLD+GNFV+R   +  P+  LWQSF
Sbjct  99    IS-DSNLVVLDQSDTPVWST-NLTGGDVRSPLVAELLDNGNFVLRDSKNSAPDGVLWQSF  156

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD+KTG NR+I SW+SP DPS GD +FKL+  G PE FL N++  +
Sbjct  157   DFPTDTLLPEMKLGWDAKTGFNRFIRSWKSPDDPSSGDFSFKLETEGFPEIFLWNRESRM  216

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  +K EV YSF I   +++SRL ++ + LL+R+
Sbjct  217   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSKEEVTYSFRITKSDVYSRLSISSSGLLQRF  276

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD Y+ECG +G CD++ SPVC C  GFKPRN Q W LRDGS
Sbjct  277   TWIETAQNWNQFWYAPKDQCDEYKECGVYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGS  336

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+R+C+CTA++N +I
Sbjct  337   DGCVRKTLLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLRDCNCTAFANTDI  396

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
                GSGCV WT ELFDIR Y A+GGQ LYVR+AA+D E         +   ++ K+I + 
Sbjct  397   RGSGSGCVTWTGELFDIRNY-AKGGQDLYVRLAATDLE---------DKRNRSAKIIGSS  446

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
               V  + ++ F +  L +RK +R +     +   + RSRD LMN   ISS+R  S E   
Sbjct  447   IGVSVLLLLSFIIFFLWKRKQKRSILIETPIVDHQLRSRDLLMNEVVISSRRHISRENN-  505

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F  +AMAT+NF+NANKLGQGGFG VYKG L+ G+E+AVKRLSK S QG +
Sbjct  506   TDDLELPLMEFEEVAMATNNFSNANKLGQGGFGIVYKGKLLDGQEMAVKRLSKTSVQGTD  565

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN SLDS LFDK R+S L+W+ R
Sbjct  566   EFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRNSKLNWQMR  625

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMAR+FG DETEA  
Sbjct  626   FDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEA-N  684

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++S ++N+GFY    + NLLG  W
Sbjct  685   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISSKRNKGFYNSDRDLNLLGCVW  744

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE+AEDRP M+ V+LML  + 
Sbjct  745   RNWKEGKGLEIIDPIITDSSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVILMLGSES  804

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             T++PQPK PG+CL    +  DSSS+   D    ++NQ+TV++LDAR
Sbjct  805   TTIPQPKAPGYCLERSLLDTDSSSSKQRDDESWTVNQITVSVLDAR  850


 Score = 54.7 bits (130),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLL CC++ GEKMLI       SLD+ +FD ++ ++LNW
Sbjct  578  QHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRNSKLNW  622



>gb|AID21633.1| ARK3p [Arabidopsis lyrata]
Length=851

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/826 (55%), Positives = 590/826 (71%), Gaps = 22/826 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG NS   Y+GIWYK+I  RT VWVANRD PL +S G LK
Sbjct  44    ISSNNTIVSPGNVFELGFFKPGSNSR-WYLGIWYKKISKRTYVWVANRDTPLSSSIGTLK  102

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ ++D +   +WS+ N     V    VA+LLD+GNFV+R   + +P+  LWQSF
Sbjct  103   I-SDNNLVVLDQSDTPVWST-NLTGGDVRSPVVAELLDNGNFVLRDSKNNSPDGVLWQSF  160

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR+I SW+SP DPS GD  FKL+  G PE FL N++  +
Sbjct  161   DFPTDTLLPEMKLGWDLKTGFNRFIRSWKSPDDPSSGDFWFKLETEGFPEVFLWNRESRV  220

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  ++ EV YSF +   +++SRL ++ T LL+R+
Sbjct  221   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSREEVTYSFRVTKSDIYSRLSLSSTGLLQRF  280

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y+ECG +G CD++ SPVC C  GFKP+N Q W LRDGS
Sbjct  281   TWIETAQNWNQFWYAPKDQCDDYKECGVYGYCDSNTSPVCNCIKGFKPKNPQVWGLRDGS  340

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+++C+CTA++N +I
Sbjct  341   DGCVRKTVLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLKDCNCTAFANTDI  400

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV WT ELFDIR Y A+GGQ LY+R+AA+D E   +  RG    G +  V +  
Sbjct  401   RGGGSGCVTWTGELFDIRNY-AKGGQDLYIRLAATDLED--KRNRGAKIIGSSIGVSVLI  457

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              +   I  +               V +         RSRD LMN   ISS+R  S E   
Sbjct  458   LLSFIIFFLWKRKQKRSILIETPIVDQ--------VRSRDLLMNEVVISSRRHISREDK-  508

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T++ ELP+ ++ A+A+AT+NF+N  KLGQGGFG VYKG L+ G+EIAVKRLSK S QG +
Sbjct  509   TEDLELPLMEYEAVAIATENFSN--KLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGND  566

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN SLDS LFDKKRSS L+W+ R
Sbjct  567   EFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKKRSSNLNWQMR  626

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLD+ M PKISDFGMAR+FG  ETEA  
Sbjct  627   FDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDRYMTPKISDFGMARIFGRYETEA-N  685

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY    + NLLG  W
Sbjct  686   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGCVW  745

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W +G G E++D  I   S +    +++RCIQ+GLLCVQE+AEDRP M+ V+LML  + 
Sbjct  746   RNWKQGNGLEIIDPTITDSSSTIRQHEILRCIQIGLLCVQERAEDRPTMSLVVLMLGSES  805

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             T+LPQPK PG+CL   P+  DSSS+   D    ++NQ+TV++LDAR
Sbjct  806   TTLPQPKPPGYCLGRSPLDTDSSSSKQRDDESWTVNQITVSVLDAR  851



>emb|CAA67145.1| receptor-like kinase [Brassica oleracea var. viridis]
Length=847

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/828 (55%), Positives = 597/828 (72%), Gaps = 21/828 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+ S G +F+LGFF P  +S   Y+GIWYK I  RT VWVANRD PL  STG LK
Sbjct  35    ISSNKTISSPGNIFELGFFKPSSSSR-WYLGIWYKAISKRTYVWVANRDHPLSTSTGTLK  93

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ +VDG+  ++WS++ T    V    VA+LLD+GNFV+R  N+ +P+  LWQSF
Sbjct  94    I-SDSNLVVVDGSDTAVWSTNLTGGGDVRSPVVAELLDNGNFVLRDSNNNDPDIVLWQSF  152

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG N ++ SW+SP DPS GD +FKL   G PEAFL NK   +
Sbjct  153   DFPTDTLLPEMKLGWDLKTGFNWFLRSWKSPDDPSSGDYSFKLKTRGFPEAFLWNKASQV  212

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P + I F+F  +  EV YSF I   N++SRL ++ T  L+R+
Sbjct  213   YRSGPWNGIRFSGVPEMQPFDYIEFNFTTSNQEVTYSFHITKDNMYSRLSLSSTGSLQRF  272

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y+ECG++G CD++  PVC C  GF+PRN QAW LRDGS
Sbjct  273   TWIEAIQNWNQFWYAPKDQCDDYKECGTYGYCDSNTYPVCNCMRGFEPRNPQAWGLRDGS  332

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++ + VD  + + EC+E C  +C+CTA++N +I
Sbjct  333   DGCVRKTALSCNGGDGFVRLKKMKLPDTAATSVDRGIGIKECEEKCKSDCNCTAFANTDI  392

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV+WT ++ D R Y A+GGQ LYVR+AA+D E T           +  K+I +C
Sbjct  393   RGGGSGCVVWTGDILDTRNY-AKGGQDLYVRLAATDLEDTTN---------RNAKIIGSC  442

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRE-RSRDPLMNATAISSKREHSGETM  2162
               V  + ++ F      +RK +R +   IE     + RS+D LMN   I   R H     
Sbjct  443   IGVSVLLLLCFIFYRFWKRKQKRSIA--IETSFVDQVRSQDLLMNEVVIPPNRRHISREN  500

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
              TD+ ELP+ DF A+A+ATDNF+NANKLGQGGFG VYKG L+ G+EIAVKRLSK S QG 
Sbjct  501   KTDDLELPLMDFEAVAIATDNFSNANKLGQGGFGIVYKGRLLDGQEIAVKRLSKMSVQGT  560

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
             +EFKNE++LIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDK RS  L+W++
Sbjct  561   DEFKNEVKLIARLQHINLVRLLGCCVDEGEKMLIYEYLENLSLDSHLFDKTRSCKLNWQK  620

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R++I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETEA 
Sbjct  621   RFDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-  679

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
              T+++VGTYGYMSPEYAMDG+FS KSD FSFGVL+LE++SG++N+GFY   ++ NLLG  
Sbjct  680   NTRKVVGTYGYMSPEYAMDGIFSTKSDVFSFGVLLLEIISGKRNKGFYNSDHDLNLLGCV  739

Query  2883  WRLWGEGRGSELLDSVIASESHSEFVD-QVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             WR W +G+G +++D +I   S S +   +++RCI++GLLCVQE+A DRP M++V++ML  
Sbjct  740   WRNWKKGKGLDIVDPIILDSSPSTYRPLEILRCIKIGLLCVQERANDRPTMSSVVMMLGS  799

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             +  ++PQP+QPG+C+   P+  DSSS++       S+NQ+TV+++D R
Sbjct  800   ETAAIPQPEQPGYCVGRSPLDTDSSSSNQRHDESWSVNQMTVSVIDPR  847


 Score = 57.8 bits (138),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+  +LNW K
Sbjct  574  QHINLVRLLGCCVDEGEKMLIYEYLENLSLDSHLFDKTRSCKLNWQK  620



>gb|AAB33487.1| ARK3 product/receptor-like serine/threonine protein kinase ARK3 
[Arabidopsis thaliana, Columbia, Peptide, 851 aa]
Length=851

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/827 (56%), Positives = 600/827 (73%), Gaps = 20/827 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG +S   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  40    ISSNNTIVSPGNVFELGFFKPGLDSR-WYLGIWYKAISKRTYVWVANRDTPLSSSIGTLK  98

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ ++D +   +WS+ N     V    VA+LLD+GNFV+R   +  P+  LWQSF
Sbjct  99    IS-DSNLVVLDQSDTPVWST-NLTGGDVRSPLVAELLDNGNFVLRDSKNSAPDGVLWQSF  156

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD+KTG NR+I SW+SP DPS GD +FKL+  G PE FL N++  +
Sbjct  157   DFPTDTLLPEMKLGWDAKTGFNRFIRSWKSPDDPSSGDFSFKLETEGFPEIFLWNRESRM  216

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  +K EV YSF I   +++SRL ++ + LL+R+
Sbjct  217   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSKEEVTYSFRITKSDVYSRLSISSSGLLQRF  276

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD Y+ECG +G CD++ SPVC C  GFKPRN Q W LRDGS
Sbjct  277   TWIETAQNWNQFWYAPKDQCDEYKECGVYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGS  336

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+R+C+CTA++N +I
Sbjct  337   DGCVRKTLLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLRDCNCTAFANTDI  396

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
                GSGCV WT ELFDIR Y A+GGQ LYVR+AA+D E         +   ++ K+I + 
Sbjct  397   RGSGSGCVTWTGELFDIRNY-AKGGQDLYVRLAATDLE---------DKRNRSAKIIGSS  446

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
               V  + ++ F +  L +RK +R +     +   + RSRD LMN   ISS+R  S E   
Sbjct  447   IGVSVLLLLSFIIFFLWKRKQKRSILIETPIVDHQLRSRDLLMNEVVISSRRHISRENN-  505

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F  +AMAT+NF+NANKLGQGGFG VYKG L+ G+E+AVKRLSK S QG +
Sbjct  506   TDDLELPLMEFEEVAMATNNFSNANKLGQGGFGIVYKGKLLDGQEMAVKRLSKTSVQGTD  565

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD  EKMLIYEY+EN SLDS LFDK R+S L+W+ R
Sbjct  566   EFKNEVKLIARLQHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRNSKLNWQMR  625

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMAR+FG DETEA  
Sbjct  626   FDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEA-N  684

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++S ++N+GFY    + NLLG  W
Sbjct  685   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISSKRNKGFYNSDRDLNLLGCVW  744

Query  2886  RLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK  3062
             R W EG+G E++D +I     S F   +++RCIQ+GLLCVQE+AEDRP M+ V+LML  +
Sbjct  745   RNWKEGKGLEIIDPIITDSLSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVILMLGSE  804

Query  3063  GTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              T++PQPK PG+CL    +  DSSS+   D    ++NQ+TV++LDAR
Sbjct  805   STTIPQPKAPGYCLERSLLDTDSSSSKQRDDESWTVNQITVSVLDAR  851


 Score = 54.7 bits (130),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLL CC++ GEKMLI       SLD+ +FD ++ ++LNW
Sbjct  578  QHINLVRLLACCVDAGEKMLIYEYLENLSLDSHLFDKSRNSKLNW  622



>ref|XP_010665760.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=864

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/837 (55%), Positives = 608/837 (73%), Gaps = 32/837 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEI-RDRTIVWVANRDKPLRNSTGFL  905
             L++NQTL+S+   F+LGFFS G N    YVGIWYK+I  +  IVWVANRD P  +++  L
Sbjct  45    LSINQTLISSANKFELGFFSRG-NPRKYYVGIWYKDIPSEGIIVWVANRDAPSWSNSCTL  103

Query  906   KIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
              IG   N+ +++   + +W S  +  Q    N V QLLDSGN V+R   D NP+NY+WQS
Sbjct  104   MIGNQSNLVILNDGSHVVWHSDKSTAQ----NPVLQLLDSGNLVIREAEDHNPDNYIWQS  159

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FD+PTDTL+PG KLGW+ KTG +R+++SW+ P DP  G+ TF +D +G PE ++R+ + I
Sbjct  160   FDHPTDTLIPGQKLGWNLKTGLDRFLTSWKDPDDPGSGNYTFNIDYHGDPEIYMRDGEQI  219

Query  1266  IYRSGGWNGVAFSGVPEMEP-KEVIAFSFMRTKNEVYYSFEIH-NKNLFSRLIVNYTQLL  1439
             IYRSG W G  FSGVPEM        F+F R ++EVYY+FE+     + SRL V +   L
Sbjct  220   IYRSGPWVGQRFSGVPEMATTNNRFNFTFYRGEDEVYYTFELPPGGEVKSRLTVTFDGFL  279

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             +R+TW+P    W R+W A  D CD+YR CGS+G+C+T     C CP GF+P++QQAW LR
Sbjct  280   KRWTWVPTTNQWVRYWYARVDDCDSYRVCGSYGVCNTSGFFDCQCPQGFEPKDQQAWDLR  339

Query  1620  DGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
             DGS GC R  ELDC  DGFL +   KLPES T+FV+  ++LD+C++MC RNCSCTA++N 
Sbjct  340   DGSSGCARKTELDCGNDGFLKLVNMKLPESRTAFVNDGLNLDQCRDMCKRNCSCTAFANS  399

Query  1800  NISNG-GSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVI  1976
              +  G G+GCVIWT  L D+R Y  +GGQ LY+R+AASD          GN   K KK+ 
Sbjct  400   EVIRGVGNGCVIWTDNLTDMRDY-VQGGQDLYIRLAASDLGS-------GNRSDKIKKIA  451

Query  1977  LACgivlgigmv-----lfgllllkrrklrrgVTENIEMR----GTRERSRDPLMNATAI  2129
             +  GI +   M+        +   KR +    +    + R    GT ERS++ L++   +
Sbjct  452   MGVGISIASAMILVGLITLIISKRKRAQNMLLIRRTADTRASRAGTAERSQEILLSGQLM  511

Query  2130  SSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAV  2309
             SSKR++SGET   D+ +LPI+D   +A+AT+NF  ANKLGQGGFG VYKG+L+ G+E+AV
Sbjct  512   SSKRDYSGETKNLDDVDLPIYDLYTLAVATNNFDEANKLGQGGFGRVYKGVLLDGQEVAV  571

Query  2310  KRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFD  2489
             KRLSK S QGA+EFKNELRLIA+LQHRNLV+LLGCCV++DEKMLIYEY++N+SLD+ LF 
Sbjct  572   KRLSKESGQGADEFKNELRLIAKLQHRNLVRLLGCCVEMDEKMLIYEYLKNRSLDAFLFH  631

Query  2490  KKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMA  2669
             K+R+++L+W+ R+NIICG+ARGLLYLHQDSR+RI+HRD+KASN+LLD +MNPKISDFGMA
Sbjct  632   KERNTVLNWQARFNIICGIARGLLYLHQDSRYRIVHRDMKASNILLDGDMNPKISDFGMA  691

Query  2670  RLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYT  2849
             R+FGGD+TE G T+R+VGTYGYM+PEYAMDGLFS+KSD FSFGVLVLE++SG KN+GFY 
Sbjct  692   RIFGGDQTE-GNTRRVVGTYGYMAPEYAMDGLFSIKSDVFSFGVLVLEIISGTKNRGFYN  750

Query  2850  PSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPN  3029
               +E NLLG +W+LW EG+G+ELLD V+  ES S  + +V+RC+QVGLLCVQE+AEDRP 
Sbjct  751   ADHELNLLGYSWKLWREGKGTELLDKVMG-ESFS--IHEVLRCLQVGLLCVQERAEDRPT  807

Query  3030  MAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQS--LNQLTVTMLDAR  3194
             MA+V+LML  +  SLP PK PGFC+   P + DSSS+  +D S  +NQ+TVT L+AR
Sbjct  808   MASVVLMLGSESASLPLPKLPGFCMGWNPNETDSSSSKQDDVSFTVNQVTVTTLNAR  864


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 30/45 (67%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRLLGCC+E  EKMLI      +SLD F+F   +   LNW
Sbjct  596  QHRNLVRLLGCCVEMDEKMLIYEYLKNRSLDAFLFHKERNTVLNW  640



>emb|CAA73133.1| serine /threonine kinase [Brassica oleracea]
Length=847

 Score =   910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/828 (55%), Positives = 596/828 (72%), Gaps = 21/828 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+ S G +F+LGFF P  +S   Y+GIWYK I  RT VWVANRD PL  STG LK
Sbjct  35    ISSNKTISSPGNIFELGFFKPSSSSR-WYLGIWYKAISKRTYVWVANRDHPLSTSTGTLK  93

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ +VDG+  ++WS++ T    V    VA+LLD+GNFV+R  N+ +P+  LWQSF
Sbjct  94    I-SDSNLVVVDGSDTAVWSTNLTGGGDVRSPVVAELLDNGNFVLRDSNNNDPDIVLWQSF  152

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG N ++ SW+SP DPS GD +FKL   G PEAFL NK   +
Sbjct  153   DFPTDTLLPEMKLGWDLKTGFNWFLRSWKSPDDPSSGDYSFKLKTRGFPEAFLWNKASQV  212

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P + I F+F  +  EV YSF I   N++SRL ++ T  L+R+
Sbjct  213   YRSGPWNGIRFSGVPEMQPFDYIEFNFTTSNQEVTYSFHITKDNMYSRLSLSSTGSLQRF  272

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y+ECG++G CD++  PVC C  GF+PRN QAW LRDGS
Sbjct  273   TWIEAIQNWNQFWYAPKDQCDDYKECGTYGYCDSNTYPVCNCMRGFEPRNPQAWGLRDGS  332

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++ + VD  + + EC+E C  +C+CTA++N +I
Sbjct  333   DGCVRKTALSCNGGDGFVRLKKMKLPDTAATSVDRGIGIKECEEKCKSDCNCTAFANTDI  392

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGCV+WT ++ D R Y A+GGQ LYVR+AA+D E T           +  K+I +C
Sbjct  393   RGGGSGCVVWTGDILDTRNY-AKGGQDLYVRLAATDLEDTTN---------RNAKIIGSC  442

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRE-RSRDPLMNATAISSKREHSGETM  2162
               V  + ++ F      +RK +R +   IE     + RS+D LMN   I   R H     
Sbjct  443   IGVSVLLLLCFIFYRFWKRKQKRSIA--IETSFVDQVRSQDLLMNEVVIPPNRRHISREN  500

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
              TD+ ELP+ DF A+A+ATDNF+NANKLGQGGFG VYKG L+ G+EIAVKRLSK S QG 
Sbjct  501   KTDDLELPLMDFEAVAIATDNFSNANKLGQGGFGIVYKGRLLDGQEIAVKRLSKMSVQGT  560

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
             +EFKNE++LIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDK RS  L+W++
Sbjct  561   DEFKNEVKLIARLQHINLVRLLGCCVDEGEKMLIYEYLENLSLDSHLFDKTRSCKLNWQK  620

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R+ I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETEA 
Sbjct  621   RFVITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-  679

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
              T+++VGTYGYMSPEYAMDG+FS KSD FSFGVL+LE++SG++N+GFY   ++ NLLG  
Sbjct  680   NTRKVVGTYGYMSPEYAMDGIFSTKSDVFSFGVLLLEIISGKRNKGFYNSDHDLNLLGCV  739

Query  2883  WRLWGEGRGSELLDSVIASESHSEFVD-QVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             WR W +G+G +++D +I   S S +   +++RCI++GLLCVQE+A DRP M++V++ML  
Sbjct  740   WRNWKKGKGLDIVDPIILDSSPSTYRPLEILRCIKIGLLCVQERANDRPTMSSVVMMLGS  799

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             +  ++PQP+QPG+C+   P+  DSSS++       S+NQ+TV+++D R
Sbjct  800   ETAAIPQPEQPGYCVGRSPLDTDSSSSNQRHDESWSVNQMTVSVIDPR  847


 Score = 57.8 bits (138),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+  +LNW K
Sbjct  574  QHINLVRLLGCCVDEGEKMLIYEYLENLSLDSHLFDKTRSCKLNWQK  620



>gb|KFK28717.1| hypothetical protein AALP_AA7G037900 [Arabis alpina]
Length=848

 Score =   910 bits (2351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/825 (55%), Positives = 589/825 (71%), Gaps = 19/825 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ NQT+VS G +F+LGFF P   S   Y+GIWYK+I  RT VWVAN D PL N  G LK
Sbjct  40    ISSNQTIVSPGNIFELGFFKPSSKSL-WYLGIWYKKIPKRTYVWVANSDSPLSNPIGTLK  98

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ + D     +WS+ N     V    VA+LLD+GNFV+R  N+ +   +LWQSF
Sbjct  99    IS-DNNLVIFDQFDERVWST-NLTRGDVRSPVVAELLDNGNFVLRESNNISQNVFLWQSF  156

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR++SSWRS  DPS GD +FK +  G PEAFL N++  +
Sbjct  157   DFPTDTLLPEMKLGWDLKTGINRFLSSWRSQDDPSSGDFSFKFETRGFPEAFLWNRESQV  216

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEMEP + + F+F  +  EV YS+ I   N++SRL ++    LER+
Sbjct  217   YRSGPWNGIQFSGVPEMEPFDYMVFNFTMSNQEVSYSYRIIKNNIYSRLSLSSKGSLERF  276

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y ECG +G CD++ SPVC C  GFKPRN+QAW LRDGS
Sbjct  277   TWIESEQSWNQFWYAPKDQCDDYNECGIYGYCDSNTSPVCNCIKGFKPRNEQAWGLRDGS  336

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
             GGC R  EL C   DGF+ +   KLP+++ + VD+ + + EC+E CV++C+CTA++N +I
Sbjct  337   GGCVRKTELSCDGGDGFVRLEKMKLPDTTGAIVDSGLGVKECEEKCVKDCNCTAFANMDI  396

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
              NGGSGCVIWT E+ DIR Y A+GGQ LYVR+AA+D E   +  + G   G +  VI+  
Sbjct  397   RNGGSGCVIWTGEILDIRNY-AKGGQDLYVRLAATDLEN--KRNKIGKIIGSSIGVIVLL  453

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              +   I                  V +         RS D LMN   ISS+R H      
Sbjct  454   LLCFIIFRFWNRKQKPSLEIEAPIVDQ--------VRSHDFLMNEVVISSRR-HISRDYN  504

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
              ++ ELP+ +F  +A+AT+NF+NANKLG+GGFG VYKG L+ G+EIAVKRLSK S QG +
Sbjct  505   AEDLELPLMEFEDVAIATNNFSNANKLGEGGFGIVYKGRLLEGQEIAVKRLSKTSIQGID  564

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LLGCCVD DEK+LIYEY+EN SL+S LFDK RS  L+W+ R
Sbjct  565   EFKNEVKLIARLQHINLVRLLGCCVDEDEKILIYEYLENLSLNSHLFDKIRSCNLNWQMR  624

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLK SN+LLDK+M PKISDFGMAR+FG DETEA  
Sbjct  625   FSIINGIARGLLYLHQDSRFRIIHRDLKTSNILLDKDMTPKISDFGMARIFGRDETEA-N  683

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FSVKSD FSFGVL+LE++SG++N GFY    + NLL   W
Sbjct  684   TRKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLLLEIISGKRNTGFYNLDRDLNLLACVW  743

Query  2886  RLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK  3062
             R W +GRG E++D +I   S S F   +V+RCIQ+GLLCVQE+AEDRP M+++M+ML  +
Sbjct  744   RYWKKGRGLEIVDPIIIDSSPSTFRPPEVLRCIQIGLLCVQERAEDRPTMSSIMVMLGSE  803

Query  3063  GTSLPQPKQPGFCLASKPVKMDSSST-SYNDQSLNQLTVTMLDAR  3194
              T + QPK PG+C+   P+  DSSS+  ++D+S+NQ+TV+++D R
Sbjct  804   TTPIRQPKPPGYCVGRIPLDTDSSSSKQHDDESVNQITVSVIDPR  848



>gb|KCW76538.1| hypothetical protein EUGRSUZ_D00925 [Eucalyptus grandis]
Length=831

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/834 (55%), Positives = 597/834 (72%), Gaps = 44/834 (5%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNST-  896
             N  +  +QTL SA +VFQLGFF+   ++   YVGIWYK I DRT VWVANRD P+ NS+ 
Sbjct  33    NGLIASDQTLASANDVFQLGFFTL--DNAHYYVGIWYKNIPDRTYVWVANRDTPVTNSSS  90

Query  897   GFLKIGEDGN-IHLVDGTGNSI-WSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPEN  1070
                KIG+ GN + ++D    +I WSS+ T   S P N VA+LLD+GN V+R   DE+  N
Sbjct  91    AVFKIGDKGNNVVILDQANKTILWSSNQTRANSSPVNPVARLLDNGNLVIREAGDESNSN  150

Query  1071  YLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLR  1250
             YLWQSFD+PTDTLLP MKLGWD   G NR+++SW++P DPS GD +FK+D +G PE FL 
Sbjct  151   YLWQSFDFPTDTLLPEMKLGWDLTRGLNRFLNSWKTPQDPSSGDFSFKIDYHGYPEIFLW  210

Query  1251  NKDIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYT  1430
             +K   +YRSG WNG+ FSGVPEM+    I F+F+  + +                     
Sbjct  211   DKSTKLYRSGPWNGIRFSGVPEMQSSSAIDFTFVSNQQQ---------------------  249

Query  1431  QLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAW  1610
                 R+TW+ +++ W+ FW APKDQCD++ ECG +GICDT+ SPVC C  GF P+N QAW
Sbjct  250   ----RFTWVEDSKSWSMFWEAPKDQCDHFSECGPYGICDTNASPVCNCTPGFSPKNLQAW  305

Query  1611  SLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAY  1790
             + RDGS GC R  +L+C +DGFL     KLPESS + VD  MS+D+C++ C +NCSCT Y
Sbjct  306   NFRDGSAGCVRRTDLNCSSDGFLLFKGMKLPESSNTIVDMEMSVDDCQKGCAKNCSCTGY  365

Query  1791  SNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVA---RGGNGFGK  1961
             S+ NISNG +GCV+W  +L DIR Y   GGQ  YV+++ASD    G +       NG G 
Sbjct  366   SSANISNGKAGCVMWFGDLLDIRHYVG-GGQDFYVKLSASDIVALGGLVTQNSSSNGLGT  424

Query  1962  TKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSR--DPLMNATAISS  2135
                V +A G  + +      L+  ++  L   +  N E +G RERS+  D L+N    SS
Sbjct  425   LAIVGIAAGGSVLLLAFTAFLMWKRKTSLNSHI-RNTEQQGARERSQGQDFLLNEVVSSS  483

Query  2136  KREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKR  2315
             KR+++GE    +  ELP+F FNAIA+AT NF++ NKLGQGGFGSVY+  +  G  +AVKR
Sbjct  484   KRDYTGENK-PEVLELPLFAFNAIALATKNFSDENKLGQGGFGSVYQCRIEEGPVVAVKR  542

Query  2316  LSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKK  2495
             LSKNS QG EEFKNE++LIARLQHRNLV+L+GCCV++DEK+LIYEYME+KSLDS+LF K 
Sbjct  543   LSKNSGQGVEEFKNEVQLIARLQHRNLVRLIGCCVEMDEKILIYEYMEHKSLDSVLFSKT  602

Query  2496  RSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARL  2675
             +SS+L+W+RR+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLD E+NPKISDFGMAR+
Sbjct  603   KSSMLNWERRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDGELNPKISDFGMARI  662

Query  2676  FGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPS  2855
             FG D+ EA  TKR+VGTYGYM+PEYAMDGLFS KSD FSFGVLVLE++SG+KN+GFY P+
Sbjct  663   FGRDQVEA-NTKRVVGTYGYMAPEYAMDGLFSEKSDVFSFGVLVLEIISGKKNRGFYYPN  721

Query  2856  NEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMA  3035
             +E NLL  +W+ W EG+G ELLDS +  +++S  +++V+RCIQVGLLCVQE+A DRP M 
Sbjct  722   DERNLLEHSWKFWKEGKGLELLDSAVG-DAYS--MNEVLRCIQVGLLCVQERANDRPVML  778

Query  3036  AVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-SLNQLTVTMLDAR  3194
             +V+LML  +  ++P PK PGF L  + ++ DSSS+ ++   ++NQ+TVTM DAR
Sbjct  779   SVVLMLSSENPTMPHPKIPGFRLG-RAIETDSSSSKHDGTCTVNQVTVTMPDAR  831


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRL+GCC+E  EK+LI      KSLD+ +F  TK + LNW
Sbjct  565  QHRNLVRLIGCCVEMDEKILIYEYMEHKSLDSVLFSKTKSSMLNW  609



>ref|XP_008227365.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Prunus mume]
Length=880

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/842 (57%), Positives = 604/842 (72%), Gaps = 40/842 (5%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNS-TGFL  905
             L  +QTLVSA +VF+LG F PG  S   Y+GIWYK I+++T+VWVANR+ PL NS +  L
Sbjct  59    LQHDQTLVSASDVFELGLFKPGTTSD-WYLGIWYKNIQEKTVVWVANRNTPLWNSYSATL  117

Query  906   KIGEDGNIHLVDGTGNSI-WSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDE---NPENY  1073
             KIG+ GN+ LVD     I WSS+ T  Q+V  N +AQLLDSGN V++  N       + +
Sbjct  118   KIGDHGNLVLVDEETKKIAWSSNET--QAV--NPIAQLLDSGNLVLKEANSTRNGTTDEF  173

Query  1074  LWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRN  1253
             LWQSFDYPT+TLLP MKLGW+  TG +RYI+SW+S  DPS GD +FKL+  G PE FL N
Sbjct  174   LWQSFDYPTNTLLPDMKLGWNLSTGLDRYITSWKSIEDPSTGDFSFKLNHQGFPEIFLWN  233

Query  1254  KDIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNK--NLFSRLIVNY  1427
             K  I YRSG WNG  FSGVPEM     I F+F+   +EVYYS+ I      ++SRL V+ 
Sbjct  234   KQNITYRSGPWNGERFSGVPEMTASNNIRFNFVAKPDEVYYSYSILGNLGPIYSRLTVSP  293

Query  1428  TQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQA  1607
             T  L+R+ WI    IWN++W APKDQCD +RECG +G+CD++ SPVC C  GF P+N QA
Sbjct  294   TGDLQRFIWIESANIWNQYWYAPKDQCDRFRECGPYGVCDSNASPVCKCLEGFGPKNLQA  353

Query  1608  WSLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTA  1787
             W+LRDGS GC R  EL C  D FL +   KLPES  +FVD  MSL+ CK+ C+ NC+C+A
Sbjct  354   WNLRDGSDGCVRKTELGCLKDKFLVLENMKLPESGGAFVDMNMSLESCKKTCLENCNCSA  413

Query  1788  YSNYNISNG-GSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKT  1964
             YS+  ISNG GSGCV+WT +L D+RQY AEGGQ  YVR+AAS+          G   GK 
Sbjct  414   YSDARISNGEGSGCVMWTGKLMDLRQY-AEGGQSFYVRLAASEL---------GGDHGKA  463

Query  1965  KKVILACgivlgigmvlfgllllkrrklrrgVT------ENIEMRGTRERSRDPLMNATA  2126
             K+VI+   I + I  +L    L+     +R +       E+ +++G+ ER+ D L++   
Sbjct  464   KRVIMIVVITVSICCILLLSGLVIYFIRKRNLNLPIAHRESSKLKGSFERNWDSLLSEVV  523

Query  2127  ISSKREH-SGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEI  2303
             ISS+R+  SGE    +  +LP+FDFN +A+ATDNF+N NKLG+GGFG VYKG LV G+E+
Sbjct  524   ISSRRDFCSGEKSNDELDQLPLFDFNTLAVATDNFSNRNKLGEGGFGCVYKGTLVDGQEV  583

Query  2304  AVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSIL  2483
             AVKRLS NS QG EEFKNE+ LIARLQHRNLV+LLG C+D DEKML YEYMENKSL SIL
Sbjct  584   AVKRLSTNSEQGTEEFKNEVELIARLQHRNLVRLLGFCIDEDEKMLTYEYMENKSLHSIL  643

Query  2484  FDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFG  2663
             F++ R S+LDW++R+ IICG+ARGL+YLHQDSR RIIHRDLKASN+LLD ++ PKISDFG
Sbjct  644   FNRARRSMLDWQKRFKIICGIARGLIYLHQDSRLRIIHRDLKASNILLDGDLAPKISDFG  703

Query  2664  MARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGF  2843
             MARLF  D+TE   T+R+VGT+GYM+PEYAMDGLFS KSD FSFGVLVLE++SG++N+GF
Sbjct  704   MARLFCNDQTEE-NTRRVVGTFGYMAPEYAMDGLFSTKSDVFSFGVLVLEIISGKRNKGF  762

Query  2844  YTPSNEENLLGLAWRLWGEGRGSELLDSVIA-SESHSEFVDQVMRCIQVGLLCVQEKAED  3020
             Y+ + E NLLG AW+LW EG+G E++D  +  S SHSE    V+RC+QVGLLCVQE+AED
Sbjct  763   YSSNTELNLLGNAWKLWNEGKGLEMIDPDVGESYSHSE----VLRCMQVGLLCVQERAED  818

Query  3021  RPNMAAVMLML-IGKGTSLPQPKQPGFCL--ASKPVKMDSSSTSYND-QSLNQLTVTMLD  3188
             RP MA+V+LML  G  T++P PK PGFCL      V+ DSSS    +  S+NQ+T++ L 
Sbjct  819   RPTMASVVLMLSSGTATTMPNPKNPGFCLEGTESAVEADSSSDKQEEGYSVNQVTISTLV  878

Query  3189  AR  3194
              R
Sbjct  879   GR  880



>ref|XP_006391515.1| hypothetical protein EUTSA_v10018118mg [Eutrema salsugineum]
 gb|ESQ28801.1| hypothetical protein EUTSA_v10018118mg [Eutrema salsugineum]
Length=848

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/821 (55%), Positives = 602/821 (73%), Gaps = 22/821 (3%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             +T+ S  E+F+LGFF+   +S   Y+GIWYK+I  RT VWVANRD PL NS G LKI  D
Sbjct  47    KTIRSPSEIFELGFFNLASSSR-WYLGIWYKKIPTRTYVWVANRDHPLSNSNGTLKIS-D  104

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
              N+ + D +G  +WS+ N     V    VA+LLD+GNFV+R  N  NP+ +LWQSFD+PT
Sbjct  105   NNLVIFDQSGTLVWST-NLTRGDVRSLLVAELLDNGNFVLRDSN--NPDGFLWQSFDFPT  161

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DTLLP MKLGWD KTG NR+++SW+ P DPS GD   KL+  G PE ++ NKD I+YRSG
Sbjct  162   DTLLPEMKLGWDKKTGINRFLTSWKDPDDPSSGDFFTKLETRGFPEFYVCNKDSILYRSG  221

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ FS +PEMEP + I ++F  +  EV YS+EI   N++ R+ ++ T L +R+TWI 
Sbjct  222   PWNGIRFSTIPEMEPIDYIVYNFTASNEEVTYSYEITKANIYGRVSLSTTGLFQRFTWIE  281

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
               + W + W +PKD CDNY+ECG++G CD++ SPVC C  GFKP N++AW+LRD S GC 
Sbjct  282   TAQSWKQLWYSPKDLCDNYKECGNYGYCDSNTSPVCNCIKGFKPINEKAWALRDDSAGCV  341

Query  1641  RYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGG  1817
             R  +L C + DGF+ +   KLP+++ + VD  + + EC+E C+++C+CTA++N +I NGG
Sbjct  342   RKTKLSCDSRDGFMRLKKMKLPDTTATTVDRGIGVKECEERCLKDCNCTAFANTDIRNGG  401

Query  1818  SGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivl  1997
             SGCVIWT ++FDIR Y A GGQ LYVR+AA+D E      R  NG     K+I +   V 
Sbjct  402   SGCVIWTGDIFDIRNY-ARGGQDLYVRLAAADLED----KRTKNG-----KIIGSSIGVS  451

Query  1998  gigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEY  2177
              + ++ F +    +R+ +R ++  I+    + +S+D LM    I S+R  S E   TD+ 
Sbjct  452   ILLLLSFIIFCFWKRRQKRSIS--IKTSIDQVKSQDSLMKEVVIPSRRFKSRENN-TDDL  508

Query  2178  ELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKN  2357
             ELP+ +F A++MAT+NF+NANKLGQGGFG VYKG LVGG+EIAVKRLSK S QG +EF N
Sbjct  509   ELPLMEFEAVSMATNNFSNANKLGQGGFGIVYKGRLVGGKEIAVKRLSKISLQGTDEFTN  568

Query  2358  ELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNII  2537
             E+RLIARLQH NLV+LLGCC+D  EKMLIYEY+EN+SLDS LFDK R S  +W++R++I 
Sbjct  569   EVRLIARLQHLNLVRLLGCCIDKGEKMLIYEYLENRSLDSHLFDKTRRSNFNWQKRFDIT  628

Query  2538  CGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRI  2717
              G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMAR+FG DETEA  T+ +
Sbjct  629   NGIARGLLYLHQDSRFRIIHRDLKASNILLDKNMTPKISDFGMARIFGRDETEAN-TRNV  687

Query  2718  VGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWG  2897
             VGTYGYMSPEYAM+G+FS+KSD FSFGVL+LE++ G+++ GFY  + + +LLG  WR W 
Sbjct  688   VGTYGYMSPEYAMNGIFSIKSDVFSFGVLLLEIIIGKRSTGFYNSTGDLSLLGYVWRNWK  747

Query  2898  EGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSL  3074
             EG+G E++D VI   S S F   +V+RC+Q+GLLCVQE+AEDRP M++VM+ML  + T +
Sbjct  748   EGKGLEIVDPVIIDSSSSTFRTHEVLRCLQIGLLCVQERAEDRPVMSSVMVMLGSENTVI  807

Query  3075  PQPKQPGFCLASK-PVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             PQPK+PGFC+ S+ P++++SS    N+ ++NQ+T++++DAR
Sbjct  808   PQPKRPGFCIGSRSPLEIESSKQPDNEWTVNQITLSVIDAR  848


 Score = 61.6 bits (148),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCCI+ GEKMLI      +SLD+ +FD T+R+  NW K
Sbjct  577  QHLNLVRLLGCCIDKGEKMLIYEYLENRSLDSHLFDKTRRSNFNWQK  623



>gb|ADQ37374.1| unknown [Arabidopsis lyrata]
Length=923

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/843 (53%), Positives = 589/843 (70%), Gaps = 43/843 (5%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N T+VS G VF+LGFF PG NS   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  41    ISSNNTIVSPGNVFELGFFKPGSNSR-WYLGIWYKTISKRTYVWVANRDTPLSSSIGTLK  99

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I ++ N+ ++D +   +WS+ N     V    VA+LLD+GNFV+R   + +P+  LWQSF
Sbjct  100   ISDNNNLVVLDQSDTPVWST-NLTGGDVRSPLVAELLDNGNFVLRDSKNNSPDGVLWQSF  158

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR+I SW+SP DPS GD  FKL+  G PE FL N++  +
Sbjct  159   DFPTDTLLPEMKLGWDLKTGFNRFIRSWKSPDDPSSGDFWFKLEAEGFPEVFLWNRESRV  218

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P E + F+F  ++ EV YSF +   +++SRL ++   LL+R+
Sbjct  219   YRSGPWNGIRFSGVPEMQPFEYMVFNFTTSREEVTYSFRVTKSDIYSRLSLSSRGLLQRF  278

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD+Y+ECG++G CD++ SPVC C  GFKP+N Q W LRDGS
Sbjct  279   TWIETAQNWNQFWYAPKDQCDDYKECGTYGYCDSNTSPVCNCIKGFKPKNPQVWGLRDGS  338

Query  1629  GGCFRYDELDC-PTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   KLP+++T+ VD  + + EC++ C+++C+CTA++N +I
Sbjct  339   DGCVRKTVLSCGGGDGFVRLKKMKLPDTTTASVDRGIGVKECEQKCLKDCNCTAFANTDI  398

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARG--GNGFGKTKKVIL  1979
               GGSGCV WT ELFDIR Y A+GGQ LY+R+AA+D E     +    G+  G +  ++L
Sbjct  399   RGGGSGCVTWTGELFDIRNY-AKGGQDLYIRLAATDLEDNRNRSAKIIGSSIGVSVLILL  457

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
             +      I   L+     +   +   + + +       RSRD LMN   ISS+R  S E 
Sbjct  458   S-----FIIFFLWKKKQKRSILIETPIVDQV-------RSRDLLMNEVVISSRRHISREN  505

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
               TD+ ELP+ +F  +AMATDNF+ ANKLGQGGFG VYKG L+ G+E+AVKRLSK S QG
Sbjct  506   N-TDDLELPLMEFEEVAMATDNFSKANKLGQGGFGIVYKGKLLDGQEMAVKRLSKTSVQG  564

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EFKNE++LIARLQH NLV+LL CCVD                     DK RSS L+W+
Sbjct  565   TDEFKNEVKLIARLQHINLVRLLACCVDA--------------------DKSRSSKLNWQ  604

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
              R++II G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMAR+FG DETEA
Sbjct  605   MRFDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEA  664

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
              +T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY    + NLLG 
Sbjct  665   -STRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGC  723

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
              WR W EG+G E++D +I   S +    +++RCIQ+GLLCVQE+AEDRP M+ V+LML  
Sbjct  724   VWRNWKEGKGLEIIDPIITESSSTFRQHEILRCIQIGLLCVQERAEDRPTMSLVVLMLGS  783

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR*LIHVRPWSLLW  3230
             + T++PQPK PG+CL   P+  DSSS+  +D    ++NQ+TV++LDAR       + +LW
Sbjct  784   ESTTIPQPKSPGYCLGRSPLDTDSSSSKQHDDESWTVNQITVSVLDARKEKDSSKYHILW  843

Query  3231  HSL  3239
              SL
Sbjct  844   GSL  846



>gb|AGN12878.1| putative receptor kinase 3 [Sisymbrium irio]
Length=942

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/827 (54%), Positives = 586/827 (71%), Gaps = 22/827 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             L+ N T+ S G +F+LGFF P   S   Y+G+WYK I  RT VWVANRD PL +S G LK
Sbjct  43    LSSNNTISSLGNIFELGFFKPASASR-WYLGVWYKVISKRTYVWVANRDHPLSSSIGTLK  101

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ L+D +   +WS+ N     V    VA+LLD+GNFV+R   + +P+  LWQSF
Sbjct  102   IS-DSNLVLLDQSDTPVWST-NLTRGDVTSPVVAELLDNGNFVLRDSENNSPDGVLWQSF  159

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR++ SW+S  DPS GD +F+L+  G PE+FL NK+  +
Sbjct  160   DFPTDTLLPEMKLGWDLKTGYNRFLRSWKSLDDPSSGDFSFRLETRGFPESFLWNKESRV  219

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P + + F+F  + + V YSF I   N++SRL ++ T  L+R+
Sbjct  220   YRSGPWNGIRFSGVPEMQPFDYMVFNFTASNDVVTYSFHITKNNIYSRLSLSSTGSLQRF  279

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN+FW APKDQCD Y+ECG++G CD++ SPVC C  GF+PRN Q W LRDGS
Sbjct  280   TWIESAQNWNQFWYAPKDQCDEYKECGTYGYCDSNTSPVCNCIRGFEPRNPQVWGLRDGS  339

Query  1629  GGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R  EL C   DGF+ +   KLP+++ S VD  +   +C+E C ++C+CTA++N +I
Sbjct  340   DGCVRKTELSCEGGDGFVRLKKMKLPDTTASSVDRGIGTRQCEEKCKKDCNCTAFANTDI  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
              +GG GCV WT E+ DIR Y A+GGQ LYVR+AA+D +   E  R     G    V +  
Sbjct  400   RDGGFGCVTWTGEISDIRNY-AKGGQDLYVRLAATDLDD--ERNRSAKIIGSIIGVGVLL  456

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              ++  I                  V +         RS+D LMN   ISS+R  S E   
Sbjct  457   LLLSFIIFCWKRKQKRSMAIETPFVDQ--------VRSQDLLMNEVVISSRRHISRENK-  507

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T++ ELP+ +F+A+++ATD F+NANKLGQGGFG VYKG L+ G+EIAVKRLSK S QG  
Sbjct  508   TEDLELPLMEFDAVSIATDKFSNANKLGQGGFGIVYKGRLLDGQEIAVKRLSKMSVQGTG  567

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE+RLIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLD  LFDK R S L+W+ R
Sbjct  568   EFKNEVRLIARLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDFHLFDKTRRSNLNWQTR  627

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASNVLL K+M PKISDFGMAR+FG +E EA  
Sbjct  628   FDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLGKDMTPKISDFGMARIFGREEGEA-I  686

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  + + NLLG  W
Sbjct  687   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNRGFYDSNRDLNLLGCVW  746

Query  2886  RLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK  3062
             R W EG G E++D +I +ES S F   ++ RCIQ+GLLCVQE+A+DRP M++V+LM   +
Sbjct  747   RYWKEGNGFEIVDPII-TESPSTFRPHEIFRCIQIGLLCVQERADDRPMMSSVVLMFGSE  805

Query  3063  GTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              T++PQPK PG+C+   P++ DSSS+  +D    ++NQ+TV++LDAR
Sbjct  806   TTAIPQPKPPGYCVGRSPLETDSSSSKQHDDEYWTVNQMTVSVLDAR  852


 Score = 58.2 bits (139),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLLGCC++ GEKMLI       SLD  +FD T+R+ LNW
Sbjct  580  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDFHLFDKTRRSNLNW  624



>ref|XP_006449173.1| hypothetical protein CICLE_v100142551mg, partial [Citrus clementina]
 gb|ESR62413.1| hypothetical protein CICLE_v100142551mg, partial [Citrus clementina]
Length=761

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/717 (64%), Positives = 538/717 (75%), Gaps = 24/717 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             LT  +TLVS+ +VF+LGFFSPG +SG  Y+GIWYK I  RT VWVANRD PL NS+G L+
Sbjct  66    LTNGKTLVSSDDVFELGFFSPG-SSGKWYIGIWYKNIVQRTYVWVANRDDPLANSSGVLR  124

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  +  I L DG+ N +WSS    NQ+   N VAQL DSGNFV++   +   +  LWQSF
Sbjct  125   I-INQRIGLFDGSQNLVWSS----NQTKATNPVAQLQDSGNFVLK---EAGSDEILWQSF  176

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             DYPTDTLLP MK+GWD KTG   Y++SW+S  DPS GD +FKLD +G PE FL NK    
Sbjct  177   DYPTDTLLPQMKIGWDLKTGFEWYLTSWKSTDDPSTGDNSFKLDFHGFPEGFLWNKQERK  236

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSF-MRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             YRSG WNGV FSGVPEM+P E I F F +   ++VYYSF I NKNLFSRLIV+    L+R
Sbjct  237   YRSGPWNGVRFSGVPEMKPIEGINFEFFIDQDHDVYYSFFIENKNLFSRLIVSPDGFLQR  296

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             +TWI  N+IWN FW APKDQCDNY ECG FGICDT+ SPVC C  GF+P++ QAWSLRDG
Sbjct  297   FTWIEANKIWNPFWYAPKDQCDNYGECGPFGICDTNASPVCQCMRGFEPKDPQAWSLRDG  356

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
             SGGC R  EL C  D FL +   KLP+++TSFVD  M+L EC+  C RNCSCTAY+N NI
Sbjct  357   SGGCVRKTELQCSEDKFLQLKNMKLPDTTTSFVDYNMTLKECEAFCSRNCSCTAYANTNI  416

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
             + GG+GCV WT EL DIR+Y AEGGQ LYVR+AASD      +A G N    T  +I   
Sbjct  417   T-GGTGCVTWTGELKDIRKY-AEGGQDLYVRLAASD------IADGANA---TPIIIGVT  465

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
                  + + L    L +R+ L        E RG  ERS+D L+N   ISSKR++S E   
Sbjct  466   VGSAILILGLVACFLWRRKTLLDRQIRKTERRGHPERSQDLLLNQVVISSKRDYSAEK--  523

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+FDF  I  ATDNF + NKLGQGGFG VYKG L+ G+EIAVKRLS+NS QG E
Sbjct  524   TDDLELPLFDFETIVRATDNFPDYNKLGQGGFGIVYKGRLLEGQEIAVKRLSRNSGQGIE  583

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFK E+RLIA+LQHRNLV+LLGCCV+ DEKML+YEYMEN+SLDS++FDK RSS+L+W+RR
Sbjct  584   EFKTEVRLIAKLQHRNLVRLLGCCVETDEKMLVYEYMENRSLDSVIFDKARSSILNWQRR  643

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             +NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLDKEM PKISDFGMAR+FGGD+TE   
Sbjct  644   FNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKEMTPKISDFGMARIFGGDQTEQ-N  702

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             TKR+VGTYGYMSPEYAMDGLFSVKSD FSFGVL+LE VSG+KN+GFY  +NE NLLG
Sbjct  703   TKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLLLETVSGKKNRGFYHSNNELNLLG  759


 Score = 56.6 bits (135),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCC+E  EKML+      +SLD+ +FD  + + LNW +
Sbjct  596  QHRNLVRLLGCCVETDEKMLVYEYMENRSLDSVIFDKARSSILNWQR  642



>emb|CAA74661.1| SFR1 [Brassica oleracea var. viridis]
Length=849

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/825 (53%), Positives = 581/825 (70%), Gaps = 27/825 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+T++S  E+F+LGFF+P  +S   Y+GIWYK++  RT VWVANRD PL +S G L I  
Sbjct  46    NKTILSRSEIFELGFFNPPSSSR-WYLGIWYKKVSTRTYVWVANRDNPLLSSNGTLNIS-  103

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDEN-PENYLWQSFDY  1094
             D N+ + D +   +WS++ T  + V    VA+LLD+GNFV+R  N+ N P+ YLWQSFD+
Sbjct  104   DSNLVIFDQSDTPVWSTNLTEGE-VRSPVVAELLDNGNFVLRHLNNNNDPDGYLWQSFDF  162

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PTDTLLP M+LGWD KTGR+R++ SW++P DPS GD   KL   G PE ++ +KD IIYR
Sbjct  163   PTDTLLPEMRLGWDHKTGRDRFLRSWKTPDDPSSGDFFTKLKTKGFPEFYVCSKDSIIYR  222

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             SG WNG+ FS  PE +P + I ++F  T  EV YS+ I   N++ R+ ++   LLER TW
Sbjct  223   SGPWNGIRFSSSPETKPLDYIVYNFTATNEEVSYSYLITKTNIYERVRLSSAGLLERLTW  282

Query  1455  IPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGG  1634
             I   + W + W +PKD CDNY+ECGS+G CD++ SP+C C  GF P NQQ W+LRD S G
Sbjct  283   IETAQSWKQLWYSPKDLCDNYKECGSYGYCDSNTSPICNCIKGFGPGNQQPWTLRDDSAG  342

Query  1635  CFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             C R   L C   DGF+ +   KLP+++ + VD  + L EC+E C+++C+CTA++N +I N
Sbjct  343   CVRKTRLSCDGRDGFVRLKKMKLPDTTATTVDRGIGLKECEERCLKDCNCTAFANTDIRN  402

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARG---GNGFGKTKKVILA  1982
             GGSGCVIWT E+FDI+ + A+GGQ L+VR+AA+D E      R    G   G +  ++L+
Sbjct  403   GGSGCVIWTGEIFDIKNF-AKGGQDLFVRLAAADLEDKRTKKRNIILGLSIGVSILLLLS  461

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETM  2162
               I                        +++ +      S+D LMN   ISSKR  SG+ M
Sbjct  462   FIIFRFWKRKQK---------------QSVAIPKPIVTSQDSLMNEVVISSKRHLSGD-M  505

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
              T++ ELP+ DF AIA AT NF++ NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG 
Sbjct  506   KTEDLELPLMDFEAIATATHNFSSTNKLGQGGFGIVYKGRLLDGKEIAVKRLSKMSLQGT  565

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
             +EFKNE+RLIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDK R S L+W+ 
Sbjct  566   DEFKNEVRLIARLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKSRRSNLNWQL  625

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R++I  G+ARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  DETEA 
Sbjct  626   RFDIANGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFRRDETEAN  685

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
              T+++VGTYGYMSPEYAM+G+FSVKSD FSFGVL+LE++SG+++ GFY  S + +LLG  
Sbjct  686   -TRKVVGTYGYMSPEYAMNGIFSVKSDVFSFGVLLLEIISGKRSTGFYNSSGDLSLLGCV  744

Query  2883  WRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             WR W E +G +++D +I     S F   +++RCI +GLLCVQE+AEDRP M++VM+ML  
Sbjct  745   WRNWKERKGLDIIDPIIIDSLSSTFKTHEILRCIHIGLLCVQERAEDRPAMSSVMVMLGS  804

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             + T+LP+PKQP FC+   P++ + S    ++ ++NQ+T++++DAR
Sbjct  805   ETTTLPEPKQPAFCVGRGPLEAELSKLGDDEWTVNQITLSVIDAR  849


 Score = 57.4 bits (137),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD ++R+ LNW
Sbjct  579  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKSRRSNLNW  623



>ref|XP_006391517.1| hypothetical protein EUTSA_v10018116mg [Eutrema salsugineum]
 gb|ESQ28803.1| hypothetical protein EUTSA_v10018116mg [Eutrema salsugineum]
Length=852

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/830 (53%), Positives = 588/830 (71%), Gaps = 25/830 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+ S  E+F+LGFF+   +S   Y+GIWYK+I  RT VWVANRD PL +S G LK
Sbjct  40    ISSNKTIRSPSEIFELGFFNLASSSR-WYLGIWYKKIPTRTYVWVANRDNPLSSSNGTLK  98

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ + D +   +WS+ N     V    VA+LLD+GNFV+R   + + + YLWQSF
Sbjct  99    IS-DNNLVIFDQSDTPVWST-NLTGVDVRSPMVAELLDNGNFVLRDSTNNDRDRYLWQSF  156

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR++ SW+SP DPS GD + KL+    PE ++ NKD I 
Sbjct  157   DFPTDTLLPEMKLGWDLKTGINRFLRSWKSPDDPSSGDFSTKLETRRFPEFYVYNKDSIS  216

Query  1269  YRSGGWNGVAF-SGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             YRSG WNG  F S VPEM+P + +A++F  +  EV YS+ I   N++SR+ ++ T L +R
Sbjct  217   YRSGPWNGFRFGSDVPEMKPVDYLAYNFTASNEEVTYSYLITKTNIYSRVSLSSTGLFQR  276

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             +TW+   + W++ W +PKD CDNY++CG+FG CD++ SPVC C  GFKPRN+Q   +RD 
Sbjct  277   FTWLERAQTWDQLWYSPKDLCDNYKQCGNFGYCDSNTSPVCNCIKGFKPRNEQVQEMRDD  336

Query  1626  SGGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             S GC R   L C   DGF+ +   KLP+++ + VD  + L EC+E C+++C+CTA++N +
Sbjct  337   SEGCTRKTRLSCDRGDGFVLLKKMKLPDTTVAIVDRDIGLKECEERCLKDCNCTAFANTD  396

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDA--EQTGEVARGGNGFGKTKKVI  1976
             I NGGSGC IWT E+ D+R + A+GGQ LY+R+AA D   ++T  V   G+  G +  ++
Sbjct  397   IRNGGSGCAIWTGEILDVRNH-AKGGQDLYIRLAAVDLADKRTRNVKIIGSSIGVSILLL  455

Query  1977  LACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGE  2156
             L+  I           + +++      V           RS D L N   I S+R  S E
Sbjct  456   LSFIIFCCWKRKQKRSIAVQKPFAVNQV-----------RSLDWLTNEEVIPSRRHISRE  504

Query  2157  TMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQ  2336
                TD+ ELP+ +F A+A+AT+NF+N+ KLGQGGFG VYKG L+ G+EIAVKRLSK S Q
Sbjct  505   KK-TDDVELPLIEFEAVAVATNNFSNSKKLGQGGFGIVYKGRLLDGKEIAVKRLSKMSLQ  563

Query  2337  GAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
             G +EFKNE+ LIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDK R S L+W
Sbjct  564   GTDEFKNEVILIARLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKTRRSNLNW  623

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
             K R+ I  G+ARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+FG DETE
Sbjct  624   KMRFEITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMTPKISDFGMARIFGRDETE  683

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             A  T+R+VGTYGYMSPEYAM+G+FSVKSD FSFGVL+LE++SG+++ GFY  + + +LLG
Sbjct  684   AN-TRRVVGTYGYMSPEYAMNGIFSVKSDVFSFGVLLLEIISGKRSTGFYNSTGDLSLLG  742

Query  2877  LAWRLWGEGRGSELLDSVIASE-SHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLM  3050
               WR W EG+G E++D +I ++ S + F  D+V+RCIQ+GLLCVQE AEDRP M++VM+M
Sbjct  743   CVWRYWKEGKGLEIVDPIIINDLSSAPFRTDEVLRCIQIGLLCVQEHAEDRPLMSSVMVM  802

Query  3051  LIGKGTSLPQPKQPGFCLASKPVKMDSSSTSY--NDQSLNQLTVTMLDAR  3194
             L  + T++PQPK+PGFC+    ++ DSSS++   N+ + NQ+T++++DAR
Sbjct  803   LGSETTAIPQPKRPGFCVGRSTLETDSSSSTQRNNEFTENQITLSVIDAR  852


 Score = 58.5 bits (140),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+R+ LNW
Sbjct  579  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKTRRSNLNW  623



>emb|CCI61482.1| SRK [Arabidopsis halleri]
Length=847

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/829 (53%), Positives = 589/829 (71%), Gaps = 26/829 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGG---LYVGIWYKEIRDRTIVWVANRDKPLRNSTG  899
             ++ N+T+VS G+VF+LGFF+P  +S      Y+GIWYKEI  RT VWVANRD PL NSTG
Sbjct  38    ISSNRTIVSLGDVFELGFFNPTPSSRDGDRWYLGIWYKEIPKRTYVWVANRDNPLSNSTG  97

Query  900   FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLW  1079
              LKI  D N+ LVD     +WS++ T   +V    VA+LL +GN V+R       + +LW
Sbjct  98    TLKIS-DNNLVLVDQFNTLVWSTNVTG--AVRSLVVAELLANGNLVLRDSKINETDGFLW  154

Query  1080  QSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKD  1259
             QSFD+PTDTLLP MKLGWD KTG N+++ SW+SP DPS GD ++KL+    PE FL   +
Sbjct  155   QSFDFPTDTLLPEMKLGWDLKTGVNKFLRSWKSPYDPSSGDFSYKLETREFPEFFLSWSN  214

Query  1260  IIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL  1439
               +YRSG W G  FSG+PEM+    I  +F   + E+ Y+F   ++N++SRL ++ +  L
Sbjct  215   SPVYRSGPWEGFRFSGMPEMQQWTNIISNFTENREEIAYTFRDTDQNIYSRLTMSSSGYL  274

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             +R+ WI     WN+ W APKD+CD Y++CG +GICDT+ SP C C  GF+PRN Q WSLR
Sbjct  275   QRFKWISNGEDWNQHWYAPKDRCDMYKKCGPYGICDTNSSPECNCIKGFQPRNLQEWSLR  334

Query  1620  DGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
             DGS GC R   L C  D F  +   KLP+++T+ VD  + + EC+E C+ +C+CTA++N 
Sbjct  335   DGSKGCVRKTRLSCSEDAFFWLKNMKLPDTTTAIVDRRLGVKECREKCLNDCNCTAFANA  394

Query  1800  NISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVIL  1979
             +I   GSGCVIWT +L DIR Y   GGQ L VR+AA++ E+     RG        K+I 
Sbjct  395   DIR--GSGCVIWTGDLVDIRSY-PNGGQDLCVRLAAAELEERN--IRG--------KIIG  441

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
              C  +  I  + F ++   +RK +R +     +    ER+ + LMN   ISS+R  SGE 
Sbjct  442   LCVGISLILFLSFCMICFWKRKQKRLIALAAPIV-YHERNAELLMNGMVISSRRRLSGEN  500

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
              IT++ ELP+ + +A+ MAT+NF+NANK+GQGGFG VYKG L+ G+EIAVKRLSK S QG
Sbjct  501   -ITEDLELPLVELDAVVMATENFSNANKVGQGGFGIVYKGRLLDGQEIAVKRLSKTSLQG  559

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
               EFKNE+RLIA+LQH NLV+LLGCCV++DEKMLIYEY+EN SLDS +FDK RS  L+W+
Sbjct  560   TNEFKNEVRLIAKLQHINLVRLLGCCVEVDEKMLIYEYLENLSLDSYIFDKNRSWKLNWQ  619

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
              R+NI  G+ARGLLYLHQDSR RIIHRDLKASNVLLDK+M PKISDFGMAR+FG +ETEA
Sbjct  620   MRFNITNGIARGLLYLHQDSRCRIIHRDLKASNVLLDKDMTPKISDFGMARIFGREETEA  679

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               TK++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY   N+ NLLG 
Sbjct  680   N-TKKVVGTYGYMSPEYAMDGVFSMKSDVFSFGVLLLEIISGKRNKGFYNSDNDLNLLGC  738

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFVDQ-VMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              WR W EG+G E++D +I   S S  + Q +++C+Q+GLLCVQE+AEDRP M++V+ ML 
Sbjct  739   VWRNWTEGKGLEIVDPIILESSSSTVILQEILKCMQIGLLCVQERAEDRPRMSSVVAMLG  798

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSS-STSYNDQS--LNQLTVTMLDAR  3194
              +   +PQPK PG+C+   P++ DSS S  ++D+S  +N++T++++DAR
Sbjct  799   SETAVVPQPKLPGYCVGRSPLETDSSRSKQHDDESWTVNEITLSVIDAR  847



>gb|ADQ37392.1| unknown [Capsella rubella]
Length=850

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/829 (53%), Positives = 576/829 (69%), Gaps = 27/829 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++  +T+VS G+VF+LGFF PG +S   Y+GIWYK I  RT VWVANRD PL +S G L+
Sbjct  42    ISSKKTIVSPGDVFELGFFKPGSSSR-WYLGIWYKTISKRTYVWVANRDHPLSSSIGTLR  100

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ ++D +   +WS+ N    SV    VA+LLD+GNFV+R  N+ NP+ YLWQSF
Sbjct  101   I-SDNNLVVLDQSETPVWST-NLTGGSVSTPVVAELLDNGNFVLRDSNNNNPDGYLWQSF  158

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR I SW+ P DP+ GD TFKL+  G PE FL  K+ ++
Sbjct  159   DFPTDTLLPEMKLGWDLKTGSNRLIRSWKRPDDPASGDFTFKLETGGFPEIFLWYKESLM  218

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSGVPEM+P + + F+F  + +EV YSF +   +++SR+ ++   +L+R+
Sbjct  219   YRSGPWNGIRFSGVPEMQPFDYMVFNFTTSSDEVTYSFRVTKSDVYSRVSLSSMGVLQRF  278

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WN FW APKDQCD Y+ECG++G CD++ SPVC C  GFKPRN Q W LRDGS
Sbjct  279   TWIETAQTWNLFWYAPKDQCDEYKECGAYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGS  338

Query  1629  GGCFRYDELDC-PTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF  +   KLP+++ + VD  + + EC++ C+++C+CTA++N +I
Sbjct  339   DGCVRKTLLTCGGGDGFARLEKMKLPDTTAASVDRGIGVKECEQKCLKDCNCTAFANTDI  398

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQT--GEVARGGNGFGKTKKVIL  1979
               GGSGCVIWT EL DIR Y A+GGQ LYVR+A +D + T        G+  G +  ++L
Sbjct  399   RGGGSGCVIWTGELLDIRNY-AKGGQDLYVRLANTDLDDTRNRNAKLIGSSIGVSVLLLL  457

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
             +  I           +              IE    + RSRD LMN   +SS+R  S E 
Sbjct  458   SFIIFYFWKRKQNRSIA-------------IETPRDQVRSRDFLMNDVVLSSRRHISREN  504

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
               +D+ ELP+  F  +AMAT  F+N NKLGQGGFG VYKG L+ G+EIAVKRLS+ S QG
Sbjct  505   N-SDDLELPLMKFEEVAMATKFFSNDNKLGQGGFGIVYKGRLLDGQEIAVKRLSETSSQG  563

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVD-IDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
              +EFKNE++LIARLQH NLV+LL    + +     ++E       DS   DKK+SS L+W
Sbjct  564   IDEFKNEVKLIARLQHINLVRLLASSYNSVLTVECLWEECTQLGHDSFA-DKKQSSKLNW  622

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
             + R++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M PKISDFGMAR+FG D+TE
Sbjct  623   QMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKYMTPKISDFGMARIFGRDDTE  682

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             +  T+++VGTYGYMSPEYAMDG+FSVKSD FSFGVL+LE++SG++N+GFY    + NLLG
Sbjct  683   S-ITRKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLLLEIISGKRNKGFYNSDRDVNLLG  741

Query  2877  LAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
               WR W EG+G E++D +IA+ S +    +++RCIQ+GL+CVQE+AEDRP M+ V+LML 
Sbjct  742   CVWRNWKEGKGLEIIDPIIANSSSTVKQHEILRCIQIGLVCVQERAEDRPTMSLVVLMLG  801

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              + T++PQPK PG+CL   PV+ D SS    D    ++NQ+TV++LD R
Sbjct  802   SESTTIPQPKLPGYCLRRNPVETDFSSNKRRDDEPWTVNQITVSVLDGR  850



>ref|XP_006391306.1| hypothetical protein EUTSA_v10018108mg [Eutrema salsugineum]
 gb|ESQ28592.1| hypothetical protein EUTSA_v10018108mg [Eutrema salsugineum]
Length=872

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/839 (52%), Positives = 579/839 (69%), Gaps = 24/839 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             +T N+T++S  E+F+LGFF+P  +S   Y+GIWYK+I  RT VWVANRD PL NS G LK
Sbjct  41    ITSNKTIISPNEIFELGFFNPASSSR-WYLGIWYKKIPTRTYVWVANRDNPLSNSNGTLK  99

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ + D +    WS+ N     V    VA+LLD+GN V+R  N  NP+ +LWQSF
Sbjct  100   IS-DNNLVIFDQSDTPAWST-NLTGGDVGSPVVAELLDTGNLVIRDSN--NPDRFLWQSF  155

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG +R +SSW++P DPS GD + KL I G PE ++ N++ I+
Sbjct  156   DFPTDTLLPEMKLGWDLKTGIDRLLSSWKAPDDPSSGDFSTKLQIRGFPEFYVSNRENIL  215

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FS VP M+P + + ++F  T  EV YS+ I   N++SRL ++   LL+R 
Sbjct  216   YRSGPWNGIGFSSVPVMKPLDYLVYNFTATNEEVTYSYRITKTNIYSRLSLSSAGLLQRL  275

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + W + W +PKD CDNY++CG+FG CD++ SPVC C  GF+ RNQQ W+LRD S
Sbjct  276   TWIESAQSWKQLWYSPKDMCDNYKQCGNFGYCDSNTSPVCNCIKGFELRNQQTWALRDDS  335

Query  1629  GGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGFL +   KLP++  + VD ++ + EC+E C+++C+C A++N +I
Sbjct  336   AGCVRKARLSCDGRDGFLRLKNLKLPDTKATTVDRSIGVKECEEKCLKDCNCKAFANADI  395

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAE--QTGEVARGGNGFGKTKKVIL  1979
              +GGSGCVIWT E+ DIR + A+GGQ LYVR+AA+D E  +T  +   G+  G +  ++L
Sbjct  396   RDGGSGCVIWTGEILDIRNF-AKGGQDLYVRLAAADLEDKETKNIKIIGSSIGVSILLLL  454

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRG------TRERSRDPLM-----NATA  2126
             +  I           +  +         +   + G        E   DP +     N   
Sbjct  455   SFIIFRFWKRKYKRSIAFQTPDGMISFIKIPSLTGFYNNFKIEEFMLDPSLLEEDFNLKL  514

Query  2127  ISSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIA  2306
                 R         ++ ELP+ +F AI+ AT+NF+NANKLGQGGFG VYKG L  G EIA
Sbjct  515   FGIYRVSKSSEKKKEKLELPLMEFEAISRATNNFSNANKLGQGGFGIVYKGRLDDGREIA  574

Query  2307  VKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILF  2486
             VKRLSK S QG  EFKNE+RLIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LF
Sbjct  575   VKRLSKMSLQGTNEFKNEVRLIARLQHMNLVRLLGCCVDKGEKMLIYEYLENLSLDSHLF  634

Query  2487  DKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGM  2666
             DK R S L+W++R++I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M PKISDFGM
Sbjct  635   DKTRRSNLNWQKRFDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKNMTPKISDFGM  694

Query  2667  ARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFY  2846
             AR+FG DETEA  T+++VGTYGYMSPEYAMDGLFS+KSD FSFGVL+LE++SG+KN GFY
Sbjct  695   ARIFGQDETEAN-TRKVVGTYGYMSPEYAMDGLFSMKSDVFSFGVLLLEIISGKKNNGFY  753

Query  2847  TPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDR  3023
               + + NLLG  WR W EG   E++D +I   S S     +++R IQ+GLLCVQE+AEDR
Sbjct  754   NSNRDLNLLGCLWRHWKEGSVLEIVDPIIIDSSSSTCRTHEILRYIQIGLLCVQERAEDR  813

Query  3024  PNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ--SLNQLTVTMLDAR  3194
             P M++VMLML  + T +PQPK+PG+C+    ++ DSSS++ ++   ++NQ+T++++DAR
Sbjct  814   PVMSSVMLMLGSETTVIPQPKRPGYCVGRSLLETDSSSSTQHNYEWTVNQITLSVIDAR  872


 Score = 60.8 bits (146),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+R+ LNW K
Sbjct  600  QHMNLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKTRRSNLNWQK  646



>dbj|BAB40987.1| SRKb [Arabidopsis lyrata]
 gb|ADQ37349.1| unknown [Arabidopsis lyrata]
Length=853

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/826 (53%), Positives = 564/826 (68%), Gaps = 24/826 (3%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGG---LYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKI  911
             QT+VS GEVF+LGFF+P   S      Y+GIW+K   +RT VWVANRD PL NSTG LKI
Sbjct  44    QTIVSPGEVFELGFFNPAATSRDGDRWYLGIWFKTNLERTYVWVANRDNPLYNSTGTLKI  103

Query  912   GEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFD  1091
               D N+ L+D     +WS++ T     P   VA+LL +GN V++     + +  LWQSFD
Sbjct  104   S-DTNLVLLDQFDTLVWSTNLTGVLRSP--VVAELLSNGNLVLKDSKTNDKDGILWQSFD  160

Query  1092  YPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIY  1271
             YPTDTLLP MK+GWD K G NR++ SW+S  DPS GD ++KL+  G PE FL  ++  ++
Sbjct  161   YPTDTLLPQMKMGWDVKKGLNRFLRSWKSQYDPSSGDFSYKLETRGFPEFFLLWRNSRVF  220

Query  1272  RSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYT  1451
             RSG W+G+ FSG+PEM+  E +  +F   + EV Y+F+I N N++SR  ++ T  L+R+ 
Sbjct  221   RSGPWDGLRFSGIPEMQQWEYMVSNFTENREEVAYTFQITNHNIYSRFTMSSTGALKRFR  280

Query  1452  WIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
             WI  +  WN+ WN P D CD Y+ CG +  CD + SP+C C  GFKPRN   W+LR+GS 
Sbjct  281   WISSSEEWNQLWNKPNDHCDMYKRCGPYSYCDMNTSPICNCIGGFKPRNLHEWTLRNGSI  340

Query  1632  GCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             GC R   L+C  DGFL +   KLP+SS + VD T+ L ECK+ C+ +C+CTAY++ +I N
Sbjct  341   GCVRKTRLNCGGDGFLCLRKMKLPDSSAAIVDRTIDLGECKKRCLNDCNCTAYASTDIQN  400

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgi  1991
             GG GCVIW  EL DIR Y A GGQ LYVR+A  D      +     G      VIL    
Sbjct  401   GGLGCVIWIEELLDIRNY-ASGGQDLYVRLADVDIGDERNIRGKIIGLAVGASVILFLSS  459

Query  1992  vlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITD  2171
             ++         LL          T N  +          LMN   ISS R H  E   T+
Sbjct  460   IMFCVWRRKQKLLRATEAPIVYPTINQGL----------LMNRLEISSGR-HLSEDNQTE  508

Query  2172  EYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEF  2351
             + ELP+ +F A+ MAT+NF+N+NKLG+GGFG VYKG L+ G+EIAVKRLS  S QG  EF
Sbjct  509   DLELPLVEFEAVVMATENFSNSNKLGEGGFGVVYKGRLLDGQEIAVKRLSTTSIQGICEF  568

Query  2352  KNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYN  2531
             +NE++LI++LQH NLV+L GCCVD +EKMLIYEY+EN SLDS LF+K  S  L+W+ R++
Sbjct  569   RNEVKLISKLQHINLVRLFGCCVDENEKMLIYEYLENLSLDSHLFNKSLSCKLNWQMRFD  628

Query  2532  IICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTK  2711
             I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETEA  T+
Sbjct  629   ITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEAN-TR  687

Query  2712  RIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRL  2891
             ++VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE+VSG+KN+GFY  + + NLLG AWR 
Sbjct  688   KVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSGKKNRGFYNSNQDNNLLGYAWRN  747

Query  2892  WGEGRGSELLDSVI--ASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK  3062
             W EG+G E+LD  I  +S S S F   +V+RCIQ+GLLCVQE+AEDRP M++V++ML  +
Sbjct  748   WKEGKGLEILDPFIVDSSSSPSAFRPHEVLRCIQIGLLCVQERAEDRPVMSSVVVMLRSE  807

Query  3063  GTSLPQPKQPGFCLASKPVKMDSSSTSYNDQS--LNQLTVTMLDAR  3194
               ++PQPK PG+C+   P + DSS+    D+S  +NQ+T++ +D R
Sbjct  808   TETIPQPKPPGYCVGRSPFETDSSTHEQRDESCTVNQITISAIDPR  853



>ref|XP_006391514.1| hypothetical protein EUTSA_v10018117mg [Eutrema salsugineum]
 gb|ESQ28800.1| hypothetical protein EUTSA_v10018117mg [Eutrema salsugineum]
Length=848

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/823 (52%), Positives = 582/823 (71%), Gaps = 22/823 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+T++S  E+F+LGFF+    S   Y+GIWYK I  RT VW+ANRD PL +S G  KI  
Sbjct  44    NKTIISPSEIFELGFFNLAPTSR-WYLGIWYKRIPVRTYVWIANRDDPLSSSIGTFKIS-  101

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             D N+ + D +    WS+++T    V    VA+LLD+GN V+R  N  NP+ +LWQSFD+P
Sbjct  102   DNNLVIFDQSDTPAWSTNSTGGD-VGFPVVAELLDNGNLVLRDSN--NPDRFLWQSFDFP  158

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
             TDTLLP MKLGWD KTG NR++ S ++P DPS GD + K++  G P+ ++ N++ I YRS
Sbjct  159   TDTLLPEMKLGWDKKTGFNRFLRSRQTPDDPSSGDFSTKVETRGFPDVYVYNRESITYRS  218

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWI  1457
             G WNG+ FSG PE++P + + F+F  +  EV YS+ I   N++SRLI++   LL+R+TWI
Sbjct  219   GPWNGIRFSGTPEVKPIDYLVFNFTASNEEVTYSYRITKTNVYSRLILSSAGLLQRFTWI  278

Query  1458  PENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGC  1637
                + W   W   KD C+NY+ECG++  CD++ SPVC C  GFKP N++AW+LRD S GC
Sbjct  279   ETAQNWKLLWFPSKDLCNNYKECGNYSYCDSNTSPVCNCIKGFKPMNEKAWALRDDSTGC  338

Query  1638  FRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNG  1814
              R   L C  +DGFL +   KLP+++ + VD  + + EC+E C+++C+CTA++N +I NG
Sbjct  339   VRKTRLSCDGSDGFLRLKNMKLPDTTATAVDRGIGVKECEERCLKDCNCTAFANTDIRNG  398

Query  1815  GSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgiv  1994
             GSGCVIWT ++ D R Y A+GGQ LYVR+AA+D E             K  K+I +C  V
Sbjct  399   GSGCVIWTGDILDSRNY-AKGGQDLYVRLAAADLEDKR---------AKNIKIIGSCIGV  448

Query  1995  lgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDE  2174
               + ++ F +    +R  +R +T    +   + RS D LMN   I S++  S E   T++
Sbjct  449   SILLLLSFIIFSFWQRNYKRSITIQTPIVD-QVRSPDSLMNELVIPSRKYKSRENK-TED  506

Query  2175  YELPIFDFNAIAMATDNFANANKLGQGGFGSVYK--GMLVGGEEIAVKRLSKNSRQGAEE  2348
              ELP+ +F A++MAT+NF+N NKLGQGGFG VYK  G L+ G+EIAVKRLSK S QG +E
Sbjct  507   LELPLIEFEAVSMATNNFSNVNKLGQGGFGIVYKVKGRLLDGKEIAVKRLSKMSLQGTDE  566

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             F NE+RLIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDK R S L+W+ R+
Sbjct  567   FTNEVRLIARLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKTRRSNLNWQMRF  626

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
              I  G+ARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+FG DETEA  T
Sbjct  627   EIANGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMTPKISDFGMARIFGRDETEAN-T  685

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             +R+VGTYGYMSPEYAM+G FSVKSD FSFGVL+LE++SG+++ GF+  + + +LLG  WR
Sbjct  686   RRVVGTYGYMSPEYAMNGTFSVKSDVFSFGVLLLEIISGKRSTGFFNSTGDFSLLGCVWR  745

Query  2889  LWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
              W EG+G +++D +I   S S     +V+RCIQ+GLLCVQE+ EDRP M++VM+ML  + 
Sbjct  746   NWKEGKGLDIVDPIIIESSSSTVRTHEVLRCIQIGLLCVQERPEDRPVMSSVMVMLGSET  805

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             T +PQPK+PGFC+   P++ ++S    ++ ++NQ+T++++DAR
Sbjct  806   TPIPQPKRPGFCIGRSPLETEASKQHGDEWTVNQITLSVIDAR  848


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+R+ LNW
Sbjct  578  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKTRRSNLNW  622



>ref|XP_010924050.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=828

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/826 (52%), Positives = 573/826 (69%), Gaps = 25/826 (3%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG  899
             N PL+  QTLVS G  F+LGFFS G NS   Y+GIWYK I  +T VWVANR+ PL N+TG
Sbjct  27    NTPLSDGQTLVSPGGNFELGFFSLG-NSKNTYLGIWYKNISPQTFVWVANREAPLTNNTG  85

Query  900   FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRR-ENDENPENYL  1076
              L I   GN+ L +      WS+++T   S     VAQLLD+GNFVV+   ND N  + L
Sbjct  86    ILNISSYGNLILSNQAAKVFWSANSTKASS----PVAQLLDTGNFVVKEGTNDSN--SLL  139

Query  1077  WQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNK  1256
             WQSFDYP DTLLPGMKLG +  TG ++Y+++W+S  DPS GD +FKLD +G PE F+  +
Sbjct  140   WQSFDYPCDTLLPGMKLGLNLTTGFDQYLTTWKSSDDPSPGDYSFKLDPHGSPEFFIWKQ  199

Query  1257  DIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQL  1436
                +YR+G WNG+ FSG PEM+  +   F F+    E+YY++++ + ++ SR ++N + +
Sbjct  200   STKVYRNGPWNGIRFSGEPEMDSDKYFTFEFVDNPPEIYYTYQVVDSSIVSRFMLNQSTI  259

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
              +RY W   +  W+ +W+ P+D+CDNY +CG +GIC+++ SP C C  GF P++ Q W+L
Sbjct  260   -QRYVWFNSSVGWSLYWSMPRDRCDNYAQCGPYGICNSNDSPNCNCLQGFSPKSPQEWNL  318

Query  1617  RDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSN  1796
             RDG  GC R   LDC  DGFL ++  KLP+SS S V+ +MSL +C+E C+ NCSCTAY+ 
Sbjct  319   RDGHDGCVRNTRLDCQGDGFLRLSQVKLPDSSNSTVNESMSLGQCQETCLNNCSCTAYAT  378

Query  1797  YNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVI  1976
              NIS  GSGC+ W  +L DIRQ+  +GGQ LYVR+AASD   TG  +       K KK I
Sbjct  379   ANISGEGSGCIFWGGDLIDIRQF-VDGGQDLYVRLAASDLSSTGGDSN------KKKKAI  431

Query  1977  LACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGE  2156
             +   + +  G++L              V   I++ G R+ S D  + A   +   +   E
Sbjct  432   VIIFVSIACGLLLLVSSGCYIWHKMFKV-HRIKLGGRRQLSFDFALTALGPTQDHQPENE  490

Query  2157  TMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQ  2336
                  E ELP+F+ + I MATDNF+ ANKLG+GGFG VYKG L  G+ IAVKRLS++S Q
Sbjct  491   GTRGKELELPLFELSTIVMATDNFSIANKLGEGGFGPVYKGELEDGQSIAVKRLSRHSLQ  550

Query  2337  GAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
             G +EFKNE+ LIA+LQH NLV+LLGCC+  +++MLIYEYM N+SLD+I+FDK +S+LL W
Sbjct  551   GIDEFKNEVLLIAKLQHVNLVRLLGCCIQGEDRMLIYEYMHNRSLDTIIFDKTKSALLIW  610

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
             ++R++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+MNPKISDFG+AR+FGGD+++
Sbjct  611   QKRFSIIVGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMNPKISDFGVARIFGGDQSD  670

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             A  T+R+VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE++SG+KN+G Y      +LL 
Sbjct  671   A-YTQRVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIISGKKNRGIYNAEPNLSLLN  729

Query  2877  LAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              AW+LW EG+  ELLD  +     S  + +V+RCIQVGLLCVQ++AEDRP+M+ V+LML 
Sbjct  730   HAWKLWKEGKSLELLDKSMGC---SYSISEVLRCIQVGLLCVQDRAEDRPHMSTVILMLA  786

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
                  LPQPKQPG+C        +SSS+     ++N++T+TML  R
Sbjct  787   SASAMLPQPKQPGYCSERSATDTESSSSC----TVNEITMTMLAGR  828


 Score = 57.4 bits (137),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCCI+G ++MLI      +SLDT +FD TK A L W K
Sbjct  566  QHVNLVRLLGCCIQGEDRMLIYEYMHNRSLDTIIFDKTKSALLIWQK  612



>ref|XP_002886975.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63234.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=845

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/825 (52%), Positives = 589/825 (71%), Gaps = 20/825 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             L+ N+T++S  ++F+LGFF+P  +S   Y+GIW+K I  RT VWVANRD PL +S G LK
Sbjct  38    LSSNKTIISPNQIFELGFFNPASSSR-WYLGIWFKIISKRTYVWVANRDNPLSSSNGTLK  96

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  + N+ + D +   +WS+ N     V    VA+LLD+GNFV+R   +++P  +LWQSF
Sbjct  97    ISGN-NLVIFDQSDRPVWST-NITGGDVRSPLVAELLDNGNFVLRDSKNKDPRGFLWQSF  154

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLL  MKLGWD+KTG ++ + SW++  DPS GD + KL  +G PE ++ N++ I 
Sbjct  155   DFPTDTLLSEMKLGWDNKTGYSKLLRSWKTTDDPSSGDFSIKLRTSGFPEFYVCNRESIT  214

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG W G  FS VP  +P + I  +F  +  EV Y++ ++  N++S L ++ T LL+R 
Sbjct  215   YRSGPWIGNRFSSVPGTKPLDYIVNNFTMSNQEVAYTYRVNKTNIYSILSLSSTGLLQRL  274

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TW+   + W + W +PKD CDNY+ECG++G CD + SP+C C  GF+P N+QA +LRD S
Sbjct  275   TWMEAAQSWKQLWYSPKDLCDNYKECGNYGYCDPNSSPICNCIKGFEPMNEQA-ALRDDS  333

Query  1629  GGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF+ +   +LP+++T+ VD  + L EC+E C+++C+CTA++N +I
Sbjct  334   VGCVRKTNLSCDGRDGFVRLTKMRLPDTTTTIVDRGIGLKECEERCLKDCNCTAFANTDI  393

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
              NGGSGCVIWT EL DIR Y A+GGQ LYVR+AA D E             K +K+I + 
Sbjct  394   RNGGSGCVIWTGELLDIRNY-AKGGQDLYVRLAAEDLEDKRI---------KNEKIIGSS  443

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
               V  + +++F +    +RK +R +     +   + RS++  MN   ISS+   S E   
Sbjct  444   IGVSILLLLMFIIFHFWKRKQKRSIAIQTPIVD-QVRSQELPMNEVVISSRIYRSKENK-  501

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T+  ELP+ +  A+AMAT+NF+N NKLGQGGFG VYKG L+ G++IAVKRLSK S QG +
Sbjct  502   TEYLELPMMELKALAMATNNFSNDNKLGQGGFGIVYKGRLLDGKDIAVKRLSKMSSQGTD  561

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EF NE+RLIA+LQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDK R S L+W++R
Sbjct  562   EFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKTRRSNLNWQKR  621

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSR RIIHRDLKASNVLLDK M PKISDFGMAR+FG +ETEA  
Sbjct  622   FDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEAN-  680

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+R+VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  +++ NLL   W
Sbjct  681   TRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNHDLNLLSFVW  740

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +    S S F  Q++RCIQ+GLLCVQE+AEDRP M++VM+ML  + 
Sbjct  741   RHWTEGKGLEIVDRINIDSSSSAFRTQILRCIQIGLLCVQERAEDRPEMSSVMVMLGSET  800

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ--SLNQLTVTMLDAR  3194
             T++ QPK+PGFC+   P++ DSSS++  D   S+NQ+T++++DAR
Sbjct  801   TAITQPKRPGFCIGKSPLEADSSSSTQRDDECSVNQITLSVIDAR  845


 Score = 59.7 bits (143),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+R+ LNW K
Sbjct  574  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKTRRSNLNWQK  620



>ref|XP_010415122.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
isoform X1 [Camelina sativa]
Length=841

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/828 (52%), Positives = 580/828 (70%), Gaps = 28/828 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T++S  ++F+LGFF+P  +S   Y+G+WYK I  RT VWVANRD PL +S G LK
Sbjct  36    ISSNKTIISPSQIFELGFFNPPSSSL-WYLGVWYKIIPKRTYVWVANRDNPLTSSNGTLK  94

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             +  + N+ L D +   +WS+  T   SV    VA+LLD+GNFV+R  N++    +LWQSF
Sbjct  95    LSNN-NLVLFDQSDRPVWSTKQTGG-SVRPPVVAELLDNGNFVLRDSNNK----FLWQSF  148

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR + SW++  DPS GD + KL+    PE ++  K+ I+
Sbjct  149   DFPTDTLLPEMKLGWDRKTGFNRILRSWKTTDDPSSGDFSTKLENRDFPEFYVCGKESIM  208

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNGV FS VP  +  + + ++F  +K EV YS+ I+  N++S L ++   LL+R 
Sbjct  209   YRSGPWNGVRFSSVPGTKQVDYMVYNFTASKEEVSYSYRINKTNMYSMLSLSSAGLLQRL  268

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TW    + W + W +PKD CDNY+ECG+FG CD++  P+C C  GFKP ++QAW LRDGS
Sbjct  269   TWFETTQSWKQLWYSPKDLCDNYKECGNFGYCDSNTLPICNCIKGFKPMDEQAWDLRDGS  328

Query  1629  GGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
             GGC R   L C   DGF  +   KLP+++ + VD  +SL  CKE C+++C+CTA++N +I
Sbjct  329   GGCMRKTRLSCDGRDGFARLKRLKLPDTNATIVDRGVSLKVCKERCLKDCNCTAFANADI  388

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAE--QTGEVARGGNGFGKTKKVIL  1979
              +GGSGCVIW  E+ DIR + A+GGQ LYVR+AA+D E  +T      G+  G +   +L
Sbjct  389   RDGGSGCVIWNGEILDIRNF-AKGGQDLYVRLAAADLEDKRTKYEKIIGSSIGVSILFLL  447

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
             +  I             +         T  +++     RS+D LMN    SSK   S E 
Sbjct  448   SFIIFRFWKKRQKRSTAIH--------TPIVDL----VRSQDTLMNEMVTSSKGYISREN  495

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
              I D  +LP+ +F A+AMAT+NF++ NKLG+GGFG VYKG L+ G+EI VKRLSK S QG
Sbjct  496   NIED-LDLPLMEFKAVAMATNNFSDTNKLGKGGFGIVYKGRLLDGKEIGVKRLSKMSSQG  554

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EF NE+RLIA+LQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDK R S LDW+
Sbjct  555   TDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKTRRSNLDWQ  614

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
             +R++I  G+ARGLLYLHQDSR RIIHRDLKASNVLLDK M PKISDFG+AR+FG +E EA
Sbjct  615   KRFDIANGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGLARIFGREEIEA  674

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++ G++N+GFY  + + NLLG 
Sbjct  675   N-TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIICGKRNKGFYNSNRDLNLLGF  733

Query  2880  AWRLWGEGRGSELLDSV-IASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              WR W EG+G E++D   I S S +    +++RCIQ+GLLCVQE+A+DRP M++VM+ML 
Sbjct  734   VWRHWKEGKGLEIVDPTNIDSSSSTSQTHEILRCIQIGLLCVQERAQDRPVMSSVMVMLG  793

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ--SLNQLTVTMLDAR  3194
              + T++PQPK+PGFC+   P++ DSSS++  D   + NQ+T++++DAR
Sbjct  794   SETTAIPQPKRPGFCVGRSPLEADSSSSTQRDDECTFNQITLSVIDAR  841


 Score = 57.8 bits (138),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+R+ L+W K
Sbjct  569  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKTRRSNLDWQK  615



>gb|AGN12871.1| putative receptor kinase 3 [Leavenworthia alabamica]
Length=815

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/827 (54%), Positives = 573/827 (69%), Gaps = 63/827 (8%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+T+VS G +F+LGFF PG  S   Y+GIWYK I  RT VWVANRD PL NS G L+I  
Sbjct  44    NKTIVSPGGIFELGFFKPGLASR-WYLGIWYKSISKRTYVWVANRDSPLFNSIGTLRIS-  101

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             D N+ +   T   +WS+ N     V  + VA+LLD+GNFV+R  +++NP+  L+      
Sbjct  102   DNNLVIFGQTDVPVWST-NLTGGDVSSSVVAELLDNGNFVLRDSDNDNPDGILY------  154

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
                LLP MKLGWD KTG NR+I SW+S  DPS GD  FK++  G PE FL N+D  +YRS
Sbjct  155   ---LLPEMKLGWDVKTGFNRFIRSWKSLDDPSSGDFFFKIETRGFPEIFLWNRDSRLYRS  211

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWI  1457
             G WNG+ FSGVPEM+P + + F+F  +K EV YSF +  KN +SRL ++ + LL+R+TWI
Sbjct  212   GPWNGIRFSGVPEMQPFDYMVFNFTASKEEVTYSFRVTKKNYYSRLSLSSSGLLQRFTWI  271

Query  1458  PENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGC  1637
                + WN FW APKDQCD Y+ECG +  CD++ SPVC C  GF PRN QAW LRDGS GC
Sbjct  272   ETVQNWNLFWYAPKDQCDEYKECGVYSYCDSNTSPVCNCIKGFTPRNPQAWGLRDGSDGC  331

Query  1638  FRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNG  1814
              R  +L C   DGF+ +   KLP+++ S VD    + EC++ C+R+C+CTA++N +I  G
Sbjct  332   VRKTQLSCEGGDGFVQLKKMKLPDTTASSVDRGTGVKECEQKCLRDCNCTAFANTDIRGG  391

Query  1815  GSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARG--GNGFGKTKKVILACg  1988
             GSGCVIWT E+FDIR Y AEGGQ LYVR+AA+D E+  + +    G+  G   +V     
Sbjct  392   GSGCVIWTGEIFDIRNY-AEGGQDLYVRLAANDLEENRDRSAKIIGSSIGTVDEV-----  445

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
                                                RSRD LMN   ISS+R  S E   T
Sbjct  446   -----------------------------------RSRDLLMNEVVISSRRYTSKENK-T  469

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             ++ ELP+ +F  +AM T+NF+N NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG +E
Sbjct  470   EDLELPLMEFKEVAMVTNNFSNDNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGTDE  529

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             FKNE+RLIARLQH NLV+LL CCVD DEK+LIYEY+EN SLDS LFDK RS  L W+ R+
Sbjct  530   FKNEVRLIARLQHINLVRLLACCVDEDEKILIYEYLENLSLDSHLFDKSRSCKLTWQMRF  589

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             +I  G+ARG+LYLHQDSRFRIIHRDLKASNVLLDK M PKISDFGMAR+FG DETEA  T
Sbjct  590   DIANGIARGMLYLHQDSRFRIIHRDLKASNVLLDKNMTPKISDFGMARIFGRDETEA-NT  648

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             +++VGTYGYMSPEYAMDG+FS+KSD FSFGVL++E++ G++N+GFY   ++ NLLG  W+
Sbjct  649   RKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLIEIICGKRNKGFYNTDHDVNLLGCVWK  708

Query  2889  LWGEGRGSELLDSVIASESHSEFV--DQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK  3062
              W EG+  +++D +I   S S F   ++++RCIQ+GLLCVQE+AEDRP M++V++ML  +
Sbjct  709   NWKEGKVMDIIDQIIIDSSSSTFQPHEKILRCIQIGLLCVQERAEDRPMMSSVVMMLGNE  768

Query  3063  GTSLPQPKQPGFCLASKPVKMDSSSTS--YNDQ-SLNQLTVTMLDAR  3194
              T +PQPK PG+C+   P   DSSS+   Y++  ++NQ+T+++LDAR
Sbjct  769   TTKIPQPKPPGYCVGRSPHDTDSSSSKPRYDEPWTVNQITISVLDAR  815



>gb|AAB33486.1| ARK2 product/receptor-like serine/threonine protein kinase ARK2 
[Arabidopsis thaliana, Columbia, Peptide, 850 aa]
Length=850

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/827 (52%), Positives = 589/827 (71%), Gaps = 20/827 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T++S  ++F+LGFF+P  +S   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  39    ISSNKTIISPSQIFELGFFNPDSSSR-WYLGIWYKIIPIRTYVWVANRDNPLSSSNGTLK  97

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ + D +   +WS+ N     V     A+LLD GNFV+R   +  P  +LWQSF
Sbjct  98    IS-DNNLVIFDQSDRPVWST-NITGGDVRSPVAAELLDYGNFVLRDSKNNKPSGFLWQSF  155

Query  1089  DYPTDTLLPGMKLGWDSKTG-RNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             D+PTDTLL  MK+GWD+K+G  NR + SW++  DPS GD + KL  +G PE ++ NK+ I
Sbjct  156   DFPTDTLLSDMKMGWDNKSGGFNRILRSWKTTDDPSSGDFSTKLRTSGFPEFYIYNKESI  215

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
              YRSG W G  FS VP M+P + I  SF     +V YS+ ++  N++S L ++ T LL+R
Sbjct  216   TYRSGPWLGNRFSSVPGMKPVDYIDNSFTENNQQVVYSYRVNKTNIYSILSLSSTGLLQR  275

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
              TW+   + W + W +PKD CDNY+ECG++G CD + SP+C C  GF+P N+QAW+LRD 
Sbjct  276   LTWMEAAQSWKQLWYSPKDLCDNYKECGNYGYCDANTSPICNCIKGFEPMNEQAWALRDD  335

Query  1626  SGGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             S GC R  +L C   DGF+ +   +LP+++ + VD  + L EC+E C++ C+CTA++N +
Sbjct  336   SVGCVRKTKLSCDGRDGFVRLKKMRLPDTTETSVDKGIGLKECEERCLKGCNCTAFANTD  395

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             I NGGSGCVIW+  LFDIR Y A+GGQ LYVRVAA D E             K+KK+I +
Sbjct  396   IRNGGSGCVIWSGGLFDIRNY-AKGGQDLYVRVAAGDLEDKRI---------KSKKIIGS  445

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETM  2162
                V  + ++ F +    +RK +R +T    +   + RS+D LMN   + + R ++ +  
Sbjct  446   SLGVSILLLLSFIIFHFWKRKQKRSITIQTPIVDLQVRSQDSLMNE-LVKASRSYTSKEN  504

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
              TD  ELP+ ++ A+AMAT+NF+  NKLGQGGFG VYKGML+ G+EIAVKRLSK S QG 
Sbjct  505   KTDYLELPLMEWKALAMATNNFSTDNKLGQGGFGIVYKGMLLDGKEIAVKRLSKMSSQGT  564

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
             +EF NE+RLIA+LQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFD+ RSS L+W++
Sbjct  565   DEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDQTRSSNLNWQK  624

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R++II G+ARGLLYLHQDSR RIIHRDLKASNVLLDK M PKISDFGMAR+FG +ETEA 
Sbjct  625   RFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEA-  683

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
              T+R+VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  + + NLLG  
Sbjct  684   NTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGFV  743

Query  2883  WRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             WR W EG+  E++D +      SEF   +++RCIQ+GLLCVQE+AEDRP M++VM+ML  
Sbjct  744   WRHWKEGKELEIVDPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVMVMLGS  803

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ--SLNQLTVTMLDAR  3194
             + T++PQPK+PGFC+    +++DSSS++  D   ++NQ+T++++DAR
Sbjct  804   ETTAIPQPKRPGFCVGRSSLEVDSSSSTQRDDECTVNQVTLSVIDAR  850


 Score = 57.4 bits (137),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+ + LNW K
Sbjct  578  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDQTRSSNLNWQK  624



>gb|AFP33767.1| SRK [Arabidopsis kamchatica subsp. kawasakiana]
Length=849

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/826 (52%), Positives = 576/826 (70%), Gaps = 25/826 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS   VF+LGFF    NS   Y+GIWYK++ ++T +WVANRD P  NS G LK
Sbjct  45    ISSNRTIVSPSGVFELGFFETAPNSR-WYLGIWYKKVPEKTYIWVANRDHPFSNSIGILK  103

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENP-ENYLWQS  1085
             I E  N+ L+D +   +WS++ T     P   VA+LLD+GNFV+R  +++N  + YLWQS
Sbjct  104   ISE-ANLVLLDHSDTLVWSTNRTGGTRSP--VVAELLDNGNFVLRESSNKNDLDRYLWQS  160

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FD+PTDTLLP MKLGWD K G NRY++SW+SP DPS G  ++KL++ GLPE FL  KD  
Sbjct  161   FDFPTDTLLPEMKLGWDLKRGLNRYLTSWKSPNDPSSGYYSYKLELQGLPEFFLSYKDSP  220

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             ++RSG W+GV FSG+PE +    + ++F   + EV Y+F + N ++ SRL V+ +  L R
Sbjct  221   MHRSGPWDGVRFSGMPEKQQLTYMVYNFTENEEEVAYTFSMTNHSILSRLTVSSSGTLNR  280

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             +TWIP +  WN  W +PKD CD Y  CG +  CD + SP C C  GF P+NQQ W L +G
Sbjct  281   FTWIPPSWQWNTVWFSPKDDCDLYERCGPYSYCDVNTSPSCNCIQGFDPKNQQQWDLSNG  340

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
               GC R  +L C    FL +   KLP +  + VD  +   ECKE C+ +C+CTAY+N + 
Sbjct  341   VSGCVRKTQLSCSEKRFLRLKKMKLPVTMDAIVDRKIGKKECKERCLGDCNCTAYANID-  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
                GSGC+IWT E FDIR Y+ EG Q LYVR+AASD    G  +R      K   +++  
Sbjct  400   ---GSGCLIWTGEFFDIRNYSHEG-QDLYVRLAASDLGDEGNKSR------KIIGLVVGI  449

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              I+  +  ++      K+++ +      +     ++R++D LMN   ISS R  SGE   
Sbjct  450   SIMFLLSFIVICCWKRKQKRAKAIAAPTV----YQDRNQDLLMNEVVISSMRNFSGENK-  504

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F A+ +ATDNF+++NKLGQGGFG VYKG L+ G+EIAVKRLS+ S QG  
Sbjct  505   TDDSELPLMEFKAVLIATDNFSDSNKLGQGGFGIVYKGRLLDGQEIAVKRLSETSTQGTS  564

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE+RLIARLQH NLV+LLGCCVD+DEKMLIYEY+EN SLD  LFDK +S+ L+WK R
Sbjct  565   EFKNEMRLIARLQHINLVRLLGCCVDVDEKMLIYEYLENLSLDFYLFDKTQSAKLNWKMR  624

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++I  G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMAR+F  DETEA  
Sbjct  625   FDITNGIARGLLYLHQDSRFRIIHRDLKASNILLDKDMIPKISDFGMARIFARDETEAN-  683

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  + + NLLG  W
Sbjct  684   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGCVW  743

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE A DRP M++V+LML  + 
Sbjct  744   RNWKEGKGLEIVDPIIIDSSTTFRPKEILRCIQIGLLCVQEHAHDRPTMSSVVLMLGSET  803

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              ++PQP  PG+C+    ++ DSSS+   D    ++NQ+T++++DAR
Sbjct  804   IAIPQPNTPGYCVGRSSLETDSSSSGQQDDESCTVNQITLSVMDAR  849


 Score = 55.1 bits (131),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLLGCC++  EKMLI       SLD ++FD T+ A+LNW
Sbjct  577  QHINLVRLLGCCVDVDEKMLIYEYLENLSLDFYLFDKTQSAKLNW  621



>emb|CDY39268.1| BnaC06g27230D [Brassica napus]
Length=848

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/827 (52%), Positives = 575/827 (70%), Gaps = 28/827 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+T+VS  E F+LGFF+PG +S   Y+GIWYK+I  RT VWVANRD PL    G LKI  
Sbjct  42    NKTIVSRNETFELGFFTPGSSSR-WYLGIWYKKIPIRTYVWVANRDNPLSRPNGSLKISY  100

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             D N+ + D +   +WS++ T   S   + VA+LLD+GNFV+R   D N   YLW+SFD+P
Sbjct  101   DNNLVIYDHSDTPVWSTNLTVGAS-RSSLVAELLDNGNFVLR---DSNSNEYLWESFDFP  156

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
             TDTLLP MKLGWD KTG +R + SW+S  DP+ G+   KL+  G PE ++ N++ IIYRS
Sbjct  157   TDTLLPDMKLGWDKKTGLDRVLRSWKSVEDPASGNFWTKLETRGFPEYYVFNRETIIYRS  216

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWI  1457
             G W G  FS VPEM+P E + ++F+ +  EV YS+ +    ++S L ++YT  ++R  WI
Sbjct  217   GPWIGNRFSCVPEMKPIEYMVYTFIASNEEVSYSYHMTKPEVYSTLSLSYTGTIQRRNWI  276

Query  1458  PENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGC  1637
              +++ W + W  PKD CDNYR+CG++G CD++  P C C  GF   N Q W+LRD S GC
Sbjct  277   EQSQAWKQLWYQPKDICDNYRQCGNYGYCDSNSLPNCNCIKGFGLGNGQEWALRDDSAGC  336

Query  1638  FRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNG  1814
              R   L C   DGF+ +   KLP+++ + +D  + L EC+  C+++C+CTAY+N +I +G
Sbjct  337   VRKTRLSCDGRDGFVVVKRMKLPDTAATVLDRGIGLKECEAKCLQDCNCTAYANTDIRDG  396

Query  1815  GSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARG---GNGFGKTKKVILAC  1985
             GSGCVIW   LFDIR Y A GGQ LYV++AA+D +     + G   G+G G T  +++  
Sbjct  397   GSGCVIWKGGLFDIRSY-ANGGQDLYVKLAAADLDHVKITSHGTIIGSGIGVTIFLLIII  455

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              I     +     + ++              R  + RS+  L +   ++S+R  S E   
Sbjct  456   IIFSYWKIKQKSDITIQTP------------RVDQVRSQYLLTDEVVLTSERYISRENK-  502

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F A+AMAT+ F+ AN LGQGGFG VYKGML  G+EIAVKRLSK S QG +
Sbjct  503   TDDLELPLMEFEALAMATNRFSVANMLGQGGFGIVYKGMLPDGKEIAVKRLSKMSLQGTD  562

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE+RLIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDK R S L W++R
Sbjct  563   EFKNEVRLIARLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKIRRSNLSWQKR  622

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M PKISDFGMAR+FG DETEA  
Sbjct  623   FDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKNMTPKISDFGMARIFGPDETEA-N  681

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYM+PEYAMDG+FS+KSD FSFGVL+LE+++G++++GFY  + + NLLG  W
Sbjct  682   TRKVVGTYGYMAPEYAMDGIFSMKSDVFSFGVLLLEIITGKRSKGFYNSNRDHNLLGFVW  741

Query  2886  RLWGEGRGSELLDSVIASESHSEFV--DQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             R W EG+G E++D +I  +S S  +   +++RCIQ+GLLCVQE+AEDRP MA VM+ML  
Sbjct  742   RYWKEGKGIEIVDPIIIDDSSSALLWTHEILRCIQIGLLCVQERAEDRPVMATVMVMLGS  801

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSL--NQLTVTMLDAR  3194
             + T++PQPK+PGFC+     + + SS++  D  L  NQ+T++++DAR
Sbjct  802   ETTAIPQPKRPGFCVGRSLFETELSSSTQRDDDLTVNQITLSVIDAR  848


 Score = 56.6 bits (135),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD  +R+ L+W K
Sbjct  575  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKIRRSNLSWQK  621



>gb|AFP33766.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
Length=849

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/826 (52%), Positives = 576/826 (70%), Gaps = 25/826 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS   VF+LGFF    NS   Y+GIWYK++ ++T +WVANRD P  NS G LK
Sbjct  45    ISSNRTIVSPSGVFELGFFETAPNSR-WYLGIWYKKVPEKTYIWVANRDHPFSNSIGILK  103

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENP-ENYLWQS  1085
             I E  N+ L+D +   +WS++ T     P   VA+LLD+GNFV+R  +++N  + YLWQS
Sbjct  104   ISE-ANLVLLDHSDTLVWSTNRTGGTRSP--VVAELLDNGNFVLRESSNKNDLDRYLWQS  160

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FD+PTDTLLP MKLGWD K G NRY++SW+SP DPS G  ++KL++ GLPE FL  KD  
Sbjct  161   FDFPTDTLLPEMKLGWDLKRGLNRYLTSWKSPNDPSSGYYSYKLELQGLPEFFLSYKDSP  220

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             ++RSG W+GV FSG+PE +    + ++F   + EV Y+F + N ++ SRL V+ +  L R
Sbjct  221   MHRSGPWDGVRFSGMPEKQQLTYMVYNFTENEEEVAYTFSMTNHSILSRLTVSSSGTLNR  280

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             +TWIP +  WN  W +PKD CD Y  CG +  CD + SP C C  GF P+NQQ W L +G
Sbjct  281   FTWIPPSWQWNTVWFSPKDDCDLYERCGPYSYCDVNTSPSCNCIQGFDPKNQQQWDLSNG  340

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
               GC R  +L C    FL +   KLP +  + VD  +   ECKE C+ +C+CTAY+N + 
Sbjct  341   VSGCVRKTQLSCSEKRFLRLKKMKLPVTMDAIVDRKIGKKECKERCLGDCNCTAYANID-  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
                GSGC+IWT E FDIR Y+ EG Q LYVR+AASD    G  +R      K   +++  
Sbjct  400   ---GSGCLIWTGEFFDIRNYSHEG-QDLYVRLAASDLGDEGNKSR------KIIGLVVGI  449

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              I+  +  ++      K+++ +      +     ++R++D LMN   ISS R  SGE   
Sbjct  450   SIMFLLSFIVICCWKRKQKRAKAIAAPTV----YQDRNQDLLMNEVVISSMRNFSGENK-  504

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T++ ELP+ +F A+ +ATDNF+++NKLGQGGFG VYKG L+ G+EIAVKRLS+ S QG  
Sbjct  505   TEDSELPLMEFKAVLIATDNFSDSNKLGQGGFGIVYKGRLLDGQEIAVKRLSETSTQGTS  564

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE+RLIARLQH NLV+LLGCCVD+DEKMLIYEY+EN SLD  LFDK +S+ L+WK R
Sbjct  565   EFKNEMRLIARLQHINLVRLLGCCVDVDEKMLIYEYLENLSLDFYLFDKTQSAKLNWKMR  624

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++I  G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMAR+F  DETEA  
Sbjct  625   FDITNGIARGLLYLHQDSRFRIIHRDLKASNILLDKDMIPKISDFGMARIFARDETEAN-  683

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  + + NLLG  W
Sbjct  684   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGCVW  743

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE A DRP M++V+LML  + 
Sbjct  744   RNWKEGKGLEIVDPIIIDSSTTFRPKEILRCIQIGLLCVQEHAHDRPTMSSVVLMLGSET  803

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              ++PQP  PG+C+    ++ DSSS+   D    ++NQ+T++++DAR
Sbjct  804   IAIPQPNTPGYCVGRSSLETDSSSSGQQDDESCTVNQITLSVMDAR  849


 Score = 54.7 bits (130),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLLGCC++  EKMLI       SLD ++FD T+ A+LNW
Sbjct  577  QHINLVRLLGCCVDVDEKMLIYEYLENLSLDFYLFDKTQSAKLNW  621



>gb|AFP33761.1| SRK, partial [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33762.1| SRK, partial [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33763.1| SRK, partial [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33764.1| SRK, partial [Arabidopsis halleri subsp. gemmifera]
Length=857

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/832 (52%), Positives = 582/832 (70%), Gaps = 29/832 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS G VF+LGFF     S   Y+GIWYK++  RT VWVANRD PL NS G LK
Sbjct  45    ISSNRTIVSPGGVFELGFFETVSTSR-WYLGIWYKKVPQRTYVWVANRDNPLSNSIGILK  103

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPEN-YLWQS  1085
             I  D N+ L+D +   +WS++ T +   P   + +L D+GNFV+R  N++N ++  LWQS
Sbjct  104   I-LDANLVLLDHSDTLVWSTNRTGDTKSP--LLGELFDNGNFVLRESNNKNDQDGLLWQS  160

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FD+PTDTLLP MKLGWD KTGRN+++ SW+SP+DPS G  ++KLD  G+PE FL N+   
Sbjct  161   FDFPTDTLLPQMKLGWDRKTGRNKFLISWKSPSDPSSGYYSYKLDFQGIPEFFLNNRGWP  220

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
              +RSG W+G+ FSG+PE +   ++ ++F   K EV Y+F + N +++SRL +N T    R
Sbjct  221   THRSGPWDGIRFSGIPEKQLNYMV-YNFTENKEEVTYTFSMINHSIYSRLTMNPTGTFSR  279

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             +TWIP +  W+  W +PKD+CD Y+ CGS+G CD + SP C C  GF P+  Q W L +G
Sbjct  280   FTWIPTSWQWSVPWFSPKDECDMYKTCGSYGYCDINTSPPCNCIKGFDPKYPQQWELSNG  339

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GGC R   L C  DGF+ +   KLP +  + VD  ++  ECK+ C+RNC+CTA++N NI
Sbjct  340   VGGCVRKTRLSCNDDGFVRLKKMKLPVTKDTIVDRRITTKECKKSCLRNCNCTAFANTNI  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
              NGGSGC+IWT EL DIR Y A+G Q LYV++AASD          G+   K  K+I   
Sbjct  400   QNGGSGCLIWTGELMDIRNYAADG-QDLYVKLAASDI---------GDERNKRGKIIGLI  449

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
               V  + ++ F +    +RK +R  T ++ +    +R++D LMN   ISS+R   GE   
Sbjct  450   VGVSVMLLLSFTVFYFWKRKQKRTRTISVPI-AYEDRNQDLLMNEGVISSRRHFCGENR-  507

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T++ ELP+ +F  + +ATDNF+++NKLGQGGFG VYKG L  G+EIAVKRLSK S QG  
Sbjct  508   TEDLELPLMEFKDVVVATDNFSDSNKLGQGGFGIVYKGRLFDGQEIAVKRLSKMSSQGIR  567

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE+RLIARLQH NLV+LLGCCVD  E +LIYEY+EN SLD  LF+K +S  L+W+ R
Sbjct  568   EFKNEVRLIARLQHINLVRLLGCCVDAGENILIYEYLENLSLDFYLFEKSQSPKLNWQMR  627

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             + II G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMAR+FG DETEA  
Sbjct  628   FEIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKDMIPKISDFGMARIFGRDETEA-N  686

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  + + NLLG AW
Sbjct  687   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGCAW  746

Query  2886  RLWGEGRGSELLDSVIASESHSEFV------DQVMRCIQVGLLCVQEKAEDRPNMAAVML  3047
             R W +G   E++D +I   S S F       D+V+RCI +GLLCVQE A DRP M++V+L
Sbjct  747   RNWKDGNRLEIVDPIIMDSSPS-FASTTFRPDEVLRCIHIGLLCVQEHAHDRPTMSSVLL  805

Query  3048  MLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             M   + T++PQPK PG+C+    ++ +SSS   +D    ++NQ+T+++++ R
Sbjct  806   MFGSETTAIPQPKPPGYCVGRGSLETESSSCKQHDDESWTVNQITLSVVNGR  857



>gb|AFP33768.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
Length=849

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/826 (52%), Positives = 575/826 (70%), Gaps = 25/826 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS   VF+LGFF    NS   Y+GIWYK++ ++T +WVANRD P  NS G LK
Sbjct  45    ISSNRTIVSPSGVFELGFFETAPNSR-WYLGIWYKKVPEKTYIWVANRDHPFSNSIGILK  103

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENP-ENYLWQS  1085
             I E  N+ L+D +   +WS++ T     P   VA+LLD+GNFV+R  +++N  + YLWQS
Sbjct  104   ISE-ANLVLLDHSDTLVWSTNRTGGTRSP--VVAELLDNGNFVLRESSNKNDLDRYLWQS  160

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FD+PTDTLLP MKLGWD K G NRY++SW+SP DPS G  ++KL++ GLPE FL  KD  
Sbjct  161   FDFPTDTLLPEMKLGWDLKRGLNRYLTSWKSPNDPSSGYYSYKLELQGLPEFFLSYKDSP  220

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             ++RSG W+GV FSG+PE +    + ++F   + EV Y+F + N ++ SRL V+ +  L R
Sbjct  221   MHRSGPWDGVRFSGMPEKQQLTYMVYNFTENEEEVAYTFSMTNHSILSRLTVSSSGTLNR  280

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             +TWIP +  WN  W +PKD CD Y  CG +  CD + SP C C  GF P+NQQ W L +G
Sbjct  281   FTWIPPSWQWNTVWFSPKDDCDLYERCGPYSYCDVNTSPSCNCIQGFDPKNQQQWDLSNG  340

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
               GC R  +L C    FL +   KLP +  + VD  +   ECKE C+ +C+CTAY+N + 
Sbjct  341   VSGCVRKTQLSCSEKRFLRLKKMKLPVTMDAIVDRKIGKKECKERCLGDCNCTAYANID-  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
                GSGC+IWT E FDIR Y  EG Q LYVR+AASD    G  +R      K   +++  
Sbjct  400   ---GSGCLIWTGEFFDIRNYGHEG-QDLYVRLAASDLGDEGNKSR------KIIGLVVGI  449

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              I+  +  ++      K+++ +      +     ++R++D LMN   ISS R  SGE   
Sbjct  450   SIMFLLSFIIICCWKRKQKRAKAIAAPTV----YQDRNQDLLMNEVVISSMRNFSGENK-  504

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T++ ELP+ +F A+ +ATDNF+++NKLGQGGFG VYKG L+ G+EIAVKRLS+ S QG  
Sbjct  505   TEDSELPLMEFKAVLIATDNFSDSNKLGQGGFGIVYKGRLLDGQEIAVKRLSETSTQGTS  564

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE+RLIARLQH NLV+LLGCCVD+DEKMLIYEY+EN SLD  LFDK +S+ L+WK R
Sbjct  565   EFKNEMRLIARLQHINLVRLLGCCVDVDEKMLIYEYLENLSLDFYLFDKTQSAKLNWKMR  624

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++I  G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMAR+F  DETEA  
Sbjct  625   FDITNGIARGLLYLHQDSRFRIIHRDLKASNILLDKDMIPKISDFGMARIFARDETEAN-  683

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  + + NLLG  W
Sbjct  684   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGCVW  743

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE A DRP M++V+LML  + 
Sbjct  744   RNWKEGKGLEIVDPIIIDSSTTFRPKEILRCIQIGLLCVQEHAHDRPTMSSVVLMLGSET  803

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              ++PQP  PG+C+    ++ DSSS+   D    ++NQ+T++++DAR
Sbjct  804   IAIPQPNTPGYCVGRSSLETDSSSSGQQDDESCTVNQITLSVMDAR  849


 Score = 54.7 bits (130),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLLGCC++  EKMLI       SLD ++FD T+ A+LNW
Sbjct  577  QHINLVRLLGCCVDVDEKMLIYEYLENLSLDFYLFDKTQSAKLNW  621



>gb|AFP33770.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
Length=849

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/826 (52%), Positives = 575/826 (70%), Gaps = 25/826 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS   VF+LGFF    NS   Y+GIWYK++ ++T +WVANRD P  NS G LK
Sbjct  45    ISSNRTIVSPSGVFELGFFETAPNSR-WYLGIWYKKVPEKTYIWVANRDHPFSNSIGILK  103

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENP-ENYLWQS  1085
             I E  N+ L+D +   +WS++ T     P   VA+LLD+GNFV+R  +++N  + YLWQS
Sbjct  104   ISE-ANLVLLDHSDTLVWSTNRTGGTRSP--VVAELLDNGNFVLRESSNKNDLDRYLWQS  160

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FD+PTDTLLP MKLGWD K G NRY++SW+SP DPS G  ++KL++ GLPE FL  KD  
Sbjct  161   FDFPTDTLLPEMKLGWDLKRGLNRYLTSWKSPNDPSSGYYSYKLELQGLPEFFLSYKDSP  220

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             ++RSG W+GV FSG+PE +    + ++F   + EV Y+F + N ++ SRL V+ +  L R
Sbjct  221   MHRSGPWDGVRFSGMPEKQQLTYMVYNFTENEEEVAYTFSMTNHSILSRLTVSSSGTLNR  280

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             +TWIP +  WN  W +PKD CD Y  CG +  CD + SP C C  GF P+NQQ W L +G
Sbjct  281   FTWIPPSWQWNTVWFSPKDDCDLYERCGPYSYCDVNTSPSCNCIQGFDPKNQQQWDLSNG  340

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
               GC R  +L C    FL +   KLP +  + VD  +   ECKE C+ +C+CTAY+N + 
Sbjct  341   VSGCVRKTQLSCSEKRFLRLKKMKLPVTMDAIVDRKIGKKECKERCLGDCNCTAYANID-  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
                GSGC+IWT E FDIR Y  EG Q LYVR+AASD    G  +R      K   +++  
Sbjct  400   ---GSGCLIWTGEFFDIRNYGHEG-QDLYVRLAASDLGDEGNKSR------KIIGLVVGI  449

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              I+  +  ++      K+++ +      +     ++R++D LMN   ISS R  SGE   
Sbjct  450   SIMFLLSFIVICCWKRKQKRAKAIAAPTV----YQDRNQDLLMNEVVISSMRNFSGENK-  504

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T++ ELP+ +F A+ +ATDNF+++NKLGQGGFG VYKG L+ G+EIAVKRLS+ S QG  
Sbjct  505   TEDSELPLMEFKAVLIATDNFSDSNKLGQGGFGIVYKGRLLDGQEIAVKRLSETSTQGTS  564

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE+RLIARLQH NLV+LLGCCVD+DEKMLIYEY+EN SLD  LFDK +S+ L+WK R
Sbjct  565   EFKNEMRLIARLQHINLVRLLGCCVDVDEKMLIYEYLENLSLDFYLFDKTQSAKLNWKMR  624

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++I  G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMAR+F  DETEA  
Sbjct  625   FDITNGIARGLLYLHQDSRFRIIHRDLKASNILLDKDMIPKISDFGMARIFARDETEAN-  683

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  + + NLLG  W
Sbjct  684   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGCVW  743

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE A DRP M++V+LML  + 
Sbjct  744   RNWKEGKGLEIVDPIIIDSSTTFRPKEILRCIQIGLLCVQEHAHDRPTMSSVVLMLGSET  803

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              ++PQP  PG+C+    ++ DSSS+   D    ++NQ+T++++DAR
Sbjct  804   IAIPQPNTPGYCVGRSSLETDSSSSGQQDDESCTVNQITLSVMDAR  849


 Score = 54.7 bits (130),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLLGCC++  EKMLI       SLD ++FD T+ A+LNW
Sbjct  577  QHINLVRLLGCCVDVDEKMLIYEYLENLSLDFYLFDKTQSAKLNW  621



>dbj|BAA23676.1| receptor kinase 1 [Brassica rapa subsp. oleifera]
Length=847

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/847 (51%), Positives = 587/847 (69%), Gaps = 25/847 (3%)
 Frame = +3

Query  669   WPESGTADDIL**GPPWNPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDR  848
             +P SG   + L   P  +  ++ N+T+VS  E F+LGFF+PG +S   Y+GIWYK+I  R
Sbjct  21    FPASGVYANTL--SPTESLTISNNKTIVSRNETFELGFFTPGSSSR-WYLGIWYKKIPTR  77

Query  849   TIVWVANRDKPLRNSTGFLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSG  1028
             T VWVANRD PL   +G LKI  D N+ + D +   +WS++ T   S     VA+LLD+G
Sbjct  78    TYVWVANRDNPLSRPSGSLKISSDNNLVIYDHSDTPVWSTNLTVGAS-RSPVVAELLDNG  136

Query  1029  NFVVRRENDENPENYLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDIT  1208
             NFV+   N  +PE YLWQSFD+PTDTLLP MKLGWD KTG +R + SW+S  DP+ GD +
Sbjct  137   NFVL---NSNDPEGYLWQSFDFPTDTLLPDMKLGWDKKTGLDRVLRSWKSVEDPASGDYS  193

Query  1209  FKLDINGLPEAFLRNKDIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEI  1388
              KL+  G PE ++ NK+ IIYRSG W G  FS VPEM+P E + ++F+ +  EV Y++ +
Sbjct  194   TKLETRGFPEYYVFNKETIIYRSGPWIGNRFSCVPEMKPIEYMVYTFIASNEEVSYAYHM  253

Query  1389  HNKNLFSRLIVNYTQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVC  1568
                +++S L ++YT  ++R  WI + + W + W  PKD CDNYR+CG++G CD++  P C
Sbjct  254   TKPDVYSTLSLSYTGTIQRRNWIEQAQDWKQLWYQPKDICDNYRQCGNYGYCDSNNLPNC  313

Query  1569  GCPVGFKPRNQQAWSLRDGSGGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLD  1745
              C  GF   N Q W+LRD S GC R   L C   DGF+++   KLP+++ + +D  + L 
Sbjct  314   NCIKGFGLENGQEWALRDDSAGCVRKTRLSCDGRDGFVAVKRMKLPDTAATVLDRGIGLK  373

Query  1746  ECKEMCVRNCSCTAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQT  1925
             ECK  C+++C+CTAY+N +I +GGSGCVIW   LFDIR Y   GGQ +YV++AA+D +  
Sbjct  374   ECKAKCLQDCNCTAYANTDIRDGGSGCVIWNGGLFDIRMY-PNGGQDIYVKLAAADLDH-  431

Query  1926  GEVARGGNGFGKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRE-RSR  2102
                      F  T    +    +  I ++L  +++L   K ++     I+     + RS+
Sbjct  432   ---------FKITSHGTIIGSGIGVIILLLLSIIILGYWKRKQKRFITIQTPIVDQVRSQ  482

Query  2103  DPLMNATAISSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGM  2282
             D L+N   ++S+R  S E   TD+ ELP+ +F A+ MAT+ F+ AN LGQGGFG VYKGM
Sbjct  483   DLLINQVVLTSERYISRENK-TDDLELPLMEFEALDMATNRFSVANMLGQGGFGIVYKGM  541

Query  2283  LVGGEEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMEN  2462
             L  G+EIAVKRLSK S QG +EFKNE+RLIARLQH NLV+LLGCCVD  EKMLIYEY+EN
Sbjct  542   LPDGKEIAVKRLSKMSLQGTDEFKNEVRLIARLQHINLVRLLGCCVDKGEKMLIYEYLEN  601

Query  2463  KSLDSILFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMN  2642
              SLDS LFDK R S L W +R++I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M 
Sbjct  602   LSLDSHLFDKIRRSNLSWPKRFDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKNMT  661

Query  2643  PKISDFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVS  2822
             PKISDFGMAR+FG +ETEA  T+++VGTYGYM+PEYAMDG+FS+KSD FSFGVL+LE+++
Sbjct  662   PKISDFGMARIFGREETEA-NTRKVVGTYGYMAPEYAMDGIFSMKSDVFSFGVLLLEIIT  720

Query  2823  GRKNQGFYTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLC  2999
             G++++GFY  + + NLLG  WR W EG+G E++D +I   S S     +++RCIQ+GLLC
Sbjct  721   GKRSKGFYNSNRDNNLLGFVWRYWKEGKGIEIVDPIIMDSSLSALCTHEILRCIQIGLLC  780

Query  3000  VQEKAEDRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ--SLNQLT  3173
             VQE+AEDRP M+ VM+ML  + T++PQPK PGFC+     + +SSS++  D   S+NQ+T
Sbjct  781   VQERAEDRPVMSTVMVMLGSETTAIPQPKPPGFCVGRSLFETESSSSTQRDDELSVNQIT  840

Query  3174  VTMLDAR  3194
             ++++DAR
Sbjct  841   LSVIDAR  847


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD  +R+ L+W K
Sbjct  575  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKIRRSNLSWPK  621



>gb|AFP33758.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33759.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33760.1| SRK [Arabidopsis halleri subsp. gemmifera]
Length=840

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/825 (51%), Positives = 574/825 (70%), Gaps = 29/825 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS G+VF+LGFF  G +    Y+GIWYK++ + + VWVANR+ PL NS G LK
Sbjct  42    ISSNRTIVSPGDVFELGFFKLG-SPARWYLGIWYKKVPEISYVWVANRNNPLSNSMGGLK  100

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  DGN+ + D   N +WS+ N   + V  + VA+LLD+GNFV+R  N+ +P+ +LWQSF
Sbjct  101   I-VDGNLIIFDHYDNYVWST-NLTTKDVRSSLVAELLDNGNFVLRVSNNNDPDKFLWQSF  158

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             DYPTDTLLP MKLGWD KTG NR++ SW+S  DPS G+ T KL+  G PE  +R +   I
Sbjct  159   DYPTDTLLPQMKLGWDLKTGLNRFLRSWKSSDDPSSGNFTCKLETRGFPEFLIRFRFTPI  218

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG W+G+ FSG+PEM   + +   F     EV Y+F + NK+++SR+ ++   + ERY
Sbjct  219   YRSGPWDGIRFSGMPEMRDLDYMFNKFTANGEEVVYTFLMTNKSIYSRITLSSAGIFERY  278

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TW+P +  W  F ++P DQCD   ECG +  CDT  SPVC C  GF P++QQ W L DG 
Sbjct  279   TWVPTSWEWTLFSSSPTDQCDMNEECGPYSYCDTSTSPVCNCIQGFSPKSQQQWDLADGL  338

Query  1629  GGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
              GC R   L C  D FL +   KLP+++++ VD  +   +CK+ C+ NC+CT ++N +I 
Sbjct  339   SGCVRRTPLSCRGDRFLRLKNMKLPDTTSAIVDMEIDEKDCKKRCLWNCNCTGFANADIR  398

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             NGGSGCVIWT EL DIR Y A  GQ  +VR+AAS+     ++++   G      ++  C 
Sbjct  399   NGGSGCVIWTGELLDIRSYVA-NGQDFHVRLAASEIGDEKKISKTIIGL-----IVGVCV  452

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
             ++L   ++ +     K+R     +          ER++D +MN   IS++R  S ET  T
Sbjct  453   MLLLSSIIFYFWNRRKKRANATPIV-------FEERNQDLVMNGVVISNRRHLSAETE-T  504

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             ++ ELP+ +F A+ MATDNF+++NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG +E
Sbjct  505   EDLELPLMEFEAVVMATDNFSSSNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGFDE  564

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             F NE++LIARLQH NLV+LLGCC+D++E MLIYEY+ N SLDS LFD+ + S L+W+ R+
Sbjct  565   FMNEVKLIARLQHINLVRLLGCCIDVEEMMLIYEYLANLSLDSYLFDQNQRSKLNWQMRF  624

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             +I  G+ARGLLYLHQDSR RIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETEA  T
Sbjct  625   DITNGIARGLLYLHQDSRCRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEAN-T  683

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             +R+VGTYGYMSPEYAMDG+FS KSD FSFGVL+LE++SG++N+GFY  +++ NLL   WR
Sbjct  684   RRVVGTYGYMSPEYAMDGIFSTKSDVFSFGVLLLEIISGKRNKGFYNSNHDLNLLDCVWR  743

Query  2889  LWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
              W EG+G E++D +I   S S F   +++RCIQ+GLLCVQE AEDRP M++V+LML  + 
Sbjct  744   NWKEGKGLEVVDPIIKDSSSSTFRPHEILRCIQIGLLCVQEYAEDRPMMSSVVLMLGSET  803

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ--SLNQLTVTMLDAR  3194
               +PQPK PG+C+          S  YND+  SLNQ+T+++++ R
Sbjct  804   VGIPQPKPPGYCVG--------RSKQYNDESCSLNQITLSIVEPR  840



>gb|KHN19083.1| Receptor-like serine/threonine-protein kinase SD1-8 [Glycine 
soja]
Length=743

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/734 (57%), Positives = 533/734 (73%), Gaps = 15/734 (2%)
 Frame = +3

Query  1005  VAQLLDSGNFVVRRENDENPENYLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSP-  1181
             V QLLD+GN V+R  N  +P  YLWQSFDYPTDTLLPGMK+GW+  TG  ++++SW++  
Sbjct  21    VLQLLDTGNLVLREANITDPTKYLWQSFDYPTDTLLPGMKMGWNLDTGVEKHLTSWKATG  80

Query  1182  TDPSEGDITFKLDINGLPEAFLRNKDIIIYRSGGWNGVAFSGVPEMEPK-EVIAFSFMRT  1358
             +DPS GD +FK+D  G+PE FLR+   I YRSG WNG  FSGVPEM+P  + I F F   
Sbjct  81    SDPSSGDYSFKIDTRGIPEIFLRDDQNITYRSGPWNGERFSGVPEMQPNTDTITFDFSYD  140

Query  1359  KNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFG  1538
             K+ VYY F I ++++ SRL++     L+R TW+P    W +FW A KDQCD YRECG +G
Sbjct  141   KDGVYYLFSIGSRSILSRLVLTSGGELQRLTWVPSRNTWTKFWYARKDQCDGYRECGPYG  200

Query  1539  ICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTS  1718
             +CD++ SPVC C  GF+PRN QAW+LRDGS GC R  +LDC  D FL +   KLPE++  
Sbjct  201   LCDSNASPVCTCVGGFRPRNLQAWNLRDGSDGCVRNTDLDCGRDKFLHLENVKLPETTYV  260

Query  1719  FVDATMSLDECKEMCVRNCSCTAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVR  1898
             F + TM+L EC+++C +NCSCTAY+N  I+NGGSGCV WT EL D+R Y A GGQ LYVR
Sbjct  261   FANRTMNLRECEDLCRKNCSCTAYANIEITNGGSGCVTWTGELIDMRLYPA-GGQDLYVR  319

Query  1899  VAASDAEQTGEVARGGNGFGKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEM  2078
             +AASD   +G  +   N  G+   + ++  +++   +V+F                    
Sbjct  320   LAASDV-GSGGGSHKKNHIGEVVGITISAAVIILGLVVIFWKKRKLLSISNVKAGP----  374

Query  2079  RGTRERSRDPLMNAT-AISSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQG  2255
             RG+ +RSRD L       S+ R++SGE  + D+ ELP+FDFN I MATDNF+ ANKLGQG
Sbjct  375   RGSFQRSRDLLTTVQRKFSTNRKNSGERNM-DDIELPMFDFNTITMATDNFSEANKLGQG  433

Query  2256  GFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEK  2435
             GFG VY+G L+ G++IAVKRLSK+S QG EEFKNE++LI RLQHRNLV+L GCC+++ E+
Sbjct  434   GFGIVYRGRLMEGQDIAVKRLSKSSMQGVEEFKNEIKLIVRLQHRNLVRLFGCCIEMHER  493

Query  2436  MLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKAS  2615
             +L+YEYMEN+SLDSILFDK +  +LDWKRR+NIICG+ARGLLYLH DSRFRIIHRDLKAS
Sbjct  494   LLVYEYMENRSLDSILFDKAKKPILDWKRRFNIICGIARGLLYLHHDSRFRIIHRDLKAS  553

Query  2616  NVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSF  2795
             N+LLD EMNPKISDFGMARLFG ++TEA T+ R+VGTYGYMSPEYAMDG FSVKSD FSF
Sbjct  554   NILLDSEMNPKISDFGMARLFGSNQTEANTS-RVVGTYGYMSPEYAMDGNFSVKSDVFSF  612

Query  2796  GVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMR  2975
             GVLVLE+++G+KN+GFY  + + NLLG AWR W +G   EL+DS   S   S    +V+R
Sbjct  613   GVLVLEIITGKKNRGFYYSNEDMNLLGNAWRQWRDGSALELIDS---STGDSYSPSEVLR  669

Query  2976  CIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKM-DSSSTSYND  3152
             CI VGLLCVQE+AEDRP M++V+LML  +   +PQP+ PGF +   P +   SSS     
Sbjct  670   CIHVGLLCVQERAEDRPTMSSVLLMLSSESVLMPQPRNPGFSIGKNPAETDSSSSKKDES  729

Query  3153  QSLNQLTVTMLDAR  3194
              S+NQ+TVT+LDAR
Sbjct  730   WSVNQVTVTLLDAR  743



>ref|XP_008225015.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Prunus mume]
Length=1616

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/826 (55%), Positives = 580/826 (70%), Gaps = 27/826 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG-FLKIG  914
             N T+VS  EVF+LGFF PG NSG  Y+GIWYK +++RT+VWVANRD PL NS+G  L  G
Sbjct  811   NMTIVSPCEVFELGFFKPGNNSG-WYLGIWYKNVQNRTVVWVANRDTPLSNSSGALLMTG  869

Query  915   EDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + GNI L+D +GN  WSS++T  Q +  N +  LLD+GN V++ E  EN +   WQSFDY
Sbjct  870   DHGNIFLLDPSGNVTWSSNHT--QVLRPNVL--LLDTGNLVIK-EGTENSQTIFWQSFDY  924

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PT  LLP MKLGW+  TG NR+++SW+S  DPS GD + KLD +G PE FL +K +  +R
Sbjct  925   PTHILLPDMKLGWNLSTGLNRHLTSWKSSEDPSTGDFSIKLDYHGFPEIFLWHKHVKNFR  984

Query  1275  SGGWNGVAFSGVPEM-EPKEVIAFSFMRTKNEVYYSFEIHNKNL--FSRLIVNYTQLLER  1445
             +G WNG+ FSGVPEM   K  + F+F+  ++EVYYSF + NK    +S L V+    +++
Sbjct  985   TGPWNGMIFSGVPEMCASKHGVDFNFVTKQDEVYYSFSLQNKLELEYSGLTVSPNGDVQQ  1044

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
              TW+   ++WN F   PKDQCD+Y ECG FGICDT+ SPVC C  GF+P+N +AW+L +G
Sbjct  1045  ITWVESTKMWNIFQYPPKDQCDSYGECGPFGICDTNASPVCKCVRGFQPKNLEAWNLGNG  1104

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
               GC R  EL C  D FL +   KLPES  +FVD  MSL+ CKE C+ NCSC+AY N  I
Sbjct  1105  LDGCVRKRELKCTKDKFLRLRSVKLPESWGAFVDRDMSLEACKEKCLENCSCSAYCNMEI  1164

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
             +NGG GCV+W  EL D+R Y A+GGQ LYVR+A S+         GG+G      +I+  
Sbjct  1165  TNGGRGCVMWFRELMDMRVY-ADGGQDLYVRLAPSEI--------GGDGKETLAIIIVVA  1215

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              + L I +   G  ++ +R LR       + +G   RS+  L+N    +SK  +SGE  I
Sbjct  1216  IVGLVILLAGLGFYIVWKRNLRISRNARTQPKGPCGRSQVLLLNEVVFTSKDFYSGER-I  1274

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
              DE EL + DF+ +A+AT+NF++ N LG+GGFG VYKG L  G+EIAVKRLSKNS QG E
Sbjct  1275  NDEPELALIDFSTVAVATNNFSDENLLGEGGFGYVYKGTLTEGQEIAVKRLSKNSGQGTE  1334

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNEL+LIARLQH NLV+LL CC+D DE+MLIYEYMENKSLD+ LF K++ S LDW++R
Sbjct  1335  EFKNELKLIARLQHINLVRLLACCIDKDEQMLIYEYMENKSLDAFLFSKEKRSTLDWQKR  1394

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             YNIICG+ARGL+YLHQDSRFRIIHRDLKASN+LLD E  PKISDFGMAR+FG D+ E+  
Sbjct  1395  YNIICGIARGLVYLHQDSRFRIIHRDLKASNILLDGEFTPKISDFGMARIFGKDQNES-H  1453

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPS-NEENLLGLA  2882
             T+R+VGTYGYMSPEYAMDG FS KSD FSFGVLVLE++SG+KN+GF+  S N+ NLL  A
Sbjct  1454  TRRVVGTYGYMSPEYAMDGFFSTKSDVFSFGVLVLEIISGKKNKGFFNYSDNKPNLLDCA  1513

Query  2883  WRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK  3062
             W+ W EG+G E++DS   S  +S    +V+RCIQVGLLCVQE   DRP M++V+ ML   
Sbjct  1514  WKQWKEGKGLEIVDS---SLGNSYCPSEVLRCIQVGLLCVQEHVVDRPTMSSVVFMLSSP  1570

Query  3063  GTSLPQPKQPGFCLASKPV-KMDSSSTSYN-DQSLNQLTVTMLDAR  3194
               ++PQPK PGFCL   P  + DSSS+      + +Q+T+  LD R
Sbjct  1571  DATMPQPKTPGFCLGRNPAGQTDSSSSKLEGSHTTDQVTIAALDGR  1616


 Score =   522 bits (1344),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 332/858 (39%), Positives = 470/858 (55%), Gaps = 135/858 (16%)
 Frame = +3

Query  726   PLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLR--NSTG  899
             PL   QT+VS G +F+LGFFSP  ++   YVGIWY+ I  R +VWVANR+KPL   ++  
Sbjct  42    PLAEGQTIVSPGNLFELGFFSPNNSAANKYVGIWYQNILPRKVVWVANREKPLAVADTVA  101

Query  900   FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVP--GNTVAQLLDSGNFVVRRENDENPENY  1073
              L+I  +G + LVDG  NS+WS    NN SVP  G+  A LLD GNFVV+   +    ++
Sbjct  102   SLRISRNGTLELVDGKQNSVWS----NNVSVPSNGSAAALLLDDGNFVVKV--NAGAADH  155

Query  1074  LWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLR-  1250
             LW+SFDYP+DTLLP M LG+DSK+G+  ++S+W+S +DPS G     L    +P   +  
Sbjct  156   LWESFDYPSDTLLPSMLLGFDSKSGKRNFLSAWKSESDPSTGIFLAGLRPE-VPSQLVVW  214

Query  1251  -NKDIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKN--EVYYSFEIHNKNLFSRLIV  1421
              N   + +RSG W+   F GVPEM+ +    F           Y+SF + +K + + + +
Sbjct  215   INGSTLNWRSGPWDKSKFIGVPEMDDQYQSGFYLDENAQLGTKYFSFSLFDKTVAAYMDI  274

Query  1422  NYTQLLER-YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRN  1598
             +   +L+  Y+   EN  WN FW APK  CDNY  CG FG C    SP+C C  GF P++
Sbjct  275   SSEGVLKLIYSTHGEN--WNTFWEAPKSPCDNYGACGPFGACKASESPICKCLKGFVPKS  332

Query  1599  QQAWSLRDGSGGCFRYDELDCPT------------DGFLSMNYTKLPESSTSFVDATMSL  1742
              + WS  + +GGC R  +L C +            DGF  M+  KLP+       +++S 
Sbjct  333   LEEWSKGNRAGGCVRKTKLFCESNTNQSVGSRGNDDGFWKMSRVKLPDFHEYI--SSLST  390

Query  1743  DECKEMCVRNCSCTAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQ  1922
             + C+  C+ NCSC AY+  N      GC++W+ ++ D+ ++++  GQ L++R+       
Sbjct  391   ENCRRQCLDNCSCLAYTYVN----NIGCLVWSKDIIDVEEFSS-AGQDLFIRL-------  438

Query  1923  TGEVARGGNGFGKTKKVILA-----CgivlgigmvlfgllllkrrklrrgVTEN-IEMRG  2084
                  R  +G GK  ++I++     C + +   +V     L  ++     VT   IE+  
Sbjct  439   -----RTESGEGKRTRLIVSLTVAICFMCVLAAIVFILHRLRAKQTGNIKVTRKFIELND  493

Query  2085  TRERSRDPLMNATAISSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFG  2264
             T   S + L         R H       D  EL I++F+ I +AT+NF+  NKLG+GGFG
Sbjct  494   TIGNSSNTLQEYI-----RRH-------DRSELLIYNFDNILLATNNFSITNKLGEGGFG  541

Query  2265  SVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLI  2444
              VYKG L  G+EIAVKRLS +S QG EEFKNE+ LI+++QH+NLV+++GC V  DEK+LI
Sbjct  542   PVYKGKLQEGKEIAVKRLSSSSGQGIEEFKNEMLLISKMQHKNLVRIMGCSVQDDEKLLI  601

Query  2445  YEYMENKSLDSILFDKKR-SSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNV  2621
             YE+M N SLD++LF+     ++LDW RR+ II GVARGLLYLH DS  ++IHRDLK SN+
Sbjct  602   YEFMPNGSLDTLLFNPMTGGAVLDWGRRFKIIQGVARGLLYLHHDSCLKVIHRDLKVSNI  661

Query  2622  LLDKEMNPKISDFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGV  2801
             LLD+ MNPKISDFG+AR+    ++ A T K +VGT                      FGV
Sbjct  662   LLDENMNPKISDFGLARIVQSTQSLANTHK-VVGTI---------------------FGV  699

Query  2802  LVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCI  2981
             L+LE++SG+KN  FY                                      DQ     
Sbjct  700   LLLEIISGKKNTSFYCS------------------------------------DQ-----  718

Query  2982  QVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSL  3161
             Q+G L   + A DRP M  V+ ML    T  PQP +P F +  K V  D      N  S 
Sbjct  719   QLGFL-AYDNAADRPTMPDVVSML-STETDRPQPNRPIFTV-QKSVS-DPQPKYDNIYSG  774

Query  3162  NQLTVTMLDAR*LIHVRP  3215
             N+ T+T++  R L+ + P
Sbjct  775   NEATITVIQGRYLLTLSP  792



>ref|XP_010924053.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=822

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/818 (51%), Positives = 563/818 (69%), Gaps = 28/818 (3%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             QTLVS G +F+LGFFSPG NS   Y+GIWYK+I  +TIVW+ANR  PL +STG L I +D
Sbjct  33    QTLVSTGGIFELGFFSPG-NSPYRYLGIWYKKIPVQTIVWIANRASPLTDSTGVLTIRKD  91

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             GN+ L++     +W++ +    S   N +AQLLDSGNFV+  E   +PE++ WQSFDYP+
Sbjct  92    GNLVLLNSRAEVLWTTGS--RVSASSNPIAQLLDSGNFVLTAEESSSPESFAWQSFDYPS  149

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DTLLPGMKLGW+ KTG NRYISSW+S  DPS G  +F++D +G PE FL  +   I+ SG
Sbjct  150   DTLLPGMKLGWNLKTGLNRYISSWKSSDDPSPGSYSFRMDPHGSPELFLYRESTKIHASG  209

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ FSG+PE++P +   FSF+  K+EVYY++EI+  ++ SRL V  + L++R+ W+ 
Sbjct  210   PWNGLQFSGIPELKPDDFFRFSFISNKDEVYYTYEINKGSVVSRLAVTTSGLVQRFVWLD  269

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
               R WN FW+ PKDQCD+Y  CG FG+C+++ SPVC C  GF+P++ Q W+LRDGS GC 
Sbjct  270   ATRAWNVFWSDPKDQCDHYAACGPFGVCNSNQSPVCSCLEGFRPKSPQEWNLRDGSAGCV  329

Query  1641  RYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGS  1820
             R    DC  DGF++++  KLP+++++ VD +MSL+ C+E C++NCSC AY++ NI  G S
Sbjct  330   RITPSDCKGDGFVTLSNMKLPDTTSASVDESMSLNMCRESCLKNCSCRAYASANIGGGES  389

Query  1821  GCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlg  2000
             GC+IW  +L DIR +   GGQ L VR+AAS      E+A+  +G     K ++   +++ 
Sbjct  390   GCIIWATDLIDIRHFVG-GGQNLQVRLAAS------ELAKMNSGRSSDDKKVVIVSVLIF  442

Query  2001  igmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEYE  2180
              G++L G+        +R  T +    G     R P   A  ++ +     E   + E +
Sbjct  443   SGLLLLGIGGCCMLNEKRRTTSSPSFSG-----RGP---AAYLAKEHCSDDEIRASKELD  494

Query  2181  LPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNE  2360
             LP FD   I  AT++FA  +K+G+GGFG VY+G L  G++IAVKRLS+ S QG +EFKNE
Sbjct  495   LPFFDLEIILAATNSFAIESKVGEGGFGPVYQGKLNNGQDIAVKRLSEKSSQGPDEFKNE  554

Query  2361  LRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIIC  2540
             + LIA+LQHRNLV+LLGCC+   E+MLIYEYM N SLD+ +FD+ + SLL W+ R+ II 
Sbjct  555   VMLIAKLQHRNLVRLLGCCIHRGERMLIYEYMHNGSLDTFIFDEGKRSLLSWQNRFVIIL  614

Query  2541  GVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIV  2720
             G+ARGLLYLHQDSRFRIIHRDLKA NVLLD+EMNPKISDFGMAR+FG D+T A  T+++V
Sbjct  615   GIARGLLYLHQDSRFRIIHRDLKAGNVLLDREMNPKISDFGMARIFGDDQTHA-RTRKVV  673

Query  2721  GTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGE  2900
             GTYGYM+PEYAMDG+ S+K D FSFGVLVLE++SG++N+GFY      NL+  AW+LW E
Sbjct  674   GTYGYMAPEYAMDGILSIKLDVFSFGVLVLEIISGKRNRGFYQSEQHSNLITHAWKLWKE  733

Query  2901  GRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQ  3080
             G+  ELLD  +     SE    V+RCIQVGLLC Q +  DRP M++V++ML  +  +LP+
Sbjct  734   GKSFELLDESLEDLHTSE----VLRCIQVGLLCAQAQPGDRPMMSSVIMMLATENAALPE  789

Query  3081  PKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             PK+PGF      V + +        S N LT T + AR
Sbjct  790   PKEPGFSTGEGSVDIKTCI-----HSANYLTATSVQAR  822


 Score = 61.6 bits (148),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRLLGCCI  GE+MLI       SLDTF+FD  KR+ L+W
Sbjct  562  QHRNLVRLLGCCIHRGERMLIYEYMHNGSLDTFIFDEGKRSLLSW  606



>gb|AID21577.1| SRKp [Arabidopsis halleri]
Length=849

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/826 (52%), Positives = 573/826 (69%), Gaps = 25/826 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS   VF+LGFF    NS   Y+GIWYK++ ++T VWVANRD P  NS G LK
Sbjct  45    ISSNRTIVSPSGVFELGFFETAPNSR-WYLGIWYKKVPEKTYVWVANRDHPFSNSIGILK  103

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENP-ENYLWQS  1085
             I E  N+ L+D +   +WS++ T     P   VA+LLD+GNFV+R  +++N  + YLWQS
Sbjct  104   ISE-ANLVLLDHSDTLVWSTNRTGGTRSP--VVAELLDNGNFVLRESSNKNDLDRYLWQS  160

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FD+PTDTLLP MKLGWD KTG NRY++SW+SP DPS G  ++KL++ GLPE FL  KD  
Sbjct  161   FDFPTDTLLPEMKLGWDLKTGLNRYLTSWKSPNDPSSGYYSYKLELQGLPEFFLSYKDSP  220

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             ++RSG W+GV FSG+PE +    + ++F   + EV Y+F + N ++ SRL V+ +    R
Sbjct  221   MHRSGPWDGVRFSGMPEKKQLTYMVYNFTENEEEVAYTFSMTNHSILSRLTVSSSGTFNR  280

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             +TWIP +  WN  W +PKD CD Y  CG +  CD + SP C C  GF P+NQQ W L +G
Sbjct  281   FTWIPPSWQWNTVWFSPKDDCDLYERCGPYSYCDVNTSPSCNCIQGFDPKNQQQWDLSNG  340

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
               GC R   L C    FL +   KLP +  + VD  +   ECKE C+ +C+CTAY+N + 
Sbjct  341   VSGCVRRTRLSCSEKRFLRLKKMKLPVTMDAIVDRKIGKKECKERCLGDCNCTAYANID-  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
                GSGC+IWT +  DIR Y  EG Q LYVR+AASD    G  +R      K   +++  
Sbjct  400   ---GSGCLIWTGDFLDIRNYGHEG-QDLYVRLAASDLGDEGNKSR------KIIGLVVGI  449

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              I+  +  ++      K+++ +      +     ++R++D LMN   ISS R  SGE   
Sbjct  450   SIMFLLSFIIICCWKRKQKRAKAIAAPTV----YQDRNQDLLMNEMVISSMRNFSGENK-  504

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T++ ELP+ +F A+ +ATDNF+++NKLGQGGFG VYKG L+ G+EIAVKRLS+ S QG  
Sbjct  505   TEDSELPLMEFKAVLIATDNFSDSNKLGQGGFGIVYKGRLLDGQEIAVKRLSETSTQGTS  564

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE+RLIARLQH NLV+LLGCCVD+DEKMLIYEY+EN SLD  LFDK +S+ L+WK R
Sbjct  565   EFKNEMRLIARLQHINLVRLLGCCVDVDEKMLIYEYLENLSLDFYLFDKTQSAKLNWKMR  624

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++I  G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMAR+F  DETEA  
Sbjct  625   FDITNGIARGLLYLHQDSRFRIIHRDLKASNILLDKDMIPKISDFGMARIFARDETEAN-  683

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  + + NLLG  W
Sbjct  684   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGCVW  743

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE A DRP M++V+LML  + 
Sbjct  744   RNWKEGKGLEIVDPIIIDSSTTFRPQEILRCIQIGLLCVQEHAHDRPTMSSVVLMLGSET  803

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              ++PQP  PG+C+    ++ DSSS+   D    ++NQ+T++++DAR
Sbjct  804   IAIPQPNTPGYCIGRSSLETDSSSSEQQDDESCTVNQITLSVMDAR  849


 Score = 54.7 bits (130),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLLGCC++  EKMLI       SLD ++FD T+ A+LNW
Sbjct  577  QHINLVRLLGCCVDVDEKMLIYEYLENLSLDFYLFDKTQSAKLNW  621



>gb|AGN12877.1| putative S-locus receptor kinase [Sisymbrium irio]
Length=858

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/827 (52%), Positives = 578/827 (70%), Gaps = 24/827 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G+VF+LGFF     S   Y+GIWYK++ +RT  WVANRD PL N+ G LKI  
Sbjct  48    NRTLVSPGDVFELGFFKITPTSS-WYLGIWYKKVPERTYAWVANRDNPLSNAVGTLKIS-  105

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             D N+ L+D +GN +WS+ N    +V    +A+LL +GNFV+R   + +P  +LWQSFDYP
Sbjct  106   DRNLVLLDQSGNLVWST-NLTRGNVRSPVMAELLANGNFVLRYSKNNDPSEFLWQSFDYP  164

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
             TDTLLP MKLG D KTG NR++ S +S  DPS G+ ++KL+  GLPE FL   D  ++RS
Sbjct  165   TDTLLPEMKLGLDRKTGLNRFLRSGKSLDDPSSGNYSYKLETRGLPEFFLLKDDFQLHRS  224

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWI  1457
             G WNG+  SG+P  +    + ++F   + EV Y+F + N++++SRL ++    L+R+TWI
Sbjct  225   GPWNGIQISGIPGEQQLNYMVYNFTENREEVAYTFLMTNRSIYSRLTLSNEGYLQRFTWI  284

Query  1458  PENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGG  1634
             P    W  FW++P D QCD Y+ CG +  CDT+MSP C C  GF P N Q W LRDGS G
Sbjct  285   PPAWGWIVFWSSPMDIQCDLYQSCGPYAYCDTNMSPECNCIRGFTPWNTQQWELRDGSSG  344

Query  1635  CFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNG  1814
             C R   L C  D FL +   KLP+++ + VD  +   ECK+ C+R+C+CTA++N +I NG
Sbjct  345   CVRRTPLHCREDKFLRLKKMKLPDTTKAIVDRRIGTKECKQKCLRDCNCTAFANADIRNG  404

Query  1815  GSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgiv  1994
             G GCVIWT EL D+R + A GGQ LYVR+AAS+ E+    ++      K   +I+  G+V
Sbjct  405   GIGCVIWTQELEDVRNFVA-GGQDLYVRMAASELEEASNTSK------KIIGLIIGVGVV  457

Query  1995  lgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDE  2174
               +   LF     K+++ R   T ++     +ER+++ L+N   ISS+R H  ET  T++
Sbjct  458   FLLSFSLFCFWKRKQKQARSVATPDV----YQERNQELLLNGVVISSRR-HLSETNTTED  512

Query  2175  YELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFK  2354
              ELP+ +  A+ +AT+ F++ NKLG+GGFG VYKG L+ G+EIAVKRLS+ S QG  EFK
Sbjct  513   LELPLMELKAVVIATEIFSDCNKLGEGGFGIVYKGRLLDGQEIAVKRLSELSHQGTNEFK  572

Query  2355  NELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNI  2534
             NE++LIARLQH NLV++LGCCVD +EKMLIYEY+EN SLD  LF+K RSS L+W++R++I
Sbjct  573   NEVKLIARLQHINLVQILGCCVDANEKMLIYEYLENSSLDRYLFEKSRSSKLNWEKRFDI  632

Query  2535  ICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKR  2714
               G+ARGLLYLHQDSR RIIHRDLKASN+LLDK M PKISDFGMAR+F  DETEA  T+R
Sbjct  633   TNGIARGLLYLHQDSRCRIIHRDLKASNILLDKNMTPKISDFGMARIFARDETEA-ITRR  691

Query  2715  IVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLW  2894
             IVGTYGYMSPEYAM G+FS KSD FSFGVLVLE+VSG++N+GFY  ++E NLLG AWR W
Sbjct  692   IVGTYGYMSPEYAMGGIFSTKSDVFSFGVLVLEIVSGKRNRGFYNFNHENNLLGYAWRNW  751

Query  2895  GEGRGSELLDSVIASESHSEFV----DQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK  3062
              E +G E++D  I   S S        +V+RCIQ+GLLCVQE AEDRP M++V++ML  +
Sbjct  752   KEAKGLEIVDPTIVDSSSSSLSTFRPQEVLRCIQIGLLCVQELAEDRPTMSSVVMMLGSE  811

Query  3063  GTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
               ++PQPK PG  +   P++ +SSST+  D    ++NQ+T++++DAR
Sbjct  812   TAAIPQPKLPGNYVGRSPLETNSSSTTQRDDESWTVNQITLSVIDAR  858



>ref|XP_009105170.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like serine/threonine-protein 
kinase SD1-7 [Brassica rapa]
Length=845

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/827 (51%), Positives = 579/827 (70%), Gaps = 26/827 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ ++T++S  E+F+LGFF+P  +S   Y+GIWYK+I  RT VWVANRD PL +S G LK
Sbjct  40    ISSSKTIISRSEIFELGFFTPASSSR-WYLGIWYKKIPTRTYVWVANRDTPLSHSKGSLK  98

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ ++D +   +WS+ N    +V    VA+LLD+GNFV+R  N+     YLWQSF
Sbjct  99    IS-DNNLVILDHSNKPVWST-NLTGGTVRSPVVAELLDNGNFVLRHSNNYE---YLWQSF  153

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG NR++ S ++P DPS GD + K    G PE ++ NK+ I+
Sbjct  154   DFPTDTLLPEMKLGWDLKTGMNRFLRSRKTPDDPSSGDYSTKFKTIGFPEVYVCNKESIV  213

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRS  W+G+ F+G+PE+ P + +  +F  T  E+ YS+ I   N++S L +  T LL+R 
Sbjct  214   YRSXPWDGIRFNGIPEVRPVDYLVLNFSATDKEITYSYHITKSNIYSILTLTPTGLLQRS  273

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TW+   + W   W +P+D C+NY++CGS+G CD++ SPVC C  GFKPRN+  W LRD  
Sbjct  274   TWVERLQSWRPLWYSPRDICNNYKQCGSYGYCDSNASPVCNCIHGFKPRNK--WDLRDDF  331

Query  1629  GGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C  TDGF+ +   KLP+++ + VD  +  +EC+  C++NC+CTA++N +I
Sbjct  332   DGCVRKTRLSCDGTDGFVRLKNMKLPDTTKTIVDRGIGTEECEARCLKNCNCTAFANADI  391

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
              NGG GCVIWT ++ D+R Y AEGGQ LYVR AA+D +   ++   G   G +  + +  
Sbjct  392   RNGGWGCVIWTGDMLDMR-YFAEGGQDLYVRQAAADLDD--KITNNGKIIGSSVGMSILF  448

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              + + I                  V +         RS+D L +   ++ K   S E+  
Sbjct  449   LLSIIIFRFWKTKQKRATAVQTPIVDQ--------VRSKDSLTDEVIVTRKSYISRESK-  499

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T++ ELP+ +F A+A+AT+NF++ NKLG+GGFG VYKGML  G+EIAVKRLSK S QG  
Sbjct  500   TEDLELPLMEFEAVAIATNNFSDGNKLGKGGFGIVYKGMLPDGKEIAVKRLSKKSLQGTG  559

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE+RLIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDK R S L W++R
Sbjct  560   EFKNEVRLIARLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKIRRSNLSWQKR  619

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++I  G+ARGLLYLHQDSRFR+IHRDLKASN+LLDK M PKISDFGMAR+FG +ETEA  
Sbjct  620   FDIANGIARGLLYLHQDSRFRVIHRDLKASNILLDKNMTPKISDFGMARIFGREETEAN-  678

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFG+L+LE++SG+K  GFY  + + NLLG  W
Sbjct  679   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGILLLEIISGKKTNGFYNSNRDLNLLGFVW  738

Query  2886  RLWGEGRGSELLDSVIASESHSEFV--DQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             R W EG+G E++D +I  +S S  +   +++RCIQ+GLLCVQE+AEDRP M+ VM+ML  
Sbjct  739   RYWKEGKGIEIVDPIIIDDSSSAVLRTHEILRCIQIGLLCVQERAEDRPVMSTVMVMLGS  798

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSY--NDQSLNQLTVTMLDAR  3194
             + T++PQPK+PGFC+    ++ +SSS++   ++ S+NQ+T++++DAR
Sbjct  799   ETTAIPQPKRPGFCVGRSLLETESSSSTQRGDEVSVNQITLSVIDAR  845


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD  +R+ L+W K
Sbjct  572  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKIRRSNLSWQK  618



>ref|XP_010924049.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=835

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/828 (51%), Positives = 575/828 (69%), Gaps = 29/828 (4%)
 Frame = +3

Query  726   PLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFL  905
             PLT  QTL+SAG +F+LGFFSP  NS   YVGIWY ++  +T+VWVANR  P+    G L
Sbjct  32    PLTDGQTLISAGRIFELGFFSPA-NSNNRYVGIWYHKVSVQTVVWVANRQHPISERKGNL  90

Query  906   KIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDE--NPENYLW  1079
              I  +G + + D    +IWSS ++       N VAQLLD+GN ++R+ +D+  +P ++ W
Sbjct  91    SITANGTLIITDQNSTTIWSSGSSG----LANPVAQLLDTGNLIIRQTSDDTHDPNSFAW  146

Query  1080  QSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKD  1259
             QSFD+PTDTLLP MKLGW+  +  NR +++W S +DP+ G  +  +DI G PE FL N  
Sbjct  147   QSFDHPTDTLLPSMKLGWNLTSHLNRNLTAWTSSSDPAPGYYSMAMDIQGDPEIFLWNGA  206

Query  1260  IIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL  1439
               ++R+G W G  FSGVPEM+   +  F F+  ++E+YYSF I N+++ SRLIVN + + 
Sbjct  207   HRVWRAGPWVGQRFSGVPEMKTYSMFKFDFVNDQDEIYYSFNIFNESIISRLIVNQSGVT  266

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             +R  W+ ++++W+ FW APKDQCDN   CG FG+CD + SP+C C  GF+P++   W+LR
Sbjct  267   QRMVWLEQSQMWSIFWFAPKDQCDNVSPCGPFGVCDPNNSPICDCLQGFEPKSPTNWALR  326

Query  1620  DGSGGCFRYDELDCP--TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYS  1793
             DGS GC R    DC   TDGF++++  KLP++S S VD +++LD+C+  C+ NCSCTA++
Sbjct  327   DGSEGCKRKTARDCRNGTDGFVTVSDAKLPDTSGSTVDMSLNLDQCRAKCLTNCSCTAFA  386

Query  1794  NYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKV  1973
             +   S  G GC+IWT EL D+R +   GGQ LYVRVAA+D      +A   +    + + 
Sbjct  387   SAKTS--GDGCIIWTTELTDLRVF-GFGGQDLYVRVAAADLGMCCSIALDSSASDHSHRN  443

Query  1974  -ILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHS  2150
              I+A  +   +G++L G +     K         + + TR +++  L + +  S+  + S
Sbjct  444   DIIAVVVGSVLGILLLGFICCCFWK---------KKKRTRRQAQSTLGSVSFASNYIDES  494

Query  2151  GETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNS  2330
              E     E ELP+FD   IA AT+NF+  NKLG+GGFG VYKG L   +EIAVKRL+K S
Sbjct  495   TEGR---ELELPLFDLGTIAAATNNFSIQNKLGEGGFGPVYKGKLGDEQEIAVKRLAKTS  551

Query  2331  RQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLL  2510
              QG +EFKNE+ LIA+LQHRNLV+LLGCCV  +E+MLIYEYM N+SLD+ LFDK +++LL
Sbjct  552   VQGLDEFKNEVMLIAKLQHRNLVRLLGCCVQGEERMLIYEYMPNRSLDAFLFDKAKAALL  611

Query  2511  DWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDE  2690
             DW+ RY+II G+ARG+LYLHQDSRFRIIHRDLKASN+LLDKEMNPKISDFGMAR+FGGDE
Sbjct  612   DWRTRYHIIVGIARGILYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDE  671

Query  2691  TEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENL  2870
             TEA  T+R+VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE++SG+KN+G Y   +  NL
Sbjct  672   TEA-NTRRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIISGKKNRGIYLSHHHVNL  730

Query  2871  LGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLM  3050
              G AW  W EG G +L+D  I    HS  V + +RCI+VGLLCVQE  EDRP M++V+LM
Sbjct  731   PGHAWSSWKEGNGLDLVDDSIV---HSFPVSEALRCIKVGLLCVQEHPEDRPTMSSVVLM  787

Query  3051  LIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             L  + T LP PKQPGF     P+++DSSS+  +  ++N L+VT+ + R
Sbjct  788   LGSENTPLPDPKQPGFVSTKGPLEIDSSSSKQDSLTVNGLSVTIFEGR  835


 Score = 61.2 bits (147),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRLLGCC++G E+MLI      +SLD F+FD  K A L+W
Sbjct  569  QHRNLVRLLGCCVQGEERMLIYEYMPNRSLDAFLFDKAKAALLDW  613



>gb|AGC55015.1| S-receptor kinase [Arabidopsis thaliana]
Length=854

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/828 (50%), Positives = 575/828 (69%), Gaps = 24/828 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS G+ F+LGFF  G  S   Y+GIWYK++  RT  WVANRD PL NS G LK
Sbjct  45    ISSNRTIVSPGDDFELGFFKTG-TSSLWYLGIWYKKVPQRTYAWVANRDNPLSNSIGTLK  103

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I    N+ L+  +   +WS+ N  + ++    +A+LL +GNFV+R  N++    +LWQSF
Sbjct  104   I-SGRNLVLLGHSNKLVWST-NLTSGNLRSPVMAELLANGNFVMRYSNNDQG-GFLWQSF  160

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             DYPTDTLLP MKLGWD KTG NR + SWRS  DPS  + ++KL+  G PE FL ++D+ +
Sbjct  161   DYPTDTLLPQMKLGWDRKTGLNRILRSWRSLDDPSSSNYSYKLETRGFPEFFLLDEDVPV  220

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             +RSG W+G+ FSG+PEM     + ++F   ++E+ Y+F++ N +++SRL V+++  L+R+
Sbjct  221   HRSGPWDGIQFSGIPEMRQLNYMVYNFTENRDEISYTFQMTNHSIYSRLTVSFSGSLKRF  280

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
              +IP +  WN+FW+ P D C  Y  CG +G CD + SP+C C  GFKPRN Q W LRDGS
Sbjct  281   IYIPPSYGWNQFWSIPTDDCYMYLGCGPYGYCDVNTSPMCNCIRGFKPRNLQEWVLRDGS  340

Query  1629  GGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
              GC R  +L C  DGF+ +   KLP++++  VD  +   ECK+ C+ +C+CTA++N +  
Sbjct  341   SGCVRKTQLSCRGDGFVQLKKIKLPDTTSVTVDRRIGSKECKKRCLNDCNCTAFANADNK  400

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             N GSGCVIWT EL DIR Y A GGQ LYVR+AA+D ++  +V+    G      ++L   
Sbjct  401   NEGSGCVIWTGELVDIRNY-ATGGQNLYVRIAAADIDKGVKVSGKIIGLIAGVSIMLLLS  459

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
               +             R  +             +E+++D +MN  A+ S R H     +T
Sbjct  460   FTMLCIWKRKQKGARAREIVY------------QEKTQDLIMNEVAMKSSRRHFAGDNMT  507

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             ++ E P+ +  A+ MAT+NF++ N+LG+GGFG VYKG+L  G EIAVKRLSK S QG EE
Sbjct  508   EDLEFPLMELTAVVMATENFSDCNELGKGGFGIVYKGILPDGREIAVKRLSKMSLQGNEE  567

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             FKNE+RLIA+LQH NLV+LLGCC+D DEK+LIYEY+EN  LDS LFD  +S  L+W++R+
Sbjct  568   FKNEVRLIAKLQHINLVRLLGCCIDADEKILIYEYLENLGLDSYLFDTTQSCKLNWQKRF  627

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             +I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK++ PKISDFGMAR+FG DETEA  T
Sbjct  628   DIANGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDLTPKISDFGMARIFGRDETEA-NT  686

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             + +VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  +++ NLLG  WR
Sbjct  687   RTVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNRGFYNVNHDLNLLGCVWR  746

Query  2889  LWGEGRGSELLDSVIASESHSEFVD----QVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              W EG+G E++D V+   S S   +    +++RCIQ+GLLCVQE+A+DRP M++V+LML 
Sbjct  747   NWKEGKGLEIVDPVVKDSSPSSSSNFQPHEILRCIQIGLLCVQERAQDRPMMSSVVLMLG  806

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQS--LNQLTVTMLDAR  3194
              + T++PQPK PGFC+  +     SSS    D+S  +N++TV++L+AR
Sbjct  807   SETTTIPQPKTPGFCVGIRRQTDSSSSNQREDESCTVNEITVSVLEAR  854


 Score = 53.9 bits (128),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIKS------LDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCCI+  EK+LI        LD+++FD T+  +LNW K
Sbjct  579  QHINLVRLLGCCIDADEKILIYEYLENLGLDSYLFDTTQSCKLNWQK  625



>gb|ACO83273.1| SRK [Capsella rubella]
 gb|ACO83274.1| SRK [Capsella rubella]
 gb|ACO83275.1| SRK [Capsella rubella]
 gb|ACO83276.1| SRK [Capsella rubella]
 gb|ACO83277.1| SRK [Capsella rubella]
Length=853

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/824 (52%), Positives = 574/824 (70%), Gaps = 23/824 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+T+VS G +F+LGFF PG  S   Y+GIWYK+  + T VWVANRD+PL N+ G LK+  
Sbjct  48    NRTIVSPGGLFELGFFKPG-TSSRWYLGIWYKKTPEETFVWVANRDRPLPNAMGTLKLS-  105

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             D N+ L+D +   +WS++ T       + VA+LL +GN V+R  ++ NP  +LWQSF +P
Sbjct  106   DTNLVLLDHSNTLVWSTNLTRGDR-RSSVVAELLANGNLVLRYSSNSNPSGFLWQSFHFP  164

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
             TDTLLP MKLGWD KTGRN ++ SWRS  DPS G  +++L+    PE F+   D+ +YRS
Sbjct  165   TDTLLPQMKLGWDRKTGRNIFLRSWRSSDDPSTGKFSYRLETRSFPEFFIWQTDVPMYRS  224

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWI  1457
             G W+GV FSG+ EM   + + ++F   + EV Y+F + N +++SRL ++ +  L++ TW 
Sbjct  225   GPWDGVRFSGMVEMRDLDYMVYNFTDNQEEVVYTFLMTNHDIYSRLTMSPSGSLQQITWK  284

Query  1458  PENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGC  1637
              E+RI +  W +P D CD Y+ CG +  C  + S  C C  GF+P+ Q+AW++ DG+ GC
Sbjct  285   DEDRILS--WLSPTDPCDAYQICGPYSYCYLNTSAFCSCIKGFEPKIQEAWAVNDGTSGC  342

Query  1638  FRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNG  1814
              R   L C + DGF  +  TKLP+++ + VD ++ ++ECK+ C+ NC+CTAY+N +I NG
Sbjct  343   VRKTRLSCTSGDGFFKLKNTKLPDTTWTIVDKSIDVEECKKRCLSNCNCTAYANTDIRNG  402

Query  1815  GSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgiv  1994
             GSGCVIWT  L DIR Y A G Q LYV++A +D E        GN  GK   +I+   ++
Sbjct  403   GSGCVIWTGVLKDIRNYPATG-QELYVKLARADLED-------GNRKGKVIGLIVGISVI  454

Query  1995  lgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDE  2174
             L     +      +++K  R +          ER++D L N   ISS+   S E   TDE
Sbjct  455   LFFLCFIAFCFWRRKQKQARAIPAPF---AYEERNQDLLNNWMVISSRSHFSRENR-TDE  510

Query  2175  YELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFK  2354
              ELP+ +  AI +AT+NF+++NK+G+GGFG VYKG L+ G+EIAVKRLSK S QG  EF 
Sbjct  511   LELPLMEIEAIIIATNNFSHSNKIGEGGFGVVYKGNLLDGQEIAVKRLSKTSIQGTNEFM  570

Query  2355  NELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNI  2534
             NE+RLIARLQH NLV+LLGCC+D DEK+LIYEY+EN SLDS LFDK RS +L+W+ R++I
Sbjct  571   NEVRLIARLQHINLVRLLGCCIDTDEKILIYEYLENLSLDSYLFDKTRSYMLNWQMRFDI  630

Query  2535  ICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKR  2714
               G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M PKISDFGMAR+FG DETEA  T++
Sbjct  631   TNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKYMTPKISDFGMARIFGRDETEAN-TRK  689

Query  2715  IVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLW  2894
             +VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SGR+N+GFY    + NLLG  WR W
Sbjct  690   VVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGRRNKGFYNSHRDLNLLGCVWRHW  749

Query  2895  GEGRGSELLDSVIASESHSEFVDQ-VMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTS  3071
              EG+G E++D +I   S S F  Q ++RCIQ+GLLCVQE AEDRP M+ V+LM   + T+
Sbjct  750   EEGKGLEIVDPIIIDSSSSTFQPQEILRCIQIGLLCVQEGAEDRPMMSEVVLMFGSETTT  809

Query  3072  LPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             +PQPK PG+C+    V +DSSS++  D    S+NQ+T+++LDAR
Sbjct  810   VPQPKPPGYCVGRSLVNIDSSSSNQGDDESWSVNQITLSVLDAR  853



>ref|NP_176756.1| receptor-like serine/threonine-protein kinase SD1-6 [Arabidopsis 
thaliana]
 sp|Q9S972.2|SD16_ARATH RecName: Full=Receptor-like serine/threonine-protein kinase SD1-6; 
AltName: Full=Arabidopsis thaliana receptor kinase 2; 
AltName: Full=S-domain-1 (SD1) receptor kinase 6; Short=SD1-6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AEE34424.1| receptor kinase 2 [Arabidopsis thaliana]
Length=847

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/827 (52%), Positives = 587/827 (71%), Gaps = 22/827 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T++S  ++F+LGFF+P  +S   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  38    ISSNKTIISPSQIFELGFFNPDSSSR-WYLGIWYKIIPIRTYVWVANRDNPLSSSNGTLK  96

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ + D +   +WS+ N     V     A+LLD GNFV+R   +  P  +LWQSF
Sbjct  97    IS-DNNLVIFDQSDRPVWST-NITGGDVRSPVAAELLDYGNFVLRDSKNNKPSGFLWQSF  154

Query  1089  DYPTDTLLPGMKLGWDSKTGR-NRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             D+PTDTLL  MK+GWD+K+G  NR + SW++  DPS GD + KL  +G PE ++ NK+ I
Sbjct  155   DFPTDTLLSDMKMGWDNKSGGFNRILRSWKTTDDPSSGDFSTKLRTSGFPEFYIYNKESI  214

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
              YRSG W G  FS VP M+P + I  SF     +V YS+ ++  N++S L ++ T LL+R
Sbjct  215   TYRSGPWLGNRFSSVPGMKPVDYIDNSFTENNQQVVYSYRVNKTNIYSILSLSSTGLLQR  274

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
              TW+   + W + W +PKD CDNY+ECG++G CD + SP+C C  GF+P N+QA +LRD 
Sbjct  275   LTWMEAAQSWKQLWYSPKDLCDNYKECGNYGYCDANTSPICNCIKGFEPMNEQA-ALRDD  333

Query  1626  SGGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             S GC R  +L C   DGF+ +   +LP+++ + VD  + L EC+E C++ C+CTA++N +
Sbjct  334   SVGCVRKTKLSCDGRDGFVRLKKMRLPDTTETSVDKGIGLKECEERCLKGCNCTAFANTD  393

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             I NGGSGCVIW+  LFDIR Y A+GGQ LYVRVAA D E             K+KK+I +
Sbjct  394   IRNGGSGCVIWSGGLFDIRNY-AKGGQDLYVRVAAGDLEDKRI---------KSKKIIGS  443

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETM  2162
                V  + ++ F +    +RK +R +T    +     RS+D LMN   + + R ++ +  
Sbjct  444   SIGVSILLLLSFIIFHFWKRKQKRSITIQTPIVDL-VRSQDSLMNE-LVKASRSYTSKEN  501

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
              TD  ELP+ ++ A+AMAT+NF+  NKLGQGGFG VYKGML+ G+EIAVKRLSK S QG 
Sbjct  502   KTDYLELPLMEWKALAMATNNFSTDNKLGQGGFGIVYKGMLLDGKEIAVKRLSKMSSQGT  561

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
             +EF NE+RLIA+LQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFD+ RSS L+W++
Sbjct  562   DEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDQTRSSNLNWQK  621

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R++II G+ARGLLYLHQDSR RIIHRDLKASNVLLDK M PKISDFGMAR+FG +ETEA 
Sbjct  622   RFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEA-  680

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
              T+R+VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  + + NLLG  
Sbjct  681   NTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGFV  740

Query  2883  WRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             WR W EG+  E++D +      SEF   +++RCIQ+GLLCVQE+AEDRP M++VM+ML  
Sbjct  741   WRHWKEGKELEIVDPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVMVMLGS  800

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ--SLNQLTVTMLDAR  3194
             + T++PQPK+PGFC+    +++DSSS++  D   ++NQ+T++++DAR
Sbjct  801   ETTAIPQPKRPGFCVGRSSLEVDSSSSTQRDDECTVNQVTLSVIDAR  847


 Score = 57.8 bits (138),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+ + LNW K
Sbjct  575  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDQTRSSNLNWQK  621



>ref|XP_004485682.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Cicer arietinum]
Length=837

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/820 (52%), Positives = 560/820 (68%), Gaps = 18/820 (2%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             NQTLVS   +F+ GFF+        Y+GIWYK+  D+  VWVANR+ PL NS G LKI E
Sbjct  35    NQTLVSPQNIFEFGFFNT--TISKWYIGIWYKDFPDKIYVWVANRNNPLENSNGTLKIEE  92

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
              GN+ L + T N IWSS+ T   +   N V  L D GN V++   ++N  NY+WQSFD+P
Sbjct  93    SGNLVLFNQTNNPIWSSNQTTTSAT--NPVLHLSDDGNLVLKEAQEKNNTNYIWQSFDHP  150

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
             TDTLLPGMKLGW+  TG    ++SW+S  DPS GD  F LD +G+P+ +L NK   ++RS
Sbjct  151   TDTLLPGMKLGWNLDTGVEIRVTSWKSQDDPSSGDGYFSLDYHGIPDIYLWNKQQRVFRS  210

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWI  1457
             G WNG +F GVP +    V+    +  K++ YY      ++  SRL+VN+T  +ERY WI
Sbjct  211   GSWNGESFGGVPILNTISVLNDKIVADKHQAYYYPARLFQSNLSRLVVNWTGSIERYAWI  270

Query  1458  PENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGC  1637
                + WN  WNAP   CD+Y  CG FGICD++  P+C C  GF  +NQ  W+LR+ S GC
Sbjct  271   ESTKTWNIVWNAPAVDCDHYGACGPFGICDSNAFPICKCVTGFSIKNQGQWNLRNFSDGC  330

Query  1638  FRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGG  1817
              R  EL+C  D FL M   + P++ + FV+ +M+L EC+  C+++CSCTAY+N  I+NGG
Sbjct  331   VRKTELECGKDKFLHMKNVQFPDTRSVFVNKSMNLLECESKCLKDCSCTAYANAEITNGG  390

Query  1818  SGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivl  1997
             +GCV+W   L D+RQ+ +E G  L++R+AASD   TG         GK   + +A  I++
Sbjct  391   TGCVMWNYSLVDMRQF-SEAGTDLFIRLAASDVGGTGSSGGSKKNAGKIAGITIAIVILI  449

Query  1998  gigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEY  2177
                ++       +R+K       N    G  +R +  L++    S+ R+ S +  I DE 
Sbjct  450   LGVIIFILWKKKRRQKG------NTNHSGNSDRGQITLLSEMMFSNSRDTSDQRNI-DEL  502

Query  2178  ELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKN  2357
             ELP+F+F+ I+ AT++F+ ANKLG+GGFG+VY+G LV G+EIAVKRLS +S QG  EFKN
Sbjct  503   ELPLFEFHVISDATNSFSLANKLGEGGFGTVYRGRLVDGQEIAVKRLSTSSGQGNVEFKN  562

Query  2358  ELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNII  2537
             E+R IA+LQHRNLV+L GCC++ +EKMLIYEYMEN SLDSILFDK +SS+LDW  R+NII
Sbjct  563   EVRSIAKLQHRNLVRLFGCCIEKEEKMLIYEYMENNSLDSILFDKAKSSMLDWPMRFNII  622

Query  2538  CGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRI  2717
             CG+A+GLLYLH DSRFRIIHRDLKASNVLLD+EMNPKISDFG+AR+F  D+T + T  R+
Sbjct  623   CGIAKGLLYLHHDSRFRIIHRDLKASNVLLDREMNPKISDFGIARIFDNDQTHSNTM-RV  681

Query  2718  VGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWG  2897
             VGTYGYM+PEYAM G FS KSD FSFGVLVLE++SG KN+GF+  S++ NLLG  WRLW 
Sbjct  682   VGTYGYMAPEYAMGGYFSAKSDVFSFGVLVLEIISGMKNRGFHF-SDDLNLLGHVWRLWN  740

Query  2898  EGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLP  3077
             EG+  ELLDS  A +S SE   +V+RCI VGL+CVQEK EDRP M +V++ML  +  SLP
Sbjct  741   EGKALELLDSSFA-DSISE--SEVIRCINVGLICVQEKVEDRPIMPSVVMMLNSETASLP  797

Query  3078  QPKQPGFCLASKPVKMDSSSTSYND-QSLNQLTVTMLDAR  3194
             QPK PGF L     + DSSS    D  ++NQ+TVT+++ R
Sbjct  798   QPKHPGFVLGRNQGETDSSSARQEDSNTINQVTVTIVNGR  837


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 30/45 (67%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRL GCCIE  EKMLI       SLD+ +FD  K + L+W
Sbjct  571  QHRNLVRLFGCCIEKEEKMLIYEYMENNSLDSILFDKAKSSMLDW  615



>gb|ADQ37382.1| unknown [Arabidopsis lyrata]
Length=855

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/832 (52%), Positives = 581/832 (70%), Gaps = 31/832 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS G+ F+LGFF  G +S   Y+GIWYK++ DRT VWVANRD PL    G LK
Sbjct  45    ISSNRTIVSPGDDFELGFFKTGSSSL-WYLGIWYKKVPDRTYVWVANRDNPLSEPIGTLK  103

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  + N+ L+D +   +WS+ N    S+    VA+LL +GNFV+R  N++    +LWQSF
Sbjct  104   ISGN-NLVLLDHSNKLVWST-NLTRGSMRSPVVAELLANGNFVMRYYNNDRGV-FLWQSF  160

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII-  1265
             DYPTDTLLP MKLGWD KTG NR++ S +S  DPS G+ ++KL+  GLPE FL   D++ 
Sbjct  161   DYPTDTLLPQMKLGWDRKTGLNRFLRSSKSLDDPSSGNFSYKLETRGLPEFFLLMNDVLK  220

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             I+RSG W+G   SG+PE    + + ++F   + EV Y F + N +++SRLI++    L+R
Sbjct  221   IHRSGPWDGTQISGIPEERKLDYMVYNFTENRGEVVYKFLMTNHSIYSRLILSNLGYLQR  280

Query  1446  YTWIPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRD  1622
             +TW P +  W +FW++P+D QCD Y+ CG +  CD +  P+C C  GF+P N+Q W LRD
Sbjct  281   FTWFPPSWGWIQFWSSPRDFQCDLYQTCGPYSYCDMNTLPLCNCIRGFRPWNEQQWELRD  340

Query  1623  GSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             GS GC R   L C  DGF  +   K+P+++ + VD ++S  EC+  C+R+C+CTA++N +
Sbjct  341   GSSGCVRKTPLSCDGDGFWRLKNMKMPDTTMAIVDRSISGKECRTKCLRDCNCTAFANAD  400

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             I NGGSGCV+WT EL DIR + A GGQ LYVR+AA+D              GK       
Sbjct  401   IQNGGSGCVVWTGELVDIRNF-AGGGQDLYVRMAAAD-------------LGKESNRSRI  446

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETM  2162
                V+    V+  L  +     +R  T    +    ER++  LMN   ISS+R H  E  
Sbjct  447   IIGVIIGISVVLLLGFIMLSFWKRKQTPARTIATPTERNQGLLMNGVVISSRR-HLSEEN  505

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
             IT++ ELP+ +F+A+ +AT+NF+  NKLGQGGFG VYKG L+ G+EIAVKRLS+ S QG 
Sbjct  506   ITEDLELPLMEFSAVVIATENFSERNKLGQGGFGIVYKGRLLDGQEIAVKRLSELSHQGT  565

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
              EFKNE++LIARLQH NLV++LGCCVD  EKMLIYEY+EN SLD  LFDK RSS L+W++
Sbjct  566   NEFKNEVKLIARLQHINLVQILGCCVDGKEKMLIYEYLENSSLDIYLFDKTRSSKLNWEK  625

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R+NI  G+ARGLLYLHQDSR RIIHRDLKASN+LLDK+M PKISDFGMAR+F  DETEA 
Sbjct  626   RFNITNGIARGLLYLHQDSRCRIIHRDLKASNILLDKDMVPKISDFGMARIFAKDETEA-  684

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
              T+RIVGTYGYMSPEYAMDG+FS+KSD FSFGVLVLE+++G++N+GFY  S+E NLLG A
Sbjct  685   ITRRIVGTYGYMSPEYAMDGMFSIKSDVFSFGVLVLEIITGKRNRGFYN-SHENNLLGYA  743

Query  2883  WRLWGEGRGSELLDSVI----ASESHSEFVDQ-VMRCIQVGLLCVQEKAEDRPNMAAVML  3047
             W+ W EG+G E++D +I    +S S S F  Q V+RCIQ+GL+CVQE AEDRP M++V+L
Sbjct  744   WKNWKEGKGLEIIDPIILDSSSSSSLSTFRPQDVLRCIQIGLVCVQEFAEDRPPMSSVVL  803

Query  3048  MLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             ML  +  ++PQPK PG+C+   P+  DSSS+   D    ++N++T++++DAR
Sbjct  804   MLSSETAAIPQPKIPGYCVGRSPLDTDSSSSKQRDDESWTVNEITLSVIDAR  855


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QH NLV++LGCC++G EKMLI       SLD ++FD T+ ++LNW K
Sbjct  579  QHINLVQILGCCVDGKEKMLIYEYLENSSLDIYLFDKTRSSKLNWEK  625



>ref|XP_009397154.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=823

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/826 (50%), Positives = 557/826 (67%), Gaps = 46/826 (6%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             QTL+S G  FQLGFF     S   YVGIWY ++  RT+VWVANR +P+  ++G L I  +
Sbjct  36    QTLISTGGTFQLGFF----GSDKRYVGIWYSKVSVRTVVWVANRRQPITGTSGSLSIKTN  91

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRE--NDENPENYLWQSFDY  1094
             G + + D     +W SS+        N VAQLLD+GNFVVR    N  +P ++ WQSFD+
Sbjct  92    GTLVITDENATVVWYSSS----RALANPVAQLLDNGNFVVRESGSNSNDPNSFAWQSFDF  147

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PTDTLLPGMKLGW+  +G NR +++W S +DP+  + T  +D+ G PE FL ++    +R
Sbjct  148   PTDTLLPGMKLGWNLTSGLNRNLTAWTSDSDPAPSEYTMAVDVRGYPEIFLWSRSTRTWR  207

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             +G WNG+ FSG+PEM+  + ++F F+  ++EV+YSF +H+    +RLIVN + + +R  W
Sbjct  208   TGPWNGLRFSGIPEMKTYDKLSFDFVVNRDEVFYSFYVHDAAFITRLIVNQSGITQRLVW  267

Query  1455  IPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGG  1634
             I +++IWN FW APKDQCD   +CG  G+CD + SP+CGC  GF+P+N   W+LRD S G
Sbjct  268   IEQSKIWNAFWFAPKDQCDKVSQCGPNGVCDPNESPICGCLNGFRPKNPSNWALRDASDG  327

Query  1635  CFRYDELDCP--TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYS--NYN  1802
             C R  ELDC   TDGF+ ++  KLP++S+S  + ++SL++C+ MC+ NCSCTAY+  N +
Sbjct  328   CRRKTELDCRNGTDGFVMVSGVKLPDTSSSVANMSLSLEQCRTMCLTNCSCTAYAAANIS  387

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASD--AEQTGEVARGGNGFGKTKKVI  1976
             +S  GSGC++WT EL D+R YT  GGQ LY+R+AA+D  +E      R          V+
Sbjct  388   VSGTGSGCIMWTTELTDLRVYT-NGGQDLYLRLAAADLGSESNPSHQRRIVVIIVVLAVM  446

Query  1977  LACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGE  2156
             +         +                          R++ R   M+   IS    +  E
Sbjct  447   ITLLASTAFCIRR------------------------RKKRRSTGMSGN-ISFSERYINE  481

Query  2157  TMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQ  2336
                  + +LP+FD   I  AT+NF+  +KLG+GGFG VYKG L   +EIAVKRLSK S Q
Sbjct  482   GGEGKDIDLPLFDLGTIIDATNNFSVHSKLGEGGFGPVYKGNLGEEQEIAVKRLSKTSVQ  541

Query  2337  GAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
             G +EFKNE+ LIA+LQHRNLV+LLGCC+  +E+MLIYEYM N+SLD+ILFDK +  LLDW
Sbjct  542   GLDEFKNEVMLIAKLQHRNLVRLLGCCIQDEERMLIYEYMPNRSLDAILFDKAKVGLLDW  601

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
             + RYNII G+ARGLLYLHQDSRFRIIHRD+KA N+LLDK+M PKISDFGMAR+FGGDETE
Sbjct  602   RTRYNIIVGIARGLLYLHQDSRFRIIHRDMKAGNILLDKDMCPKISDFGMARIFGGDETE  661

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             A  T+R+VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE+VSG++N+G Y  + + NLLG
Sbjct  662   A-NTRRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSGKRNRGVYHSAPQLNLLG  720

Query  2877  LAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              AW LW EGR SEL+D    S   S  + + +RCI+VGLLCVQ++ E RP MA+ +LML 
Sbjct  721   YAWSLWKEGRTSELVDE---SMGDSFPMAEALRCIKVGLLCVQDRPEHRPTMASAVLMLG  777

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
               G  LPQP QPGF     P++ DSS++  +  S+N +++TM++ R
Sbjct  778   SDGALLPQPTQPGFVATKGPLESDSSASKQDSVSVNDISITMVEGR  823



>gb|AID21613.1| SRKp [Arabidopsis halleri]
Length=857

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/828 (52%), Positives = 571/828 (69%), Gaps = 29/828 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS G+ F+LGFF PG +S   Y+GIWYK++ DRT VWVANRD PL NSTG LK
Sbjct  53    ISSNRTIVSPGDDFELGFFKPGSSSL-WYLGIWYKKVPDRTYVWVANRDNPLSNSTGTLK  111

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVR-RENDENPENYLWQS  1085
             I  + N+ L   +   +WS++ T     P   +A+LL +GNFV+R  +ND+    +LWQS
Sbjct  112   ISGN-NLVLFGRSDKPVWSTNLTRGNVRPP-VMAELLANGNFVIRYSKNDQG--GFLWQS  167

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FD+PTDTLLP MKLGWD K G NR++ SW+S  DPS GD ++KL+  G PE +L   DI 
Sbjct  168   FDFPTDTLLPQMKLGWDLKRGLNRFLRSWKSLDDPSSGDFSYKLETRGFPEFYLWKNDIP  227

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             I+RSG W+G   SGVPE +    + ++F   + EV Y+F + N +++SRL ++++   +R
Sbjct  228   IHRSGPWDGTRISGVPEEQQLNYMVYNFTENREEVAYTFLMTNSSIYSRLTLSHSGFFQR  287

Query  1446  YTWIPENRIWNRFWNAPKDQ-CDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRD  1622
              T IP    W+  W++P D+ CD Y+ CG +  CDT  SP+C C  G  P + Q W L+D
Sbjct  288   LTSIPPAWGWSVLWSSPMDRPCDYYQFCGPYSYCDTSTSPMCNCIRGLNPWSMQQWDLKD  347

Query  1623  GSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             GS GC R   L C  DGF+ +   KLP+++ + VD  + + ECKE C+RNC+CTAY+  +
Sbjct  348   GSSGCVRRTPLSCSGDGFVPLKKMKLPDTTMTIVDRRIGVKECKEKCLRNCNCTAYAKAD  407

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             I+NGG GCVIWT EL DIR Y   GGQ LYVR+AA+D  +   + R      K   +IL 
Sbjct  408   ITNGGVGCVIWTGELVDIRNYVV-GGQDLYVRMAAADLGEESNLTR------KMIGLILG  460

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETM  2162
               IV+ +  + F     ++++ +   T  +  R    R++D LMN+  I S+R H  E  
Sbjct  461   VSIVVLLCFIAFCFWKRRQKRAKAITTPLVYQR----RNQDLLMNSVVIPSRR-HLSEES  515

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
               ++ ELP+ DF A+ MAT NF  +NKLG+GGFG VYKG L+ G+EIAVKRLS+ S QG 
Sbjct  516   TEEDLELPLMDFKAVVMATSNFCESNKLGEGGFGIVYKGRLLDGQEIAVKRLSEMSHQGT  575

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
              EFKNE+ LIARLQH NLV++LGCC D  EKMLIYEY+EN SLD+ LFDK +SS L+W++
Sbjct  576   REFKNEVNLIARLQHINLVRILGCCFDAKEKMLIYEYLENLSLDTYLFDKTQSSKLNWQK  635

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R+ II G+ARGLLYLHQDSR  IIHRDLKASNVLLDK+M PKISDFGMAR+F  DE EA 
Sbjct  636   RFEIINGIARGLLYLHQDSRCMIIHRDLKASNVLLDKDMIPKISDFGMARIFARDEEEA-  694

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
             TT+RIVGTYGYMSPEYAMDG++SVKSD FSFGVLVLE+VSG++N+GFY  + E NLLG  
Sbjct  695   TTRRIVGTYGYMSPEYAMDGIYSVKSDVFSFGVLVLEIVSGQRNRGFYISNEENNLLGYV  754

Query  2883  WRLWGEGRGSELLDSVIASESHSEFV----DQVMRCIQVGLLCVQEKAEDRPNMAAVMLM  3050
             WR W EG+G E++D  + + S S       + V+RCIQ+GLLCVQE AEDRP M++V+LM
Sbjct  755   WRNWKEGKGPEIIDPTVVNSSSSSPSTFRPEDVLRCIQIGLLCVQEHAEDRPLMSSVVLM  814

Query  3051  LIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             L  + +++PQPKQPG+C+   P++ D  S     +++NQ T ++++ R
Sbjct  815   LGSETSTIPQPKQPGYCVGRSPLEHDDES-----RTVNQYTASVIEGR  857


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVR+LGCC +  EKMLI       SLDT++FD T+ ++LNW K
Sbjct  589  QHINLVRILGCCFDAKEKMLIYEYLENLSLDTYLFDKTQSSKLNWQK  635



>gb|AES63661.2| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=846

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/826 (52%), Positives = 574/826 (69%), Gaps = 24/826 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             NQTL+S  +VF+ GFF+    +   Y+GIWYK++ D+  VWVANRD PL NS G LKI +
Sbjct  38    NQTLISPQKVFEFGFFNT--TTSKWYLGIWYKDVPDKIFVWVANRDTPLENSNGTLKIQD  95

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNT--VAQLLDSGNFVVRRENDENPENYLWQSFD  1091
              G + L + T N IWSS    NQ++   T  V  LLD GN V++   ++N  NY+WQSFD
Sbjct  96    GGKLVLFNQTDNPIWSS----NQTISSVTDPVLHLLDDGNLVLKEAQEKNNSNYIWQSFD  151

Query  1092  YPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIY  1271
             +PTDTLLPGMKLGW+  TG    I+SW+S  DPS GD  F LD +G+P+ +L NK   ++
Sbjct  152   HPTDTLLPGMKLGWNLDTGVEIRITSWKSQDDPSTGDSHFSLDYHGVPDIYLWNKQQRVF  211

Query  1272  RSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYT  1451
             RSG WNG +F GVP +     +    +  ++E YY      ++  SRL+VN T  +ERY 
Sbjct  212   RSGSWNGQSFGGVPILSTIAALNDKIVVDEHEAYYYPAGLLQSNLSRLVVNSTSSMERYA  271

Query  1452  WIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
             WI   + WN+ W+AP  QCDNY  CG FGICD++  PVC C  GF  +NQ+ W LR+ S 
Sbjct  272   WIESTKDWNKVWSAPALQCDNYGTCGPFGICDSNAFPVCKCVTGFDIKNQRQWDLRNFSD  331

Query  1632  GCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             GC R  EL+C  D FL +   +LPE+ + FV+ +M+L EC+  C+++CSCTAY+N  I+N
Sbjct  332   GCVRKTELECDKDKFLHLKNVQLPETRSVFVNKSMTLLECENKCLKDCSCTAYANEEITN  391

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQ---TGEVARGGNGFGKTKKVILA  1982
             GG+GCV+W   L D+RQ+T E GQ +++R+AASD      + E   G +G  K    ++A
Sbjct  392   GGTGCVMWNYSLVDMRQFT-EAGQDIFIRLAASDVGNFFFSDEADTGSSGGSKKNAGMIA  450

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENI--EMRGTRERSRDPLMNATAISSKREHSGE  2156
                +  + ++L  +L + R+K R    + +    RG  +R +   ++ +  S+ RE+S E
Sbjct  451   GITITIVILILGVILFILRKKRRWQRIQKVNNSQRGNSDRGQKTRLSDSKFSNSREYSDE  510

Query  2157  TMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQ  2336
               + D+ +LP+F+F+ I+ AT++F+ ANKLG+GGFG+VY+G LV G++IAVKRLS +S Q
Sbjct  511   RNM-DDLDLPLFEFHVISDATNSFSLANKLGEGGFGAVYRGRLVDGQDIAVKRLSTSSGQ  569

Query  2337  GAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
             G  EFKNE+R IA+LQHRNLV+L GCC++ +EKMLIYEY EN SLDSILFDK +S  LDW
Sbjct  570   GNVEFKNEVRSIAKLQHRNLVRLFGCCIEKEEKMLIYEYCENNSLDSILFDKAKSCKLDW  629

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
               R++IICG+A+GLLYLH DSRFRIIHRDLKASNVLLDKEMNPKISDFG+AR+F  D+T 
Sbjct  630   PMRFSIICGIAKGLLYLHHDSRFRIIHRDLKASNVLLDKEMNPKISDFGIARIFDNDQTH  689

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             + +T RIVGTYGYMSPEYAM G FS KSD FSFGVLVLE++SG KN+GF+  S++ NLLG
Sbjct  690   S-STMRIVGTYGYMSPEYAMGGYFSAKSDVFSFGVLVLEIISGMKNRGFHQ-SDDLNLLG  747

Query  2877  LAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              AWRLW EG+  EL+DS  A +S+SE   +V+RCI VGL+CVQEK EDRP M +V++ML 
Sbjct  748   HAWRLWNEGKAMELIDSSYA-DSYSE--AEVIRCINVGLICVQEKIEDRPIMPSVVMMLN  804

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
              + +SLPQPK PGF L     + DSSS      ++N++TVT+++ R
Sbjct  805   SETSSLPQPKHPGFVLGRNLGESDSSSAV----TINEVTVTIINGR  846


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 30/45 (67%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRL GCCIE  EKMLI       SLD+ +FD  K  +L+W
Sbjct  585  QHRNLVRLFGCCIEKEEKMLIYEYCENNSLDSILFDKAKSCKLDW  629



>gb|AGC55017.1| S-receptor kinase, partial [Arabidopsis lyrata]
Length=832

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/808 (51%), Positives = 563/808 (70%), Gaps = 24/808 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS G  F+LGFF     S   Y+GIWYK++  RT  WVANRD PL N  G LK
Sbjct  35    ISSNRTIVSPGNDFELGFFKFDSRSL-WYLGIWYKKVPQRTYPWVANRDNPLSNPIGTLK  93

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  + N+ L+D +   +WS+ N   ++V    VA+LL +GNFV+R  N++    +LWQSF
Sbjct  94    ISGN-NLVLLDHSNKPVWST-NLTIRNVRSPVVAELLANGNFVMRYSNNDQ-GGFLWQSF  150

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             DYPTDTLLP MKLGWD KTG NR + SWRS  DPS  + +++L   G PE FL ++D+ +
Sbjct  151   DYPTDTLLPQMKLGWDRKTGLNRILRSWRSLDDPSSSNYSYELQTRGFPEFFLLDEDVPV  210

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             +RSG W+G+ FSG+PE+     I  +F   ++E+ Y+F++ N +++SRL V+++  L+R+
Sbjct  211   HRSGPWDGIQFSGIPEVRQLNYIINNFKENRDEISYTFQMTNHSIYSRLTVSFSGSLKRF  270

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
              +IP +  WN+FW+ P D CD Y  CG +G CD + SP+C C  GF+PRN Q W LRDGS
Sbjct  271   MYIPPSYGWNQFWSIPTDDCDMYLGCGPYGYCDVNTSPICNCIRGFEPRNLQEWILRDGS  330

Query  1629  GGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
              GC R  +L C  DGF+ +   KLP++++  VD  +   ECK+ C+ +C+CTA++N +I 
Sbjct  331   DGCVRKTQLSCGGDGFVELKKIKLPDTTSVTVDRRIGTKECKKRCLNDCNCTAFANADIR  390

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             N GSGCVIWT EL DIR Y A GGQ LYVR+AA+D ++  +V+    G      ++L   
Sbjct  391   NDGSGCVIWTGELVDIRNY-ATGGQTLYVRIAAADMDKGVKVSGKIIGLIAGVGIMLLLS  449

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
               +             R  +             +ER++D +MN  A+ S R H     +T
Sbjct  450   FTMLCIWKKKQKRARGREIVY------------QERTQDLIMNEVAMISGRRHFAGDNMT  497

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             ++ E P+ +F A+ MAT+NF++ NKLG+GGFG VYKG+L  G EIAVKRLSK S QG EE
Sbjct  498   EDLEFPLMEFTAVVMATENFSDCNKLGKGGFGIVYKGILPDGREIAVKRLSKMSLQGNEE  557

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             FKNE+RLIA+LQH NLV+LLGCC+D DEK+LIYEY+EN  LDS LFD  +S  L+W++R+
Sbjct  558   FKNEVRLIAKLQHINLVRLLGCCIDADEKILIYEYLENLGLDSYLFDTTQSCKLNWQKRF  617

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             +I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK++ PKISDFGMAR+FG DETEA  T
Sbjct  618   DIANGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDLTPKISDFGMARIFGRDETEA-NT  676

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             +++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++ G++N+GFY  +++ NLLG  WR
Sbjct  677   RKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIICGKRNRGFYNVNHDLNLLGCVWR  736

Query  2889  LWGEGRGSELLDSVIASESHSEFV----DQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              W EG+G E++D V+   S S        +++RCIQ+GLLCVQE+A+DRP M++V+LML 
Sbjct  737   NWKEGKGLEIVDPVVIDSSSSSSSTFRPHEILRCIQIGLLCVQERAQDRPMMSSVVLMLG  796

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSST  3140
              + T++PQPK PGFC+++   + DSSS+
Sbjct  797   SETTTIPQPKPPGFCVST--FQTDSSSS  822


 Score = 54.3 bits (129),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIKS------LDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCCI+  EK+LI        LD+++FD T+  +LNW K
Sbjct  569  QHINLVRLLGCCIDADEKILIYEYLENLGLDSYLFDTTQSCKLNWQK  615



>dbj|BAA92836.1| S18 S-locus receptor kinase [Brassica oleracea]
Length=856

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/832 (51%), Positives = 565/832 (68%), Gaps = 29/832 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+TLVS G VF+LGFF    +S   Y+GIWYK++ DRT VW+ANRD PL N+ G LK
Sbjct  44    ISSNRTLVSPGNVFELGFFKTTSSSR-WYLGIWYKKLPDRTYVWIANRDNPLPNTIGTLK  102

Query  909   IGEDGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
             I  + N+ ++  +  S+WS++ T  N+  P   VA+LL +GNFV+R  N+ +   +LWQS
Sbjct  103   ISGN-NLVILGHSNKSVWSTNVTRGNERSP--VVAELLANGNFVMRDSNNTDANEFLWQS  159

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FD+PT+TLLP MKLG+D KTG NR+++SWR   DPS GD  +KL+    PE ++ N D  
Sbjct  160   FDFPTNTLLPEMKLGYDLKTGLNRFLTSWRGSDDPSSGDHLYKLEPRSFPEFYIFNDDFP  219

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             ++R G WNG+ FSG+PE +    + ++F     EV YSF + N +++SRLI++    L+R
Sbjct  220   VHRIGPWNGIEFSGIPEDQKSSYMVYNFTENSEEVAYSFRMTNNSIYSRLIISSEGYLQR  279

Query  1446  YTWIPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRD  1622
               W P  +IW  FW++P   QCD YR CG +  CD + SPVC C  GF P+NQQ W LR 
Sbjct  280   LIWTPSTKIWQEFWSSPVSLQCDPYRICGPYAYCDENTSPVCNCIQGFDPKNQQQWDLRS  339

Query  1623  GSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
              + GC R   L C  DGF  M   KLP+++ + VD ++ + EC++ C+ NC+CTA++N +
Sbjct  340   HASGCIRRTWLSCRGDGFTRMKNMKLPDTTAAIVDRSVGVKECEKKCLSNCNCTAFANAD  399

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             I NGG+GCVIWT EL DIR Y A+G Q LYVR+AA+D      + +  N  GK   +I+ 
Sbjct  400   IRNGGTGCVIWTGELEDIRNYVADG-QDLYVRLAAAD------LVKKRNSNGKIIGLIVG  452

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETM  2162
               ++L + +        KR K       N      R+R+++  MN   +SSKR+ SGE  
Sbjct  453   VSVLLLLIISCLWKRRQKRAKASATSIAN------RQRNQNMPMNGMVLSSKRQLSGENK  506

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
             I D  ELP+ +  A+  AT+NF++ NK+G+GGFG VYKG L+ G+EIAVKRLSK S QG 
Sbjct  507   IED-LELPLIELEAVVKATENFSSCNKIGEGGFGIVYKGRLLDGQEIAVKRLSKTSFQGT  565

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
             +EF NE+ LIARLQH NLV++LGCC++ DEKMLIYEY+EN SLDS LF K RSS L WK 
Sbjct  566   DEFMNEVTLIARLQHINLVQVLGCCIEGDEKMLIYEYLENLSLDSYLFGKTRSSKLSWKE  625

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R++I  GVARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  DETEA 
Sbjct  626   RFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEAN  685

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
             T K +VGTYGYMSPEYAM+G+FS KSD FSFGV+VLE+V+G++N+GFY  + + N L  A
Sbjct  686   TMK-VVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTGKRNRGFYNLNYKNNFLSYA  744

Query  2883  WRLWGEGRGSELLDSVIA---SESHSEFVDQ-VMRCIQVGLLCVQEKAEDRPNMAAVMLM  3050
             W  W EGR  E++D VI    S   S F  Q V++CIQ+GLLCVQE AE RP M+ V+ M
Sbjct  745   WSNWKEGRALEIVDPVIVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSTVVWM  804

Query  3051  LIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ----SLNQLTVTMLDAR  3194
             L  + T +PQPK PG+C+ S P ++D S++   D     ++NQ T +++DAR
Sbjct  805   LGSEATEIPQPKPPGYCVGSSPYELDPSASRQLDDDESWTVNQYTCSVIDAR  856



>gb|AFP33769.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
Length=834

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/826 (51%), Positives = 569/826 (69%), Gaps = 40/826 (5%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS   VF+LGFF    NS   Y+GIWYK++ ++T +WVANRD P  NS G LK
Sbjct  45    ISSNRTIVSPSGVFELGFFETAPNSR-WYLGIWYKKVPEKTYIWVANRDHPFSNSIGILK  103

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENP-ENYLWQS  1085
             I E  N+ L+D +   +WS++ T     P   VA+LLD+GNFV+R  +++N  + YLWQS
Sbjct  104   ISE-ANLVLLDHSDTLVWSTNRTGGTRSP--VVAELLDNGNFVLRESSNKNDLDRYLWQS  160

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FD+PTDTLLP MKLGWD K G NRY++SW+SP DPS G  ++KL++ GLPE FL  KD  
Sbjct  161   FDFPTDTLLPEMKLGWDLKRGLNRYLTSWKSPNDPSSGYYSYKLELQGLPEFFLSYKDSP  220

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             ++RSG W+GV FSG+PE +    + ++F   + EV Y+F + N ++ SRL V+ +  L R
Sbjct  221   MHRSGPWDGVRFSGMPEKQQLTYMVYNFTENEEEVAYTFSMTNHSILSRLTVSSSGTLNR  280

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             +TWIP +  WN  W +PKD CD Y  CG +  CD + SP C C  GF P+NQQ W L +G
Sbjct  281   FTWIPPSWQWNTVWFSPKDDCDLYERCGPYSYCDVNTSPSCNCIQGFDPKNQQQWDLSNG  340

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
               GC R                 KLP +  + VD  +   ECKE C+ +C+CTAY+N + 
Sbjct  341   VSGCVRK---------------MKLPVTMDAIVDRKIGKKECKERCLGDCNCTAYANID-  384

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
                GSGC+IWT E FDIR Y  EG Q LYVR+AASD    G  +R      K   +++  
Sbjct  385   ---GSGCLIWTGEFFDIRNYGHEG-QDLYVRLAASDLGDEGNKSR------KIIGLVVGI  434

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              I+  +  ++      K+++ +      +     ++R++D LMN   ISS R  SGE   
Sbjct  435   SIMFLLSFIIICCWKRKQKRAKAIAAPTV----YQDRNQDLLMNEVVISSMRNFSGENK-  489

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T++ ELP+ +F A+ +ATDNF+++NKLGQGGFG VYKG L+ G+EIAVKRLS+ S QG  
Sbjct  490   TEDSELPLMEFKAVLIATDNFSDSNKLGQGGFGIVYKGRLLDGQEIAVKRLSETSTQGTS  549

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE+RLIARLQH NLV+LLGCCVD+DEKMLIYEY+EN SLD  LFDK +S+ L+WK R
Sbjct  550   EFKNEMRLIARLQHINLVRLLGCCVDVDEKMLIYEYLENLSLDFYLFDKTQSAKLNWKMR  609

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++I  G+ARGLLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMAR+F  DETEA  
Sbjct  610   FDITNGIARGLLYLHQDSRFRIIHRDLKASNILLDKDMIPKISDFGMARIFARDETEAN-  668

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  + + NLLG  W
Sbjct  669   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGCVW  728

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
             R W EG+G E++D +I   S +    +++RCIQ+GLLCVQE A DRP M++V+LML  + 
Sbjct  729   RNWKEGKGLEIVDPIIIDSSTTFRPKEILRCIQIGLLCVQEHAHDRPTMSSVVLMLGSET  788

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              ++PQP  PG+C+    ++ DSSS+   D    ++NQ+T++++DAR
Sbjct  789   IAIPQPNTPGYCVGRSSLETDSSSSGQQDDESCTVNQITLSVMDAR  834


 Score = 55.1 bits (131),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLLGCC++  EKMLI       SLD ++FD T+ A+LNW
Sbjct  562  QHINLVRLLGCCVDVDEKMLIYEYLENLSLDFYLFDKTQSAKLNW  606



>emb|CDY66915.1| BnaC03g72660D [Brassica napus]
Length=841

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/825 (51%), Positives = 580/825 (70%), Gaps = 28/825 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+T+VS+GE+F+LGFF+   +S   Y+GIWYK+I  R  VWVANRD PL NS G L+I  
Sbjct  39    NETIVSSGEIFELGFFNLPSSSR-WYLGIWYKKIPARAYVWVANRDNPLSNSNGTLRI-S  96

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             D N+ + D +G  +WS++ T   +     VA+LLD+GNFV+R  N+ + + +LWQSFD+ 
Sbjct  97    DNNLVIFDQSGTPVWSTNRTGGHA-GSPLVAELLDNGNFVLRHLNNSDQDVFLWQSFDFL  155

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFLRNKDIIIYR  1274
             TDTLLP MKLGWD KTG NR++ SWR+P DPS GD + KL+   G PE +  NKD IIYR
Sbjct  156   TDTLLPEMKLGWDRKTGLNRHLRSWRNPDDPSSGDFSTKLETTRGFPEFYAWNKDEIIYR  215

Query  1275  SGGWNGVAF-SGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYT  1451
             SG W+G  F S V +M+P + + F+F      V YS+ I   +++SR+I++   LL+R+T
Sbjct  216   SGPWSGNRFGSDVLDMKPIDYLGFNFTADNEHVTYSYRITKPDVYSRVILSSAGLLQRFT  275

Query  1452  WIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
             W    + W + W  P+D CD+YRECG +G CD + SPVC C  GF+ RN Q       +G
Sbjct  276   WFETEQSWRQLWYLPRDLCDDYRECGDYGYCDLNTSPVCNCVQGFETRNNQ-------TG  328

Query  1632  GCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
             GC R   L C   DGF+ +   KLP+++ + VD+ + L EC+E C+++C+CTA++N +I 
Sbjct  329   GCARKTRLSCGGKDGFVRLKKMKLPDTTVTVVDSGVGLKECEERCLKDCNCTAFANMDIR  388

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             NGGSGCVIW  ++FDIR +   GGQ LYVR+AA+D              GK  K+I    
Sbjct  389   NGGSGCVIWKGDIFDIRNF-PNGGQDLYVRLAAADLVDKR---------GKRGKIIALSI  438

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
              V    ++ F +    ++K +R +     +   + R  D LMN  AI+S+R  S E    
Sbjct  439   GVTIFLLLCFIIFRFWKKKQKRSIAIQTPIVD-QGRIEDSLMNELAITSRRYISRENKTD  497

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             D+ EL + +F  +A+AT+NF+NANKLG+GGFG+VYKG L+ G+EIAVKRLSK S QG +E
Sbjct  498   DDLELSLMEFEVVALATNNFSNANKLGRGGFGTVYKGRLLDGKEIAVKRLSKMSLQGTDE  557

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             FKNE++LIARLQH NLV+L+GCC+D  EKMLIYEY+EN SLDS +F+  R S L+W+ R+
Sbjct  558   FKNEVKLIARLQHINLVRLIGCCIDKGEKMLIYEYLENLSLDSHIFEITRRSNLNWQMRF  617

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             +I  G+ARGL+YLH+DSRF IIHRDLKASNVLLDK M PKISDFGMAR+FG D+ EA  T
Sbjct  618   DITNGIARGLVYLHRDSRFMIIHRDLKASNVLLDKNMTPKISDFGMARIFGRDDAEA-NT  676

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             +++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG+KN GFY  +++ NLL   WR
Sbjct  677   RKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKKNNGFYNSNHDLNLLAFVWR  736

Query  2889  LWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
              W EG+  E+LD +I   S S     +++RCIQ+GLLCVQE+AEDRP MA+VM+M+  + 
Sbjct  737   KWKEGKWLEILDPIIIDSSSSTCQAHEILRCIQIGLLCVQERAEDRPVMASVMVMIGSET  796

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSY-NDQ-SLNQLTVTMLDAR  3194
              ++P+PK+PGFC+   P+++DSSS++  ND+ ++NQ+T++++DAR
Sbjct  797   MAIPEPKRPGFCVGRNPLEIDSSSSTQGNDECTVNQVTLSVIDAR  841


 Score = 55.5 bits (132),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRL+GCCI+ GEKMLI       SLD+ +F+ T+R+ LNW
Sbjct  569  QHINLVRLIGCCIDKGEKMLIYEYLENLSLDSHIFEITRRSNLNW  613



>emb|CDX95304.1| BnaC04g28540D [Brassica napus]
Length=815

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/828 (51%), Positives = 563/828 (68%), Gaps = 61/828 (7%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T++S  E+F+LGFF+P  +S   Y+GIWYK++  RT VWVANRD PL +S G L 
Sbjct  43    ISSNKTILSRSEIFELGFFNPPSSSR-WYLGIWYKKVSTRTYVWVANRDNPLLSSNGTLN  101

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDEN-PENYLWQS  1085
             I  D N+ + D +   +WS++ T  + V    VA+LLD+GNFV+R  N+ N P+ YLWQS
Sbjct  102   IS-DSNLVIFDQSDTPVWSTNLTEGE-VRSPVVAELLDNGNFVLRHLNNNNDPDGYLWQS  159

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FD+PTDTLLP M+LGWD KTGR+R++ SW++P DPS GD   KL   G PE ++ +KD I
Sbjct  160   FDFPTDTLLPEMRLGWDHKTGRDRFLRSWKTPDDPSSGDFFTKLKTKGFPEFYVCSKDSI  219

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             IYRSG WNG+ FS  PE +P + I ++F  T  E                          
Sbjct  220   IYRSGPWNGIRFSSSPETKPLDYIVYNFTATNEES-------------------------  254

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
                      W + W +PKD CDNY+ECGS+G CD++ SP+C C  GF P NQQ W+LRD 
Sbjct  255   ---------WKQLWYSPKDLCDNYKECGSYGYCDSNTSPICNCIKGFGPGNQQPWTLRDD  305

Query  1626  SGGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             S GC R   L C   DGF+ +   KLP+++ + VD  + L EC+E C+++C+CTA++N +
Sbjct  306   SAGCVRKTRLSCDGRDGFVRLKKMKLPDTTATTVDRGIGLKECEERCLKDCNCTAFANTD  365

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARG---GNGFGKTKKV  1973
             I NGGSGCVIWT E+FDI+ + A+GGQ L+VR+AA+D E      R    G   G +  +
Sbjct  366   IRNGGSGCVIWTGEIFDIKNF-AKGGQDLFVRLAAADLEDKRTKKRNIILGLSIGVSILL  424

Query  1974  ILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSG  2153
             +L+  I                        +++ +      S+D LMN   ISSKR  SG
Sbjct  425   LLSFIIFRFWKRKQK---------------QSVAIPKPIVTSQDSLMNEVVISSKRHLSG  469

Query  2154  ETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSR  2333
             + M T++ ELP+ DF AIA AT NF++ NKLGQGGFG VYKG L+ G+EIAVKRLSK S 
Sbjct  470   D-MKTEDLELPLMDFEAIATATHNFSSTNKLGQGGFGIVYKGRLLDGKEIAVKRLSKMSL  528

Query  2334  QGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLD  2513
             QG +EFKNE+RLIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDK R S L+
Sbjct  529   QGTDEFKNEVRLIARLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKSRRSNLN  588

Query  2514  WKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDET  2693
             W+ R++I  G+ARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  DET
Sbjct  589   WQLRFDIANGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFRRDET  648

Query  2694  EAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLL  2873
             EA  T+++VGTYGYMSPEYAM+G+FSVKSD FSFGVL+LE++SG+++ GFY  S + +LL
Sbjct  649   EAN-TRKVVGTYGYMSPEYAMNGIFSVKSDVFSFGVLLLEIISGKRSTGFYNSSGDLSLL  707

Query  2874  GLAWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLM  3050
             G  WR W E +G +++D +I     S F   +++RCI +GLLCVQE+AEDRP M++VM+M
Sbjct  708   GCVWRNWKERKGLDIIDPIIIDSLSSTFKTHEILRCIHIGLLCVQERAEDRPAMSSVMVM  767

Query  3051  LIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             L  + T+LP+PKQP FC+   P++ + S    ++ ++NQ+T++++DAR
Sbjct  768   LGSETTTLPEPKQPAFCVGRGPLEAELSKLGDDEWTVNQITLSVIDAR  815


 Score = 57.4 bits (137),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD ++R+ LNW
Sbjct  545  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKSRRSNLNW  589



>gb|KEH36480.1| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=758

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/722 (59%), Positives = 524/722 (73%), Gaps = 19/722 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNST-GFL  905
             L  NQTL S  + F LGF  PG NS  +Y+ IWYK I D T+VWVANRD PL+NST   L
Sbjct  36    LLTNQTLESPNQTFVLGFI-PGTNSNNIYLAIWYKNIED-TVVWVANRDNPLQNSTNSHL  93

Query  906   KIGEDGNIHLV----DGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENY  1073
             KIG++GNI L+    D   N IWSS+ T         V QL D+GN V+R  N  +P  Y
Sbjct  94    KIGDNGNIVLLNSSSDSDNNLIWSSNQT---KATNPLVLQLFDNGNLVLRETNVNDPTKY  150

Query  1074  LWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSP-TDPSEGDITFKLDINGLPEAFLR  1250
             LWQSFDYPTDTLLP M +GW+      ++++SW++   DPS G  +FK+D +GLPE FLR
Sbjct  151   LWQSFDYPTDTLLPSMNIGWNFDKNTEKHLTSWKNTGEDPSTGHYSFKIDYHGLPEIFLR  210

Query  1251  NKDIIIYRSGGWNGVAFSGVPEME-PKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNY  1427
             N D IIYRSG WNG  FSGVPEM+   + I F+F   ++ V YSF I N ++FSRL+V+ 
Sbjct  211   NDDNIIYRSGPWNGERFSGVPEMQHDTDSIVFNFSSNQHGVNYSFTIGNPSIFSRLVVDS  270

Query  1428  TQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQA  1607
                L+R TWI   + W  FW APKDQCD+YRECG +G+CDT+ SPVC C  GF P+N+QA
Sbjct  271   GGQLQRRTWIQSMKTWTNFWYAPKDQCDSYRECGPYGLCDTNGSPVCQCVKGFSPKNEQA  330

Query  1608  WSLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTA  1787
             W LRDGS GC R   L+C +D FL M   KLPE+S+ FV+ TM + EC +MC RNCSCT 
Sbjct  331   WKLRDGSDGCVRNKNLECESDKFLRMENVKLPETSSVFVNKTMGIKECGDMCHRNCSCTG  390

Query  1788  YSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTK  1967
             Y+N  ++NGGSGCV+W  EL DIR Y  +GGQ L+VR+AAS+ + +G  + GG+     K
Sbjct  391   YANVYVTNGGSGCVMWIGELNDIRDY-PDGGQDLFVRLAASELDNSG--STGGSHKKNHK  447

Query  1968  KVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREH  2147
               I+   I   + ++  G LL  RRKL     +  + RG+ +RSRD LMN    SSKRE 
Sbjct  448   AEIIGITISAAVIILGLGFLLCNRRKLLSNGKK--DNRGSLQRSRDLLMNEVVFSSKRET  505

Query  2148  SGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKN  2327
             SGE  + DE +LP+FDFN I +AT+NF  ANKLGQGGFGSVY+G L+ G+EIAVKRLS+ 
Sbjct  506   SGERNM-DELDLPMFDFNTIILATNNFLEANKLGQGGFGSVYRGRLIEGQEIAVKRLSQT  564

Query  2328  SRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSL  2507
             S QG EEFKNE++LIA+LQHRNLV+LLGCCVD DEK+L+YEYMEN+SLDSILFDK R  L
Sbjct  565   SEQGVEEFKNEVKLIAKLQHRNLVRLLGCCVDRDEKLLVYEYMENRSLDSILFDKARKPL  624

Query  2508  LDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGD  2687
             LDWK+R++IICG+ RGLLYLH DSR RIIHRDLKASN+LLD +MNPKISDFGMAR+FG D
Sbjct  625   LDWKKRFDIICGIVRGLLYLHHDSRLRIIHRDLKASNILLDGKMNPKISDFGMARIFGRD  684

Query  2688  ETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEEN  2867
             +TEA T  R+VGTYGYMSPEYAMDG FSVKSD FSFGVLVLE++SG+KN+GFY   ++ N
Sbjct  685   QTEANTL-RVVGTYGYMSPEYAMDGNFSVKSDVFSFGVLVLEIISGKKNRGFYYADDDMN  743

Query  2868  LL  2873
             LL
Sbjct  744   LL  745


 Score = 54.3 bits (129),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCC++  EK+L+      +SLD+ +FD  ++  L+W K
Sbjct  583  QHRNLVRLLGCCVDRDEKLLVYEYMENRSLDSILFDKARKPLLDWKK  629



>ref|NP_176755.1| receptor-like serine/threonine-protein kinase SD1-7 [Arabidopsis 
thaliana]
 sp|Q39086.1|SD17_ARATH RecName: Full=Receptor-like serine/threonine-protein kinase SD1-7; 
AltName: Full=Arabidopsis thaliana receptor kinase 1; 
AltName: Full=S-domain-1 (SD1) receptor kinase 7; Short=SD1-7; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAA32786.1| receptor kinase [Arabidopsis thaliana]
 gb|AEE34423.1| receptor kinase 1 [Arabidopsis thaliana]
 prf||1908429A receptor kinase
Length=843

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/828 (51%), Positives = 580/828 (70%), Gaps = 28/828 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T++S  ++F+LGFF+P  +S   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  38    ISSNKTIISPSQIFELGFFNPASSSR-WYLGIWYKIIPIRTYVWVANRDNPLSSSNGTLK  96

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  + N+ + D +   +WS+ N     V     A+LLD+GNF++R  N+      LWQSF
Sbjct  97    ISGN-NLVIFDQSDRPVWST-NITGGDVRSPVAAELLDNGNFLLRDSNNR----LLWQSF  150

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLL  MKLGWD KTG NR + SW++  DPS G+ + KL+ +  PE ++ +K+ I+
Sbjct  151   DFPTDTLLAEMKLGWDQKTGFNRILRSWKTTDDPSSGEFSTKLETSEFPEFYICSKESIL  210

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FS VP     + + ++F  +K EV YS+ I+  NL+SRL +N   LL+R 
Sbjct  211   YRSGPWNGMRFSSVPGTIQVDYMVYNFTASKEEVTYSYRINKTNLYSRLYLNSAGLLQRL  270

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TW    + W + W +PKD CDNY+ CG+FG CD++  P C C  GFKP N+QAW LRDGS
Sbjct  271   TWFETTQSWKQLWYSPKDLCDNYKVCGNFGYCDSNSLPNCYCIKGFKPVNEQAWDLRDGS  330

Query  1629  GGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF  +   KLP+++ + VD  + L  CKE C+ +C+CTA++N +I
Sbjct  331   AGCMRKTRLSCDGRDGFTRLKRMKLPDTTATIVDREIGLKVCKERCLEDCNCTAFANADI  390

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAE--QTGEVARGGNGFGKTKKVIL  1979
              NGGSGCVIWT E+ D+R Y A+GGQ LYVR+AA++ E  +       G+  G +  ++L
Sbjct  391   RNGGSGCVIWTREILDMRNY-AKGGQDLYVRLAAAELEDKRIKNEKIIGSSIGVSILLLL  449

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
             +  I           + ++        T N++    + RS+D L+N   +S +R ++ + 
Sbjct  450   SFVIFHFWKRKQKRSITIQ--------TPNVD----QVRSQDSLINDVVVS-RRGYTSKE  496

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
               ++  ELP+ +  A+A AT+NF+N NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG
Sbjct  497   KKSEYLELPLLELEALATATNNFSNDNKLGQGGFGIVYKGRLLDGKEIAVKRLSKMSSQG  556

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EF NE+RLIA+LQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFD+ RSS L+W+
Sbjct  557   TDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDQTRSSNLNWQ  616

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
             +R++II G+ARGLLYLHQDSR RIIHRDLKASNVLLDK M PKISDFGMAR+FG +ETEA
Sbjct  617   KRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEA  676

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               T+R+VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  + + NLLG 
Sbjct  677   N-TRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGF  735

Query  2880  AWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              WR W EG   E++D +      S+F   +++RCIQ+GLLCVQE+AEDRP M++VM+ML 
Sbjct  736   VWRHWKEGNELEIVDPINIDSLSSKFPTHEILRCIQIGLLCVQERAEDRPVMSSVMVMLG  795

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ--SLNQLTVTMLDAR  3194
              + T++PQPK+PGFC+   P++ DSSS++  D   ++NQ+T++++DAR
Sbjct  796   SETTAIPQPKRPGFCIGRSPLEADSSSSTQRDDECTVNQITLSVIDAR  843


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+ + LNW K
Sbjct  571  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDQTRSSNLNWQK  617



>gb|AIB04258.1| S-locus receptor kinase s-haplotype 1 [Arabidopsis lyrata subsp. 
petraea]
Length=851

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/829 (50%), Positives = 558/829 (67%), Gaps = 27/829 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ NQT+VS G VF+LGFF   G+S   Y+GIWYK+I  RT VW+ANRD PL NS G LK
Sbjct  43    ISSNQTIVSPGGVFELGFFKILGDS--WYLGIWYKKIPQRTYVWIANRDNPLSNSIGILK  100

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  + N+ ++D +   +WS++ T   +V    VA+LLD+GNFV+R     + + +LWQSF
Sbjct  101   IS-NANLVILDNSDTPVWSTNLTG--AVRSLVVAELLDNGNFVLRNSKTNDLDGFLWQSF  157

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLG D+K G N++I+SW+S  DPS GD  FKL+  GLPE F+      +
Sbjct  158   DFPTDTLLPQMKLGLDNKRGLNKFITSWKSSFDPSSGDYIFKLETQGLPEFFISRSKFKL  217

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             +RSG W+G  FSG+PEME  + I ++F   + EV Y+F++ N +L+SRL +N   LL+R+
Sbjct  218   FRSGPWDGNRFSGIPEMEQWDNIIYNFTDNREEVAYTFQLTNHSLYSRLKINSDGLLQRF  277

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWIP  + WN +W  P   CD Y  CG +  CD + SP+C C  GF+PR  Q W+  D +
Sbjct  278   TWIPTIQEWNMYWLTPATHCDFYENCGPYAYCDMNTSPMCNCIQGFEPRIPQEWASGDVA  337

Query  1629  GGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
             G C R   L+C  DGF+ +   KLP S+T+ VD  + L EC+E C + C+CTAY+N +  
Sbjct  338   GSCQRKTPLNCLEDGFIKLKKMKLPASTTAIVDKRIGLKECEEKCKQYCNCTAYANTDTR  397

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             NGG+GCVIW  +  D+R Y A  GQ LY+R+AA D   T  ++    G      V+L   
Sbjct  398   NGGTGCVIWIGKFDDVRYYPA-AGQDLYIRLAAGDNGGTRNISAKIIGITVGVSVMLLII  456

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
               +                +             RER +D LMN    S++    GE   T
Sbjct  457   FFMYCFWQRKLKRTGAALIVY------------RERIQDFLMNRVVNSNRGHLFGENK-T  503

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             ++ ELP+ +F A+ MAT NF+++NKLGQGGFG+VYKG L+ G+EIAVKRLSK S QG +E
Sbjct  504   EDLELPLMEFEAVVMATHNFSDSNKLGQGGFGTVYKGRLLDGQEIAVKRLSKMSHQGTDE  563

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             F NE +LIARLQH NLV+L+GC  D +EKMLIYEY+EN SLDS LF + +S+ L W++R+
Sbjct  564   FMNEAKLIARLQHINLVRLVGCYADAEEKMLIYEYLENLSLDSHLFYRNQSTKLHWQKRF  623

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             NII G+ARGLLYLHQDSRF+IIHRDLKASN+LLDK+M PKISDFGMAR+F  DETEA  T
Sbjct  624   NIINGIARGLLYLHQDSRFKIIHRDLKASNILLDKDMIPKISDFGMARIFERDETEA-NT  682

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             +++VGTYGYMSPEYAMDG+FSVKSD FSFGVL+LE+VSG++N+GFY      NLL  AW 
Sbjct  683   RKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLLLEIVSGKRNRGFYNSDQNSNLLSYAWE  742

Query  2889  LWGEGRGSELLDSVIASESHSEFV----DQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              W EG G ++ D VI   + S        +V+RCIQ+GLLCVQE+AEDRP M++V+LML 
Sbjct  743   NWKEGTGLKIADPVIVDSTSSSLSTFRPHEVLRCIQIGLLCVQERAEDRPKMSSVVLMLE  802

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              +  ++P PK PG+C+    ++ DSSS++  D    ++NQ+T ++++AR
Sbjct  803   SETETIPHPKPPGYCVGRNYLETDSSSSAQLDDESCTVNQITASVINAR  851



>ref|XP_008813304.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like serine/threonine-protein 
kinase SD1-8, partial [Phoenix dactylifera]
Length=1592

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/825 (52%), Positives = 574/825 (70%), Gaps = 31/825 (4%)
 Frame = +3

Query  726   PLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFL  905
             PL+  +TLVSAG  F+LGFFS G NS   Y+GIWYK I   T+VWVANR+ PL + TG L
Sbjct  42    PLSDGETLVSAGGNFELGFFSRG-NSKNKYLGIWYKNISTHTVVWVANREAPLTDRTGSL  100

Query  906   KIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
              I  DGN+ L + T    WS+    N S   + VAQLLD+GNFV++ E + +  ++LWQS
Sbjct  101   NISSDGNLILSNQTAKVFWST----NSSKASSPVAQLLDTGNFVLK-EGNSDSYSFLWQS  155

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FDYP DTLLPGMKLG D  TG +RY+++W+S  DPS GD +FKLD +G PE F+      
Sbjct  156   FDYPCDTLLPGMKLGLDLTTGLDRYLTTWKSTDDPSPGDYSFKLDPHGSPEFFIWKGSTK  215

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
              YR+G WNG+ FSG PEM+      F F+   +E+YY +++ + ++ SR ++N + +++R
Sbjct  216   EYRNGPWNGIRFSGEPEMDSDSYFTFEFVDNSHEIYYMYQVADSSIISRFMLNQS-MIQR  274

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             Y W      W+ +W+ P+DQCD Y +CG +GIC+++ SP+C C  GF P++ Q W+LRDG
Sbjct  275   YVWFNSTLGWSLYWSMPRDQCDYYAQCGPYGICNSNDSPICNCIHGFDPKSPQNWNLRDG  334

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
               GC R   LDC  DGFL +   KLP++S S V+ +MSL++C+E C+ NCSC AY+  NI
Sbjct  335   RDGCVRKTRLDCQGDGFLKLTDVKLPDTSNSTVNESMSLEQCRESCLNNCSCVAYAAANI  394

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKK-----  1970
             S GGSGC+IW + L DI+Q+  +GGQ LYVR+AAS      E+    NG  + KK     
Sbjct  395   SGGGSGCIIWGSNLIDIKQF-VDGGQDLYVRLAAS------ELNTSSNGGDQNKKKHATV  447

Query  1971  VILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHS  2150
             +I+ C     + +V  G  +  ++  +     +I++ G R+ S D  + A   +      
Sbjct  448   IIVICITSGLLLLVSSGCYIWHKKFRK----HSIKLGGRRQLSIDLALTALGPTQDHHPE  503

Query  2151  GETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNS  2330
              E     E ELP+F+ + I +ATD+F+ ANKLG+GGFG+VYKG L  G+ IAVKRLS++S
Sbjct  504   NEGNRGKELELPLFELSTIVIATDDFSIANKLGEGGFGAVYKGELEDGQGIAVKRLSRHS  563

Query  2331  RQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLL  2510
             RQG +EFKNE+ LIA+LQH NLV+LLGCC+  +++MLIYEYM N+SLD+I+FDK + +LL
Sbjct  564   RQGTDEFKNEVMLIAKLQHVNLVRLLGCCMHGEDRMLIYEYMHNRSLDTIIFDKTKCALL  623

Query  2511  DWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDE  2690
              W++R+NII G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+MNPKISDFG+AR+FGGD+
Sbjct  624   TWQKRFNIIVGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMNPKISDFGVARIFGGDQ  683

Query  2691  TEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENL  2870
             ++A  TKR+VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE++SG+KN+G Y+     NL
Sbjct  684   SDA-YTKRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIISGKKNRGIYSTEPNLNL  742

Query  2871  LGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLM  3050
             L  AW+LW EG   ELLD  +     S  +++V+RCIQVGLLCVQ++AEDRP+M+ V+LM
Sbjct  743   LSHAWKLWKEGNSLELLDKSVGC---SYSINEVLRCIQVGLLCVQDRAEDRPHMSTVILM  799

Query  3051  LIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTML  3185
             L      LP PKQPG+C        + SS+     ++N++TVTML
Sbjct  800   LGSASAMLPLPKQPGYCSERSATDTEWSSSC----TVNEITVTML  840


 Score =   408 bits (1048),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 192/400 (48%), Positives = 270/400 (68%), Gaps = 8/400 (2%)
 Frame = +3

Query  726   PLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFL  905
             PL+  +TLVSAG  F+LGFFSPG +S   Y+GIWYK I   T+VWVANR+ PL + TG L
Sbjct  1016  PLSDGETLVSAGGNFELGFFSPG-SSKNRYLGIWYKNISTHTVVWVANREAPLTDGTGSL  1074

Query  906   KIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
              I  DGN+ L +     +WS+    N S   + VAQLLD+GNFV++ E + +  ++LWQS
Sbjct  1075  NISSDGNLILYNQAAKVLWST----NSSKASSPVAQLLDTGNFVLK-EGNSDSHSFLWQS  1129

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             F+YP DT LPGMKLGW+  TG + Y+++W+S  DPS GD +FKLD  G PE F+  +   
Sbjct  1130  FNYPCDTXLPGMKLGWNLTTGFDLYLTTWKSTDDPSPGDYSFKLDPLGAPEFFIWKQSTK  1189

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
              YRSG WNG+ FSG PEM+    + F F    + VYY F++ + ++ SR ++N +++ +R
Sbjct  1190  EYRSGPWNGIQFSGEPEMDSDNYLTFEFFIYPHAVYYMFKVVDSSIISRFMLNQSKI-QR  1248

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             Y W      W  +W+ PKDQCD Y  CG +GIC+T+ SP+C C  GF P++   W+LRDG
Sbjct  1249  YVWFNSTLGWTLYWSIPKDQCDYYAVCGPYGICNTNDSPICNCMYGFTPKSPLEWNLRDG  1308

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
               GC R   LDC  DGF+ +++ KLP++S S ++ +MSL++C+E C+ NCSC AY++ NI
Sbjct  1309  HNGCVRKTSLDCHGDGFVRLSHVKLPDTSNSTLNESMSLEQCRESCLNNCSCVAYASANI  1368

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQT  1925
             + GGSGC+IW ++L DI+Q+  +GGQ LY R+AAS+   T
Sbjct  1369  TEGGSGCIIWGSDLIDIKQF-VDGGQDLYFRLAASELSST  1407


 Score =   252 bits (644),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +3

Query  2199  NAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNELRLIAR  2378
             + I +AT NF+ +NKLG+GGFG+VYKG L  G+ IAVKRLS++SRQG +EFKNE+ LIA+
Sbjct  1430  STIVIATANFSISNKLGEGGFGTVYKGELEDGQGIAVKRLSRHSRQGTDEFKNEVMLIAK  1489

Query  2379  LQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIICGVARGL  2558
             LQH NLV+LLGCC+  +++MLIYEYM N+SLD+I+FDK + +LL W++R+NII G+ARGL
Sbjct  1490  LQHVNLVRLLGCCMQGEDRMLIYEYMHNRSLDTIIFDKTKCALLTWQKRFNIIVGIARGL  1549

Query  2559  LYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGD  2687
             LYLHQDSRFRIIHRDLKASN+LLDK+MNPKISDFG+AR+FGGD
Sbjct  1550  LYLHQDSRFRIIHRDLKASNILLDKDMNPKISDFGVARIFGGD  1592


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2     QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
             QH NLVRLLGCC++G ++MLI      +SLDT +FD TK A L W K
Sbjct  1491  QHVNLVRLLGCCMQGEDRMLIYEYMHNRSLDTIIFDKTKCALLTWQK  1537


 Score = 55.5 bits (132),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC+ G ++MLI      +SLDT +FD TK A L W K
Sbjct  581  QHVNLVRLLGCCMHGEDRMLIYEYMHNRSLDTIIFDKTKCALLTWQK  627



>emb|CDY35375.1| BnaA03g19850D [Brassica napus]
Length=842

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/826 (51%), Positives = 579/826 (70%), Gaps = 29/826 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+T+VS+ E+F+LGFF+   +S   Y+GIWYK+I  RT VWVANRD PL NS G L+I  
Sbjct  39    NKTIVSSREIFELGFFNLPSSSR-WYLGIWYKKIPTRTYVWVANRDNPLSNSNGTLRI-S  96

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             D N+ + D +G  +WS+ N          VA+LLD+GNFV+R  N+ + + +LWQSFD+ 
Sbjct  97    DNNLVIFDQSGTPVWST-NLTGGDAGSPLVAELLDNGNFVLRPSNNNDQDVFLWQSFDFL  155

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFLRNKDIIIYR  1274
             TDTLLP MKLGWD KTG NR++ SWR+P DPS GD + KL+   G PE +  NKD IIYR
Sbjct  156   TDTLLPEMKLGWDRKTGLNRHLRSWRNPDDPSSGDFSTKLETTRGFPEFYAWNKDKIIYR  215

Query  1275  SGGWNGVAF-SGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYT  1451
             SG W+G  F S V +M+P + +AF+F     +V YS+ I   +++SR+I++ + LL+R+T
Sbjct  216   SGPWSGNRFGSDVLDMKPIDYLAFNFTADNEQVTYSYRITKPDVYSRVILSSSGLLQRFT  275

Query  1452  WIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
             W    + W + W  P+D CD+Y+ECG +G CD + SPVC C  GF+ RN Q       +G
Sbjct  276   WFETEQSWRQLWYLPRDLCDDYKECGDYGYCDLNTSPVCNCIQGFETRNNQ-------TG  328

Query  1632  GCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
             GC R   L C   DGF  +   KLP+++ + VD+ + L EC+E C+++C+CTA++N +I 
Sbjct  329   GCARKTRLSCGGKDGFARLKKMKLPDTTVTVVDSGVGLKECEERCLKDCNCTAFANMDIR  388

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             +GGSGCVIW  ++FDIR +   GGQ LYVR+AA+D              GK  K+I    
Sbjct  389   DGGSGCVIWKGDIFDIRNF-PNGGQDLYVRLAAADLVDKR---------GKRGKIIALSI  438

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
              V    ++ F +    + K +R +     +   + R  D LMN  AI+S+R  S E    
Sbjct  439   GVTIFLLLCFIIFRFWKNKQKRSIAIQTPIVD-QGRIEDSLMNELAITSRRYISRENKTD  497

Query  2169  DE-YELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             D+  EL + +F  +A+AT+NF+NANKLG+GGFG+VYKG L+ G+EIAVKRLSK S QG +
Sbjct  498   DDDLELSLMEFEVVALATNNFSNANKLGKGGFGTVYKGRLLDGKEIAVKRLSKMSLQGTD  557

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+L+GCC+D  EKMLIYEY+EN SLDS +FD  R S L+W+ R
Sbjct  558   EFKNEVKLIARLQHINLVRLIGCCIDKGEKMLIYEYLENLSLDSHIFDITRRSNLNWQMR  617

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++I  G+ARGL+YLH+DSRF IIHRDLKASNVLLDK M PKISDFGMAR+FG D+ EA  
Sbjct  618   FDITNGIARGLVYLHRDSRFMIIHRDLKASNVLLDKNMTPKISDFGMARIFGRDDAEA-N  676

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG+KN GFY  +++ NLL   W
Sbjct  677   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKKNNGFYNSNHDLNLLAFVW  736

Query  2886  RLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK  3062
             R W EG+  E+LD +I   S S     +++RCIQ+GLLCVQE+AEDRP MA+VM+M+  +
Sbjct  737   RKWKEGKWLEILDPIIIDSSSSTCQAHEILRCIQIGLLCVQERAEDRPVMASVMVMIGSE  796

Query  3063  GTSLPQPKQPGFCLASKPVKMDSSSTSY-NDQ-SLNQLTVTMLDAR  3194
               ++P+PK+PGFC+   P+++DSSS++  ND+ ++NQ+T++++DAR
Sbjct  797   TMAIPEPKRPGFCVGRNPLEIDSSSSTQGNDECTVNQVTLSVIDAR  842


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRL+GCCI+ GEKMLI       SLD+ +FD T+R+ LNW
Sbjct  570  QHINLVRLIGCCIDKGEKMLIYEYLENLSLDSHIFDITRRSNLNW  614



>emb|CAA74662.1| SFR3 [Brassica oleracea var. viridis]
Length=841

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/825 (51%), Positives = 578/825 (70%), Gaps = 28/825 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+T+VS+GE+F+LGFF+   +S   Y+GIWYK+I  R  VWVANRD PL NS G L+I  
Sbjct  39    NETIVSSGEIFELGFFNLPSSSR-WYLGIWYKKIPARAYVWVANRDNPLSNSNGTLRI-S  96

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             D N+ + D +G  +WS++ T   +     VA+LLD+GNFV+R  N+ + + +LWQSFD+ 
Sbjct  97    DNNLVMFDQSGTPVWSTNRTRGDA-GSPLVAELLDNGNFVLRHLNNSDQDVFLWQSFDFL  155

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFLRNKDIIIYR  1274
             TDTLLP MKLGWD KTG NRY+ SWR+P DPS GD + KL+   G PE +  NKD IIYR
Sbjct  156   TDTLLPEMKLGWDRKTGLNRYLRSWRNPDDPSSGDFSTKLETTRGFPEFYAWNKDEIIYR  215

Query  1275  SGGWNGVAF-SGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYT  1451
             SG W+G  F S V +M+P + + F+F      V YS+ I   +++SR+I++   LL+R+T
Sbjct  216   SGPWSGNRFGSDVLDMKPIDYLGFNFTADNEHVTYSYRITKPDVYSRVILSSAGLLQRFT  275

Query  1452  WIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
             W    + W + W  P+D CD+YRECG +G CD + SPVC C  GF+ RN Q       + 
Sbjct  276   WFETEQSWRQLWYLPRDLCDDYRECGDYGYCDLNTSPVCNCIQGFETRNNQ-------TA  328

Query  1632  GCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
             GC R   L C   DGF+ +   KLP+++ + V++ + L EC+E C+++C+CTA++N +I 
Sbjct  329   GCARKTRLSCGGKDGFVRLKKMKLPDTTVTVVESGVGLKECEERCLKDCNCTAFANMDIR  388

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             NGGSGCVIW  ++FDIR +   GGQ LYVR+AA+D              GK  K+I    
Sbjct  389   NGGSGCVIWKGDIFDIRNF-PNGGQDLYVRLAAADLVDKR---------GKRGKIIALSI  438

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
              V    ++ F +    ++K +R +     +   + R  D LMN  AI+S+R  S E    
Sbjct  439   GVTIFLLLCFIIFRFWKKKQKRSIAIQTPIVD-QGRIEDSLMNELAITSRRYISRENKTD  497

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             D+ EL + +F  +A+AT+NF++ANKLG+GGFG+VYKG L+ G+EIAVKRLSK S QG +E
Sbjct  498   DDLELSLMEFEVVALATNNFSSANKLGRGGFGTVYKGRLLDGKEIAVKRLSKMSLQGTDE  557

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             FKNE++LIARLQH NLV+L+GCC+D  EKMLIYEY+EN SLDS +FD  R S L+W+ R+
Sbjct  558   FKNEVKLIARLQHINLVRLIGCCIDKGEKMLIYEYLENLSLDSHIFDITRRSNLNWQMRF  617

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             +I  G+ARGL+YLH+DSRF IIHRDLKASNVLLDK M PKISDFGMAR+FG D+ EA  T
Sbjct  618   DITNGIARGLVYLHRDSRFMIIHRDLKASNVLLDKNMTPKISDFGMARIFGRDDAEA-NT  676

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             +++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG+KN GFY  + + NLL L WR
Sbjct  677   RKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKKNNGFYNSNQDLNLLALVWR  736

Query  2889  LWGEGRGSELLDSVIA-SESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
              W EG+  E+LD +I  S S +    +++RCIQ+GLLCVQE+AEDRP MA+VM+M+  + 
Sbjct  737   KWKEGKWLEILDPIIIDSSSSTGQAHEILRCIQIGLLCVQERAEDRPVMASVMVMIGSET  796

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSY-NDQ-SLNQLTVTMLDAR  3194
              ++P  K+PGFC+   P+++DSSS++  ND+ ++NQ+T++++DAR
Sbjct  797   MAIPDRKRPGFCVGRNPLEIDSSSSTQGNDECTVNQVTLSVIDAR  841


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRL+GCCI+ GEKMLI       SLD+ +FD T+R+ LNW
Sbjct  569  QHINLVRLIGCCIDKGEKMLIYEYLENLSLDSHIFDITRRSNLNW  613



>ref|XP_009115145.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Brassica rapa]
Length=855

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/841 (51%), Positives = 559/841 (66%), Gaps = 46/841 (5%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ + T+VS   +F+LGFF    NSG  Y+GIWYK I  RT VWVANRD PL +  G LK
Sbjct  42    ISSHNTIVSPSHIFELGFFKLPSNSG-WYIGIWYKVISKRTYVWVANRDSPLSSPMGTLK  100

Query  909   IGEDGNIHLVD----GTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVR-----RENDEN  1061
             I  D N+ + D     T  S+WS+ N     V    +A+LLD+GN V+R       N+ N
Sbjct  101   IS-DNNLVIFDISNTTTPVSVWST-NLTRGDVKSPVIAELLDNGNLVLRDSNNNNNNNNN  158

Query  1062  PENYLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEA  1241
             P+  LWQSFD+PTDTLLP MKLGWD KTG NR + SWRSP DPS GD +FK++  G P+ 
Sbjct  159   PDGILWQSFDFPTDTLLPEMKLGWDRKTGFNRLLRSWRSPDDPSSGDYSFKMETKGFPQI  218

Query  1242  FLRNKDII-IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLI  1418
             FL   D   +YRS  WNGV FS  PEM+P   +  +F+ +  EV YSF+I   N++S   
Sbjct  219   FLWKSDSRRVYRSRPWNGVRFSDAPEMQPFNDLVLNFIVSNEEVTYSFQITKNNIYSIFT  278

Query  1419  VNYTQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRN  1598
             ++   LLER+TW      W++FW+APKDQCD Y+ CGS+  CD++ SPVC C  GF+P  
Sbjct  279   LSSKGLLERFTWNETEHNWHQFWHAPKDQCDQYKVCGSYSYCDSNKSPVCQCIKGFEPEP  338

Query  1599  QQ--AWSLRDGSGGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVR  1769
                  W L + SGGC R  +L C   DGF+ +   KLP+S  + VD  + + EC++ C++
Sbjct  339   MYPVVWGLGNRSGGCARQTQLSCDGRDGFVQLKNIKLPDSMEASVDRRIGVKECEDRCLK  398

Query  1770  NCSCTAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRV---AASDAEQTGEVAR  1940
             +C+CTA++N +I  GG GC+IWT EL DIR YT    Q LYVRV   AA+D +   + + 
Sbjct  399   DCTCTAFANRDIHRGGWGCMIWTGELVDIRSYTKTTSQDLYVRVVRQAAADQDDKSKKSA  458

Query  1941  G--GNGFGKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLM  2114
                G+  G +  ++L+  I                           + R +   S+D  M
Sbjct  459   KVIGSSIGVSVLLVLSFIIYGFRKWK--------------------QKRPSIAGSQDLPM  498

Query  2115  NATAISSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGG  2294
                 +SS    S E   T++ ELP+ +F+A+A+ATDNF++ANKLGQGGFG VYKG L+ G
Sbjct  499   KEAVLSSMGHISRENK-TEDLELPLMEFDAVAIATDNFSDANKLGQGGFGIVYKGRLLEG  557

Query  2295  EEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLD  2474
             +EIAVKRLSK S QG +EF NE++LIARLQH NLV+LLGCCVD DEKMLIYEY+EN S D
Sbjct  558   KEIAVKRLSKTSVQGNDEFMNEVKLIARLQHVNLVRLLGCCVDKDEKMLIYEYLENLSFD  617

Query  2475  SILFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKIS  2654
             S LFDK R S LDWK+R++I+ G+ARGLLYLHQDSR R+IHRDLKASNVLLDK+M PKIS
Sbjct  618   SHLFDKTRRSNLDWKKRFDIVNGIARGLLYLHQDSRLRVIHRDLKASNVLLDKDMTPKIS  677

Query  2655  DFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKN  2834
             DFGMAR+FG DETEA  T+++VGTYGYMSPEYAM G FS+KSD FSFGVL+LE++SG++N
Sbjct  678   DFGMARIFGRDETEAN-TRKVVGTYGYMSPEYAMYGKFSMKSDVFSFGVLLLEIISGKRN  736

Query  2835  QGFYTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEK  3011
               FY    + NLL   WR W EG+G E++D VI   S S F   +++RCIQ+GLLCVQE+
Sbjct  737   NSFYDSDRDLNLLSFVWRYWKEGKGLEIVDPVIVDWSSSTFRPHEILRCIQIGLLCVQER  796

Query  3012  AEDRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDA  3191
             A+DRP M++V+LM   + T++PQPK PGFC    P   DS    Y   ++NQ+T+++LDA
Sbjct  797   ADDRPMMSSVVLMFGSETTAIPQPKTPGFCAGKSP--SDSKQREYRSWTVNQITLSILDA  854

Query  3192  R  3194
             R
Sbjct  855   R  855


 Score = 54.7 bits (130),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++  EKMLI       S D+ +FD T+R+ L+W K
Sbjct  587  QHVNLVRLLGCCVDKDEKMLIYEYLENLSFDSHLFDKTRRSNLDWKK  633



>ref|XP_010928033.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=1213

 Score =   830 bits (2144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/830 (52%), Positives = 562/830 (68%), Gaps = 40/830 (5%)
 Frame = +3

Query  726   PLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFL  905
             PL   QTL+SAG  F+LGFFSP  NS   YVGIWY ++   T+VWVANR  P+    G L
Sbjct  417   PLRDGQTLISAGGNFELGFFSPV-NSNNRYVGIWYHKVSVPTVVWVANRQHPISEPKGSL  475

Query  906   KIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRREN--DENPENYLW  1079
              I  +G + + D    ++WSS ++       N VAQLLDSGNF+V+        P ++ W
Sbjct  476   SITANGTLVITDQNSTAVWSSGSSGLT----NPVAQLLDSGNFIVKEAKGASNGPGSFAW  531

Query  1080  QSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKD  1259
             QSFDYPTDTLLPGMKLGW+  +  NR +++W   +DP+ G  +  LD+ G PE FL    
Sbjct  532   QSFDYPTDTLLPGMKLGWNLTSHLNRNLTAWTDASDPAPGYYSMALDVEGDPEIFLLGGA  591

Query  1260  IIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL  1439
               ++R+G W G  FSG+PEM+   +  F+F+  ++E+YY+F I + ++ SRLIVN + + 
Sbjct  592   HRLWRTGPWVGQRFSGIPEMKTYSMFTFNFVMDQDEIYYTFNILDGSVISRLIVNQSGVT  651

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             +R  W+ +++ W+ FW APKDQCD    CG FGICDT+ SP+C C  GF+PR+   W+LR
Sbjct  652   QRLVWLEQSQAWSIFWFAPKDQCDGVSPCGPFGICDTNNSPICDCLQGFEPRSPTNWALR  711

Query  1620  DGSGGCFRYDELDCP--TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYS  1793
             DGS GC R   LDC   TDGF+++N  KLP++S S VD ++SLD+C+ MC+RNCSCTAY+
Sbjct  712   DGSDGCKRKTALDCRNGTDGFVTVNEVKLPDTSNSTVDMSLSLDQCRAMCLRNCSCTAYA  771

Query  1794  NYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASD---AEQTGEVARGGNGFGKT  1964
             + N S GG  C+IWTAE+ D+R +T  GGQ LYVR+AA+D   A +   ++R        
Sbjct  772   SANTSGGG--CIIWTAEITDLRVFTF-GGQDLYVRLAAADLGSASKHSHLSR--------  820

Query  1965  KKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKRE  2144
                I+   ++  + +   G  +  +++ RR   + + M GT             IS    
Sbjct  821   IAAIVVGSVLGTLLLGWIGCCIWNKKRRRRRTKQAMSMLGT-------------ISFANN  867

Query  2145  HSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSK  2324
             +  E    +E +LP +D   I  ATDNF+  NKLG+GGFG VYKG L   +EIAVKRL+K
Sbjct  868   YINEGTEGNELDLPSYDLGTIVAATDNFSIKNKLGEGGFGPVYKGKLGEEQEIAVKRLAK  927

Query  2325  NSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSS  2504
              S QG +EFKNE+ LIA+LQHRNLV+LLGCC+  +E+MLIYEYM NKSLD+ LFDK +++
Sbjct  928   TSVQGIDEFKNEVMLIAKLQHRNLVQLLGCCIQGEERMLIYEYMPNKSLDAFLFDKAKAA  987

Query  2505  LLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGG  2684
             LLDW+ RYNII G+ARGLLYLHQDSR RIIHRDLKASN+LLDKEMNPKISDFGMAR+FGG
Sbjct  988   LLDWQTRYNIIAGIARGLLYLHQDSRLRIIHRDLKASNILLDKEMNPKISDFGMARIFGG  1047

Query  2685  DETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEE  2864
             DE E   T R+VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE+ SG+KN+G Y  +   
Sbjct  1048  DEAEV-NTHRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEITSGKKNRGVYYSNRHT  1106

Query  2865  NLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVM  3044
             NLLG AW LW EG G EL+D  I    +S  + +V+RCI+V LLCVQE  EDRP M++V+
Sbjct  1107  NLLGHAWYLWKEGNGLELVDESIG---YSFPMAEVLRCIKVALLCVQEHPEDRPTMSSVV  1163

Query  3045  LMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             LML  +   LP PKQPGF     P ++DSSS+  +  ++N L+VT+ +AR
Sbjct  1164  LMLGSESACLPYPKQPGFVATKGPFEIDSSSSKQDSLTVNDLSVTVFEAR  1213


 Score =   396 bits (1018),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 196/311 (63%), Positives = 239/311 (77%), Gaps = 9/311 (3%)
 Frame = +3

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             + ++ELP+FD   I  A +NF+  NKLG+GGFG + +      +EIAVKRLSK S QG +
Sbjct  65    SKDWELPLFDLGTIIAAINNFSIENKLGRGGFGPLGEE-----QEIAVKRLSKTSAQGTD  119

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EF NE+ LIA+LQHRNLV+LLGCC   +E+ML+YEYM NKSLD+ LFDK R  LLDW+ R
Sbjct  120   EFMNEVTLIAKLQHRNLVRLLGCCTQGEERMLVYEYMPNKSLDAFLFDKDRGVLLDWQTR  179

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             YNII G+A+GLLYLH+DSR RIIHRDLKASNVLLDK+MNPKISDFG+AR+F GDE  A  
Sbjct  180   YNIIEGIAQGLLYLHRDSRLRIIHRDLKASNVLLDKDMNPKISDFGLARIFRGDEI-AIN  238

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+R+VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE++SG+KN+G     +E NLL  AW
Sbjct  239   TRRVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIISGKKNRGVSVSEHEGNLLAHAW  298

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
              LW EG  SEL+D  I   S+S  + + + CI+VGLLCVQE   DRP M++V+LML  + 
Sbjct  299   SLWTEGNASELIDKSI---SNSTSMVEAVNCIKVGLLCVQESPRDRPTMSSVVLMLGSRN  355

Query  3066  TSLPQPKQPGF  3098
              SL  PK PGF
Sbjct  356   ASLSDPKHPGF  366


 Score = 60.8 bits (146),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLV+LLGCCI+G E+MLI      KSLD F+FD  K A L+W
Sbjct  947  QHRNLVQLLGCCIQGEERMLIYEYMPNKSLDAFLFDKAKAALLDW  991


 Score = 56.6 bits (135),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRLLGCC +G E+ML+      KSLD F+FD  +   L+W
Sbjct  132  QHRNLVRLLGCCTQGEERMLVYEYMPNKSLDAFLFDKDRGVLLDW  176



>sp|Q09092.2|SRK6_BRAOV RecName: Full=Putative serine/threonine-protein kinase receptor; 
AltName: Full=S-receptor kinase; Short=SRK; Flags: Precursor 
[Brassica oleracea var. viridis]
 gb|AAA33000.1| receptor protein kinase [Brassica oleracea var. viridis]
Length=857

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/834 (51%), Positives = 559/834 (67%), Gaps = 32/834 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+TLVS G +F++GFF         Y+G+WYK++ DRT VWVANRD PL N+ G LK
Sbjct  44    ISSNKTLVSPGSIFEVGFFRTNSR---WYLGMWYKKVSDRTYVWVANRDNPLSNAIGTLK  100

Query  909   IGEDGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
             I  + N+ L+D +   +W ++ T  N+  P   VA+LL +GNFV+R  ++ +   YLWQS
Sbjct  101   ISGN-NLVLLDHSNKPVWWTNLTRGNERSP--VVAELLANGNFVMRDSSNNDASEYLWQS  157

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FDYPTDTLLP MKLG++ KTG NR+++SWRS  DPS G+ ++KL+   LPE +L  ++  
Sbjct  158   FDYPTDTLLPEMKLGYNLKTGLNRFLTSWRSSDDPSSGNFSYKLETQSLPEFYLSRENFP  217

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             ++RSG WNG+ FSG+PE +    + ++F+    EV Y+F + N + +SRL +      +R
Sbjct  218   MHRSGPWNGIRFSGIPEDQKLSYMVYNFIENNEEVAYTFRMTNNSFYSRLTLISEGYFQR  277

Query  1446  YTWIPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRD  1622
              TW P  RIWNRFW++P D QCD Y  CG +  CD + SPVC C  GF PRN Q W  R 
Sbjct  278   LTWYPSIRIWNRFWSSPVDPQCDTYIMCGPYAYCDVNTSPVCNCIQGFNPRNIQQWDQRV  337

Query  1623  GSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
              +GGC R  +L C  DGF  M   KLPE++ + VD ++ + ECK+ C+ +C+CTA++N +
Sbjct  338   WAGGCIRRTQLSCSGDGFTRMKKMKLPETTMATVDRSIGVKECKKRCISDCNCTAFANAD  397

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEG--GQLLYVRVAASDAEQTGEVARGGNGFGKTKKVI  1976
             I NGGSGCVIWT  L DIR Y  +   GQ LYVR+AA+D      +A+  N  GK   + 
Sbjct  398   IRNGGSGCVIWTERLEDIRNYATDAIDGQDLYVRLAAAD------IAKKRNASGKIISLT  451

Query  1977  LACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGE  2156
             +   ++L + M        KR K       N +      R+++  MN   +SSKRE SGE
Sbjct  452   VGVSVLLLLIMFCLWKRKQKRAKASAISIANTQ------RNQNLPMNEMVLSSKREFSGE  505

Query  2157  TMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQ  2336
                 +E ELP+ +   +  AT+NF++ NKLGQGGFG VYKG L+ G+EIAVKRLSK S Q
Sbjct  506   YKF-EELELPLIEMETVVKATENFSSCNKLGQGGFGIVYKGRLLDGKEIAVKRLSKTSVQ  564

Query  2337  GAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
             G +EF NE+ LIARLQH NLV++LGCC++ DEKMLIYEY+EN SLDS LF K R S L+W
Sbjct  565   GTDEFMNEVTLIARLQHINLVQVLGCCIEGDEKMLIYEYLENLSLDSYLFGKTRRSKLNW  624

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
               R++I  GVARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  DETE
Sbjct  625   NERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFERDETE  684

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             A T K +VGTYGYMSPEYAM G+FS KSD FSFGV+VLE+VSG+KN+GFY    E +LL 
Sbjct  685   ANTMK-VVGTYGYMSPEYAMYGIFSEKSDVFSFGVIVLEIVSGKKNRGFYNLDYENDLLS  743

Query  2877  LAWRLWGEGRGSELLDSVIA---SESHSEFVDQ-VMRCIQVGLLCVQEKAEDRPNMAAVM  3044
               W  W EGR  E++D VI    S   S F  Q V++CIQ+GLLCVQE AE RP M++V+
Sbjct  744   YVWSRWKEGRALEIVDPVIVDSLSSQPSIFQPQEVLKCIQIGLLCVQELAEHRPAMSSVV  803

Query  3045  LMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ----SLNQLTVTMLDAR  3194
              M   + T +PQPK PG+C+   P ++D SS+   D+    ++NQ T +++DAR
Sbjct  804   WMFGSEATEIPQPKPPGYCVRRSPYELDPSSSWQCDENESWTVNQYTCSVIDAR  857


 Score = 58.5 bits (140),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLV++LGCCIEG EKMLI       SLD+++F  T+R++LNW +
Sbjct  580  QHINLVQVLGCCIEGDEKMLIYEYLENLSLDSYLFGKTRRSKLNWNE  626



>ref|XP_009105614.1| PREDICTED: uncharacterized protein LOC103831486 [Brassica rapa]
Length=1708

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/847 (51%), Positives = 587/847 (69%), Gaps = 25/847 (3%)
 Frame = +3

Query  669   WPESGTADDIL**GPPWNPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDR  848
             +P SG   + L   P  +  ++ N+T+VS  E F+LGFF+PG +S   Y+GIWYK+I  R
Sbjct  882   FPASGVYANTL--SPTESLTISNNKTIVSRNETFELGFFTPGSSSR-WYLGIWYKKIPTR  938

Query  849   TIVWVANRDKPLRNSTGFLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSG  1028
             T VWVANRD PL   +G LKI  D N+ + D +   +WS++ T   S     VA+LLD+G
Sbjct  939   TYVWVANRDNPLSRPSGSLKISSDNNLVIYDHSDTPVWSTNLTVGAS-RSPVVAELLDNG  997

Query  1029  NFVVRRENDENPENYLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDIT  1208
             NFV+   N  +PE YLWQSFD+PTDTLLP MKLGWD KTG +R + SW+S  DP+ GD +
Sbjct  998   NFVL---NSNDPEGYLWQSFDFPTDTLLPDMKLGWDKKTGLDRVLRSWKSVEDPASGDYS  1054

Query  1209  FKLDINGLPEAFLRNKDIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEI  1388
              KL+  G PE ++ NK+ IIYRSG W G  FS VPEM+P E + ++F+ +  EV Y++ +
Sbjct  1055  TKLETRGFPEYYVFNKETIIYRSGPWIGNRFSCVPEMKPIEYMVYTFIASNEEVSYAYHM  1114

Query  1389  HNKNLFSRLIVNYTQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVC  1568
                +++S L ++YT  ++R  WI + + W + W  PKD CDNYR+CG++G CD++  P C
Sbjct  1115  TKPDVYSTLSLSYTGTIQRRNWIEQAQDWKQLWYQPKDICDNYRQCGNYGYCDSNNLPNC  1174

Query  1569  GCPVGFKPRNQQAWSLRDGSGGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLD  1745
              C  GF   N Q W+LRD S GC R   L C   DGF+++   KLP+++ + +D  + L 
Sbjct  1175  NCIKGFGLENGQEWALRDDSAGCVRKTRLSCDGRDGFVAVKRMKLPDTAATVLDRGIGLK  1234

Query  1746  ECKEMCVRNCSCTAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQT  1925
             ECK  C+++C+CTAY+N +I +GGSGCVIW   LFDIR Y   GGQ +YV++AA+D +  
Sbjct  1235  ECKAKCLQDCNCTAYANTDIRDGGSGCVIWNGGLFDIRMY-PNGGQDIYVKLAAADLDH-  1292

Query  1926  GEVARGGNGFGKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRE-RSR  2102
                      F  T    +    +  I ++L  +++L   K ++     I+     + RS+
Sbjct  1293  ---------FKITSHGTIIGSGIGVIILLLLSIIILGYWKRKQKRFITIQTPIVDQVRSQ  1343

Query  2103  DPLMNATAISSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGM  2282
             D L+N   ++S+R  S E   TD+ ELP+ +F A+ MAT+ F+ AN LGQGGFG VYKGM
Sbjct  1344  DLLINQVVLTSERYISRENK-TDDLELPLMEFEALDMATNRFSVANMLGQGGFGIVYKGM  1402

Query  2283  LVGGEEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMEN  2462
             L  G+EIAVKRLSK S QG +EFKNE+RLIARLQH NLV+LLGCCVD  EKMLIYEY+EN
Sbjct  1403  LPDGKEIAVKRLSKMSLQGTDEFKNEVRLIARLQHINLVRLLGCCVDKGEKMLIYEYLEN  1462

Query  2463  KSLDSILFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMN  2642
              SLDS LFDK R S L W +R++I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M 
Sbjct  1463  LSLDSHLFDKIRRSNLSWPKRFDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKNMT  1522

Query  2643  PKISDFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVS  2822
             PKISDFGMAR+FG +ETEA  T+++VGTYGYM+PEYAMDG+FS+KSD FSFGVL+LE+++
Sbjct  1523  PKISDFGMARIFGREETEAN-TRKVVGTYGYMAPEYAMDGIFSMKSDVFSFGVLLLEIIT  1581

Query  2823  GRKNQGFYTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLC  2999
             G++++GFY  + + NLLG  WR W EG+G E++D +I   S S     +++RCIQ+GLLC
Sbjct  1582  GKRSKGFYNSNRDNNLLGFVWRYWKEGKGIEIVDPIIMDSSLSALCTHEILRCIQIGLLC  1641

Query  3000  VQEKAEDRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ--SLNQLT  3173
             VQE+AEDRP M+ VM+ML  + T++PQPK PGFC+     + +SSS++  D   S+NQ+T
Sbjct  1642  VQERAEDRPVMSTVMVMLGSETTAIPQPKPPGFCVGRSLFETESSSSTQRDDELSVNQIT  1701

Query  3174  VTMLDAR  3194
             ++++DAR
Sbjct  1702  LSVIDAR  1708


 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/821 (50%), Positives = 549/821 (67%), Gaps = 54/821 (7%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS  E F+LGFF+PG +S   Y+GIWYK+I  RT VWVANRD PL +  G LK
Sbjct  38    ISSNETIVSHNETFELGFFTPGSSSR-WYLGIWYKKIPTRTYVWVANRDNPLSHPNGSLK  96

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ + D + N+   S+N    ++    VA+LLD+GNFV+R  N+     YLWQSF
Sbjct  97    ISSDNNLVIYDHSSNTPVWSTNLTVGTLRSPLVAELLDNGNFVLRHSNNNE---YLWQSF  153

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG +R + SWR   DPS GD + KL+  G PE ++ NK+ II
Sbjct  154   DFPTDTLLPDMKLGWDKKTGLDRVLRSWRGVEDPSSGDFSTKLETRGFPEYYVFNKERII  213

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG W G  FS +PEM+P + + ++F+ +  EV YS++    +++S L V+Y   L+R 
Sbjct  214   YRSGPWIGNRFSCIPEMKPVDYMVYTFIASNEEVTYSYQ----DVYSVLSVSYMGTLQRR  269

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
              WI   +IW + W  PKD CDNY++CGS+G  D++  P C C  GF+ RN+Q W+LRD S
Sbjct  270   NWIESAQIWKQLWYQPKDICDNYKQCGSYGYGDSNTIPSCNCIKGFERRNEQEWALRDDS  329

Query  1629  GGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R  +L C   DGF+ +   KLP+++ + +D  + L EC+  C+ +C+CTAY+N +I
Sbjct  330   AGCVRKTKLSCDGRDGFVVVKKMKLPDTTATVLDRGIGLKECEAKCLNDCNCTAYANTDI  389

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARG---GNGFGKTKKVI  1976
              +GGSGCVIW  ELFDIR Y A GGQ LYV++AA+D +     + G   G+G G T  ++
Sbjct  390   RDGGSGCVIWKGELFDIRSY-ANGGQDLYVKLAAADLDHVRITSHGTIIGSGIGVTIFLL  448

Query  1977  LACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGE  2156
             ++  I+ G         +  +      V           RS+D L++   ++S+R  S E
Sbjct  449   ISIIILFGYWKRKQKSDITIQTPRVDQV-----------RSQDLLIDEVLLTSERYISRE  497

Query  2157  TMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQ  2336
                TD+ ELP+ +F A+AMAT+ F++AN LGQGGFG VYKGML  G+EIAVKRLSK S Q
Sbjct  498   NK-TDDLELPLMEFEALAMATNRFSDANMLGQGGFGIVYKGMLPDGKEIAVKRLSKMSLQ  556

Query  2337  GAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
             G +EFKNE+RLIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDK R S L W
Sbjct  557   GTDEFKNEVRLIARLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKIRRSNLSW  616

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
              +R++I  G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK M PKISDFGMAR+FG D+  
Sbjct  617   PKRFDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKNMTPKISDFGMARIFGRDD--  674

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
                        GYM+PEYAMDG+FS+KSD FSFGVL+LE+++G++++GFY  + + NLLG
Sbjct  675   -----------GYMAPEYAMDGIFSMKSDVFSFGVLLLEIITGKRSKGFYNSNRDNNLLG  723

Query  2877  LAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
               WR W EG+G E++D +I   S S                  ++AEDRP M+ VM+ML 
Sbjct  724   FVWRYWKEGKGIEIVDPIIMDSSSSAL----------------QRAEDRPVMSTVMVMLG  767

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVT  3179
              + T++PQPK+PGFC+    ++ +SSS++ +D  L  + ++
Sbjct  768   SETTAIPQPKRPGFCVGRSLLETESSSSTQHDDDLTSMHIS  808


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD  +R+ L+W K
Sbjct  572  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKIRRSNLSWPK  618


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2     QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
             QH NLVRLLGCC++ GEKMLI       SLD+ +FD  +R+ L+W K
Sbjct  1436  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKIRRSNLSWPK  1482



>ref|XP_010924052.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=804

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/825 (51%), Positives = 555/825 (67%), Gaps = 47/825 (6%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG  899
             N PL+  QTLVSAG  F+LGFFSPG NS   Y+GIWYK+I  +T+VWVANR+ PL +++G
Sbjct  27    NTPLSDGQTLVSAGGNFELGFFSPG-NSMNRYLGIWYKKISTQTVVWVANREAPLTDNSG  85

Query  900   FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLW  1079
              L I  DGN+ + +     +WS+S++   S     VAQLLD+GNFV++  N+ +  + LW
Sbjct  86    SLNISSDGNLIISNQAAKVVWSTSSSKASS----PVAQLLDTGNFVLKEGNNHS-YSLLW  140

Query  1080  QSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKD  1259
             QSFDYP DTLLP MKLG D  TG + Y++SW S  DPS GD +FKLD    PE F+  + 
Sbjct  141   QSFDYPCDTLLPRMKLGLDFTTGLDLYLTSWTSTDDPSPGDYSFKLDPRRSPEFFIWKQS  200

Query  1260  IIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL  1439
                YRSG WNG+ FSG PE+       F F      +YY +E+ + ++ SR I+N + ++
Sbjct  201   TKEYRSGPWNGIQFSGEPEIHSGNYFTFEFFVNPQAMYYMYEVVDSSIISRFILNQS-MV  259

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             +RY W   +  W+ + + PKDQCD Y ECG +GIC+ + SP+C C  GF P++   W+LR
Sbjct  260   QRYVWFNSSVGWSLYRSIPKDQCDYYAECGPYGICNPNESPICKCLHGFSPKSPPDWNLR  319

Query  1620  DGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
             DG  GC R   LDC  DGFL +++ KLP+SS S V+ +MS+++C+E C+ NCSC AY+  
Sbjct  320   DGQDGCVRNTRLDCQGDGFLRLSHVKLPDSSNSTVNESMSIEQCQETCLNNCSCMAYATA  379

Query  1800  NISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVIL  1979
             NIS GGSGC+ W  +L DIRQ+  +GGQ LYVR+AAS+   TG     G+   K + +++
Sbjct  380   NISGGGSGCITWGGDLIDIRQF-VDGGQDLYVRLAASELSSTG-----GDPKKKKQAIVI  433

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
                                       +  +I        S D    A  +    +   E 
Sbjct  434   --------------------------IVVSIACGLLLLLSFDFAHTALRLGQDHQPENEG  467

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
                 E ELP+F+ + I MATDNF+ ANKLG+GGFGSVYKG L  G+ IAVKRLS++S QG
Sbjct  468   NREKELELPLFELSTIVMATDNFSIANKLGEGGFGSVYKGELEDGQGIAVKRLSRHSLQG  527

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EFKNE+ LI +LQH NLV+LLGCC+  +++MLIYEYM N+SLD+I+FDK +S+LL W+
Sbjct  528   TDEFKNEVMLIVKLQHVNLVRLLGCCIQGEDRMLIYEYMHNRSLDTIIFDKTKSTLLTWQ  587

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
             +R++II  +ARGLLYLHQDSRFRIIHRDLKASNVLLDK+MNPKISDFGMAR+FGGD+++A
Sbjct  588   KRFSIIVRIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMNPKISDFGMARIFGGDQSDA  647

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               TKR+VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE++SG+KN+G Y      +LL  
Sbjct  648   -YTKRVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIISGKKNRGIYNTEPNLSLLSH  706

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             AW+LW EG   ELLD  +     S  +++V++CIQVGLLCVQ++ EDRP+M+ V+LML G
Sbjct  707   AWKLWNEGNSLELLDKSMGC---SYSINEVLKCIQVGLLCVQDRPEDRPHMSTVILMLDG  763

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
                 LP PKQP +C       M+ SS+     ++N++T+TML  R
Sbjct  764   ASAVLPPPKQPAYCSERNATDMEWSSSC----TVNEITMTMLSGR  804


 Score = 57.4 bits (137),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCCI+G ++MLI      +SLDT +FD TK   L W K
Sbjct  542  QHVNLVRLLGCCIQGEDRMLIYEYMHNRSLDTIIFDKTKSTLLTWQK  588



>ref|XP_008775529.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Phoenix dactylifera]
Length=822

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/864 (49%), Positives = 570/864 (66%), Gaps = 58/864 (7%)
 Frame = +3

Query  618   FFLSSIQTPLVAKQSCRWPESGTADDIL**GPPWNPPLTLNQTLVSAGEVFQLGFFSPGG  797
             FFLS++ TP +              DIL    P   PL   QTL+SA   F+LGFFSP  
Sbjct  12    FFLSTLFTPSIGG------------DIL---TP-TQPLGDGQTLISASGNFELGFFSPV-  54

Query  798   NSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGEDGNIHLVDGTGNSIWSSSNT  977
             NS   YVGIWY E+  +T+VWVANR  P+    G L I  +G + + D    +IWSS ++
Sbjct  55    NSNNRYVGIWYHEVSVQTVVWVANRQHPITERKGSLSITGNGTLIITDQNSTTIWSSGSS  114

Query  978   NNQSVPGNTVAQLLDSGNFVVRR--ENDENPENYLWQSFDYPTDTLLPGMKLGWDSKTGR  1151
                + P   VA+LLD+GNF++    +N  +P+++ WQSFDYPTDTLLPGMKLGW+ K+  
Sbjct  115   GRLASP---VARLLDTGNFIIPEASDNSNHPDSFAWQSFDYPTDTLLPGMKLGWNLKSHL  171

Query  1152  NRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSGGWNGVAFSGVPEMEPKE  1331
             NR +++W SP+DP+ G  +  +D+ G PE FL      ++R+G W G  FSGVPEM+   
Sbjct  172   NRNVTAWTSPSDPAPGYYSAAMDVQGDPEIFLWAGAQRLWRTGPWVGHRFSGVPEMKTYS  231

Query  1332  VIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIPENRIWNRFWNAPKDQCD  1511
             +  F+F+  ++E+YY+F I N ++ SRL+VN + +++R  W+ ++++WN FW APKDQCD
Sbjct  232   MFTFNFVDDRDEIYYTFNILNGSIISRLVVNQSGVIQRLVWLEQSQMWNIFWFAPKDQCD  291

Query  1512  NYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCFRYDELDC--PTDGFLSM  1685
             +   CG FG+CD + SP+C C  GF+P++   W+LRDGSGGC R   LDC   TDGFL++
Sbjct  292   SVSPCGPFGVCDPNNSPICDCLQGFEPKSPANWALRDGSGGCKRKTPLDCRNGTDGFLTV  351

Query  1686  NYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGSGCVIWTAELFDIRQY  1865
             N  KLP++S+S VD +++LD+CK  C++NCSCTAY++ N S  G GC+IWTAEL  +R +
Sbjct  352   NDAKLPDTSSSTVDMSLNLDQCKAACLKNCSCTAYASANTS--GDGCIIWTAELTGLRVF  409

Query  1866  TAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlgigmvlfgllllkrrk  2045
                GGQ LY+R+AA+D     + +   +        +L   ++  I   ++     +RR 
Sbjct  410   -GFGGQDLYIRLAAADLGSASDHSHQIHIVAVVVGSVLGTLLLGSICCCIWKKKKRRRRP  468

Query  2046  lrrgVTENIEMRGTRERSRD-PLMNATAISSKREHSGETMITDEYELPIFDFNAIAMATD  2222
                    N    GT  R  + PL +   I                          A AT+
Sbjct  469   GTVSFASNHIDEGTEGRELELPLFDMGTI--------------------------AAATN  502

Query  2223  NFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVK  2402
             +F+  NKLG+GGFG VYKG L   +EIAVKRL+K S QG +EFKNE+ LIARLQHRNLV+
Sbjct  503   DFSIQNKLGEGGFGPVYKGKLGHEQEIAVKRLAKTSVQGLDEFKNEVVLIARLQHRNLVR  562

Query  2403  LLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSR  2582
             LLGCC+  +E+ML+YEYM N+SLD+ LFDK R++LLDW+ RYNII G+ARG+LYLHQDSR
Sbjct  563   LLGCCIQGEERMLVYEYMPNRSLDAFLFDKARAALLDWRIRYNIILGIARGILYLHQDSR  622

Query  2583  FRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDG  2762
             FRIIHRDLKASN+LLDKEMNPKISDFGMAR+FGGDETE  T  R+VGTYGYMSPEYAMDG
Sbjct  623   FRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEVNTC-RVVGTYGYMSPEYAMDG  681

Query  2763  LFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGEGRGSELLDSVIASE  2942
             +FSVKSD FSFGVLVLE++SG+KN+G Y      NLLG AW LW EG G EL+D  I   
Sbjct  682   IFSVKSDVFSFGVLVLEIISGKKNRGVYLSHQRMNLLGHAWSLWKEGNGLELVDESII--  739

Query  2943  SHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVK  3122
              HS  + + +RCI+VGLLCVQE  EDRP M++++ ML  +  SLP PKQPGF      ++
Sbjct  740   -HSFPMAEALRCIKVGLLCVQEHPEDRPTMSSLVFMLGSESASLPDPKQPGFVATKGHLE  798

Query  3123  MDSSSTSYNDQSLNQLTVTMLDAR  3194
               SSS+  +  ++N L+VT+ + R
Sbjct  799   TYSSSSKQDSLTVNGLSVTIFEGR  822


 Score = 60.5 bits (145),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRLLGCCI+G E+ML+      +SLD F+FD  + A L+W
Sbjct  556  QHRNLVRLLGCCIQGEERMLVYEYMPNRSLDAFLFDKARAALLDW  600



>ref|XP_010439487.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Camelina sativa]
Length=768

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/718 (57%), Positives = 521/718 (73%), Gaps = 16/718 (2%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS G+VF+LGFF PG +S   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  43    ISSNKTIVSPGDVFELGFFKPGSSSR-WYLGIWYKTISKRTYVWVANRDNPLSSSVGTLK  101

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ ++D +   +WS+ N    SV    VA+LLD+GNFV+R  N  N + YLWQSF
Sbjct  102   IS-DNNLVVLDQSETPVWST-NLTGGSVRSPVVAELLDNGNFVLRDSNSNNLDEYLWQSF  159

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLGWD KTG +R+I SW++  DPS GD +FKL+  G PE FL N++  +
Sbjct  160   DFPTDTLLPEMKLGWDLKTGFSRFIRSWKNSDDPSSGDYSFKLETGGFPEIFLWNRESRV  219

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNGV FSGVPEM+  + + F+F  +K EV YSF +   +++SRL ++ T +LER+
Sbjct  220   YRSGPWNGVQFSGVPEMQRFDYMVFNFTASKEEVTYSFRVTKDDIYSRLSLSSTGVLERF  279

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TWI   + WNRFW APKDQCD+Y+ECG +G CD++ SPVC C  GFKPRN Q W LRDGS
Sbjct  280   TWIEAAQTWNRFWYAPKDQCDDYKECGVYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGS  339

Query  1629  GGCFRYDELDC-PTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   +GF  +   KLP+++ + VD  + + EC++ C+++C+CTA++N +I
Sbjct  340   DGCVRKTLLTCGGKEGFARLKKMKLPDTTAASVDRGIGVKECEQKCLKDCNCTAFANTDI  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
                GSGCVIWT EL DIR Y A+GGQ LYVR+AA+D E   +  R     G +  VI   
Sbjct  400   RGAGSGCVIWTGELLDIRNY-AKGGQDLYVRLAATDIED--KRNRSAKIIGSSIGVISVL  456

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              I+  I   L+     +   +   + + +       RSRD LMN   ISS+R  S E   
Sbjct  457   LILSFIIFCLWKRKQKQSAAIETPIVDQV-------RSRDLLMNEVVISSRRHISRENN-  508

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             TD+ ELP+ +F  +AMAT+NF+N NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG +
Sbjct  509   TDDLELPLMEFEEVAMATNNFSNENKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGTD  568

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+LL CCVD+DEKMLIYEY+ N SLDS LFDKKRSS L+W+ R
Sbjct  569   EFKNEVKLIARLQHINLVRLLACCVDVDEKMLIYEYLANLSLDSHLFDKKRSSKLNWQMR  628

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLD+ M PKISDFGMAR+FG D+TEA  
Sbjct  629   FDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDQYMTPKISDFGMARIFGRDDTEA-I  687

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY    + NLLG+
Sbjct  688   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGV  745



>emb|CAA79355.1| S-receptor kinase-like protein [Brassica oleracea var. alboglabra]
Length=857

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/837 (51%), Positives = 573/837 (68%), Gaps = 34/837 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTI---VWVANRDKPLRNSTG  899
             ++ N+TLVS G+VF+LGFF    +S   Y+GIWYK++   +I   VWVANRD PL N+ G
Sbjct  40    ISSNRTLVSPGDVFELGFFKTTSSSR-WYLGIWYKKLYFGSIKNYVWVANRDSPLFNAIG  98

Query  900   FLKIGEDGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYL  1076
              LKI  + N+ L+D +  S+WS++ T  N+  P   VA+LL +GNFV+R  N+++   +L
Sbjct  99    TLKIS-NMNLVLLDQSNKSVWSTNLTRGNERSP--VVAELLANGNFVMRDSNNKDASGFL  155

Query  1077  WQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDI-NGLPEAFLRN  1253
             WQSFDYPTDTLLP MKLG+D KTG NR+++SWRS  DPS G+I++KLD  +G+PE +L  
Sbjct  156   WQSFDYPTDTLLPEMKLGYDHKTGLNRFLTSWRSSDDPSSGEISYKLDTQSGMPEFYLLI  215

Query  1254  KDIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQ  1433
                  +RSG WNGV FSG+PE +    + ++F+    EV Y+F + N +++SRL ++   
Sbjct  216   NGSPDHRSGPWNGVQFSGIPEDQKLSYMVYNFIENTEEVAYTFRMTNNSIYSRLTISSKG  275

Query  1434  LLERYTWIPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAW  1610
             +LER+TW P +  WN FW+ P D +CD Y  CG++  CD + SP C C  GF P N Q W
Sbjct  276   ILERWTWTPTSFSWNLFWSLPVDLKCDLYMACGAYSYCDVNTSPECNCMQGFMPFNMQQW  335

Query  1611  SLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAY  1790
             +LRDGSGGC R   L C +DGF  M   KLPE+  + VD ++ L EC++ C+ +C+CTA+
Sbjct  336   ALRDGSGGCIRRTRLSCSSDGFTRMKKMKLPETRMAIVDPSIGLKECRKRCLSDCNCTAF  395

Query  1791  SNYNISNGGSGCVIWTAELFDIRQY-TAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTK  1967
             +N +I NGG+GCVIWT EL DI  Y  A+ GQ +YVR+AA+D      + +  N  GK  
Sbjct  396   ANADIRNGGTGCVIWTGELEDIMTYFAADLGQDIYVRLAAAD------IVKKRNADGKII  449

Query  1968  KVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREH  2147
              +I+   ++L + M        KR K       N      R+R+++ LM     S+KR+ 
Sbjct  450   TLIVGVSVLLLMIMFCLWKRKQKRAKAMATTIVN------RQRNQNLLMKLMTQSNKRQL  503

Query  2148  SGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKN  2327
             S E   T+E+ELP  +  A+  AT+NF+N N+LGQGGFG VYKGML  G+E+AVKRLSK 
Sbjct  504   SRENK-TEEFELPFIELEAVVKATENFSNCNELGQGGFGIVYKGML-DGQEVAVKRLSKT  561

Query  2328  SRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSL  2507
             S QG +EF NE+RLIARLQH NLV++LGCC++ DEK+LIYEY+EN SLD  LF KKRSS 
Sbjct  562   SLQGIDEFMNEVRLIARLQHINLVRILGCCIEADEKILIYEYLENSSLDYFLFGKKRSSN  621

Query  2508  LDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGD  2687
             L+WK R+ II GVARGLLYLHQDSRFRIIHRD+K SN+LLDK M PKISDFGMAR+F  D
Sbjct  622   LNWKDRFAIINGVARGLLYLHQDSRFRIIHRDMKPSNILLDKYMIPKISDFGMARIFARD  681

Query  2688  ETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEEN  2867
             ETEA  T+  VGTYGYMSPEYAMDG+ S K+D FSFGV+VLE+VSG++N+GFY  + E N
Sbjct  682   ETEAN-TENAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRNRGFYQLNPENN  740

Query  2868  LLGLAWRLWGEGRGSELLDSVIA---SESHSEFV-DQVMRCIQVGLLCVQEKAEDRPNMA  3035
             LL  AW  W EGR  E++D VI    S   S F   +V++CIQ+GLLC+QE+AEDRP M+
Sbjct  741   LLSYAWSHWAEGRALEIVDPVIVDSFSSLPSTFQPKEVLKCIQIGLLCIQERAEDRPTMS  800

Query  3036  AVMLMLIGKGTSLPQPKQPGFCL-ASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             +V+ ML  + T +PQPK P +CL  S      SSS  + D    ++N+ T +++DAR
Sbjct  801   SVVWMLGSEATDIPQPKPPIYCLITSYYANNPSSSRQFEDDESWTVNKYTCSVIDAR  857



>ref|XP_009133539.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-6 
[Brassica rapa]
Length=842

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/826 (51%), Positives = 577/826 (70%), Gaps = 29/826 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+T+VS+ E+F+LGFF+   +S   Y+GIWYK+I  RT VWVANRD PL NS G L+I  
Sbjct  39    NKTIVSSREIFELGFFNLPSSSR-WYLGIWYKKIPTRTYVWVANRDNPLSNSNGTLRI-S  96

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             D N+ + D +G  +WS+ N          VA+LLD+GNFV+R  N+ + + +LWQSFD+ 
Sbjct  97    DNNLVIFDQSGTPVWST-NLTGGDAGSPLVAELLDNGNFVLRPSNNSDQDVFLWQSFDFL  155

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFLRNKDIIIYR  1274
             TDTLL  MKLGWD KTG NR++ SWR+P DPS GD + KL+   G PE +  NKD IIYR
Sbjct  156   TDTLLSEMKLGWDRKTGLNRHLRSWRNPDDPSSGDFSTKLETTRGFPEFYAWNKDEIIYR  215

Query  1275  SGGWNGVAF-SGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYT  1451
             SG W+G  F S V +M+P + +AF+F      V YS+ I   +++SR+I++ + LL+R+T
Sbjct  216   SGPWSGNRFGSDVLDMKPIDYLAFNFTADNEHVTYSYRITKPDVYSRVILSSSGLLQRFT  275

Query  1452  WIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
             W    + W + W  P+D CD+Y+ECG +G CD + SPVC C  GF+ RN Q       +G
Sbjct  276   WFETEQSWRQLWYLPRDLCDDYKECGDYGYCDLNTSPVCNCIQGFETRNNQ-------TG  328

Query  1632  GCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
             GC R   L C   DGF  +   KLP+++ + VD+ + L EC+E C+++C+CTA++N +I 
Sbjct  329   GCARKTRLSCGGKDGFARLKKMKLPDTTVTVVDSGVGLKECEERCLKDCNCTAFANMDIR  388

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             +GGSGCVIW  ++FDIR +   GGQ LYVR+AA+D              GK  K+I    
Sbjct  389   DGGSGCVIWKGDIFDIRNF-PNGGQDLYVRLAAADLVDKR---------GKRGKIIALSI  438

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
              V    ++ F +    + K +R +     +   + R  D LMN  AI+S+R  S E    
Sbjct  439   GVTIFLLLCFIIFRFWKNKQKRSIAIQTPIVD-QGRIEDSLMNELAITSRRYISRENKTD  497

Query  2169  DE-YELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             D+  EL + +F  +A+AT+NF+NANKLG+GGFG+VYKG L+ G+EIAVKRLSK S QG +
Sbjct  498   DDDLELSLMEFEVVALATNNFSNANKLGKGGFGTVYKGRLLDGKEIAVKRLSKMSLQGTD  557

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+L+GCC+D  EKMLIYEY+EN SLDS +FD  R S L+W+ R
Sbjct  558   EFKNEVKLIARLQHINLVRLIGCCIDKGEKMLIYEYLENLSLDSHIFDITRRSNLNWQMR  617

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++I  G+ARGL+YLH+DSRF IIHRDLKASNVLLDK M PKISDFGMAR+FG D+ EA  
Sbjct  618   FDITNGIARGLVYLHRDSRFMIIHRDLKASNVLLDKNMTPKISDFGMARIFGRDDAEA-N  676

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG+KN GFY  +++ NLL   W
Sbjct  677   TRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKKNNGFYNSNHDLNLLAFVW  736

Query  2886  RLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK  3062
             R W EG+  E+LD +I   S S     +++RCIQ+GLLCVQE+AEDRP MA+VM+M+  +
Sbjct  737   RKWKEGKWLEILDPIIIDSSSSTCQAHEILRCIQIGLLCVQERAEDRPVMASVMVMIGSE  796

Query  3063  GTSLPQPKQPGFCLASKPVKMDSSSTSY-NDQ-SLNQLTVTMLDAR  3194
               ++P+PK+PGFC+   P+++DSSS++  ND+ ++NQ+T++++DAR
Sbjct  797   TMAIPEPKRPGFCVGRNPLEIDSSSSTQGNDECTVNQVTLSVIDAR  842


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRL+GCCI+ GEKMLI       SLD+ +FD T+R+ LNW
Sbjct  570  QHINLVRLIGCCIDKGEKMLIYEYLENLSLDSHIFDITRRSNLNW  614



>emb|CDY23167.1| BnaA04g05920D [Brassica napus]
Length=816

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/826 (51%), Positives = 559/826 (68%), Gaps = 62/826 (8%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+T++S  E+F+LGFF+P  +S   Y+GIWYK++  RT VWVANRD PL +S+G L I  
Sbjct  46    NKTILSRSEIFELGFFNPPSSSR-WYLGIWYKKVSTRTYVWVANRDNPLLSSSGTLNIS-  103

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRR--ENDENPENYLWQSFD  1091
             D N+ + D +   +WS+ N  ++ V    VA+LLD+GNFV+R     + NP  +LWQSFD
Sbjct  104   DNNLVIFDQSDTPVWST-NLTDKEVRSPVVAELLDNGNFVLRHLNNTNNNPNGFLWQSFD  162

Query  1092  YPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIY  1271
             +PTDTLLP M+LGWD KTGR R++ SW++P DPS GD   KL   G PE ++ +KD IIY
Sbjct  163   FPTDTLLPEMRLGWDHKTGRERFLRSWKTPDDPSSGDFFTKLKTKGFPEFYVCSKDSIIY  222

Query  1272  RSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYT  1451
             RSG WNGV FS   E +P + I ++F  T  E                            
Sbjct  223   RSGPWNGVRFSSSAETKPLDYIIYNFTATNEES---------------------------  255

Query  1452  WIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
                    W + W +PKD CDNY+ECGS+G CD++ SP+C C  GF P N+Q W+LRD S 
Sbjct  256   -------WKQLWYSPKDLCDNYKECGSYGYCDSNTSPICNCIKGFGPGNEQPWTLRDDSA  308

Query  1632  GCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
             GC R   L C   DGF+ +   KLP+++ + VD  + L EC+E C+++C+CTA++N +I 
Sbjct  309   GCVRKTRLSCDGRDGFVRLKKMKLPDTTATTVDRGIGLKECEERCLKDCNCTAFANTDIR  368

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARG---GNGFGKTKKVIL  1979
             NGGSGCVIWT E+FDI+ + A+GGQ L+VR+AA+D E      R    G   G +  ++L
Sbjct  369   NGGSGCVIWTGEIFDIKNF-AKGGQDLFVRLAAADLEDKRTKKRNIILGLSIGVSILLLL  427

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
             +  I                        ++I +      S+D +MN   ISSKR  SG+ 
Sbjct  428   SFIIFRFWKRKQK---------------QSIAIPKPIVTSQDSIMNEVVISSKRHTSGD-  471

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
             M T++ ELP+ DF AIA AT NF+  NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG
Sbjct  472   MKTEDLELPLMDFEAIATATHNFSTTNKLGQGGFGIVYKGRLLDGKEIAVKRLSKMSLQG  531

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EFKNE+RLIARLQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFDKKR S L+W+
Sbjct  532   TDEFKNEVRLIARLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKKRRSNLNWQ  591

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
              R++I  G+ARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  DETEA
Sbjct  592   LRFDIANGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFRRDETEA  651

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               T+++VGTYGYMSPEYAM+G+FSVKSD FSFGVL+LE++SG+++ GFY  S + +LLG 
Sbjct  652   N-TRKVVGTYGYMSPEYAMNGIFSVKSDVFSFGVLLLEIISGKRSTGFYNSSGDLSLLGC  710

Query  2880  AWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              WR W E +G +++D +I   + S F + +++RC+ +GLLCVQE+AEDRP M++VM+ML 
Sbjct  711   VWRNWKERKGLDIIDPIIIDSASSTFKMHEILRCVHIGLLCVQERAEDRPAMSSVMVMLG  770

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
              + T+LP+PKQP FC+   P+  + S    ++ ++NQ+T++++DAR
Sbjct  771   SETTTLPEPKQPAFCVGRGPLGAELSKLGDDEWTVNQITLSVIDAR  816


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD  +R+ LNW
Sbjct  546  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKKRRSNLNW  590



>ref|XP_009115144.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Brassica rapa]
Length=887

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/853 (51%), Positives = 565/853 (66%), Gaps = 38/853 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ + T+VS   +F+LGFF    NSG  Y+GIWYK I  RT VWVANRD PL +  G LK
Sbjct  42    ISSHNTIVSPSHIFELGFFKLPSNSG-WYIGIWYKVISKRTYVWVANRDSPLSSPMGTLK  100

Query  909   IGEDGNIHLVD----GTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVR-----RENDEN  1061
             I  D N+ + D     T  S+WS+ N     V    +A+LLD+GN V+R       N+ N
Sbjct  101   IS-DNNLVIFDISNTTTPVSVWST-NLTRGDVKSPVIAELLDNGNLVLRDSNNNNNNNNN  158

Query  1062  PENYLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEA  1241
             P+  LWQSFD+PTDTLLP MKLGWD KTG NR + SWRSP DPS GD +FK++  G P+ 
Sbjct  159   PDGILWQSFDFPTDTLLPEMKLGWDRKTGFNRLLRSWRSPDDPSSGDYSFKMETKGFPQI  218

Query  1242  FLRNKDII-IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLI  1418
             FL   D   +YRS  WNGV FS  PEM+P   +  +F+ +  EV YSF+I   N++S   
Sbjct  219   FLWKSDSRRVYRSRPWNGVRFSDAPEMQPFNDLVLNFIVSNEEVTYSFQITKNNIYSIFT  278

Query  1419  VNYTQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRN  1598
             ++   LLER+TW      W++FW+APKDQCD Y+ CGS+  CD++ SPVC C  GF+P  
Sbjct  279   LSSKGLLERFTWNETEHNWHQFWHAPKDQCDQYKVCGSYSYCDSNKSPVCQCIKGFEPEP  338

Query  1599  QQ--AWSLRDGSGGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVR  1769
                  W L + SGGC R  +L C   DGF+ +   KLP+S  + VD  + + EC++ C++
Sbjct  339   MYPVVWGLGNRSGGCARQTQLSCDGRDGFVQLKNIKLPDSMEASVDRRIGVKECEDRCLK  398

Query  1770  NCSCTAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRV---AASDAEQTGEVAR  1940
             +C+CTA++N +I  GG GC+IWT EL DIR YT    Q LYVRV   AA+D +   + + 
Sbjct  399   DCTCTAFANRDIHRGGWGCMIWTGELVDIRSYTKTTSQDLYVRVVRQAAADQDDKSKKSA  458

Query  1941  G--GNGFGKTKKVILACgiv----------lgigmvlfgllllkrrklrrgVTENIEMRG  2084
                G+  G +  ++L+  I                V     L         ++  + + G
Sbjct  459   KVIGSSIGVSVLLVLSFIIYGFRKWKQKRPSIGKAVTTLSFLFFFCLKTLIISYILIVFG  518

Query  2085  TRER--SRDPLMNATAISSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGG  2258
               ++  S+D  M    +SS    S E   T++ ELP+ +F+A+A+ATDNF++ANKLGQGG
Sbjct  519   VSDQAGSQDLPMKEAVLSSMGHISRENK-TEDLELPLMEFDAVAIATDNFSDANKLGQGG  577

Query  2259  FGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKM  2438
             FG VYKG L+ G+EIAVKRLSK S QG +EF NE++LIARLQH NLV+LLGCCVD DEKM
Sbjct  578   FGIVYKGRLLEGKEIAVKRLSKTSVQGNDEFMNEVKLIARLQHVNLVRLLGCCVDKDEKM  637

Query  2439  LIYEYMENKSLDSILFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASN  2618
             LIYEY+EN S DS LFDK R S LDWK+R++I+ G+ARGLLYLHQDSR R+IHRDLKASN
Sbjct  638   LIYEYLENLSFDSHLFDKTRRSNLDWKKRFDIVNGIARGLLYLHQDSRLRVIHRDLKASN  697

Query  2619  VLLDKEMNPKISDFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFG  2798
             VLLDK+M PKISDFGMAR+FG DETEA  T+++VGTYGYMSPEYAM G FS+KSD FSFG
Sbjct  698   VLLDKDMTPKISDFGMARIFGRDETEAN-TRKVVGTYGYMSPEYAMYGKFSMKSDVFSFG  756

Query  2799  VLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEF-VDQVMR  2975
             VL+LE++SG++N  FY    + NLL   WR W EG+G E++D VI   S S F   +++R
Sbjct  757   VLLLEIISGKRNNSFYDSDRDLNLLSFVWRYWKEGKGLEIVDPVIVDWSSSTFRPHEILR  816

Query  2976  CIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ  3155
             CIQ+GLLCVQE+A+DRP M++V+LM   + T++PQPK PGFC    P   DS    Y   
Sbjct  817   CIQIGLLCVQERADDRPMMSSVVLMFGSETTAIPQPKTPGFCAGKSP--SDSKQREYRSW  874

Query  3156  SLNQLTVTMLDAR  3194
             ++NQ+T+++LDAR
Sbjct  875   TVNQITLSILDAR  887


 Score = 54.7 bits (130),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++  EKMLI       S D+ +FD T+R+ L+W K
Sbjct  619  QHVNLVRLLGCCVDKDEKMLIYEYLENLSFDSHLFDKTRRSNLDWKK  665



>ref|XP_010268959.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Nelumbo nucifera]
Length=848

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/837 (52%), Positives = 579/837 (69%), Gaps = 34/837 (4%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             QTLVS+ E F+LGFFSPG NS   Y+GIWY+ I + TIVWVANR+ P+ ++TG LKI ED
Sbjct  27    QTLVSSDESFELGFFSPG-NSKNRYLGIWYRNIPE-TIVWVANRNNPILDATGVLKITED  84

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNT---VAQLLDSGNFVVRRENDENPENYLWQSFD  1091
             GN+ L++ T +  WSS ++++ +        VAQLLDSGNFV+R E++ N E Y+WQSFD
Sbjct  85    GNLVLLNKTSSVFWSSISSSSTTAAAAAKSPVAQLLDSGNFVLRDESNGNSEMYVWQSFD  144

Query  1092  YPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIY  1271
             +P+DTLLPGMKLG + KT  +RY++SW+   DP+ GD ++ +DI+ LP+  +    I  Y
Sbjct  145   FPSDTLLPGMKLGLNFKTNLSRYMTSWKKADDPALGDFSYSIDISVLPQLVIWEGSIEKY  204

Query  1272  RSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYT  1451
             RSG WNGV FSGVP +    V    F+   +EVYY +E ++ +   R  +N +  L+R  
Sbjct  205   RSGPWNGVRFSGVP-VNTNAVFRPIFISDTDEVYYMYERNDDSTVMRFTLNPSGSLQRLV  263

Query  1452  WIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
             W  +   W+  +  P++ CD Y +CG+ G+C  +  P+C C  GF P+    W+L + S 
Sbjct  264   WNKQRLAWDLLYEVPQEPCDRYDQCGANGLCKLNYWPICDCLKGFTPKLPGDWNLLNWSA  323

Query  1632  GCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
             GC R   LDC   +GF  ++  KLP+   S+V+ TM+L EC+  C+ +CSC AY+   +S
Sbjct  324   GCVRRTPLDCRKGEGFAKISGVKLPDLLQSWVNETMNLKECEVHCLNSCSCVAYARRYVS  383

Query  1809  NGGSGCVIWTAELFDIRQYTAEGG-QLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
              GG GC++W  +L DIR++  E G Q LYVR+A+S+    G+++       K K+V++  
Sbjct  384   EGGCGCILWFGDLTDIREFNEENGEQDLYVRMASSEMGGEGKMS------DKNKRVVVIV  437

Query  1986  givlgigmvlfgllllkrrklrrgVT------------ENIEMRG-TRERSRD-PLMNAT  2123
              +V  +G  +  L L    K ++  +               E RG  RE+S+D  ++   
Sbjct  438   SLVAFLGTSVLALSLYLLWKSKKITSLWKRNTVHPVLRRKTEDRGINREKSKDLQMLFDM  497

Query  2124  AISSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEI  2303
              I S R+H  E    D+ EL +FDF+ IA ATDNF+N   LG+GGFG VYKG LV G+EI
Sbjct  498   VIPSARDHLDENF-NDDTELLLFDFDTIANATDNFSNTKMLGKGGFGCVYKGDLVDGQEI  556

Query  2304  AVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSIL  2483
             AVKRL KNS QGAEEFKNE+RLIA+LQHRNLV+LLGCC+  +EKMLIYEYM NKSL+SI+
Sbjct  557   AVKRLGKNSEQGAEEFKNEVRLIAKLQHRNLVRLLGCCISREEKMLIYEYMRNKSLNSII  616

Query  2484  FDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFG  2663
             FDK +S++LDW++R++II G+ARGLLYLHQDSRFRI+HRDLKASNVLLD EMNPKISDFG
Sbjct  617   FDKTKSTILDWQKRFDIIGGIARGLLYLHQDSRFRIVHRDLKASNVLLDGEMNPKISDFG  676

Query  2664  MARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGF  2843
             MAR+FG D+TEA  T+RIVGTYGYMSPEYAMDGLFSVKSD FSFGVLVLE++SG KN GF
Sbjct  677   MARIFGEDQTEA-NTRRIVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIISGNKNTGF  735

Query  2844  YTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDR  3023
             YT S + NLLG AWRLW EG+  EL+DS I    HS   ++V RCI+VGLLCVQE AEDR
Sbjct  736   YTHS-QHNLLGHAWRLWREGKALELVDSSIG---HSYNANEVFRCIKVGLLCVQEHAEDR  791

Query  3024  PNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             P M++V+LML  +  +LPQPK+PGFCL     + DSSS      S+NQ+TVT+L+AR
Sbjct  792   PIMSSVVLMLSSETATLPQPKEPGFCLGRNFNETDSSSGKQEPYSVNQVTVTLLEAR  848


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCCI   EKMLI      KSL++ +FD TK   L+W K
Sbjct  583  QHRNLVRLLGCCISREEKMLIYEYMRNKSLNSIIFDKTKSTILDWQK  629



>ref|XP_010910454.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Elaeis guineensis]
Length=824

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/828 (52%), Positives = 571/828 (69%), Gaps = 37/828 (4%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG  899
             N PL  N+TL+S+G  F LGFFSP  NS   Y+GIWY EI  +TIVWVANR+ P+  STG
Sbjct  31    NQPLADNETLISSGGRFALGFFSPS-NSRNRYIGIWYDEIPIQTIVWVANRENPITESTG  89

Query  900   -FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYL  1076
               L I  +G++ +       +WS++ T       N VAQLLD  NFVV+ E+  +  ++ 
Sbjct  90    GSLSIATNGSLIISTENSTVVWSTAATG----LSNPVAQLLDDANFVVKEESSTDSNSFA  145

Query  1077  WQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNK  1256
             WQSFD+PTDTLLPGMKLG D  +G NR +++W+S +DPS G+    +DI+G PE FL + 
Sbjct  146   WQSFDHPTDTLLPGMKLGVDLTSGLNRNLTAWKSSSDPSPGEYCNAMDIDGDPELFLWDG  205

Query  1257  DIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQL  1436
                ++R+G WNG  FSG+P     +   FSF+  K EV YS++I N++L SRL+VN + +
Sbjct  206   TRKLWRTGPWNGQHFSGIPGTTTYQGFIFSFVNNKEEVTYSYDIVNQSLVSRLVVNESGV  265

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
             L+R  W+  N  WN FW AP DQCD    CG +G CD + SP+C C  GF P++   W L
Sbjct  266   LQRSVWLAGNGGWNIFWFAPMDQCDPLSTCGPYGACDPNNSPICECLQGFTPKSPANWEL  325

Query  1617  RDGSGGCFRYDELDCP--TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAY  1790
             RDGS GC R  +LDC   TDGF++++  KLP++S   VD +M+LDECK MC++NCSCTAY
Sbjct  326   RDGSDGCVRKTKLDCKNGTDGFVTVSRVKLPDTSNCSVDMSMNLDECKAMCLKNCSCTAY  385

Query  1791  SNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKK  1970
             +   I  GGSGC++W +EL DIR YT + GQ LYVR+AA+D      +A   +G G    
Sbjct  386   AGAIIGGGGSGCIMWLSELTDIRLYT-DSGQDLYVRLAAAD------IAAQSHGSGHAPI  438

Query  1971  VILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHS  2150
              I+   +++ + +V  G                      R++ R  ++ AT++S +   S
Sbjct  439   AIIVVLVLVVLLLVCVGF-----------------FLWRRKKRRRVMLGATSLSDQ-NIS  480

Query  2151  GETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNS  2330
              E    D+ ELP+F+   +A ATDNF+  NKLG+GGFG VYKG L  G+EIAVKRL+K S
Sbjct  481   EEHFEGDDLELPLFELGNVAAATDNFSILNKLGEGGFGPVYKGKLGDGQEIAVKRLAKTS  540

Query  2331  RQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLL  2510
              QG +EFKNE+ LIA+LQHRNLV+L+GCC+  +E+MLIYEYM NKSLD+ LFDK++S+LL
Sbjct  541   VQGLDEFKNEVVLIAKLQHRNLVRLVGCCIQGEERMLIYEYMVNKSLDAFLFDKEKSALL  600

Query  2511  DWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDE  2690
             +W+ RY+II G+ARGL+YLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMAR+FGGDE
Sbjct  601   NWQTRYHIIVGIARGLVYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDE  660

Query  2691  TEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENL  2870
             TE   T+R+VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE++SG+KN+G Y  S+  NL
Sbjct  661   TEV-NTRRVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIISGKKNRGVYAHSSHLNL  719

Query  2871  LGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLM  3050
             L  AW LW E +  +L+D    S  +S   ++V++CI+VGLLCVQE+ EDRP M++V+LM
Sbjct  720   LAHAWSLWNEEKSLQLVDE---SLGYSFPANEVIKCIKVGLLCVQERPEDRPLMSSVVLM  776

Query  3051  LIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             L     ++P P+QPGF     P++++SSS+  +  +LN ++VTML  R
Sbjct  777   LGSDSAAIPNPRQPGFGTRRIPLEVESSSSKQDSCTLNSMSVTMLQGR  824


 Score = 63.5 bits (153),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRL+GCCI+G E+MLI      KSLD F+FD  K A LNW
Sbjct  558  QHRNLVRLVGCCIQGEERMLIYEYMVNKSLDAFLFDKEKSALLNW  602



>ref|XP_010644282.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Vitis vinifera]
Length=1162

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/820 (52%), Positives = 574/820 (70%), Gaps = 30/820 (4%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             +T+VSAG  F+LGFFSPG +S   Y+GIWYK+I   T+VWVA+RD PL +S+G LK+ E 
Sbjct  371   ETIVSAGGDFELGFFSPG-SSENRYLGIWYKKISTGTVVWVADRDVPLNDSSGILKLDER  429

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             G + L++    +IWSS+++ +   P   VAQLLD+GN VVR END +PEN+LWQSFDYP 
Sbjct  430   GTLVLLNKANMTIWSSNSSRSVQSP---VAQLLDTGNLVVRNENDSDPENFLWQSFDYPG  486

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DT LPGMK G +  TG + Y++SW+S  DPS GD T +LD  G P+ FL+   ++ +RSG
Sbjct  487   DTFLPGMKYGKNLITGLDSYLTSWKSTDDPSTGDFTNRLDPRGFPQMFLKEGSVVTFRSG  546

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ FSG+P ++P  +  F F+  + E+YY++E+ N ++ +R++++   +L+ YTWI 
Sbjct  547   PWNGLRFSGMPNLKPNSIYTFHFVLNQKEIYYTYELINSSVVTRMVLSPNGVLQDYTWID  606

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
               + W  +  A  D CD Y  CG++G CD + SP CGC  GF P++   W++ D SGGC 
Sbjct  607   RRQGWLLYLTAQMDNCDRYALCGAYGSCDINNSPACGCLKGFVPKHPNDWNVADWSGGCV  666

Query  1641  RYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGG  1817
             R   L+C   DGFL     KLP++  S+ + TM+L ECK  C++NC+CTAY+N +I NGG
Sbjct  667   RRTRLNCQNGDGFLKYPGVKLPDTQDSWFNMTMNLKECKMKCLKNCNCTAYANSDIRNGG  726

Query  1818  SGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivl  1997
             SGCV+W   L DIR+Y  E GQ LYVR+AAS+ E+              KK++    I +
Sbjct  727   SGCVLWFGNLIDIREYN-ENGQDLYVRMAASELEEYES--------SDQKKLVKIIVIPI  777

Query  1998  gigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEY  2177
             G+  ++  ++ +    L+R   +     G      +P         +R+H+ E+   ++ 
Sbjct  778   GLAGLILLVIFVILHVLKRKRLKKKAPLGEVTMGHNP---------ERDHTNESE-KEDL  827

Query  2178  ELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKN  2357
             ELP+FDF+ IA ATDNF+ +NKLGQGGFG VYKGML GG+EIAVKRLSKNSRQG +EFKN
Sbjct  828   ELPLFDFDTIAEATDNFSRSNKLGQGGFGPVYKGMLRGGQEIAVKRLSKNSRQGLDEFKN  887

Query  2358  ELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNII  2537
             E+  IA+LQHRNLVKLLG C+  +EKMLIYEYM NKSL+S +FD+ +S LLDW +R++II
Sbjct  888   EVLCIAKLQHRNLVKLLGYCIQYEEKMLIYEYMPNKSLNSFIFDQTQSMLLDWPKRFHII  947

Query  2538  CGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRI  2717
              G+ARGLLYLHQDSR RIIHRDLKASN+LLD+EMNPKISDFGMAR F  +ETEA TT R+
Sbjct  948   KGIARGLLYLHQDSRLRIIHRDLKASNILLDQEMNPKISDFGMARSFEENETEANTT-RV  1006

Query  2718  VGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWG  2897
             VGTYGYMSPEYA+DGLFSVKSD +SFGVLVLE+VSG++N+GF  P +  NLLG AWRL+ 
Sbjct  1007  VGTYGYMSPEYAVDGLFSVKSDVYSFGVLVLEIVSGKRNRGFCDPDHHLNLLGHAWRLYR  1066

Query  2898  EGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLP  3077
             +GR  EL D+ I    +     +V++ I VGLLCVQ+  +DRP+M++V++ML G   +LP
Sbjct  1067  KGRSIELTDASIQQSCNPL---EVLQSIHVGLLCVQQSPDDRPSMSSVVMML-GSEIALP  1122

Query  3078  QPKQPGFCLASKPVK-MDSSSTSYNDQSLNQLTVTMLDAR  3194
             QP++PGF +A + ++  DSSS  Y   S+N +TVT L AR
Sbjct  1123  QPREPGFFVARRMIEAADSSSGIYEPCSVNDITVTFLAAR  1162


 Score =   400 bits (1027),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 198/309 (64%), Positives = 244/309 (79%), Gaps = 5/309 (2%)
 Frame = +3

Query  2172  EYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEF  2351
             + ELP+FD   I  AT+NF+  NKLG+GGFG VYKG+L  G+E+AVKRLSK+SRQG  EF
Sbjct  41    DLELPLFDLATILNATNNFSIENKLGEGGFGPVYKGLLQQGQEVAVKRLSKDSRQGLIEF  100

Query  2352  KNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYN  2531
             K E+  IA LQHRNLVKLLGCC+   EKMLIYEYM NKSL+S +FDK+RS  LDW +R+ 
Sbjct  101   KTEVIHIANLQHRNLVKLLGCCIHGQEKMLIYEYMSNKSLESFIFDKRRSKELDWPKRFL  160

Query  2532  IICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTK  2711
             II G+ARGLLYLHQDSR RIIHRDLKA N+LLD EM PKISDFG+AR FGG+ETEA TTK
Sbjct  161   IINGIARGLLYLHQDSRLRIIHRDLKADNILLDSEMGPKISDFGIARSFGGNETEANTTK  220

Query  2712  RIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRL  2891
              +VGT GY+SPEYA +GL+SVKSD FSFGV+VLE+VSG++N+GF  P +  NLLG AW L
Sbjct  221   -VVGTLGYISPEYASEGLYSVKSDVFSFGVMVLEIVSGKRNRGFSHPDHRLNLLGHAWTL  279

Query  2892  WGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTS  3071
             + EGR  EL+D+++          +V+R I VGLLCVQ  A+DRP+M++V+LML  +  +
Sbjct  280   YTEGRYLELMDAMVGDTFQPS---EVLRSIHVGLLCVQHCADDRPSMSSVVLMLSSE-VA  335

Query  3072  LPQPKQPGF  3098
             LPQP++PGF
Sbjct  336   LPQPREPGF  344


 Score = 58.5 bits (140),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCCI G EKMLI      KSL++F+FD  +   L+W K
Sbjct  111  QHRNLVKLLGCCIHGQEKMLIYEYMSNKSLESFIFDKRRSKELDWPK  157



>dbj|BAA34233.1| SRK23Bol [Brassica oleracea]
Length=846

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/835 (52%), Positives = 567/835 (68%), Gaps = 33/835 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFF-SPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFL  905
             ++ N+TLVS G +F+LGFF +P  +S   Y+G+WYK++ DRT VWVANRD PL NS G L
Sbjct  32    ISSNRTLVSPGNIFELGFFRTP--SSSRWYLGMWYKKVSDRTYVWVANRDNPLSNSIGTL  89

Query  906   KIGEDGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQ  1082
             KI  + N+ L+D +  S+WS+++T  N+  P   VA+LL +GNFV+R  N+ +   +LWQ
Sbjct  90    KIS-NMNLVLIDHSNKSVWSTNHTRGNERSP--VVAELLANGNFVMRDSNNNDASGFLWQ  146

Query  1083  SFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFL-RNK  1256
             SFDYPTDTLLP MKLG+D +TG NR+++SWR+  DPS GD ++KLD   GLPE +L +  
Sbjct  147   SFDYPTDTLLPEMKLGYDLRTGLNRFLTSWRNSDDPSSGDFSYKLDTQRGLPEFYLWKES  206

Query  1257  DIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQL  1436
             + +++RSG WNGV FSG+PE +    + ++F +   EV Y+F + N +++SRL ++ +  
Sbjct  207   NFLVHRSGPWNGVGFSGMPEDQKLSYMVYNFTQNSEEVAYTFLMTNNSIYSRLTISSSGY  266

Query  1437  LERYTWIPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWS  1613
              ER TW P +  WN FW++P+D +CD Y+ CG++  CD + SPVC C  GF P N Q W 
Sbjct  267   FERLTWNPSSETWNVFWSSPEDLRCDVYKICGAYSYCDVNTSPVCNCIQGFDPWNVQEWD  326

Query  1614  LRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYS  1793
             LR  SGGC R   L C  DGF  M   KLPE++ + VD ++SL ECK+ C+ +C+CTA++
Sbjct  327   LRAWSGGCIRRTRLSCSGDGFTRMKNMKLPETTMAIVDRSISLKECKKRCLSDCNCTAFA  386

Query  1794  NYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKV  1973
             N +I NGGSGCVIWT  L DIR Y    GQ LYVR+AA+D      + +  N  GK   +
Sbjct  387   NTDIRNGGSGCVIWTELLEDIRTYFT-NGQDLYVRLAAAD------LVKKRNANGKIISL  439

Query  1974  ILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSG  2153
             I+    +L + M        KR K       N      RERS++  M    +SSK + SG
Sbjct  440   IVGVSGLLLLIMFCIWKTKQKRVKGSAISIAN------RERSQNLPMTGMVLSSKTQLSG  493

Query  2154  ETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSR  2333
                I +     I     +  AT+NF+N NKLGQGGFG VYKG L+ G+EIAVKRLSK S 
Sbjct  494   VNQIEELELPLIEL-EVVIKATENFSNCNKLGQGGFGIVYKGTLIDGQEIAVKRLSKTSI  552

Query  2334  QGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLD  2513
             QG +EF NE+ LIARLQH NLV++ GCC++ DEKMLIYEY+EN SLDS +F   RS+ L+
Sbjct  553   QGTDEFMNEVTLIARLQHINLVQIHGCCIEADEKMLIYEYLENLSLDSYIFGNPRSTKLN  612

Query  2514  WKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDET  2693
             WK R++II GVARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  DET
Sbjct  613   WKERFDIINGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDET  672

Query  2694  EAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLL  2873
             EA T K +VGTYGYMSPEYAM G+FS KSD FSFGV+VLE+V+G++N+GFY  S E +LL
Sbjct  673   EANTMK-VVGTYGYMSPEYAMGGIFSEKSDVFSFGVIVLEIVTGKRNRGFYNLSYEYSLL  731

Query  2874  GLAWRLWGEGRGSELLDSVIA---SESHSEFVDQ-VMRCIQVGLLCVQEKAEDRPNMAAV  3041
               AW  W EGR  E++DSV+    S   S F  Q V++CIQ+GLLCVQE AE RP M++V
Sbjct  732   SYAWSNWKEGRALEIVDSVLVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSV  791

Query  3042  MLMLIGKGTSLPQPKQPGFCLASKPVKMD-SSSTSYNDQ---SLNQLTVTMLDAR  3194
             + ML  + T +P PK PG C+   P ++D SSS  Y D    ++NQ T +++DAR
Sbjct  792   VWMLGSEATEIPHPKPPGNCVGRSPYELDPSSSRQYEDDESWTVNQYTCSVIDAR  846



>dbj|BAA83905.1| SRK13 [Brassica oleracea]
Length=854

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/831 (51%), Positives = 569/831 (68%), Gaps = 28/831 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+TLVS G VF+LGFF    +S   Y+GIWYK+   RT VWVANRD PL N  G LK
Sbjct  43    ISSNRTLVSPGNVFELGFFKTTSSSR-WYLGIWYKKFPYRTYVWVANRDNPLSNDIGTLK  101

Query  909   IGEDGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
             I  + N+ L+D +  S+WS++ T  N+  P   VA+LLD+GNFV+R  N  N   +LWQS
Sbjct  102   ISGN-NLVLLDHSNKSVWSTNVTRGNERSP--VVAELLDNGNFVMRDSNSNNASQFLWQS  158

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FDYPTDTLLP MKLG+D KTG NR+++SWRS  DPS GD ++KL+   LPE +L   +I 
Sbjct  159   FDYPTDTLLPEMKLGYDLKTGLNRFLTSWRSSDDPSSGDYSYKLEPGRLPEFYLWKGNIR  218

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
              +RSG W+G+ FSG+PE +    + ++F   + EV Y+F++ N + +S L ++ T   +R
Sbjct  219   THRSGPWSGIQFSGIPEDQRLSYMVYNFTENREEVAYTFQMTNNSFYSILTISSTGYFQR  278

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
              TW P + +WN FW++P  QCD YR CG +  CD + SP C C  GF P N Q W+LR  
Sbjct  279   LTWAPSSVVWNVFWSSPNHQCDMYRICGPYTYCDVNTSPSCNCIQGFNPENVQQWALRIP  338

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
               GC R   L C  DGF  M   KLP+++ + VD ++ + ECK+ C+ +C+CTA++N +I
Sbjct  339   ISGCKRRTRLSCNGDGFTRMKNMKLPDTTMAIVDRSIGVKECKKRCLGDCNCTAFANADI  398

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
              NGG+GCVIWT EL DIR Y A+GGQ LYVR+AA+D  +     R  N     K +I+  
Sbjct  399   RNGGTGCVIWTGELADIRNY-ADGGQDLYVRLAAADLVK----KRDANW----KIIIVGV  449

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              +VL + +++   L  +++   + +  +I     ++R+++ LMN    S+KR+ S E   
Sbjct  450   SVVLLLLLLIMFCLWKRKQNRAKAMATSIV---NQQRNQNVLMNGMTQSNKRQLSRENK-  505

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T+E+ELP+ +  A+  AT+NF+N N+LGQGGFG VYKGML  G+E+AVKRLSK S QG +
Sbjct  506   TEEFELPLIELEAVVKATENFSNCNELGQGGFGIVYKGML-DGQEVAVKRLSKTSLQGID  564

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EF NE+RLIARLQH NLV++LGCC++ DEK+LIYEY+EN SLD  LF KKRSS L+WK R
Sbjct  565   EFMNEVRLIARLQHINLVRILGCCIEADEKILIYEYLENSSLDYFLFGKKRSSNLNWKDR  624

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             + I  GVARGLLYLHQDSRFRIIHRDLK  N+LLDK M PKISDFGMAR+F  DET+A  
Sbjct  625   FAITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKISDFGMARIFARDETQA-M  683

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T   VGTYGYMSPEYAMDG+ S K+D FSFGV+VLE+VSG++N+GFY  + E NLL  AW
Sbjct  684   TDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRNRGFYQVNPENNLLSYAW  743

Query  2886  RLWGEGRGSELLDSVIA---SESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLML  3053
               W EGR  E++D VI    S   S F   +V++CIQ+GLLC+QE+AE RP M++V+ ML
Sbjct  744   SHWAEGRALEIVDPVIVDSLSSLPSTFQPKEVLKCIQIGLLCIQERAEHRPTMSSVVWML  803

Query  3054  IGKGTSLPQPKQPGFCL-ASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
               + T +PQPK P +CL AS      SSS  ++D    ++N+ T +++DAR
Sbjct  804   GSEATEIPQPKPPVYCLIASYYANNPSSSRQFDDDESWTVNKYTCSVIDAR  854



>ref|XP_010062923.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
Length=838

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/860 (50%), Positives = 576/860 (67%), Gaps = 35/860 (4%)
 Frame = +3

Query  618   FFLSSIQTPLVAKQSCRWPESGTADDIL**GPPWNPPLTLNQTLVSAGEVFQLGFFSPGG  797
             F + S +  L++   C +  S   D I       N  +    T+VS+G  F+LGFFSPG 
Sbjct  13    FMVGSTKFILLSTLCCIFVASAALDTI-----AENQSIRDGDTIVSSGGNFELGFFSPG-  66

Query  798   NSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGEDGNIHLVDGTGNSIWSSSNT  977
              SG  Y GIWYK+I   T+VWVANRD PL +S+G +KI +   + +  G   ++WSS+++
Sbjct  67    KSGLRYFGIWYKKISYGTVVWVANRDLPLNDSSGVVKIVDPAVLTIFSGDNRTVWSSNSS  126

Query  978   NNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPTDTLLPGMKLGWDSKTGRNR  1157
                +  G  VAQLLDSGNFV+R END +P  YLWQSFDYP +T LPGMK G D +TGRNR
Sbjct  127   --LAATGAVVAQLLDSGNFVLRPENDTDPSKYLWQSFDYPGNTFLPGMKYGIDLRTGRNR  184

Query  1158  YISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSGGWNGVAFSGVPEMEPKEVI  1337
              ++SW+SP DPS GD T  +D +G+P+ FLR    I +RSG WNG+ FSG+P ++P  + 
Sbjct  185   ILTSWKSPNDPSTGDYTNGMDPSGVPQFFLRKDSTITFRSGPWNGLRFSGMPNLKPNPIY  244

Query  1338  AFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIPENRIWNRFWNAPKDQCDNY  1517
              F F+ TK EVYY++ + + ++ SR++++   +L+R+TWI   + WN +  A  D CD Y
Sbjct  245   NFKFVFTKEEVYYTYNLTDSSVVSRMVLDPYGVLQRFTWIDRTQGWNLYLTAQMDNCDRY  304

Query  1518  RECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCFRYDELDCPT-DGFLSMNYT  1694
               CG++G CD + SP CGC  GF P+  Q W++ D SGGC R   LDC   +GFL  +  
Sbjct  305   ALCGAYGSCDINNSPACGCLKGFVPKYPQYWAMSDWSGGCVRKTPLDCQQGEGFLKYSGV  364

Query  1695  KLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGSGCVIWTAELFDIRQYTAE  1874
             KLP++  S+ + TM+L EC+++C  NCSCTAYSN +I+  G+GC++W   L DIR Y A+
Sbjct  365   KLPDTQHSWYNKTMNLQECEKVCSENCSCTAYSNMDITGSGTGCILWFDGLIDIRNY-AD  423

Query  1875  GGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlgigmvlfgllllkrrklrr  2054
              GQ +Y+R+AAS      E+A   +  G+ +   +A  +  G  +++   L+L   K RR
Sbjct  424   NGQDIYIRLAAS------ELAAYRSSKGRKRVQNIAIPVSCGGLLLIGLCLILNISKKRR  477

Query  2055  gVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEYELPIFDFNAIAMATDNFAN  2234
                ++ E  G ++  +D        + + E++       + ELP+++F+ I  AT +F+ 
Sbjct  478   KKRKSREEVGMQKPEQDG-------TKQNENT-------DLELPLYEFDTIITATSHFSI  523

Query  2235  ANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGC  2414
              NKLGQGGFG VYKG+L  G+EIAVKRLSK+SRQG  EFKNE+  IA+LQHRNLVKLLGC
Sbjct  524   ENKLGQGGFGPVYKGLLEDGKEIAVKRLSKSSRQGLREFKNEVLCIAKLQHRNLVKLLGC  583

Query  2415  CVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRII  2594
             C+  +E+MLIYEYM NKSLDS +FD+KR +LLDW++R+ II G+ARGLLYLHQDSR RII
Sbjct  584   CIQEEERMLIYEYMPNKSLDSFIFDQKRRTLLDWQKRFQIINGIARGLLYLHQDSRLRII  643

Query  2595  HRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSV  2774
             HRDLKASN+LLD EMNPKISDFGMAR FGGDE E G T R+VGTYGYM PEYA+DGLFSV
Sbjct  644   HRDLKASNILLDHEMNPKISDFGMARSFGGDECE-GNTNRVVGTYGYMPPEYAIDGLFSV  702

Query  2775  KSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSE  2954
             KSD FSFGVLVLE+VSG +N+ F  P ++ NLLG AWRL  E +  EL+D  IA ES  E
Sbjct  703   KSDVFSFGVLVLEIVSGTRNRKFSHPDHKLNLLGHAWRLSKEMKSCELIDPSIA-ESCVE  761

Query  2955  FVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSS  3134
                +V+R I V LLCVQ+  +DRPNM+ V+L+L     +LP PK+PGF        MD S
Sbjct  762   --SEVLRSIHVALLCVQQSPDDRPNMSTVVLLL-SSDIALPPPKEPGFFNERDVSDMDYS  818

Query  3135  STSYNDQSLNQLTVTMLDAR  3194
             S   +  S N +TVT+L+ R
Sbjct  819   SNKQDLSSSNTITVTLLEGR  838


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCCI+  E+MLI      KSLD+F+FD  +R  L+W K
Sbjct  573  QHRNLVKLLGCCIQEEERMLIYEYMPNKSLDSFIFDQKRRTLLDWQK  619



>gb|AAA33008.1| serine/threonine kinase receptor [Brassica napus]
 emb|CAB89179.1| S-locus receptor kinase [Brassica napus var. napus]
Length=858

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/831 (51%), Positives = 568/831 (68%), Gaps = 32/831 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G VF+LGFF    +S   Y+GIWYK +  +T VWVANRD PL +S G LKI  
Sbjct  48    NRTLVSPGNVFELGFFRTTSSSR-WYLGIWYKNLPYKTYVWVANRDNPLSDSIGTLKIS-  105

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ L+D +  S+WS++ T  N+  P   VA+LL++GNFV+R  N+ N   +LWQSFD+
Sbjct  106   NMNLVLLDHSNKSVWSTNLTRGNERSP--VVAELLENGNFVIRYSNNNNASGFLWQSFDF  163

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFLRNKDIIIY  1271
             PTDTLLP MKLG+D K G NR++++WR+  DPS G+I+++LD   G+PE +L    +  Y
Sbjct  164   PTDTLLPEMKLGYDRKKGLNRFLTAWRNSDDPSSGEISYQLDTQRGMPEFYLLKNGVRGY  223

Query  1272  RSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYT  1451
             RSG WNGV F+G+PE +    + ++F     E  Y+F + +K+++SRLI++  + L R T
Sbjct  224   RSGPWNGVRFNGIPEDQKLSYMVYNFTDNSEEAAYTFRMTDKSIYSRLIISNDEYLARLT  283

Query  1452  WIPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             + P +  WN FW +P++ +CD Y+ CGS+  CD + SPVC C  GFKP N Q W LR  +
Sbjct  284   FTPTSWEWNLFWTSPEEPECDVYKTCGSYAYCDVNTSPVCNCIQGFKPFNMQQWELRVWA  343

Query  1629  GGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
             GGC R   L C  DGF  M   KLPE++ + VD ++   ECK+ C+ +C+CTA++N +I 
Sbjct  344   GGCIRRTRLSCNGDGFTRMKNMKLPETTMAIVDRSIGRKECKKRCLSDCNCTAFANADIR  403

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVIL-AC  1985
             NGGSGCVIWT EL DIR Y  + GQ LYVR+AA+D      + +  N  GKT  +I+  C
Sbjct  404   NGGSGCVIWTGELEDIRNY-FDDGQDLYVRLAAAD------LVKKRNANGKTIALIVGVC  456

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              ++L I   L+     + +     +         R+R++D LMN   +SSKR+   E   
Sbjct  457   VLLLMIMFCLWKRKQKRAKTTATSIVN-------RQRNQDLLMNGMILSSKRQLPIENK-  508

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T+E ELP+ +  A+  AT+NF+N NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG  
Sbjct  509   TEELELPLIELEAVVKATENFSNCNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGTG  568

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EF NE+RLIARLQH NLV++LGCC++ DEKML+YEY+EN SLDS LF  KRSS L+WK R
Sbjct  569   EFMNEVRLIARLQHINLVRILGCCIEADEKMLVYEYLENLSLDSYLFGNKRSSTLNWKDR  628

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             +NI  GVARGLLYLHQDSRFRIIHRD+K SN+LLDK M PKISDFGMAR+F  DETEA  
Sbjct  629   FNITNGVARGLLYLHQDSRFRIIHRDMKVSNILLDKNMTPKISDFGMARIFARDETEAN-  687

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS KSD FSFGV+VLE+VSG++N+GFY  ++E NLL   W
Sbjct  688   TRKVVGTYGYMSPEYAMDGVFSEKSDVFSFGVIVLEIVSGKRNRGFYNLNHENNLLSYVW  747

Query  2886  RLWGEGRGSELLDSVIASESHSEFV----DQVMRCIQVGLLCVQEKAEDRPNMAAVMLML  3053
               W EGR  E++D VI     S        +V++CIQ+GLLCVQE+AE RP M++V+ ML
Sbjct  748   SHWTEGRALEIVDPVIVDSLSSLPATFQPKEVLKCIQIGLLCVQERAEHRPTMSSVVWML  807

Query  3054  IGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ----SLNQLTVTMLDAR  3194
               + T +PQP  PG+ L   P + + SS+ + D     ++NQ T + +DAR
Sbjct  808   GSEATEIPQPTPPGYSLGRSPYENNPSSSRHCDDDESWTVNQYTCSDIDAR  858



>dbj|BAB40986.1| SRKa [Arabidopsis lyrata]
Length=847

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/828 (50%), Positives = 565/828 (68%), Gaps = 25/828 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS G+VF+LGFF+  G+S   Y+GIWYK+I ++T VWVANRD P+  STG LK
Sbjct  39    ISSNKTIVSLGDVFELGFFTILGDS--WYLGIWYKKIPEKTYVWVANRDNPISTSTGILK  96

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  + N+ L++     +WS++ T     P   VA+LLD+GNFV+R       + +LWQSF
Sbjct  97    IS-NANLVLLNHFDTPVWSTNLTAEVKSP--VVAELLDNGNFVLRDSKTNGSDEFLWQSF  153

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLG D K   N+++ SW+S  D S GD  FK++  GLPE F+   D  +
Sbjct  154   DFPTDTLLPQMKLGLDHKKRLNKFLRSWKSSFDMSSGDYLFKIETLGLPEFFIWMSDFRV  213

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             +RSG WNG+ FSG+ EM+  + I ++    K EV ++F   + NL+SRL +NY  LL+++
Sbjct  214   FRSGPWNGIRFSGMLEMQKWDDIIYNLTENKEEVAFTFRPTDHNLYSRLTINYAGLLQQF  273

Query  1449  TWIPENRIWNRFWNAPKDQ-CDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             TW P  + WN  W+   D  C+ Y  CG +  CD   SP+C C  GFKPRN Q W+L D 
Sbjct  274   TWDPIYKEWNMLWSTSTDNACETYNPCGPYAYCDMSTSPMCNCVEGFKPRNPQEWALGDV  333

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              G C R   L+C  DGF  +   KLP+++ + +D  +   +CKE C + C+CTA++N +I
Sbjct  334   RGRCQRTTPLNCGRDGFTQLRKIKLPDTTAAILDKRIGFKDCKERCAKTCNCTAFANTDI  393

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
              NGGSGCVIW     DIR Y A+G Q LYVRVAA++      ++      G+   +I+  
Sbjct  394   RNGGSGCVIWIGRFVDIRNYAADG-QDLYVRVAAANIGDRKHIS------GQIIGLIVGV  446

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              ++L +  +++     K+++ R     N+     RER++  L N   ISS R   GE   
Sbjct  447   SLLLLVSFIMYWFWKKKQKQARATAAPNV----YRERTQH-LTNGVVISSGRHLFGENK-  500

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T+E ELP+ +F A+ MATDNF+++N LGQGGFG VY G L  G+EIAVKRLS  S QG  
Sbjct  501   TEELELPLTEFEAVVMATDNFSDSNILGQGGFGVVYMGRLPDGQEIAVKRLSMVSLQGVN  560

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+L  CC+  DEK+LIYEY+EN SLDS LF K +SS L+W++R
Sbjct  561   EFKNEVKLIARLQHINLVRLFSCCIYADEKILIYEYLENGSLDSHLFKKVQSSKLNWQKR  620

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             +NII G+ARGLLYLHQDSRF+IIHRDLKASNVLLDK+M PKISDFGMAR+F  +ETEA +
Sbjct  621   FNIINGIARGLLYLHQDSRFKIIHRDLKASNVLLDKDMTPKISDFGMARIFEREETEA-S  679

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             TK++VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE+VSG++N+GFY  + + NLL   W
Sbjct  680   TKKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSGKRNRGFYNSNQDNNLLSYTW  739

Query  2886  RLWGEGRGSELLDSVIA--SESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
               W EG+  E+ D +I   S S S F   +V+RC+Q+GLLCVQE+AEDRP M++V+ ML 
Sbjct  740   DHWKEGKWLEIADPIIVGTSSSSSTFRPHEVLRCLQIGLLCVQERAEDRPKMSSVVFMLG  799

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQS--LNQLTVTMLDAR  3194
              +   +PQPK PG+C+    ++ DSSS++  ++S  +NQ TV++++AR
Sbjct  800   NEKGEIPQPKPPGYCIGRSFLETDSSSSTQRNESSTINQFTVSVINAR  847



>ref|XP_002869890.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46149.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=852

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/828 (50%), Positives = 565/828 (68%), Gaps = 25/828 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS G+VF+LGFF+  G+S   Y+GIWYK+I ++T VWVANRD P+  STG LK
Sbjct  44    ISSNKTIVSLGDVFELGFFTILGDS--WYLGIWYKKIPEKTYVWVANRDNPISTSTGILK  101

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  + N+ L++     +WS++ T     P   VA+LLD+GNFV+R       + +LWQSF
Sbjct  102   IS-NANLVLLNHFDTPVWSTNLTAEVKSP--VVAELLDNGNFVLRDSKTNGSDEFLWQSF  158

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLG D K   N+++ SW+S  D S GD  FK++  GLPE F+   D  +
Sbjct  159   DFPTDTLLPQMKLGLDHKKRLNKFLRSWKSSFDMSSGDYLFKIETLGLPEFFIWMSDFRV  218

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             +RSG WNG+ FSG+ EM+  + I ++    K EV ++F   + NL+SRL +NY  LL+++
Sbjct  219   FRSGPWNGIRFSGMLEMQKWDDIIYNLTENKEEVAFTFRPTDHNLYSRLTINYAGLLQQF  278

Query  1449  TWIPENRIWNRFWNAPKDQ-CDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             TW P  + WN  W+   D  C+ Y  CG +  CD   SP+C C  GFKPRN Q W+L D 
Sbjct  279   TWDPIYKEWNMLWSTSTDNACETYNPCGPYAYCDMSTSPMCNCVEGFKPRNPQEWALGDV  338

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              G C R   L+C  DGF  +   KLP+++ + VD  +   +CKE C + C+CTA++N +I
Sbjct  339   RGRCQRTTPLNCGRDGFTQLRKIKLPDTTAAIVDKRIGFKDCKERCAKTCNCTAFANTDI  398

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
              NGGSGCVIW     DIR Y A+G Q LYVRVAA++      ++      G+   +I+  
Sbjct  399   RNGGSGCVIWIGRFVDIRNYAADG-QDLYVRVAAANIGDRKHIS------GQIIGLIVGV  451

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              ++L +  +++     K+++ R     N+     RER++  L N   ISS R   GE   
Sbjct  452   SLLLLVSFIMYWFWKKKQKQARATAAPNV----YRERTQH-LTNGVVISSGRHLFGENK-  505

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T+E ELP+ +F A+ MATDNF+++N LGQGGFG VY G L  G+EIAVKRLS  S QG  
Sbjct  506   TEELELPLTEFEAVVMATDNFSDSNILGQGGFGVVYMGRLPDGQEIAVKRLSMVSLQGVN  565

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE++LIARLQH NLV+L  CC+  DEK+LIYEY+EN SLDS LF K +SS L+W++R
Sbjct  566   EFKNEVKLIARLQHINLVRLFSCCIYADEKILIYEYLENGSLDSHLFKKVQSSKLNWQKR  625

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             +NII G+ARGLLYLHQDSRF+IIHRDLKASNVLLDK+M PKISDFGMAR+F  +ETEA +
Sbjct  626   FNIINGIARGLLYLHQDSRFKIIHRDLKASNVLLDKDMTPKISDFGMARIFEREETEA-S  684

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             TK++VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE+VSG++N+GFY  + + NLL   W
Sbjct  685   TKKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSGKRNRGFYNSNQDNNLLSYTW  744

Query  2886  RLWGEGRGSELLDSVIA--SESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
               W EG+  E+ D +I   S S S F   +V+RC+Q+GLLCVQE+AEDRP M++V+ ML 
Sbjct  745   DHWKEGKWLEIADPIIVGTSSSSSTFRPHEVLRCLQIGLLCVQERAEDRPKMSSVVFMLG  804

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQS--LNQLTVTMLDAR  3194
              +   +PQPK PG+C+    ++ DSSS++  ++S  +NQ TV++++AR
Sbjct  805   NEKGEIPQPKPPGYCIGRSFLETDSSSSTQRNESSTINQFTVSVINAR  852



>dbj|BAA83906.1| SRK13-b [Brassica oleracea]
Length=856

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/831 (51%), Positives = 562/831 (68%), Gaps = 26/831 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+TLVS G VF+LGFF    +S   Y+GIWYK+   RT VWVANRD PL N  G LK
Sbjct  43    ISSNRTLVSPGNVFELGFFKTTSSSR-WYLGIWYKKFPYRTYVWVANRDNPLSNDIGTLK  101

Query  909   IGEDGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
             I  + N+ L+D +  S+WS++ T  N+  P   VA+LLD+GNFV+R  N  N   +LWQS
Sbjct  102   ISGN-NLVLLDHSNKSVWSTNVTRGNERSP--VVAELLDNGNFVMRDSNSNNASQFLWQS  158

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FDYPTDTLLP MKLG+D KTG NR+++SWRS  DPS GD ++KL+   LPE +L   +I 
Sbjct  159   FDYPTDTLLPEMKLGYDLKTGLNRFLTSWRSSDDPSSGDYSYKLEPGRLPEFYLWKGNIR  218

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
              +RSG W+G+ FSG+PE +    + ++F   + EV Y+F++ N + +S L ++ T   ER
Sbjct  219   THRSGPWSGIQFSGIPEDQRLSYMVYNFTENREEVAYTFQMTNNSFYSILTISSTGYFER  278

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
              TW P + +WN FW++P  QCD YR CG +  CD + SP C C  GF P N Q W+LR  
Sbjct  279   LTWAPSSVVWNVFWSSPNHQCDMYRICGPYTYCDVNTSPSCNCIQGFNPENVQQWALRIP  338

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
               GC R   L C  DGF  M   KLP+++ + VD ++ + ECK+ C+ +C+CTA++N +I
Sbjct  339   ISGCKRRTRLSCNGDGFTRMKNMKLPDTTMAIVDRSIGVKECKKRCLGDCNCTAFANADI  398

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
              NGG+GCVIWT EL DIR Y A+GGQ LYVR+AA+D  +     R  N      K+I   
Sbjct  399   RNGGTGCVIWTGELADIRNY-ADGGQDLYVRLAAADLVK----KRNANW-----KIISLI  448

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
               V  + ++L  ++    ++ +            ++R+++ LMN    S+KR+ S E   
Sbjct  449   VGVSVVLLLLLLIMFCLWKRKQNRAKAMATSIVNQQRNQNVLMNGMTQSNKRQLSRENK-  507

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
              DE+ELP+ +  A+  AT+NF+N N+LGQGGFG VYKGML  G+E+AVKRLSK S QG +
Sbjct  508   ADEFELPLIELEAVVKATENFSNCNELGQGGFGIVYKGML-DGQEVAVKRLSKTSLQGID  566

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EF NE+RLIARLQH NLV++LGCC++ DEK+LIYEY+EN SLD  LF KKRSS L+WK R
Sbjct  567   EFMNEVRLIARLQHINLVRILGCCIEADEKILIYEYLENSSLDYFLFGKKRSSNLNWKDR  626

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             + I  GVARGLLYLHQDSRFRIIHRDLK  N+LLDK M PKISDFGMAR+F  DET+A  
Sbjct  627   FAITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKISDFGMARIFARDETQA-R  685

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T   VGTYGYMSPEYAMDG+ S K+D FSFGV+VLE+VSG++N+GFY  + E NLL  AW
Sbjct  686   TDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRNRGFYQVNPENNLLSYAW  745

Query  2886  RLWGEGRGSELLDSVI----ASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLML  3053
               W EGR  E++D VI    AS   +    +V++CIQ+GLLC+QE+AE RP M++V+ ML
Sbjct  746   SHWAEGRALEIVDPVIVDPLASLPSTFQPKEVLKCIQIGLLCIQERAEHRPTMSSVVWML  805

Query  3054  IGKGTSLPQPKQPGFCL-ASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
               + T +PQPK P +CL AS      SSS  ++D    ++N+ T +++DAR
Sbjct  806   GSEATEIPQPKPPVYCLIASYYANNPSSSGQFDDDESWTVNKYTCSVIDAR  856



>ref|XP_002534316.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus 
communis]
 gb|EEF28065.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus 
communis]
Length=822

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/839 (51%), Positives = 553/839 (66%), Gaps = 59/839 (7%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             +TL+SA   F+LGFFS G +S   Y+GIWYK I  +T+VWV NR+ P  ++ G L++ E 
Sbjct  22    ETLISADGNFELGFFSQG-DSRSRYLGIWYKRIPVKTVVWVGNREVPSFDNLGVLQVNEQ  80

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             G I L + T   IWSS   N+     N V QLLDSGN +V+  N  NP+N +WQSFD+P 
Sbjct  81    GVIILQNSTKGIIWSS---NSSRTAKNPVLQLLDSGNLIVKDGNGNNPDNIVWQSFDFPY  137

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             +TLLP MKLGW+   G NRY++SW+S  DP++G+ +  +D+ G P+ F++  D +  RSG
Sbjct  138   NTLLPSMKLGWNLDKGLNRYLTSWKSIDDPAQGNFSCLIDLRGFPQLFMKKGDAVQVRSG  197

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ F+G P++ P  V  FSF+  K+E+YYS+E+ N ++ SRLIV+    LER+ WI 
Sbjct  198   PWNGLQFTGSPQLNPNPVFNFSFVSNKHEIYYSYELKNTSVVSRLIVSEKGALERHNWID  257

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
               + W  F++ P DQCD Y  CG++  C+ +  PVC C  GF P++   WS  D S GC 
Sbjct  258   RTQSWTLFFSVPTDQCDTYLLCGAYASCNINSYPVCSCLEGFVPKSPTDWSASDWSDGCV  317

Query  1641  RYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGG  1817
             R  EL C T DGF  +   KLP++S+S+VD +M L EC+ MC+RNCSC AY+N +I   G
Sbjct  318   RRTELSCHTGDGFRKLKGMKLPDTSSSWVDMSMDLKECEGMCLRNCSCLAYANSDIR--G  375

Query  1818  SGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivl  1997
             SGC++W   L D+R++T EGGQ LY+R+AAS      E+A+G    GK   +I++C I+ 
Sbjct  376   SGCLLWFDHLIDMRKFT-EGGQDLYIRIAAS------ELAKG-KSHGKRVAIIVSCLIIG  427

Query  1998  gigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNAT------------------  2123
                                 +T    +  TR+R R+ L  A                   
Sbjct  428   MG------------------MTALGSLLYTRKRKRNILGQAVPLVLLVSSFAIHFYIISG  469

Query  2124  -AISSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEE  2300
              A  +  E+ G+    ++ EL  FD   I  AT NF+N NKLG+GGFG VYKG L+ G+E
Sbjct  470   LAKETYIENYGDNGAKEDTELIAFDLITIRNATGNFSNYNKLGEGGFGPVYKGTLLDGQE  529

Query  2301  IAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSI  2480
             IAVKRLS+ S QG +EFKNE+ LIARLQHRNLVKLLGCC+  DEKMLIYEYM NKSLDS 
Sbjct  530   IAVKRLSETSGQGGKEFKNEVILIARLQHRNLVKLLGCCIHGDEKMLIYEYMPNKSLDSF  589

Query  2481  LFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDF  2660
             +FDKKRS LLDW   + II G+ARGLLYLHQDSR RIIHRDLKASN+LLD +MNPKISDF
Sbjct  590   IFDKKRSMLLDWHMCFRIIGGIARGLLYLHQDSRLRIIHRDLKASNILLDCDMNPKISDF  649

Query  2661  GMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQG  2840
             G+AR FG D+  A  TKR+VGTYGYMSPEYA+DGLFSVKSD FSFGVLVLE+VSG++N+G
Sbjct  650   GLARTFGKDQN-AANTKRVVGTYGYMSPEYAVDGLFSVKSDVFSFGVLVLEIVSGKRNRG  708

Query  2841  FYTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAE  3017
             F    +  NLLG AWRLW E R  EL D      S  E+ V QV+RCIQVGLLCVQ    
Sbjct  709   FSHLDHSLNLLGHAWRLWMEERALELFDKF----SQDEYSVSQVLRCIQVGLLCVQRLPH  764

Query  3018  DRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             DRP+M+AV++ML G  +SLPQPKQPGF     P + DSS++     S N+++ T+++ R
Sbjct  765   DRPDMSAVVVML-GSESSLPQPKQPGFYTERDPFEADSSTSKERVWSRNEISSTLIEPR  822


 Score = 60.8 bits (146),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 46/129 (36%), Positives = 63/129 (49%), Gaps = 30/129 (23%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGKCfqiieeia*giq  163
            QHRNLV+LLGCCI G EKMLI      KSLD+F+FD  +   L+W  C            
Sbjct  557  QHRNLVKLLGCCIHGDEKMLIYEYMPNKSLDSFIFDKKRSMLLDWHMC------------  604

Query  164  afRQMTTLA--LKIMHGNSGIKVQHRTFMMLLK*KSVIFLMRCRHSPVKKTW*DLDLGWS  337
             FR +  +A  L  +H +S +++ HR        K+   L+ C  +P      D  L  +
Sbjct  605  -FRIIGGIARGLLYLHQDSRLRIIHRDL------KASNILLDCDMNPKIS---DFGLART  654

Query  338  FVKEILACN  364
            F K+  A N
Sbjct  655  FGKDQNAAN  663



>gb|AAF23832.1|AC007234_4 F1E22.15 [Arabidopsis thaliana]
Length=1662

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/827 (52%), Positives = 587/827 (71%), Gaps = 22/827 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T++S  ++F+LGFF+P  +S   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  853   ISSNKTIISPSQIFELGFFNPDSSSR-WYLGIWYKIIPIRTYVWVANRDNPLSSSNGTLK  911

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  D N+ + D +   +WS+ N     V     A+LLD GNFV+R   +  P  +LWQSF
Sbjct  912   IS-DNNLVIFDQSDRPVWST-NITGGDVRSPVAAELLDYGNFVLRDSKNNKPSGFLWQSF  969

Query  1089  DYPTDTLLPGMKLGWDSKTGR-NRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             D+PTDTLL  MK+GWD+K+G  NR + SW++  DPS GD + KL  +G PE ++ NK+ I
Sbjct  970   DFPTDTLLSDMKMGWDNKSGGFNRILRSWKTTDDPSSGDFSTKLRTSGFPEFYIYNKESI  1029

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
              YRSG W G  FS VP M+P + I  SF     +V YS+ ++  N++S L ++ T LL+R
Sbjct  1030  TYRSGPWLGNRFSSVPGMKPVDYIDNSFTENNQQVVYSYRVNKTNIYSILSLSSTGLLQR  1089

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
              TW+   + W + W +PKD CDNY+ECG++G CD + SP+C C  GF+P N+QA +LRD 
Sbjct  1090  LTWMEAAQSWKQLWYSPKDLCDNYKECGNYGYCDANTSPICNCIKGFEPMNEQA-ALRDD  1148

Query  1626  SGGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             S GC R  +L C   DGF+ +   +LP+++ + VD  + L EC+E C++ C+CTA++N +
Sbjct  1149  SVGCVRKTKLSCDGRDGFVRLKKMRLPDTTETSVDKGIGLKECEERCLKGCNCTAFANTD  1208

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             I NGGSGCVIW+  LFDIR Y A+GGQ LYVRVAA D E             K+KK+I +
Sbjct  1209  IRNGGSGCVIWSGGLFDIRNY-AKGGQDLYVRVAAGDLEDKRI---------KSKKIIGS  1258

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETM  2162
                V  + ++ F +    +RK +R +T    +     RS+D LMN   + + R ++ +  
Sbjct  1259  SIGVSILLLLSFIIFHFWKRKQKRSITIQTPIVDL-VRSQDSLMNE-LVKASRSYTSKEN  1316

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
              TD  ELP+ ++ A+AMAT+NF+  NKLGQGGFG VYKGML+ G+EIAVKRLSK S QG 
Sbjct  1317  KTDYLELPLMEWKALAMATNNFSTDNKLGQGGFGIVYKGMLLDGKEIAVKRLSKMSSQGT  1376

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
             +EF NE+RLIA+LQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFD+ RSS L+W++
Sbjct  1377  DEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDQTRSSNLNWQK  1436

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R++II G+ARGLLYLHQDSR RIIHRDLKASNVLLDK M PKISDFGMAR+FG +ETEA 
Sbjct  1437  RFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEAN  1496

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
              T+R+VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  + + NLLG  
Sbjct  1497  -TRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGFV  1555

Query  2883  WRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             WR W EG+  E++D +      SEF   +++RCIQ+GLLCVQE+AEDRP M++VM+ML  
Sbjct  1556  WRHWKEGKELEIVDPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVMVMLGS  1615

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ--SLNQLTVTMLDAR  3194
             + T++PQPK+PGFC+    +++DSSS++  D   ++NQ+T++++DAR
Sbjct  1616  ETTAIPQPKRPGFCVGRSSLEVDSSSSTQRDDECTVNQVTLSVIDAR  1662


 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/828 (51%), Positives = 580/828 (70%), Gaps = 28/828 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T++S  ++F+LGFF+P  +S   Y+GIWYK I  RT VWVANRD PL +S G LK
Sbjct  38    ISSNKTIISPSQIFELGFFNPASSSR-WYLGIWYKIIPIRTYVWVANRDNPLSSSNGTLK  96

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  + N+ + D +   +WS+ N     V     A+LLD+GNF++R  N+      LWQSF
Sbjct  97    ISGN-NLVIFDQSDRPVWST-NITGGDVRSPVAAELLDNGNFLLRDSNNR----LLWQSF  150

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLL  MKLGWD KTG NR + SW++  DPS G+ + KL+ +  PE ++ +K+ I+
Sbjct  151   DFPTDTLLAEMKLGWDQKTGFNRILRSWKTTDDPSSGEFSTKLETSEFPEFYICSKESIL  210

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FS VP     + + ++F  +K EV YS+ I+  NL+SRL +N   LL+R 
Sbjct  211   YRSGPWNGMRFSSVPGTIQVDYMVYNFTASKEEVTYSYRINKTNLYSRLYLNSAGLLQRL  270

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TW    + W + W +PKD CDNY+ CG+FG CD++  P C C  GFKP N+QAW LRDGS
Sbjct  271   TWFETTQSWKQLWYSPKDLCDNYKVCGNFGYCDSNSLPNCYCIKGFKPVNEQAWDLRDGS  330

Query  1629  GGCFRYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
              GC R   L C   DGF  +   KLP+++ + VD  + L  CKE C+ +C+CTA++N +I
Sbjct  331   AGCMRKTRLSCDGRDGFTRLKRMKLPDTTATIVDREIGLKVCKERCLEDCNCTAFANADI  390

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAE--QTGEVARGGNGFGKTKKVIL  1979
              NGGSGCVIWT E+ D+R Y A+GGQ LYVR+AA++ E  +       G+  G +  ++L
Sbjct  391   RNGGSGCVIWTREILDMRNY-AKGGQDLYVRLAAAELEDKRIKNEKIIGSSIGVSILLLL  449

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
             +  I           + ++        T N++    + RS+D L+N   +S +R ++ + 
Sbjct  450   SFVIFHFWKRKQKRSITIQ--------TPNVD----QVRSQDSLINDVVVS-RRGYTSKE  496

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
               ++  ELP+ +  A+A AT+NF+N NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG
Sbjct  497   KKSEYLELPLLELEALATATNNFSNDNKLGQGGFGIVYKGRLLDGKEIAVKRLSKMSSQG  556

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EF NE+RLIA+LQH NLV+LLGCCVD  EKMLIYEY+EN SLDS LFD+ RSS L+W+
Sbjct  557   TDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDQTRSSNLNWQ  616

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
             +R++II G+ARGLLYLHQDSR RIIHRDLKASNVLLDK M PKISDFGMAR+FG +ETEA
Sbjct  617   KRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEA  676

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               T+R+VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY  + + NLLG 
Sbjct  677   N-TRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSNRDLNLLGF  735

Query  2880  AWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              WR W EG   E++D +      S+F   +++RCIQ+GLLCVQE+AEDRP M++VM+ML 
Sbjct  736   VWRHWKEGNELEIVDPINIDSLSSKFPTHEILRCIQIGLLCVQERAEDRPVMSSVMVMLG  795

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ--SLNQLTVTMLDAR  3194
              + T++PQPK+PGFC+   P++ DSSS++  D   ++NQ+T++++DAR
Sbjct  796   SETTAIPQPKRPGFCIGRSPLEADSSSSTQRDDECTVNQITLSVIDAR  843


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+ + LNW K
Sbjct  571  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDQTRSSNLNWQK  617


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2     QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
             QH NLVRLLGCC++ GEKMLI       SLD+ +FD T+ + LNW K
Sbjct  1390  QHINLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDQTRSSNLNWQK  1436



>ref|XP_006370371.1| S-locus protein kinase [Populus trichocarpa]
 gb|ERP66940.1| S-locus protein kinase [Populus trichocarpa]
Length=831

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/819 (50%), Positives = 559/819 (68%), Gaps = 33/819 (4%)
 Frame = +3

Query  744   TLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGEDG  923
             TLVS+   F+LGFFSPG NS   Y+GIWYK+I   T+VWVANR+ PL +S+G  K  + G
Sbjct  44    TLVSSEGHFELGFFSPG-NSRNRYMGIWYKKISSFTVVWVANRNTPLNDSSGMFKFVDHG  102

Query  924   NIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPTD  1103
             N+  ++ T  +IWSS N +  ++  N VAQLLD+GN VVR END +PEN+LWQSFDYP D
Sbjct  103   NLAFINSTNGTIWSS-NISRAAI--NPVAQLLDTGNLVVRAENDNDPENFLWQSFDYPGD  159

Query  1104  TLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSGG  1283
             + LPGMK G    TG NRY++SW+SP+DPS G  T KLD NGLP+ FL    +  +RSG 
Sbjct  160   SFLPGMKYGISFVTGLNRYLTSWKSPSDPSTGKYTNKLDPNGLPQYFLSQGSVDQFRSGP  219

Query  1284  WNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIPE  1463
             WNG+ FSG+  ++P  +  F F+  + E+YY ++I N ++ SR++++   +L+R+TWI  
Sbjct  220   WNGLRFSGMINLKPNPIYTFEFVFNQEEIYYKYQIANSSVLSRMVLSPDGVLQRFTWIDR  279

Query  1464  NRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCFR  1643
              + W  +  A  D CD +  CG+ G+C+ + SP C C   F+P++ + W+  D S GC R
Sbjct  280   TQDWTLYLTANMDNCDRFALCGAHGVCNINNSPACDCLKEFEPKSLEEWTAADWSQGCVR  339

Query  1644  YDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGS  1820
                LDC   +GF+     K+P++  S+ + T++L+EC+E+C++NCSCTAY+N ++ +GGS
Sbjct  340   KAPLDCSNGEGFIKYTGIKVPDTRKSWYNKTINLEECEEVCLKNCSCTAYANLDVRDGGS  399

Query  1821  GCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlg  2000
             GCV+W  +L DIRQY  E GQ +Y+R+AAS  ++  +      G  + + +++   +V  
Sbjct  400   GCVLWFGDLIDIRQYN-ENGQDIYIRIAASVIDKPVK----SRGKKRVRIIVIPVSLVAF  454

Query  2001  igmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEYE  2180
               + L   L          + +N + + TRE           +++  +   +    ++ E
Sbjct  455   SLLALCLFLRF--------LRKNKQQQLTRE--------GNVVTNPEQDRTKESRNEDLE  498

Query  2181  LPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNE  2360
             LP+FD   +  AT+ F+  NKLGQGGFG VYKG+L  G+EIAVKRLSK SRQG  EF+NE
Sbjct  499   LPLFDLATLTDATNCFSINNKLGQGGFGPVYKGILQDGQEIAVKRLSKRSRQGINEFRNE  558

Query  2361  LRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIIC  2540
             +  IA+LQHRNLVKLLGCC++++E+MLIYEYM NKSLDS +FDK+R+ LLDW +R+ II 
Sbjct  559   VVCIAKLQHRNLVKLLGCCIELEERMLIYEYMPNKSLDSFIFDKRRNMLLDWTKRFPIIN  618

Query  2541  GVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIV  2720
             G+ARGLLYLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMAR FGGDET A T+ RIV
Sbjct  619   GIARGLLYLHQDSRLRIIHRDLKASNILLDYEMNPKISDFGMARSFGGDETSANTS-RIV  677

Query  2721  GTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGE  2900
             GTYGYMSPEYA+DGLFSVKSD FSFGVLVLE+VSGRKN+GF    ++ NLLG AW L  E
Sbjct  678   GTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVSGRKNRGFRHAEHKLNLLGHAWMLHKE  737

Query  2901  GRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQ  3080
             GR  +L+D  I        + +V+R I+V LLCVQ+  EDRP M+ V+LML      LPQ
Sbjct  738   GRPLDLIDESIVDTC---IISEVLRSIEVALLCVQKSPEDRPKMSIVVLML-SSDIVLPQ  793

Query  3081  PKQPGFCLASKPVKMDSSST-SYNDQSLNQLTVTMLDAR  3194
             PK+PGF    + +  DSSST  +   S+N+LT T+L+AR
Sbjct  794   PKEPGF-FTERDLSNDSSSTIKHEISSVNELTSTLLEAR  831


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCCIE  E+MLI      KSLD+F+FD  +   L+W K
Sbjct  566  QHRNLVKLLGCCIELEERMLIYEYMPNKSLDSFIFDKRRNMLLDWTK  612



>gb|ABW24819.1| S13-b receptor kinase [Brassica oleracea var. viridis]
Length=856

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/831 (51%), Positives = 561/831 (68%), Gaps = 26/831 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+TLVS G VF+LGFF    +S   Y+GIWYK+   RT VWVANRD PL N  G LK
Sbjct  43    ISSNRTLVSPGNVFELGFFKTTSSSR-WYLGIWYKKFPYRTYVWVANRDNPLSNDIGTLK  101

Query  909   IGEDGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
             I  + N+ L+D +  S+WS++ T  N+  P   VA+LLD+GNFV+R  N  N   +LWQS
Sbjct  102   ISGN-NLVLLDHSNKSVWSTNVTRGNERSP--VVAELLDNGNFVMRDSNSNNASQFLWQS  158

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FDYPTDTLLP MKLG+D KTG NR+++SWRS  DPS GD ++KL+   LPE +L   +I 
Sbjct  159   FDYPTDTLLPEMKLGYDLKTGLNRFLTSWRSSDDPSSGDYSYKLEPGRLPEFYLWKGNIR  218

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
              +RSG W+G+ FSG+PE +    + ++F   + EV Y+F++ N + +S L ++ T   ER
Sbjct  219   THRSGPWSGIQFSGIPEDQRLSYMVYNFTENREEVAYTFQMTNNSFYSILTISSTGYFER  278

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
              TW P + +WN FW++P  QCD YR CG +  CD + SP C C  GF P N Q W+LR  
Sbjct  279   LTWAPSSVVWNVFWSSPNHQCDMYRICGPYTYCDVNTSPSCNCIQGFNPENVQQWALRIP  338

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
               GC R   L C  DGF  M   KLP+++ + VD ++ + ECK+ C+ +C+CTA++N +I
Sbjct  339   ISGCKRRTRLSCNGDGFTRMKNMKLPDTTMAIVDRSIGVKECKKRCLGDCNCTAFANADI  398

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
              NGG+GCVIWT EL DIR Y A+GGQ LYVR+AA+D  +     R  N      K+I   
Sbjct  399   RNGGTGCVIWTGELADIRNY-ADGGQDLYVRLAAADLVK----KRNANW-----KIISLI  448

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
               V  + ++L  ++    ++ +            ++R+++ LMN    S+KR+ S E   
Sbjct  449   VGVSVVLLLLLLIMFCLWKRKQNRAKAMATSIVNQQRNQNVLMNGMTQSNKRQLSRENK-  507

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
              DE+ELP+ +  A+  AT+NF+N N+LGQGGFG VYKGML  G+E+AVKRLSK S QG +
Sbjct  508   ADEFELPLIELEAVVKATENFSNCNELGQGGFGIVYKGML-DGQEVAVKRLSKTSLQGID  566

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EF NE+RLIARLQH NLV++LGCC++ DEK+LIYEY+EN SLD  L  KKRSS L+WK R
Sbjct  567   EFMNEVRLIARLQHINLVRILGCCIEADEKILIYEYLENSSLDYFLLGKKRSSNLNWKDR  626

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             + I  GVARGLLYLHQDSRFRIIHRDLK  N+LLDK M PKISDFGMAR+F  DET+A  
Sbjct  627   FAITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKISDFGMARIFARDETQA-R  685

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T   VGTYGYMSPEYAMDG+ S K+D FSFGV+VLE+VSG++N+GFY  + E NLL  AW
Sbjct  686   TDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRNRGFYQVNPENNLLSYAW  745

Query  2886  RLWGEGRGSELLDSVI----ASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLML  3053
               W EGR  E++D VI    AS   +    +V++CIQ+GLLC+QE+AE RP M++V+ ML
Sbjct  746   SHWAEGRALEIVDPVIVDPLASLPSTFQPKEVLKCIQIGLLCIQERAEHRPTMSSVVWML  805

Query  3054  IGKGTSLPQPKQPGFCL-ASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
               + T +PQPK P +CL AS      SSS  ++D    ++N+ T +++DAR
Sbjct  806   GSEATEIPQPKPPVYCLIASYYANNPSSSGQFDDDESWTVNKYTCSVIDAR  856



>ref|XP_006284976.1| hypothetical protein CARUB_v10006283mg [Capsella rubella]
 gb|EOA17874.1| hypothetical protein CARUB_v10006283mg [Capsella rubella]
Length=824

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/824 (50%), Positives = 556/824 (67%), Gaps = 52/824 (6%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+T+VS G +F+LGFF PG  S   Y+GIWYK+  + T VWVANRD+PL N+ G LK+  
Sbjct  48    NRTIVSPGGLFELGFFKPG-TSSRWYLGIWYKKTPEETFVWVANRDRPLPNAMGTLKLS-  105

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             D N+ L+D +   +WS++ T       + VA+LL +GN V+R  ++ NP  +LWQSF +P
Sbjct  106   DTNLVLLDHSNTLVWSTNLTRGDR-RSSVVAELLANGNLVLRYSSNSNPSGFLWQSFHFP  164

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
             TDTLLP MKLGWD KTGRN ++ SWRS  DPS G  +++L+    PE F+   D+ +YRS
Sbjct  165   TDTLLPQMKLGWDRKTGRNIFLRSWRSSDDPSTGKFSYRLETRSFPEFFIWQTDVPMYRS  224

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWI  1457
             G W+GV FSG+ EM   + + ++F   + EV Y+F + N +++SRL ++ +  L++ TW 
Sbjct  225   GPWDGVRFSGMVEMRDLDYMVYNFTDNQEEVVYTFLMTNHDIYSRLTMSPSGSLQQITWK  284

Query  1458  PENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGC  1637
              E+RI +  W +P D CD                    C  GF+P+ Q+AW++ DG+ GC
Sbjct  285   DEDRILS--WLSPTDPCD-------------------ACIKGFEPKIQEAWAVNDGTSGC  323

Query  1638  FRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNG  1814
              R   L C + DGF  +  TKLP+++ + VD ++ ++ECK+ C+ NC+CTAY+N +I NG
Sbjct  324   VRKTRLSCTSGDGFFKLKNTKLPDTTWTIVDKSIDVEECKKRCLSNCNCTAYANTDIRNG  383

Query  1815  GSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgiv  1994
             GSGCVIWT  L DIR Y A G Q LYV++A +D E        GN  GK   +I+     
Sbjct  384   GSGCVIWTGVLKDIRNYPATG-QELYVKLARADLED-------GNRKGKVIGLIVGITFC  435

Query  1995  lgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDE  2174
                        +                    ER++D L N   ISS+   S E   TDE
Sbjct  436   FWRRKQKQARAIPAPF-------------AYEERNQDLLNNWMVISSRSHFSRENR-TDE  481

Query  2175  YELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFK  2354
              ELP+ +  AI +AT+NF+++NK+G+GGFG VYKG L+ G+EIAVKRLSK S QG  EF 
Sbjct  482   LELPLMEIEAIIIATNNFSHSNKIGEGGFGVVYKGNLLDGQEIAVKRLSKTSIQGTNEFM  541

Query  2355  NELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNI  2534
             NE+RLIARLQH +LV+LLGCC+D DEK+LIYEY+EN SLDS LFDK RS +L+W+ R++I
Sbjct  542   NEVRLIARLQHIDLVRLLGCCIDTDEKILIYEYLENLSLDSYLFDKTRSYMLNWQMRFDI  601

Query  2535  ICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKR  2714
               G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK + PKISDFGMAR+FG DETEA  T++
Sbjct  602   TNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKYITPKISDFGMARIFGRDETEAN-TRK  660

Query  2715  IVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLW  2894
             +VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++SGR+N+GFY    + NLLG  WR W
Sbjct  661   VVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGRRNKGFYNSHRDLNLLGCVWRHW  720

Query  2895  GEGRGSELLDSVIASESHSEFVDQ-VMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTS  3071
              EG+G E++D +I   S S F  Q ++RCIQ+GLLCVQE AEDRP M+ V+LM   + T+
Sbjct  721   EEGKGLEIVDPIIIDSSSSTFQPQEILRCIQIGLLCVQEGAEDRPMMSEVVLMFGSETTT  780

Query  3072  LPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             +PQPK PG+C+    V +DSSS++  D    S+NQ+T+++LDAR
Sbjct  781   VPQPKPPGYCVGRSLVNIDSSSSNQGDDESWSVNQITLSVLDAR  824



>gb|ADQ37372.1| unknown [Arabidopsis lyrata]
Length=861

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/825 (51%), Positives = 564/825 (68%), Gaps = 23/825 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+T+VS G +F+LGFF PG  S   Y+GIWYK+I +   VWVANRD PL N+ G LKI  
Sbjct  54    NRTIVSPGGLFELGFFKPG-TSSRWYLGIWYKKIPEEAFVWVANRDSPLFNAIGTLKIS-  111

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             D N+ L+D +   +WS++ +    V  + VA+LL +GNFV+R  N+ +P  +LWQSF +P
Sbjct  112   DTNLVLLDHSSTPVWSTNLSTRGVVRSSVVAELLANGNFVLRYSNNSDPSGFLWQSFHFP  171

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
             TDTLLP MKLGWD KTGRN ++ SWRSP DPS G  ++KL+    PE F+ N D  +YRS
Sbjct  172   TDTLLPQMKLGWDRKTGRNTFLRSWRSPDDPSSGAFSYKLETRSFPEFFIWNTDAPMYRS  231

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWI  1457
             G W+GV F+G+ EM+    +  +F   + E+ Y+F++   +++SRL ++ T  L++ T+I
Sbjct  232   GPWDGVRFNGMVEMKELGYMVSNFTDNREEIAYTFQMTKHHIYSRLTMSPTGYLQQITFI  291

Query  1458  P--ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
                ENRI +  W +P DQCD Y+ CG +  C    SP+C C  GF+P+  +AW L+DG+ 
Sbjct  292   EKNENRILS--WFSPMDQCDVYKVCGPYSYCYMSTSPLCNCIQGFEPKIWRAWELKDGTS  349

Query  1632  GCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
             GC R   L C + DGFL +   KLP ++ + VD ++ + EC+E C  NC+CTA++N +I 
Sbjct  350   GCVRKTRLSCGSGDGFLRLEKMKLPNTTFTIVDRSIDVKECEERCRNNCNCTAFANADIR  409

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             +GGSGCVIWT EL DIR Y A GGQ LYVR+AA+D  +  ++     G       I+   
Sbjct  410   HGGSGCVIWTGELMDIRNYPA-GGQNLYVRLAAADLVKKKKIGGKIIGLIIVGISIMLLL  468

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
               +             R      V +        +R++D L N   +SS R  SGE    
Sbjct  469   SFIMFCFWRRRKQKRARDITAHTVCQ--------KRNQDLLKNLMVMSSIRHLSGENERE  520

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             +     + +  AI +AT NF+  NKLG+GGFG VYKG L  G EIAVKRLSK S QG +E
Sbjct  521   ELELP-LIELEAIILATKNFSECNKLGRGGFGIVYKGRLPDGHEIAVKRLSKMSLQGTDE  579

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             F NE+RLIARLQH NLV+LLGCC+D DEKMLIYEY+EN SLDS LFDK  SS LDW++R+
Sbjct  580   FMNEVRLIARLQHINLVRLLGCCIDGDEKMLIYEYLENLSLDSHLFDKTGSSKLDWQKRF  639

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             +II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETEA  T
Sbjct  640   DIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEAN-T  698

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             +++VGTYGYMSPEYAMDG+FS+KSD FSFGVL+LE++S ++N+GFY  SN+ NLLG  WR
Sbjct  699   RKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISSKRNKGFYN-SNDLNLLGCVWR  757

Query  2889  LWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGT  3068
              W EG+G E++D +I   S S    +++RCIQ+GLLCVQE+AEDRP M+AV+LML  + T
Sbjct  758   NWKEGKGLEIVDPIIIDSSSSP-PHEILRCIQIGLLCVQERAEDRPIMSAVVLMLGSETT  816

Query  3069  SLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             ++PQPK PG+C+    +  DSSS+   D    ++NQ+T+++++AR
Sbjct  817   AIPQPKPPGYCVGRSLLDSDSSSSKQRDDESCTVNQITLSVIEAR  861


 Score = 55.5 bits (132),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCCI+G EKMLI       SLD+ +FD T  ++L+W K
Sbjct  591  QHINLVRLLGCCIDGDEKMLIYEYLENLSLDSHLFDKTGSSKLDWQK  637



>ref|XP_004957963.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Setaria italica]
Length=844

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/835 (49%), Positives = 559/835 (67%), Gaps = 35/835 (4%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG  899
             N  L   +TLVSAG VF+LGFF+P  +S   ++GIWY  I  +TIVWVANRD P+  +T 
Sbjct  35    NSSLADGETLVSAGGVFELGFFTPA-SSTARFLGIWYMGIAPQTIVWVANRDAPITGATA  93

Query  900   FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLW  1079
              L I   G++ + D +G   WSS+ +N     G  VAQLLDSGNFV+R    +     LW
Sbjct  94    SLAINATGSLVIADSSGRVFWSSAPSNTSGT-GAPVAQLLDSGNFVLR----DGGGAVLW  148

Query  1080  QSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLR-NK  1256
             QSFD+P+DTLLPGMKLGWD  TG +R++++WRSP DPS+GD TF +DI G+PE F+R N 
Sbjct  149   QSFDHPSDTLLPGMKLGWDLTTGLDRHLTTWRSPGDPSQGDYTFGIDIRGVPEGFIRYNG  208

Query  1257  DIIIYRSGGWNGVAFSGVPEMEPKEV-IAFSFMRTKNEVYYSFEIHNK-NLFSRLIVNYT  1430
                +YR+G WNG+ FSG PEMEP      F F+   ++VYY+F +     + SR ++N +
Sbjct  209   TAPVYRNGPWNGLQFSGEPEMEPNNSNFRFEFVANASDVYYTFVVDGAAGVVSRFVLNQS  268

Query  1431  QLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDT-DMSPVCGCPVGFKPRNQQA  1607
              + +RY W P    W+ +W+ P+DQCD+Y +CG+FG+CDT   SP CGC  GF P + + 
Sbjct  269   SV-QRYVWPPGGHAWSLYWSLPRDQCDHYAQCGAFGVCDTASGSPACGCVHGFTPASPRD  327

Query  1608  WSLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTA  1787
             W LRD S GC R   L+C  DGFL +   KLP+++ +  D ++++D+C++MC+ NCSC A
Sbjct  328   WQLRDSSAGCRRVTPLNCTGDGFLQLRGVKLPDTTNAMEDKSITVDQCRQMCLANCSCLA  387

Query  1788  YSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTK  1967
             Y+  +I  G SGC+IW++ L DIR + + GG+ LY+R+AASD      +   G G  KT 
Sbjct  388   YAASSIKGGDSGCIIWSSLLIDIRHFPS-GGEDLYIRLAASD------LPSNGGGPSKTN  440

Query  1968  KVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGT-RERSRDPLMNATAISSKRE  2144
              V+     +    +   G      +  R  V+     + T R  S D  +  T +   R+
Sbjct  441   IVVAVFVSLAAFLLFGLGGFFFWNKFFRNKVSNPGTSQSTQRFNSFDSSIPLTPVQ-DRK  499

Query  2145  HSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSK  2324
                E+    +  + +FD   IA +TDNFA   KLG+GGFG+VYKG L GG+ +AVKRLSK
Sbjct  500   LEDESGQNKDLNVTLFDMATIAFSTDNFATWTKLGEGGFGAVYKGELEGGQTVAVKRLSK  559

Query  2325  NSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSS  2504
              S QG  EFKNE+ LIA+LQH NLV+LLGCC+  +E++L+YEYMEN+SLD+ +FDK RS+
Sbjct  560   FSTQGLGEFKNEVMLIAKLQHVNLVRLLGCCIHGEERILVYEYMENRSLDNFIFDKGRSA  619

Query  2505  LLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGG  2684
              LDW +R++II G+ARGLLYLHQDSR+++IHRDLKA N+LLD++MNPKISDFG+AR+F G
Sbjct  620   QLDWSKRFDIILGIARGLLYLHQDSRYKVIHRDLKAGNILLDRDMNPKISDFGVARIF-G  678

Query  2685  DETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEE  2864
             D+T++  T+++VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE+VSGRKN+G Y+   + 
Sbjct  679   DDTDS-HTRKVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIVSGRKNRGIYSSGEQT  737

Query  2865  NLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVM  3044
             +LL  AW+LW EG    LLD  +A       V +V RC+QV LLCVQE+A+DRP+MAAV 
Sbjct  738   SLLSHAWKLWREGNAVALLDETVAGAGEHR-VSEVRRCVQVALLCVQERADDRPHMAAVF  796

Query  3045  LMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ-----SLNQLTVTMLDAR  3194
             + L   G  LPQP+ PGFC        D  STS + +     ++N +TVT+++ R
Sbjct  797   MALGNPGAVLPQPRHPGFC-------SDRGSTSTDGEWSSTCTVNDVTVTIVEGR  844


 Score = 56.6 bits (135),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCCI G E++L+      +SLD F+FD  + A+L+W K
Sbjct  579  QHVNLVRLLGCCIHGEERILVYEYMENRSLDNFIFDKGRSAQLDWSK  625



>ref|XP_007021210.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12735.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=812

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/817 (50%), Positives = 554/817 (68%), Gaps = 41/817 (5%)
 Frame = +3

Query  744   TLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGEDG  923
              L+SA  +FQLGFFSPG NS   Y+GIWYK+I  RT+VWVANR+ P+  ++G L I   G
Sbjct  37    ALISANGIFQLGFFSPG-NSIKRYLGIWYKDIPIRTVVWVANRETPISGTSGVLSITSQG  95

Query  924   NIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPTD  1103
              + L +GT +  WSS   N    P N VAQLL++GN VVR  ++   EN LWQSFD+P+D
Sbjct  96    ILQLTNGTDSIFWSS---NTSRPPLNPVAQLLEAGNLVVRDGDENREENILWQSFDHPSD  152

Query  1104  TLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSGG  1283
             TLLPGMKLG +  TG+  ++SSW+S  DP+ GD +  +D  G P+  +      +YR G 
Sbjct  153   TLLPGMKLGKNFITGKETFLSSWKSADDPAPGDFSLWIDSRGYPQLVIMKGPKFLYRDGS  212

Query  1284  WNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIPE  1463
             WNG+ F+G P+++  ++ +F F+  + EV+Y++E++N ++ SRL VN + LL+RY W+  
Sbjct  213   WNGIQFTGAPQLKKNDIYSFEFIFNEKEVHYTYELYNNSVVSRLAVNQSGLLQRYVWVDP  272

Query  1464  NRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCFR  1643
              + W  + +   D CD Y  CG++G C+   SPVC C  GF P++ + W L D + GC R
Sbjct  273   TKTWIVYLSLMTDYCDIYALCGAYGSCNIQGSPVCECLEGFVPKSPKNWGLLDWADGCVR  332

Query  1644  YDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGSG  1823
               EL+C  DGF  ++  KLP++S+S+ + TMSL EC+EMC++NCSCTAY+N +I   G+G
Sbjct  333   RTELNCSQDGFRKLSGMKLPDTSSSWFNGTMSLKECREMCLKNCSCTAYANSDIKGSGTG  392

Query  1824  CVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlgi  2003
             C++W  EL D+R +  EGGQ LY+R+AAS+ +Q G+        GK  ++I    IV+  
Sbjct  393   CLLWFNELMDVRVFN-EGGQELYIRMAASELDQIGKQRHTD---GKKLRIIEISSIVVIG  448

Query  2004  gmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEYEL  2183
              ++   L  + ++K +  V+  IE R   + + D                        EL
Sbjct  449   SLITGALFFIWKKKHQIQVSTEIEERKDEDANND-----------------------IEL  485

Query  2184  PIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNEL  2363
             P +DF+ IA+ATDNF++ NKLG+GGFG VYKG L  G++IAVKRLS NS QG  EFKNE+
Sbjct  486   PKYDFDTIAIATDNFSSKNKLGEGGFGPVYKGTLRDGQDIAVKRLSGNSGQGLTEFKNEV  545

Query  2364  RLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIICG  2543
              LIARLQHRNLVKLLGCC+  DE++LIYEYM NKSLD  +FD+   ++L+W  R++IICG
Sbjct  546   SLIARLQHRNLVKLLGCCIQGDERLLIYEYMPNKSLDYFIFDRNSITMLNWHMRFHIICG  605

Query  2544  VARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIVG  2723
             +ARGLLYLHQDSR RIIHRDLKASNVLLDK MNPKISDFGMA+ FGGD++ A  T R+VG
Sbjct  606   IARGLLYLHQDSRLRIIHRDLKASNVLLDKAMNPKISDFGMAKTFGGDQSVA-NTNRVVG  664

Query  2724  TYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGEG  2903
             TYGYMSPEYA+DGLFS KSD FSFGVL+LE++ G++N+GF+   +  NLLG AWRLW   
Sbjct  665   TYGYMSPEYAIDGLFSAKSDVFSFGVLLLEILCGKRNRGFHHSDHYLNLLGHAWRLWMNE  724

Query  2904  RGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQP  3083
             R  +L+D  + +      V +V+RCI VGLLCVQ+  EDRPNMA+V+LML G   SLPQP
Sbjct  725   RPLDLIDEFLLNNCA---VSEVLRCIHVGLLCVQQLPEDRPNMASVVLML-GSDNSLPQP  780

Query  3084  KQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             KQPGF     P+ ++SSS      S+N++T T++ AR
Sbjct  781   KQPGFYTERNPLGIESSS-----YSVNEITSTLVKAR  812


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLV+LLGCCI+G E++LI      KSLD F+FD      LNW
Sbjct  552  QHRNLVKLLGCCIQGDERLLIYEYMPNKSLDYFIFDRNSITMLNW  596



>gb|ADQ37362.1| unknown [Arabidopsis lyrata]
Length=881

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/840 (51%), Positives = 577/840 (69%), Gaps = 28/840 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS G VF+LGFF   G+S   Y+GIWYK + ++T VWVANRD PL +S G LK
Sbjct  52    ISSNKTIVSPGGVFELGFFKILGDS--WYLGIWYKNVSEKTYVWVANRDNPLSDSIGILK  109

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  + N+ L++ +   IWS++ T   +V    VA+LLD+GNFV+R     + + +LWQSF
Sbjct  110   I-TNSNLVLINHSDTPIWSTNLTG--AVISPVVAELLDNGNFVLRDSKTNDSDGFLWQSF  166

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PT+TLLP MKLG D+K   NR+++SW++  DPS GD TFKL+  GL E F     + +
Sbjct  167   DFPTNTLLPQMKLGLDNKRALNRFLTSWKNSFDPSSGDYTFKLETRGLTELFGLFTILEL  226

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG W+G  FSG+PEME  +   ++F   + EV+Y+F + + NL+SRL +N    LER+
Sbjct  227   YRSGPWDGRRFSGIPEMEQWDDFIYNFTENREEVFYTFRLTDPNLYSRLTINSAGNLERF  286

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TW P    WNRFW  PKD CD +  CG +  CDT  SP C C  GF+P + Q W+  D S
Sbjct  287   TWDPTREEWNRFWFMPKDDCDMHGICGPYAYCDTSTSPACNCIRGFQPLSPQEWASGDAS  346

Query  1629  GGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
             G C R  +L+C  D FL +   KLP+++T+ VD  + L+EC++ C  +C+CTA++N +I 
Sbjct  347   GRCRRNRQLNCGGDKFLQLMNMKLPDTTTATVDKRLGLEECEQKCKNDCNCTAFANMDIR  406

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVAR------------GGNG  1952
             NGG GCVIW  E  DIR+Y A  GQ LYVR+AA+D       A              G  
Sbjct  407   NGGPGCVIWIGEFQDIRKY-ASAGQDLYVRLAAADIHTIVNHALTHFDTIPSLFFFSGER  465

Query  1953  FGKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAIS  2132
                ++K+I    + + + +V+  ++    ++  +         G RER +  L N   +S
Sbjct  466   RNISRKII-GLIVGISLMVVVSLIIYCFWKRKHKRARPTAAAIGYRERIQGFLTNGVVVS  524

Query  2133  SKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVK  2312
             S R   G++  T++ ELP+ +F A+ MATDNF+++N LG+GGFG VYKG L+ G+EIAVK
Sbjct  525   SNRHLFGDSK-TEDLELPLTEFEAVIMATDNFSDSNILGRGGFGVVYKGRLLDGQEIAVK  583

Query  2313  RLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDK  2492
             RLS+ S QG  EF NE+RLIARLQH NLV+LL CC+   EK+LIYEY+EN SLDS LF+ 
Sbjct  584   RLSEVSSQGTIEFMNEVRLIARLQHINLVRLLSCCIHAGEKILIYEYLENGSLDSHLFNI  643

Query  2493  KRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMAR  2672
              +S  L+W++R+NII G+ARGLLYLHQDSRF+IIHRDLKASNVLLDK M PKISDFGMAR
Sbjct  644   NQSLKLNWQKRFNIINGIARGLLYLHQDSRFKIIHRDLKASNVLLDKNMTPKISDFGMAR  703

Query  2673  LFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTP  2852
             +F  DETEA  T+++VGTYGYMSPEYAMDG FSVKSD FSFGVL+LE+VSG++N+GFY  
Sbjct  704   IFESDETEA-NTRKVVGTYGYMSPEYAMDGRFSVKSDVFSFGVLILEIVSGKRNRGFYNS  762

Query  2853  SNEENLLGLAWRLWGEGRGSELLDSVIA--SESHSEFV-DQVMRCIQVGLLCVQEKAEDR  3023
             S + NLLG  W  W E +G +++DSVI   S S S F   +V+RCIQ+GLLCVQE+AEDR
Sbjct  763   SQDNNLLGYTWDNWKEEKGLDIVDSVIVDLSSSLSMFQRHEVLRCIQIGLLCVQERAEDR  822

Query  3024  PNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSY-NDQSL--NQLTVTMLDAR  3194
             PNM++V+LML  +G  LPQPK PG+C+    ++ DSSS+S+ ND+SL  NQ+TV++++AR
Sbjct  823   PNMSSVVLMLGSEG-ELPQPKLPGYCVGRSSLETDSSSSSHRNDESLTVNQITVSVINAR  881



>dbj|BAC53784.1| S-locus receptor kinase [Brassica napus]
Length=838

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/829 (51%), Positives = 563/829 (68%), Gaps = 34/829 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G+VF+LGFF    +S   Y+GIWYK++ ++T VWVANRD PL NS G LKI  
Sbjct  34    NRTLVSPGDVFELGFFKTTSSSR-WYLGIWYKQLPEKTYVWVANRDNPLPNSIGTLKIS-  91

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ L+D +  S+WS++ T  N+  P   +A+LL +GNFV+R  N+ +   +LWQSFDY
Sbjct  92    NMNLVLLDHSNKSVWSTNLTRRNERTP--VMAELLANGNFVMRDSNNNDASEFLWQSFDY  149

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PTDTLLP MKLG++ K G NR++ SWRS  DPS GD ++KL+   LPE +L   D+  +R
Sbjct  150   PTDTLLPEMKLGYNLKKGLNRFLISWRSSDDPSSGDYSYKLEPRRLPEFYLLQGDVREHR  209

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             SG WNG+ FSG+ E +    + ++F  T  EV Y+F + N + +SRL ++ T   ER TW
Sbjct  210   SGPWNGIRFSGILEDQKLSYMEYNFTETSEEVAYTFRMTNNSFYSRLTLSSTGYFERLTW  269

Query  1455  IPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
              P + IWN FW++P + QCD YR CG +  CD + SP C C  GF PRN Q W+LR    
Sbjct  270   APSSVIWNVFWSSPANPQCDMYRMCGPYSYCDVNTSPSCNCIQGFDPRNLQQWALRISLR  329

Query  1632  GCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             GC R   L C  DGF  M   KLPE++ + VD ++   ECK+ C+ +C+CTA++N +I N
Sbjct  330   GCKRRTLLSCNGDGFTRMKNMKLPETTMAIVDRSIGEKECKKRCLTDCNCTAFANADIRN  389

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgi  1991
             GG+GCVIWT  L D+R Y A+G Q LYVR+AA+D      + +  N  GK   +I+   +
Sbjct  390   GGTGCVIWTGNLADMRNYVADG-QDLYVRLAAAD------LVKKSNANGKIISLIVGVSV  442

Query  1992  vlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITD  2171
             +L + M         R K       N      R+R+++  MN   +SSKR+ SGE  I +
Sbjct  443   LLLLIMFCLWKRKQNREKSSAASIAN------RQRNQNLPMNGIVLSSKRQLSGENKIEE  496

Query  2172  EYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEF  2351
                  + +  AI  AT+NF+N+NK+GQGGFG VYKG+L+ G+EIAVKRLSK S QG +EF
Sbjct  497   LELP-LIELEAIVKATENFSNSNKIGQGGFGIVYKGILLDGQEIAVKRLSKTSVQGVDEF  555

Query  2352  KNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYN  2531
              NE+ LIARLQH NLV++LGCC+D DEKMLIYEY+EN SLDS LF K R S L+WK R++
Sbjct  556   MNEVTLIARLQHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNWKERFD  615

Query  2532  IICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTK  2711
             I  GVARGLLYLHQDSRFRIIHRDLK SN+LLD+ M PKISDFGMAR+F  DETEA T K
Sbjct  616   ITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDRNMVPKISDFGMARIFERDETEANTMK  675

Query  2712  RIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRL  2891
              +VGTYGYMSPEYAM G+FS KSD FSFGV+VLE+++G++N+GF    +E+NLL  AWR 
Sbjct  676   -VVGTYGYMSPEYAMGGIFSEKSDVFSFGVMVLEIITGKRNRGF----DEDNLLSCAWRN  730

Query  2892  WGEGRGSELLDSVIA---SESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             W EGR  E++D VI    S   S F + +V++CIQ+GLLCVQE AE+RP M++V+ ML  
Sbjct  731   WKEGRALEIVDPVIVNSFSPLSSPFQLQEVLKCIQIGLLCVQELAENRPTMSSVVWMLGN  790

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ----SLNQLTVTMLDAR  3194
             + T +PQPK PG C+   P ++D SS+   D     ++NQ T +++DAR
Sbjct  791   EATEIPQPKSPG-CVRRSPYELDPSSSRQRDDDESWTVNQYTCSVIDAR  838


 Score = 54.3 bits (129),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLV++LGCCI+  EKMLI       SLD+++F  T+R++LNW
Sbjct  566  QHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNW  610



>emb|CDX96134.1| BnaA07g25970D [Brassica napus]
Length=854

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/829 (51%), Positives = 564/829 (68%), Gaps = 31/829 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G+VF+LGFF    +S   Y+GIWYK++ ++T VWVANRD PL NS G LKI  
Sbjct  47    NRTLVSPGDVFELGFFKTTSSSR-WYLGIWYKQLPEKTYVWVANRDNPLPNSIGTLKIS-  104

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ L+D +  S+WS++ T  N+  P   +A+LL +GNFV+R  N+ +   +LWQSFDY
Sbjct  105   NMNLVLLDHSNKSVWSTNLTRRNERTP--VMAELLANGNFVMRDSNNNDASEFLWQSFDY  162

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PTDTLLP MKLG++ K G NR++ SWRS  DPS GD ++KL+   LPE +L   D+  +R
Sbjct  163   PTDTLLPEMKLGYNLKKGLNRFLISWRSSDDPSSGDYSYKLEPRRLPEFYLLQGDVREHR  222

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             SG WNG+ FSG+ E +    + ++F  T  EV Y+F + N + +SRL ++ T   ER TW
Sbjct  223   SGPWNGIRFSGILEDQKLSYMEYNFTETSEEVAYTFRMTNNSFYSRLTLSSTGYFERLTW  282

Query  1455  IPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
              P + IWN FW++P + QCD YR CG +  CD + SP C C  GF PRN Q W+LR    
Sbjct  283   APSSVIWNVFWSSPANPQCDMYRMCGPYSYCDVNTSPSCNCIQGFDPRNLQQWALRISLR  342

Query  1632  GCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             GC R   L C  DGF  M   KLPE++ + VD ++   ECK+ C+ +C+CTA++N +I N
Sbjct  343   GCKRRTLLSCNGDGFTRMKNMKLPETTMAIVDRSIGEKECKKRCLTDCNCTAFANADIRN  402

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgi  1991
             GG+GCVIWT  L D+R Y A+G Q LYVR+AA+D      + +  N  GK   +I+   +
Sbjct  403   GGTGCVIWTGNLADMRNYVADG-QDLYVRLAAAD------LVKKSNANGKIISLIVGVSV  455

Query  1992  vlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITD  2171
             +L + M         R K       +I     R+R+++  MN   +SSKR+ SGE  I +
Sbjct  456   LLLLIMFCLWKRKQNREKSS---AASIVETANRQRNQNLPMNGIVLSSKRQLSGENKIEE  512

Query  2172  EYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEF  2351
                  + +  AI  AT+NF+N+NK+GQGGFG VYKG+L+ G+EIAVKRLSK S QG +EF
Sbjct  513   LELP-LIELEAIVKATENFSNSNKIGQGGFGIVYKGILLDGQEIAVKRLSKTSVQGVDEF  571

Query  2352  KNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYN  2531
              NE+ LIARLQH NLV++LGCC+D DEKMLIYEY+EN SLDS LF K R S L+WK R++
Sbjct  572   MNEVTLIARLQHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNWKERFD  631

Query  2532  IICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTK  2711
             I  GVARGLLYLHQDSRFRIIHRDLK SN+LLD+ M PKISDFGMAR+F  DETEA T K
Sbjct  632   ITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDRNMVPKISDFGMARIFERDETEANTMK  691

Query  2712  RIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRL  2891
              +VGTYGYMSPEYAM G+FS KSD FSFGV+VLE+++G++N+GF    +E+NLL  AWR 
Sbjct  692   -VVGTYGYMSPEYAMGGIFSEKSDVFSFGVMVLEIITGKRNRGF----DEDNLLSCAWRN  746

Query  2892  WGEGRGSELLDSVIA---SESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             W EGR  E++D VI    S   S F + +V++CIQ+GLLCVQE AE+RP M++V+ ML  
Sbjct  747   WKEGRALEIVDPVIVNSFSPLSSPFQLQEVLKCIQIGLLCVQELAENRPTMSSVVWMLGN  806

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ----SLNQLTVTMLDAR  3194
             + T +PQPK PG C+   P ++D SS+   D     ++NQ T +++DAR
Sbjct  807   EATEIPQPKSPG-CVRRSPYELDPSSSRQRDDDESWTVNQYTCSVIDAR  854


 Score = 54.3 bits (129),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLV++LGCCI+  EKMLI       SLD+++F  T+R++LNW
Sbjct  582  QHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNW  626



>gb|KHN33626.1| Receptor-like serine/threonine-protein kinase SD1-8 [Glycine 
soja]
Length=685

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/696 (57%), Positives = 509/696 (73%), Gaps = 15/696 (2%)
 Frame = +3

Query  1119  MKLGWDSKTGRNRYISSWRSP-TDPSEGDITFKLDINGLPEAFLRNKDIIIYRSGGWNGV  1295
             MK+GW+  TG  ++++SW++  +DPS GD +FK+D  G+PE FL +   I YRSG WNG 
Sbjct  1     MKMGWNLDTGAEKHLTSWKNTGSDPSSGDYSFKIDTRGIPEIFLSDDQNIAYRSGPWNGE  60

Query  1296  AFSGVPEMEP-KEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIPENRI  1472
              FSGVPEM+P  + I F F   K+ VYYSF I N+++ SRL+V     L+R TW+P ++ 
Sbjct  61    RFSGVPEMQPDTDSITFDFSYDKHGVYYSFSIGNRSILSRLVVTSGGELKRLTWVPSSKT  120

Query  1473  WNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCFRYDE  1652
             W  FW APKDQCD YR CG +G+CD++ SPVC C  GF+PRNQQAW+LRDGS GC R  +
Sbjct  121   WTTFWYAPKDQCDGYRACGPYGLCDSNASPVCTCVGGFRPRNQQAWNLRDGSDGCERKTD  180

Query  1653  LDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGSGCVI  1832
             LDC +D FL +   KLPE++  F + +M+L EC+++C+R+CSCTAY+N  I+NGGSGCV 
Sbjct  181   LDCGSDKFLHVKNVKLPETTYVFANGSMNLRECQDLCLRDCSCTAYANIQITNGGSGCVT  240

Query  1833  WTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlgigmv  2012
             W+ EL D+R Y A GGQ LYVR+AASD +     +   N  G+   + ++  +++   +V
Sbjct  241   WSGELEDMRLYPA-GGQHLYVRLAASDVDDIVGGSHKKNHTGEVVGITISAAVIILGLVV  299

Query  2013  lfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEYELPIF  2192
             +F                    RG+  RSRD L +    S+ RE+SGE  + D+ ELP+F
Sbjct  300   IFWKKRKLFSISNVKTAP----RGSFRRSRDLLTSERMFSTNRENSGERNM-DDIELPMF  354

Query  2193  DFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNELRLI  2372
             DFN I MATDNF+ ANKLGQGGFG VY+G L+ G++IAVKRLSKNS QG EEFKNE++LI
Sbjct  355   DFNTITMATDNFSEANKLGQGGFGIVYRGRLMEGQDIAVKRLSKNSVQGVEEFKNEVKLI  414

Query  2373  ARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIICGVAR  2552
              RLQHRNLV+L GCC+++DEK+L+YEYMEN+SLDSILFDK +  +LDWKRR+NIICG+AR
Sbjct  415   VRLQHRNLVRLFGCCIEMDEKLLVYEYMENRSLDSILFDKAKKPILDWKRRFNIICGIAR  474

Query  2553  GLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIVGTYG  2732
             GLLYLH DSRFRIIHRDLKASN+LLD EMNPKISDFGMARLFG ++TEA T  R+VGTYG
Sbjct  475   GLLYLHHDSRFRIIHRDLKASNILLDSEMNPKISDFGMARLFGTNQTEANTL-RVVGTYG  533

Query  2733  YMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGEGRGS  2912
             YMSPEYAMDG FSVKSD FSFGVLVLE+++G+KN+GFY  + + NLLG AWR W +G   
Sbjct  534   YMSPEYAMDGNFSVKSDVFSFGVLVLEIITGKKNRGFYYSNEDMNLLGNAWRQWRDGSTL  593

Query  2913  ELLDSVIA-SESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQPKQ  3089
             EL+DS I  S S SE    V+RCI VGLLCVQE+AEDRP M++V+LML  +   +PQP+ 
Sbjct  594   ELIDSSIGDSCSQSE----VLRCIHVGLLCVQERAEDRPTMSSVLLMLSSESAIMPQPRN  649

Query  3090  PGFCLASKPVKM-DSSSTSYNDQSLNQLTVTMLDAR  3194
             PGF +   PV+   SSS      S+NQ+TVT+LDAR
Sbjct  650   PGFSIGKNPVETDSSSSKKDQSWSVNQVTVTLLDAR  685



>gb|AFP33771.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
Length=858

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/830 (50%), Positives = 562/830 (68%), Gaps = 22/830 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+T+VS G VF+LGFF   G+S   Y+GIWYK+I  RT VWVANRD PL NS G LK
Sbjct  43    ISSNKTIVSPGGVFELGFFKLLGDS--WYIGIWYKKIPQRTYVWVANRDNPLSNSIGILK  100

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             +  + N+ L++ +   +WS++ T   +V    VA+LLD+GNFV++     + + +LWQSF
Sbjct  101   LS-NANLVLLNQSNIPVWSTTQTG--AVRSLVVAELLDNGNFVLKDSRTNDSDGFLWQSF  157

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFL-RNKDII  1265
             D+PTDTLLP MKLG D K G N+ +SSW+S  DPS GD  FKL+  G+PE F  + ++  
Sbjct  158   DFPTDTLLPQMKLGRDLKRGLNKSLSSWKSSFDPSSGDYVFKLEPQGIPEFFTWKRRNFR  217

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             ++RSG W+G+ FSG+P+M   + + ++F   + EV YSF + N +++SRL +N   LL+R
Sbjct  218   LFRSGPWDGIGFSGIPDMHLLDDLMYNFTENREEVAYSFRLTNHSVYSRLTINSDGLLQR  277

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             + W+PE++ W  FW+  KD CD Y  CG +  CD   SP C C  GF+P   Q W+L D 
Sbjct  278   FEWVPEDQEWTIFWSTLKDSCDIYNSCGPYAYCDVSTSPACNCIEGFQPPYPQEWALGDV  337

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
             +G C R  +L C  D F+ +   KLP ++   VD  +   +C+E C  NC+C A++  +I
Sbjct  338   TGRCQRKTKLSCIGDKFIRLRNMKLPPTTEVIVDKRIGFKDCEERCTSNCNCLAFAITDI  397

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
              NGGSGCVIW  E  DIR Y A GGQ LYVR+AA+D   T    R  N  GK   +I+  
Sbjct  398   RNGGSGCVIWIEEFVDIRNYAA-GGQDLYVRLAAADIGGT----RTRNVSGKIIGLIVGF  452

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              ++L +  +++     K+R+ R     N      R+R ++ L N   ISS+R + GE   
Sbjct  453   SVMLLVTFIMYCFWQRKQRRARAIAAHNETEH--RQRIQEFLTNGVVISSRRHNFGENE-  509

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
             T+E ELP  +F A+ MATDNF+++NKLG+GGFG VYKG L  G+EIAVKRLS  S QG +
Sbjct  510   TEEIELPFMEFGAVVMATDNFSDSNKLGEGGFGLVYKGRLPDGKEIAVKRLSAVSHQGTD  569

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EF NE RLIARLQH NLV+LLGC  D  EKMLIYEY+EN SLD  LF K +S  LDWK+R
Sbjct  570   EFMNEARLIARLQHINLVRLLGCYADATEKMLIYEYLENLSLDFHLFYKTQSYKLDWKKR  629

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ RGLLYLHQDSRF+IIHRDLKASN+LLD+ M PKISDFGMAR+F  +ETEA  
Sbjct  630   FDIINGITRGLLYLHQDSRFKIIHRDLKASNILLDEYMTPKISDFGMARIFERNETEA-N  688

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             T+++VGTYGYMSPEYAMDG+FS KSD FSFGVLVLE+VSG++N+GFY  +++ NLL   W
Sbjct  689   TRKVVGTYGYMSPEYAMDGIFSEKSDVFSFGVLVLEIVSGKRNRGFYNSNHDSNLLSYTW  748

Query  2886  RLWGEGRGSELLDSVI---ASESHSEFVDQ-VMRCIQVGLLCVQEKAEDRPNMAAVMLML  3053
               W +G G ++ D +I    S S S F  Q V+RCIQ+GLLCVQE+AEDRP M++V LML
Sbjct  749   ENWKDGIGLQIADPIIIDCPSSSFSTFKPQEVLRCIQIGLLCVQERAEDRPKMSSVALML  808

Query  3054  IGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
               +  ++PQPK PG+C+    ++ D SS++  D    ++NQ+TV+ + AR
Sbjct  809   GSQTEAIPQPKPPGYCVGRSFIEADLSSSTQLDHGSSTVNQITVSAMKAR  858



>dbj|BAE95182.1| S-locus receptor kinase [Brassica oleracea]
Length=860

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/830 (52%), Positives = 568/830 (68%), Gaps = 27/830 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G+VF+LGFF    +S   Y+GIWYK++  RT VWVANRD PL NS G LKI  
Sbjct  47    NRTLVSPGDVFELGFFKTTSSSR-WYLGIWYKKLPGRTYVWVANRDNPLSNSIGTLKIS-  104

Query  918   DGNIHLVDGTGNSIWSSSNT--NNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFD  1091
             + N+ L+D +  S+WS+++T  N +S+    VA+LL +GNF+VR  N+ +   +LWQSFD
Sbjct  105   NMNLVLLDHSNKSVWSTNHTRGNERSL---VVAELLANGNFLVRDSNNNDAYGFLWQSFD  161

Query  1092  YPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLD-INGLPEAFLRNKDIII  1268
             YPTDTLLP MKLG+D K G NR ++SWRS  DPS GD ++KL+    LPE +L   D+  
Sbjct  162   YPTDTLLPEMKLGYDLKIGLNRSLTSWRSSDDPSSGDFSYKLEGSRRLPEFYLMQGDVRE  221

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             +RSG WNG+ FSG+PE +    + ++F     EV Y+F + N + +SRL ++    LER 
Sbjct  222   HRSGPWNGIQFSGIPEDQKLSYMMYNFTDNSEEVAYTFLMTNNSFYSRLKLSSEGYLERL  281

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TW P + IWN FW++P  QCD YR CG++  CD + SP C C  GF P+N+Q W LR   
Sbjct  282   TWAPSSGIWNVFWSSPNHQCDMYRMCGTYSYCDVNTSPSCNCIPGFNPKNRQQWDLRIPI  341

Query  1629  GGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
              GC R   L C  DGF  M   KLP+++ + VD ++S+ EC++ C+ +C+CTA++N +I 
Sbjct  342   SGCIRRTRLGCSGDGFTRMKNMKLPDTTMAIVDRSISVKECEKRCLSDCNCTAFANADIR  401

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             N G+GCVIWT EL D+R Y AEGGQ LYVR+AA+D      + +  N   K   +I+   
Sbjct  402   NRGTGCVIWTGELEDMRNY-AEGGQDLYVRLAAAD------LVKKRNANWKIISLIVGVS  454

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
             +VL + ++L  +  L +RK  R       +   ++R+++ LMN    S+KR+ S E    
Sbjct  455   VVLLLLLLLLIMFCLWKRKQNRAKAMATSIVN-QQRNQNVLMNGMTQSNKRQLSRENK-A  512

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             DE+ELP+ +  A+  AT+NF+N N+LGQGGFG VYKGML  G+E+AVKRLSK S QG +E
Sbjct  513   DEFELPLIELEAVVKATENFSNCNELGQGGFGIVYKGML-DGQEVAVKRLSKTSLQGIDE  571

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             F NE+RLIARLQH NLV++LGCC++ DEK+LIYEY+EN SLD  LF KKRSS LDWK R+
Sbjct  572   FMNEVRLIARLQHINLVRILGCCIEADEKILIYEYLENSSLDYFLFGKKRSSNLDWKDRF  631

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
              I  GVARGLLYLHQDSRFRIIHRDLK  N+LLDK M PKISDFGMAR+F  DET+A  T
Sbjct  632   AITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKISDFGMARIFARDETQA-RT  690

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
                VGTYGYMSPEYAMDG+ S K+D FSFGV+VLE+VSG++N+GFY  + E NL   AW 
Sbjct  691   DNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRNRGFYQVNPENNLPSYAWT  750

Query  2889  LWGEGRGSELLDSVIASESH---SEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              W EGR  E++D VI   S    S F   +V++CIQ+GLLC+QE+AE RP M++V+ ML 
Sbjct  751   HWAEGRALEIVDPVIVDSSSSLPSTFQPKEVLKCIQIGLLCIQERAEHRPTMSSVVWMLG  810

Query  3057  GKGTSLPQPKQPGFCL-ASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              + T +PQPK P +CL AS      SSS  ++D    ++N+ T +++DAR
Sbjct  811   SEATEIPQPKPPVYCLIASYYANNPSSSRQFDDDESWTVNKYTCSVIDAR  860



>dbj|BAF91400.1| S-locus receptor kinase [Brassica oleracea]
Length=847

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/829 (51%), Positives = 565/829 (68%), Gaps = 27/829 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G+VF+LGFF+PG +S   Y+GIWYK++  RT VWVANRD PL NS G LKI  
Sbjct  36    NRTLVSPGDVFELGFFTPGSSSR-WYLGIWYKKVYFRTYVWVANRDNPLSNSIGTLKIS-  93

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ L+D +  S+WS++ T  N+  P   VA+LL +GNFV+R  N+ +   +LWQSFDY
Sbjct  94    NMNLVLLDHSNKSVWSTNLTRGNERSP--VVAELLPNGNFVMRFSNNNDENEFLWQSFDY  151

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PTDTLLP MKLG+D KTG NR ++SWRS  DPS G++++KL+   LPE +L      I+R
Sbjct  152   PTDTLLPEMKLGYDLKTGLNRLLTSWRSSDDPSSGEVSYKLENRELPEFYLLQNGFEIHR  211

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             SG WNGV FSG+P+ +    + ++F     EV Y+F I N +++SRL V+    L+R T 
Sbjct  212   SGPWNGVRFSGIPDNQKLSYLVYNFTENSEEVAYTFRITNNSIYSRLKVSPDGFLQRLTL  271

Query  1455  IPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
             IP + +WN FW++P D +CD Y+ CG +  CD + SP+C C  GF P N Q W++ +   
Sbjct  272   IPISIVWNLFWSSPVDIRCDIYKACGPYSYCDGNTSPLCNCIQGFDPWNMQHWNMGEAVA  331

Query  1632  GCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             GC R   L C  DGF  M   KLPE++ + VD ++ + ECK+ C+ +C+CTA++N +I N
Sbjct  332   GCIRRTPLRCSDDGFTRMRKMKLPETTKAIVDRSIGVKECKKRCLSDCNCTAFANADIRN  391

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgi  1991
             GG+GCVIW  EL DIR Y AEG Q LYVR+AA+D  +     R  N      K+I     
Sbjct  392   GGTGCVIWAGELQDIRTYFAEG-QDLYVRLAAADLVK----KRNANW-----KIISLIVG  441

Query  1992  vlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITD  2171
             V  + ++L  ++    ++ +            ++R+++ LMN    S+KR+ S E    D
Sbjct  442   VSVVLLLLLLIMFCLWKRKQNRAKAMATSIVNQQRNQNVLMNGMTQSNKRQLSRENK-AD  500

Query  2172  EYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEF  2351
             E+ELP+ +  A+  AT+NF+N N+LGQGGFG VYKGML  G+E+AVKRLSK S QG +EF
Sbjct  501   EFELPLIELEAVVKATENFSNCNELGQGGFGIVYKGML-DGQEVAVKRLSKTSLQGMDEF  559

Query  2352  KNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYN  2531
              NE+RLIARLQH NLV++LGCC++ +EK+LIYEY+EN SLD  LF KKRSS L+WK R+ 
Sbjct  560   MNEVRLIARLQHINLVRILGCCIEAEEKILIYEYLENSSLDYFLFGKKRSSNLNWKDRFA  619

Query  2532  IICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTK  2711
             I  GVARGLLYLHQDSRFRIIHRDLK  N+LLDK M PKISDFGMAR+F  DET+A  T 
Sbjct  620   ITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKISDFGMARIFARDETQA-RTD  678

Query  2712  RIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRL  2891
               VGTYGYMSPEYAMDG+ S K+D FSFGV+VLE+VSG++N+GFY  + E NLL  AW  
Sbjct  679   NAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRNRGFYQVNPENNLLSYAWSH  738

Query  2892  WGEGRGSELLDSVI----ASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             W EGR  E++D VI    AS   +    +V++CIQ+GLLC+QE+AE RP M++V+ ML  
Sbjct  739   WAEGRALEIVDPVIVDPLASLPSTFQPKEVLKCIQIGLLCIQERAEHRPTMSSVVWMLGS  798

Query  3060  KGTSLPQPKQPGFCL-ASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             + T +PQPK P +CL AS      SSS  ++D    ++N+ T +++DAR
Sbjct  799   EATEIPQPKPPVYCLIASYYANNHSSSRQFDDDESWTVNKYTCSVIDAR  847



>dbj|BAF56997.1| S receptor kinase [Brassica napus]
 dbj|BAF57001.1| S receptor kinase [Brassica napus]
Length=851

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/829 (51%), Positives = 563/829 (68%), Gaps = 34/829 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G+VF+LGFF    +S   Y+GIWYK++ ++T VWVANRD PL NS G LKI  
Sbjct  47    NRTLVSPGDVFELGFFKTTSSSR-WYLGIWYKQLPEKTYVWVANRDNPLPNSIGTLKIS-  104

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ L+D +  S+WS++ T  N+  P   +A+LL +GNFV+R  N+ +   +LWQSFDY
Sbjct  105   NMNLVLLDHSNKSVWSTNLTRRNERTP--VMAELLANGNFVMRDSNNNDASEFLWQSFDY  162

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PTDTLLP MKLG++ K G NR++ SWRS  DPS GD ++KL+   LPE +L   D+  +R
Sbjct  163   PTDTLLPEMKLGYNLKKGLNRFLISWRSSDDPSSGDYSYKLEPRRLPEFYLLQGDVREHR  222

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             SG WNG+ FSG+ E +    + ++F  T  EV Y+F + N + +SRL ++ T   ER TW
Sbjct  223   SGPWNGIRFSGILEDQKLSYMEYNFTETSEEVAYTFRMTNNSFYSRLTLSSTGYFERLTW  282

Query  1455  IPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
              P + IWN FW++P + QCD YR CG +  CD + SP C C  GF PRN Q W+LR    
Sbjct  283   APSSVIWNVFWSSPANPQCDMYRMCGPYSYCDVNTSPSCNCIQGFDPRNLQQWALRISLR  342

Query  1632  GCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             GC R   L C  DGF  M   KLPE++ + VD ++   ECK+ C+ +C+CTA++N +I N
Sbjct  343   GCKRRTLLSCNGDGFTRMKNMKLPETTMAIVDRSIGEKECKKRCLTDCNCTAFANADIRN  402

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgi  1991
             GG+GCVIWT  L D+R Y A+G Q LYVR+AA+D      + +  N  GK   +I+   +
Sbjct  403   GGTGCVIWTGNLADMRNYVADG-QDLYVRLAAAD------LVKKSNANGKIISLIVGVSV  455

Query  1992  vlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITD  2171
             +L + M         R K       N      R+R+++  MN   +SSKR+ SGE  I +
Sbjct  456   LLLLIMFCLWKRKQNREKSSAASIAN------RQRNQNLPMNGIVLSSKRQLSGENKIEE  509

Query  2172  EYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEF  2351
                  + +  AI  AT+NF+N+NK+GQGGFG VYKG+L+ G+EIAVKRLSK S QG +EF
Sbjct  510   LELP-LIELEAIVKATENFSNSNKIGQGGFGIVYKGILLDGQEIAVKRLSKTSVQGVDEF  568

Query  2352  KNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYN  2531
              NE+ LIARLQH NLV++LGCC+D DEKMLIYEY+EN SLDS LF K R S L+WK R++
Sbjct  569   MNEVTLIARLQHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNWKERFD  628

Query  2532  IICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTK  2711
             I  GVARGLLYLHQDSRFRIIHRDLK SN+LLD+ M PKISDFGMAR+F  DETEA T K
Sbjct  629   ITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDRNMVPKISDFGMARIFERDETEANTMK  688

Query  2712  RIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRL  2891
              +VGTYGYMSPEYAM G+FS KSD FSFGV+VLE+++G++N+GF    +E+NLL  AWR 
Sbjct  689   -VVGTYGYMSPEYAMGGIFSEKSDVFSFGVMVLEIITGKRNRGF----DEDNLLSCAWRN  743

Query  2892  WGEGRGSELLDSVIA---SESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             W EGR  E++D VI    S   S F + +V++CIQ+GLLCVQE AE+RP M++V+ ML  
Sbjct  744   WKEGRALEIVDPVIVNSFSPLSSPFQLQEVLKCIQIGLLCVQELAENRPTMSSVVWMLGN  803

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ----SLNQLTVTMLDAR  3194
             + T +PQPK PG C+   P ++D SS+   D     ++NQ T +++DAR
Sbjct  804   EATEIPQPKSPG-CVRRSPYELDPSSSRQRDDDESWTVNQYTCSVIDAR  851


 Score = 54.3 bits (129),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLV++LGCCI+  EKMLI       SLD+++F  T+R++LNW
Sbjct  579  QHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNW  623



>dbj|BAF57003.1| S receptor kinase [Brassica rapa]
Length=858

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/830 (51%), Positives = 565/830 (68%), Gaps = 30/830 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G+VF+LGFF    +S   Y+GIWYK++ +RT VWVANRD PL N+ G LKI  
Sbjct  48    NRTLVSPGDVFELGFFRTNSSSP-WYLGIWYKQLSERTYVWVANRDSPLSNAMGILKISG  106

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ ++D +  S+WS++ T  N+  P   VA+LL +GNFV+R  N+ +   +LWQSFDY
Sbjct  107   N-NLVILDHSNKSVWSTNLTRGNERSP--VVAELLANGNFVMRDSNNNDASGFLWQSFDY  163

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFLRNKDIIIY  1271
             PTDTLLP M+LG+D KT  NR+++SW++  DPS G+I++KLD   GLPE +L    +   
Sbjct  164   PTDTLLPEMELGYDLKTRLNRFLTSWKNSDDPSSGEISYKLDTQRGLPEFYLLKDGLRAQ  223

Query  1272  RSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYT  1451
             RSG WNGV FSG+PE +    + ++F+    EV Y+F + N +++SR+ V+    L R T
Sbjct  224   RSGPWNGVKFSGIPEDQKLNYMVYNFIENSEEVAYTFRMTNNSIYSRIQVSPAGFLARLT  283

Query  1452  WIPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
               P    WN FW AP+D QCD Y+ CG +  CD + SP+C C  GFKP ++Q W LR+ S
Sbjct  284   TTPTAWEWNWFWYAPEDPQCDVYKTCGPYAYCDLNTSPLCNCIQGFKPFDEQQWDLRNPS  343

Query  1629  GGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
             GGC R   L C  DGF  M   KLPE++ + VD ++ + EC++MC+ +C+CTA++N +I 
Sbjct  344   GGCIRRTPLSCSGDGFTRMKNMKLPETTMAVVDRSIGVKECEKMCLSDCNCTAFANADIR  403

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             NGG+GCVIWT EL DIR Y  + GQ LYVR+AA+D      + +  N  GKT  +I+  G
Sbjct  404   NGGTGCVIWTGELEDIRNY-FDDGQDLYVRLAAAD------LVKKRNANGKTITLIVGVG  456

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
             ++  + +        KR K       N      R+R+ D L+N   +SSKR+   E  I 
Sbjct  457   LLFIMIVFCLWKRKQKRGKEIATSIVN------RQRNHDVLINGMILSSKRQLPRENKIE  510

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             +     + +  A+  AT+NF+N NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG +E
Sbjct  511   ELELP-LIELEAVVKATENFSNCNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGTDE  569

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             F NE+RLIARLQH NLV++LGCC+D  E MLIYEY+EN SLDS LF KKRS  L+WK R+
Sbjct  570   FMNEVRLIARLQHINLVRILGCCIDAGETMLIYEYLENSSLDSYLFGKKRSCKLNWKDRF  629

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             +I  GVARGLLYLHQDSRFRIIHRD+K SN+LLD+ M PKISDFGMAR+   DETEA  T
Sbjct  630   DITNGVARGLLYLHQDSRFRIIHRDMKVSNILLDQNMIPKISDFGMARIVARDETEAN-T  688

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             + +VGTYGYMSPEYAMDG+FS KSD FSFGV+VLE++SG++++GFY  ++E NLL   W 
Sbjct  689   RNVVGTYGYMSPEYAMDGVFSEKSDVFSFGVIVLEIISGKRSRGFYHLNHENNLLSYVWS  748

Query  2889  LWGEGRGSELLDSVIASESHSEFV----DQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              W EGR  E++D VI     S        +V++CIQ+GLLCVQE+AE RP M++V+ ML 
Sbjct  749   HWTEGRALEIVDPVIVDSLSSLAATFQPKEVLKCIQIGLLCVQERAEHRPTMSSVVRMLG  808

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSY--NDQS--LNQLTVTMLDAR  3194
              + T +PQPK PG+CL S   + + SS+ Y  +D+S  +NQ T +++DAR
Sbjct  809   SEATEIPQPKPPGYCLVSSHYENNPSSSRYCNDDESWTVNQYTCSVIDAR  858



>emb|CAA55950.1| unnamed protein product [Brassica oleracea var. viridis]
Length=850

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/824 (50%), Positives = 557/824 (68%), Gaps = 23/824 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G+VF+LGFF    +S   Y+GIWYK + DRT VW+ANRD P+ NSTG LKI  
Sbjct  45    NKTLVSPGDVFELGFFKTTSSSR-WYLGIWYKTLSDRTYVWIANRDNPISNSTGTLKISG  103

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             + N+ L+  +   +WS+ N   +S     VA+LL +GNFV+R  N+ +   +LWQSFDYP
Sbjct  104   N-NLVLLGDSNKPVWST-NLTRRSERSPVVAELLANGNFVMRDSNNNDASQFLWQSFDYP  161

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
             TDTLLP MKLG+D KTG +R+++SWRS  DPS G+ +++L+    PE +LR+    ++RS
Sbjct  162   TDTLLPDMKLGYDLKTGLDRFLTSWRSLDDPSSGNFSYRLETRKFPEFYLRSGIFRVHRS  221

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWI  1457
             G WNG+ FSG+P+ +    + ++F     EV Y+F + N +++SRL V++    ER TW 
Sbjct  222   GPWNGIRFSGIPDDQKLSYMVYNFTDNSEEVAYTFRMTNNSIYSRLTVSFLGHFERQTWN  281

Query  1458  PENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGG  1634
             P   +WN FW+   D QCD Y+ CG +  CD + SP+C C  GF P + + W  R  +GG
Sbjct  282   PSLGMWNAFWSFILDSQCDIYKMCGPYAYCDVNTSPICNCIQGFNPSDVEQWDRRSWAGG  341

Query  1635  CFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNG  1814
             C R   L C  DGF  M   KLPE++ + VD ++ + EC++ C+ +C+CTA+SN +I NG
Sbjct  342   CIRRTRLSCSGDGFTRMKNMKLPETTMAIVDRSIGVKECEKKCLSDCNCTAFSNADIRNG  401

Query  1815  GSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgiv  1994
             G GCVIWT  L D+R Y A+G Q LY R+AA D  +     R  N     K + L  G+ 
Sbjct  402   GMGCVIWTGRLDDMRNYAADG-QDLYFRLAAVDLVK----KRNANW----KIISLTVGVT  452

Query  1995  lgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDE  2174
             + + +++F L   K+++ +   T  +     R+R+++  MN   +SSK E S E  I +E
Sbjct  453   VLLLLIMFCLWKRKQKRAKANATSIVN----RQRNQNLPMNGMVLSSKTEFSEENKI-EE  507

Query  2175  YELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFK  2354
              ELP+ D   +  AT+NF+N NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG +EF 
Sbjct  508   LELPLIDLETVVKATENFSNCNKLGQGGFGIVYKGRLLDGKEIAVKRLSKTSVQGTDEFM  567

Query  2355  NELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNI  2534
             NE+ LIARLQH NLV+++GCC++ DEKMLIYEY+EN SLDS LF K R S L+WK R++I
Sbjct  568   NEVTLIARLQHINLVQIIGCCIEADEKMLIYEYLENLSLDSFLFGKTRRSKLNWKERFDI  627

Query  2535  ICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKR  2714
               GVARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  +ETEA T K 
Sbjct  628   TNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARMFAREETEASTMK-  686

Query  2715  IVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLW  2894
             +VGTYGYMSPEYAM G+FS KSD FSFGV+VLE+V+G++N GF   + E++LL  AW  W
Sbjct  687   VVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVTGKRNSGFNNLNYEDHLLNYAWSHW  746

Query  2895  GEGRGSELLDSVIASESHSEFVDQ-VMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTS  3071
              EG+  E++D V      S F  Q V++CIQ+GLLCVQE AE+RP M++V+ ML  + T 
Sbjct  747   KEGKALEIVDPVTVDSLPSTFQKQEVLKCIQIGLLCVQELAENRPTMSSVVWMLGSEATE  806

Query  3072  LPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             +PQPK PG+C+   P ++D SS+   D    ++NQ T + +DAR
Sbjct  807   IPQPKPPGYCIRRSPYELDPSSSRQYDNDEWTVNQYTCSFIDAR  850


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLV+++GCCIE  EKMLI       SLD+F+F  T+R++LNW
Sbjct  577  QHINLVQIIGCCIEADEKMLIYEYLENLSLDSFLFGKTRRSKLNW  621



>gb|EPS70219.1| hypothetical protein M569_04543, partial [Genlisea aurea]
Length=738

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/713 (56%), Positives = 512/713 (72%), Gaps = 16/713 (2%)
 Frame = +3

Query  744   TLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNS-TGFLKIGED  920
             TL+S G+ F+LGFFS G N    YVGIWY  I+ RT+VWVANRD P++++ +    I   
Sbjct  33    TLLSPGQEFELGFFS-GENPDNWYVGIWYYNIQPRTVVWVANRDSPVKSAASSNFTIIPG  91

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             GN+ L++ +G  +W SS+ +  +    TVA+LLD GN +VR E+D    NY+WQSFD+PT
Sbjct  92    GNLALLNDSGIPVWISSSFSGGAEIA-TVAELLDDGNLIVRYESDAG--NYIWQSFDHPT  148

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DTLLPGMKLGWDSKTG NR I+SW+   DPS GD  F+++ +G PE +L N+ +I+YRSG
Sbjct  149   DTLLPGMKLGWDSKTGENRAITSWKDSGDPSTGDYAFRMNTSGFPEVYLTNQGVIMYRSG  208

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ FSGVPEM P  V+ F+F+ T  E+ YSF + NK+++S L++     L+R TWIP
Sbjct  209   PWNGLRFSGVPEMAPNSVLTFNFVMTPQEITYSFNLLNKSVYSILVMKSYGSLQRLTWIP  268

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
               +IWN FW AP DQCD+Y  CG  GICD + SPVC C  GF+P+N QAW+LRDGS GC 
Sbjct  269   STKIWNLFWYAPTDQCDDYGVCGFNGICDVNSSPVCRCLKGFQPKNLQAWNLRDGSDGCV  328

Query  1641  RYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGS  1820
               +  DC TDGF  MN  KLP+S+ + VD    LD C+E C +NCSC  YS  N++ GGS
Sbjct  329   IVNGFDCETDGFYLMNNVKLPDSAAATVDPESGLDRCREACRKNCSCRGYSAVNVAAGGS  388

Query  1821  GCVIWTAELFDIRQYT-AEGGQLLYVRVAASDAEQTGEVARGGN-GFGKTKKVILACgiv  1994
             GC  WTA+L+D+RQ+T AEGGQ  Y+RV A D E   ++      G      V +A    
Sbjct  389   GCATWTADLYDMRQFTAAEGGQDFYLRVPAVDLESKTKLTTAKMIGIVSASAVFIALVSF  448

Query  1995  lgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDE  2174
                 +        +R  L      + ++   RERS+D L+ +T   +KRE+  E+   +E
Sbjct  449   SSFLLWKNKKNRPRRNGLT-----HPKILSLRERSQDLLLISTM--NKRENPVES-TDEE  500

Query  2175  YELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFK  2354
              +LPIFD+  +  ATD F+++NKLG+GGFGSVYKG L+ G EIAVKRLSK+S QG  EF 
Sbjct  501   LDLPIFDYATLLEATDEFSDSNKLGKGGFGSVYKGKLMDGREIAVKRLSKSSIQGDGEFT  560

Query  2355  NELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNI  2534
             NE+++IARLQHRNLV+LLGCCVD+DEKML+YEYMEN SLDSILF K +SS+LDW  R+NI
Sbjct  561   NEMKMIARLQHRNLVRLLGCCVDMDEKMLVYEYMENNSLDSILFRKDKSSILDWPTRFNI  620

Query  2535  ICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKR  2714
             ICGV+RGLLYLHQDSRFRI+HRDLKASN+LLD +MNPKISDFGMAR+F GD+ EA  TKR
Sbjct  621   ICGVSRGLLYLHQDSRFRIVHRDLKASNILLDADMNPKISDFGMARIFAGDQIEA-QTKR  679

Query  2715  IVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLL  2873
             +VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE+V+G KN+GFY  +++ NLL
Sbjct  680   VVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVTGTKNRGFYRANSQLNLL  732



>ref|XP_009105220.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Brassica rapa]
 dbj|BAC76056.1| S receptor kinase [Brassica rapa]
Length=859

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/832 (50%), Positives = 572/832 (69%), Gaps = 33/832 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G VF+LGFF P G S   Y+GIWYK++  +T  WVANRD PL NS G LKI  
Sbjct  48    NRTLVSPGGVFELGFFKPSGRSR-WYLGIWYKKVSQKTYAWVANRDNPLSNSIGTLKISG  106

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             + N+ L+  + N++WS+ N   ++V    +A+LL +GNFV+R  N+++   +LWQSFD+P
Sbjct  107   N-NLVLLGQSNNTVWST-NLTRENVRSPVIAELLPNGNFVMRYSNNKDSSGFLWQSFDFP  164

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFL----RNKDI  1262
             TDTLLP MKLG+D KTGRNR+++SWRS  DPS G  T++LDI  GLPE  L     N+ +
Sbjct  165   TDTLLPEMKLGYDFKTGRNRFLTSWRSYDDPSSGKFTYELDIQTGLPEFILINRFLNQRV  224

Query  1263  IIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIV-NYTQLL  1439
             ++ RSG WNG+ FSG+PE++    + +++     E+ YSF++ N++++SRL V +YT  L
Sbjct  225   VMQRSGPWNGIEFSGIPEVQGLNYMVYNYTENSEEIAYSFQMTNQSIYSRLTVSDYT--L  282

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
              R+T IP +  W+ FW+ P D CD+   CGS+  CD + SP C C  GF P+N+Q W LR
Sbjct  283   NRFTRIPPSWGWSLFWSLPTDVCDSLYFCGSYSYCDLNTSPYCNCIRGFVPKNRQRWDLR  342

Query  1620  DGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
             DGS GC R  ++ C  DGFL +N   LP++ T+ VD T+ + +C+E C+ +C+CT+++  
Sbjct  343   DGSHGCVRTTQMSCSGDGFLRLNNMNLPDTKTASVDRTIDVKKCEEKCLSDCNCTSFATA  402

Query  1800  NISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAE-QTGEVA-RGGNGFGKTKKV  1973
             ++ NGG GCV WT +L +IR+  A  GQ LYVR+ A+D +  +GE   R G   G +  V
Sbjct  403   DVRNGGLGCVFWTGDLVEIRK-QAVVGQDLYVRLNAADLDFSSGEKRDRTGTIIGWSIGV  461

Query  1974  ILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREH-S  2150
              +   + + +           +      V   +            LMN   +  K+ H S
Sbjct  462   SVMLILSVIVFCFWRRRQKQAKADATPIVGNQV------------LMNEVVLPRKKIHFS  509

Query  2151  GETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNS  2330
             GE  + +  EL + +F A+  AT++F++ NK+G+GGFG VYKG LV G+EIAVKRLS+ S
Sbjct  510   GEDEV-ENLELSLMEFEAVVTATEHFSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMS  568

Query  2331  RQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLL  2510
              QG +EF NE+RLIA+LQH NLV+LLGCCV   EK+LIYEY+EN SLDS LFD+ RS +L
Sbjct  569   AQGTDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCML  628

Query  2511  DWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDE  2690
             +W+ R++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DE
Sbjct  629   NWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGQDE  688

Query  2691  TEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENL  2870
             TEA  T+++VGTYGYMSPEYAM+G FS+KSD FSFGVL+LE++SG++N+GF    +  NL
Sbjct  689   TEAD-TRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSNLNL  747

Query  2871  LGLAWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVML  3047
             LG  WR W EG+G E++D VI   S   F   +++RC+Q+GLLCVQE+ EDRP M++V+L
Sbjct  748   LGCVWRNWKEGQGLEIVDRVIIDSSSPTFRPREILRCLQIGLLCVQERVEDRPMMSSVVL  807

Query  3048  MLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             ML  +   +PQPKQPG+C++   ++  SS +   D    ++NQ+T++++DAR
Sbjct  808   MLGSETALIPQPKQPGYCVSQSSLETYSSWSKLRDDENWTVNQITMSIIDAR  859



>ref|XP_010910453.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Elaeis guineensis]
Length=825

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/828 (52%), Positives = 569/828 (69%), Gaps = 36/828 (4%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG  899
             N PL  N+TL+S+G  F LGFFSP  NS   Y+GIWY EI  +TIVWVANR+ P+  STG
Sbjct  31    NQPLADNETLISSGGRFALGFFSPS-NSRNRYIGIWYDEIPIQTIVWVANRENPITESTG  89

Query  900   -FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYL  1076
               L I  +G++ +       +WS++ T       N VAQLLD  NFVV+ E+  +  ++ 
Sbjct  90    GSLSIATNGSLIISTENSTVVWSTAATG----LSNPVAQLLDDANFVVKEESSTDSNSFA  145

Query  1077  WQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNK  1256
             WQSFD+PTDTLLPGMKLG D  +G NR +++W+S +DPS G+    +DI+G PE FL + 
Sbjct  146   WQSFDHPTDTLLPGMKLGVDLTSGLNRNLTAWKSSSDPSPGEYCNAMDIDGDPELFLWDG  205

Query  1257  DIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQL  1436
                ++R+G WNG  FSG+P     +   FSF+  K EV YS++I N++L SRL+VN + +
Sbjct  206   TRKLWRTGPWNGQHFSGIPGTTTYQGFIFSFVNNKEEVTYSYDIVNQSLVSRLVVNESGV  265

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
             L+R  W+  N  WN FW AP DQCD    CG +G CD + SP+C C  GF P++   W L
Sbjct  266   LQRSVWLAGNGGWNIFWFAPMDQCDPLSTCGPYGACDPNNSPICECLQGFTPKSPANWEL  325

Query  1617  RDGSGGCFRYDELDCP--TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAY  1790
             RDGS GC R  +LDC   TDGF++++  KLP++S   VD +M+LDECK MC++NCSCTAY
Sbjct  326   RDGSDGCVRKTKLDCKNGTDGFVTVSRVKLPDTSNCSVDMSMNLDECKAMCLKNCSCTAY  385

Query  1791  SNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKK  1970
             +   I  GGSGC++W +EL DIR YT + GQ LYVR+AA+D           +G G    
Sbjct  386   AGAIIGGGGSGCIMWLSELTDIRLYT-DSGQDLYVRLAAADIAAAQS-----HGSGHAPI  439

Query  1971  VILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHS  2150
              I+   +++ + +V  G                      R++ R  ++ AT++S +   S
Sbjct  440   AIIVVLVLVVLLLVCVGF-----------------FLWRRKKRRRVMLGATSLSDQ-NIS  481

Query  2151  GETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNS  2330
              E    D+ ELP+F+   +A ATDNF+  NKLG+GGFG VYKG L  G+EIAVKRL+K S
Sbjct  482   EEHFEGDDLELPLFELGNVAAATDNFSILNKLGEGGFGPVYKGKLGDGQEIAVKRLAKTS  541

Query  2331  RQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLL  2510
              QG +EFKNE+ LIA+LQHRNLV+L+GCC+  +E+MLIYEYM NKSLD+ LFDK++S+LL
Sbjct  542   VQGLDEFKNEVVLIAKLQHRNLVRLVGCCIQGEERMLIYEYMVNKSLDAFLFDKEKSALL  601

Query  2511  DWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDE  2690
             +W+ RY+II G+ARGL+YLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMAR+FGGDE
Sbjct  602   NWQTRYHIIVGIARGLVYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDE  661

Query  2691  TEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENL  2870
             TE   T+R+VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE++SG+KN+G Y  S+  NL
Sbjct  662   TEV-NTRRVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIISGKKNRGVYAHSSHLNL  720

Query  2871  LGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLM  3050
             L  AW LW E +  +L+D    S  +S   ++V++CI+VGLLCVQE+ EDRP M++V+LM
Sbjct  721   LAHAWSLWNEEKSLQLVDE---SLGYSFPANEVIKCIKVGLLCVQERPEDRPLMSSVVLM  777

Query  3051  LIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             L     ++P P+QPGF     P++++SSS+  +  +LN ++VTML  R
Sbjct  778   LGSDSAAIPNPRQPGFGTRRIPLEVESSSSKQDSCTLNSMSVTMLQGR  825


 Score = 63.2 bits (152),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRL+GCCI+G E+MLI      KSLD F+FD  K A LNW
Sbjct  559  QHRNLVRLVGCCIQGEERMLIYEYMVNKSLDAFLFDKEKSALLNW  603



>dbj|BAF91394.1| S-locus receptor kinase [Brassica rapa]
Length=844

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/833 (51%), Positives = 550/833 (66%), Gaps = 30/833 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+TLVS G+VF+LGFF         Y+G+WYK++  RT VWVANRD PL NS G LK
Sbjct  31    ISSNRTLVSPGDVFELGFFRTNSR---WYLGMWYKKLPYRTYVWVANRDNPLSNSIGTLK  87

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  + N+ ++  +  S+WS+ N    S     VA+LL +GNFV+R  N+ +   +LWQSF
Sbjct  88    ISGN-NLVILGHSNKSVWST-NLTRGSERSTVVAELLANGNFVIRYSNNNDASGFLWQSF  145

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDTLLP MKLG+D K G NR++ SWRS  DPS G+ ++KL+   LPE +L +    +
Sbjct  146   DFPTDTLLPDMKLGYDLKKGFNRFLISWRSSDDPSSGNYSYKLETRRLPEFYLSSGVFRL  205

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             +RSG WNG+  SG+PE +    + ++F+    EV Y+F + N +++SRL + ++   +R 
Sbjct  206   HRSGPWNGIQISGIPEDQNLHYMVYNFIENSEEVAYTFRMTNNSIYSRLTLGFSGDFQRL  265

Query  1449  TWIPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             TW P   IW  FW++P D QCD Y  CG    CD + SPVC C  GF P N Q W  R  
Sbjct  266   TWNPSIGIWILFWSSPVDPQCDTYVMCGPNAYCDVNTSPVCNCIQGFNPWNVQLWDQRVW  325

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
             +GGC R  +L C  DGF  M   KLPE++ + VD  + + EC++ C+ NC CTA++N +I
Sbjct  326   AGGCIRRTQLSCSGDGFTRMKKMKLPETTMAIVDRRIGVKECEKRCLSNCKCTAFANADI  385

Query  1806  SNGGSGCVIWTAELFDIRQYT--AEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVIL  1979
              NGG+GCVIWT +L D+R Y   A  GQ LYVR+AA+D      +A+  N  GK   V +
Sbjct  386   RNGGTGCVIWTEQLDDMRNYGTGATDGQDLYVRLAAAD------IAKKRNANGKIISVTV  439

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
             A  I+L + M        KR K       N      R+R+++  MN   +SSK+E SGE 
Sbjct  440   AVSILLLLIMFCLWKRKQKRTKSSSTSIAN------RQRNQNLPMNGMVLSSKQEFSGEH  493

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
                D  ELP+ +   +  AT+NF++ NKLGQGGFG VYKG L  G+EIAVKRLSK S QG
Sbjct  494   KFED-LELPLIELEVVVKATENFSDCNKLGQGGFGIVYKGRLPDGQEIAVKRLSKTSGQG  552

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EF NE+ LIARLQH NLV++LGCC++ DEKMLIYEY+EN SLDS LF K R S L+WK
Sbjct  553   TDEFMNEVTLIARLQHINLVQILGCCIEADEKMLIYEYLENLSLDSYLFGKTRRSKLNWK  612

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
              R++I  GVARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  DETEA
Sbjct  613   ERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA  672

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               TK++VGTYGYMSPEY M G+FS K+D FSFGV+VLE+VSG+KN+G Y  S E NLL  
Sbjct  673   N-TKKVVGTYGYMSPEYTMHGIFSEKTDVFSFGVIVLEIVSGKKNKGLYNLSFENNLLSY  731

Query  2880  AWRLWGEGRGSELLDSVIA---SESHSEFVDQ-VMRCIQVGLLCVQEKAEDRPNMAAVML  3047
              W  W EGR  E++D VI    S   S F  Q V++CIQ+GLLCVQE AE RP M++V+ 
Sbjct  732   VWSQWKEGRALEIVDPVIVDSLSSLPSTFQPQEVLKCIQIGLLCVQEHAEHRPMMSSVVW  791

Query  3048  MLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ----SLNQLTVTMLDAR  3194
             ML  + T +PQPK PG+C+   P ++D SS+   D     ++NQ T +++D R
Sbjct  792   MLGSEATEIPQPKPPGYCVRRSPYELDPSSSRQCDDNESWTVNQYTCSVIDPR  844


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLV++LGCCIE  EKMLI       SLD+++F  T+R++LNW
Sbjct  567  QHINLVQILGCCIEADEKMLIYEYLENLSLDSYLFGKTRRSKLNW  611



>ref|XP_008813305.1| PREDICTED: uncharacterized protein LOC103723979 [Phoenix dactylifera]
Length=1667

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/824 (51%), Positives = 566/824 (69%), Gaps = 38/824 (5%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             QTLVSAG +F+LGFFSPG N+   Y+GIWYK+I   TIVWVANR  PL +STG +KI +D
Sbjct  876   QTLVSAGGIFELGFFSPG-NTLNRYLGIWYKKIPVPTIVWVANRASPLTDSTGVVKIRKD  934

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             G++ L++G    +W+S +T + S   N VAQLLDSGNFV+R E     E+  WQSFDYP+
Sbjct  935   GSLVLLNGVAKVVWTSDSTASAS---NPVAQLLDSGNFVLRAE-----ESIAWQSFDYPS  986

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DTLLPGMKLGW+ KTG NRYISSW+S  DPS G  +FKLD +G PE FL  +   I+ SG
Sbjct  987   DTLLPGMKLGWNLKTGLNRYISSWKSSDDPSPGYYSFKLDPHGSPELFLYRESTKIHASG  1046

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ FSGVP+++  +   F F+  ++E+YY+ EI+N ++ SRL+V  +  L+R+ W+ 
Sbjct  1047  PWNGLEFSGVPQLKSDQNFRFIFISNQDEIYYTCEINNSSVVSRLVVTTSGQLQRFVWLD  1106

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
               + W+ FW+ P DQCD Y  CG FG+C+++ SP C C  GF+P++ Q W LRDGS GC 
Sbjct  1107  AIQDWHVFWSDPNDQCDRYAACGPFGVCNSNPSPTCSCLKGFQPKSPQKWILRDGSDGCV  1166

Query  1641  RYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGS  1820
             R   LDC  DGF++++  KLP+++++ VD +MSLDEC+E C++NCSC AY++ NIS   S
Sbjct  1167  RITRLDCKGDGFVTVSNMKLPDTTSATVDKSMSLDECRESCLKNCSCRAYASANISGALS  1226

Query  1821  GCVIWTAELFDIRQYTAEGGQLLYVRVAASDAE--QTGEVARGGNGFGKTKKVILACgiv  1994
             GC+IW  +L D+R +  + GQ L+VR+AAS+     +G+  R  N     KKV++     
Sbjct  1227  GCIIWATDLIDLRNF-VDAGQDLHVRLAASELANMNSGQSRRNSN----KKKVVIV----  1277

Query  1995  lgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNA---TAISSKREHS-GETM  2162
                   +     L    +      N  +   R R+  P       TA  +KR  S  E  
Sbjct  1278  -----TVLIFSGLLLLGIGGRCVLNGMVNRRRRRTSLPSFGGREPTAFQAKRHCSDDEIS  1332

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
                E ++P FD   I  AT+NFA  NK+G+GGFG VY+G L  G++IAVKRLS+NS QG 
Sbjct  1333  ACKELDVPFFDVETILAATNNFAIENKIGEGGFGHVYQGKLKNGQDIAVKRLSENSSQGL  1392

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
             +EFKNE+ LIA+LQHRNLV+LLGCC+   E+MLIYEYM N+SLD+ +FD+ + SLL W+ 
Sbjct  1393  DEFKNEVILIAKLQHRNLVRLLGCCIHGGERMLIYEYMHNRSLDTFIFDEGKRSLLSWQN  1452

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R+ II G+ RGLLYLHQDSRFRIIHRDLKA+NVLLD+EMNPKISDFG AR+FG D+T+A 
Sbjct  1453  RFAIILGIVRGLLYLHQDSRFRIIHRDLKAANVLLDREMNPKISDFGTARVFGDDQTDA-  1511

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
              T+++VGT+GYMSPEYAMDG+ S+K D FSFGVLVLE++SG++N+GFY    + NL+  A
Sbjct  1512  HTRKVVGTFGYMSPEYAMDGILSIKLDVFSFGVLVLEIISGKRNKGFYQSEPQSNLITYA  1571

Query  2883  WRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK  3062
             W+LW EG+  ELLD  +  + H+  + +V+RCIQV LLCVQE+  DRP M++V +ML  +
Sbjct  1572  WKLWKEGKSFELLDESL-EDLHN--ISEVLRCIQVALLCVQEQPRDRPMMSSVTMMLASE  1628

Query  3063  GTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
               +L +PK+PGF      + + +S       S+N +TVT + AR
Sbjct  1629  NATLAEPKEPGFSTGRGSIDIITSR-----HSVNYITVTTVRAR  1667


 Score =   394 bits (1012),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 201/404 (50%), Positives = 279/404 (69%), Gaps = 12/404 (3%)
 Frame = +3

Query  708   GPPWNPPLTL--NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKP  881
             G   NP  +L   QTLVS G +F+LGFFSPG NS   Y+GIWYK+I  RTIVWVANR  P
Sbjct  30    GDSLNPTTSLLDGQTLVSTGGIFELGFFSPG-NSPNRYLGIWYKKIPVRTIVWVANRASP  88

Query  882   LRNSTGFLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDEN  1061
             L + TG +KI +DG++ L++G    +W+S +T + S   N VAQLLD GNFV+R E    
Sbjct  89    LTDFTGVVKIRKDGSLVLLNGVAKVLWTSDSTVSAS---NPVAQLLDCGNFVLRAE----  141

Query  1062  PENYLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEA  1241
              E+  WQSFDYP+DTLLPGMKLG + KTG N  ISSW+S  DPS G  +FKLD +G PE 
Sbjct  142   -ESIAWQSFDYPSDTLLPGMKLGRNMKTGLNWSISSWKSSDDPSPGYYSFKLDPHGSPEF  200

Query  1242  FLRNKDIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIV  1421
             FL ++   I+ SG WNG+ FSGVP+++  +   F F+  ++E+YY++EI+N ++ SRL+V
Sbjct  201   FLYSESTKIHASGPWNGLEFSGVPQLKSDQNFRFIFISNQDEIYYTYEINNSSVVSRLVV  260

Query  1422  NYTQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQ  1601
               +  L+R+ W+   + W+ FW+ P DQCD Y  CG FG+C ++ SP C C  GF+P++ 
Sbjct  261   TISGQLQRFVWLDAIQTWHVFWSDPNDQCDRYAVCGPFGVCSSNPSPSCSCLKGFQPKSP  320

Query  1602  QAWSLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSC  1781
             Q W LRDGS GC R   L C  DGF++++  KLP+++ + VD +MSLD+C+E C++NCSC
Sbjct  321   QEWILRDGSDGCVRITRLGCKGDGFVTVSNMKLPDTTNATVDKSMSLDKCRESCLKNCSC  380

Query  1782  TAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASD  1913
              AY++ NIS G SGC+IW  +L D+R +  + GQ L+V++ AS+
Sbjct  381   RAYASANISGGESGCIIWATDLIDLRNF-VDAGQDLHVKLPASE  423


 Score =   207 bits (528),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 116/240 (48%), Positives = 144/240 (60%), Gaps = 58/240 (24%)
 Frame = +3

Query  2184  PIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNEL  2363
             P+FD   I  ATD F+  NKLG+GGFG VYKG L  G+EIAVKRLSK S QG ++FKNE+
Sbjct  443   PLFDLFTIESATDCFSLNNKLGEGGFGPVYKGQLEDGQEIAVKRLSKYSVQGLDQFKNEV  502

Query  2364  RLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIICG  2543
              LIA+LQHRNLV+LLGCC+  DE++LIYEYM+NKSLDS +FD                 G
Sbjct  503   VLIAKLQHRNLVRLLGCCIQGDERLLIYEYMQNKSLDSFIFD----------------FG  546

Query  2544  VARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIVG  2723
             +AR                                        +F GDE +   T+++VG
Sbjct  547   IAR----------------------------------------IFQGDENQE-NTRKVVG  565

Query  2724  TYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPS-NEENLLGLAWRLWGE  2900
             T+GYMSPEYA +G+FSVK D FSFGVL+LE++SG KN+  Y       NL+G AWRLW E
Sbjct  566   TFGYMSPEYATNGIFSVKYDVFSFGVLILEILSGSKNKMIYQARYYSMNLIGHAWRLWEE  625


 Score = 66.6 bits (161),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 6/45 (13%)
 Frame = +2

Query  2     QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
             QHRNLVRLLGCCI GGE+MLI      +SLDTF+FD  KR+ L+W
Sbjct  1406  QHRNLVRLLGCCIHGGERMLIYEYMHNRSLDTFIFDEGKRSLLSW  1450



>gb|KDO74340.1| hypothetical protein CISIN_1g003254mg [Citrus sinensis]
Length=836

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/825 (51%), Positives = 556/825 (67%), Gaps = 53/825 (6%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKI-GE  917
             +TLVSA E F+LGFFSPG NS   Y+GIWYK+I + T+ WVANRD PL + +G L+I GE
Sbjct  58    ETLVSAKESFELGFFSPG-NSKSRYLGIWYKKIAEGTVTWVANRDAPLSDRSGVLRINGE  116

Query  918   -DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
              +G + L++ T +++WSS+++ +   P   VA L++SGN VV+   D NP+N LWQSFDY
Sbjct  117   RNGILVLLNSTNDTVWSSNSSISAQKP---VAALMESGNLVVKDGKDNNPDNILWQSFDY  173

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             P DTLLPGMKLG +  TG NR++SSW+S  DP+ GD T+ LD  G+P+  LR   II +R
Sbjct  174   PCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGDFTYGLDPRGIPQLVLRKNSIITFR  233

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             +G WNG+ ++GVP+++   V  F ++  + E +Y++ + N ++ SR+++N    ++RYTW
Sbjct  234   AGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYTYNLSNSSVPSRMVINPAGTVQRYTW  293

Query  1455  IPENRIW---NRFWNAPKDQCDNYRECGSFGICDTDM-SPVCGCPVGFKPRNQQAWSLRD  1622
             +   + W   +RF     DQCD+Y  CG++  C+ +  SP C C  GF P +Q+ W ++ 
Sbjct  294   MERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNINSNSPECECLQGFVPNSQREWDMQY  353

Query  1623  GSGGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
              SGGC R   LDC   DGFL     KLP++  S+VD  ++L ECKE+C +NCSCTAY+N 
Sbjct  354   KSGGCVRRTPLDCKHGDGFLEHKAVKLPDTRFSWVDKNITLWECKELCSKNCSCTAYANA  413

Query  1800  NISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVIL  1979
             ++   GSGC++W  +L DI++   E GQ L++R+AAS+ +    V R      K + +I+
Sbjct  414   DVRGRGSGCLLWFHDLIDIKEL-PESGQDLFIRMAASELDN---VERRRQSKNKKQVMII  469

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
                                        T  I + G   R             +++HS + 
Sbjct  470   I--------------------TSISLATAVIFIGGLMYR-------------RKKHSNQG  496

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
                +E ELPIFD   IA ATDNF+  NKLG+GGFG VYKGML+ G+EIAVKRLSK S QG
Sbjct  497   NEKEEMELPIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRLSKGSGQG  556

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              EEFKNE+ LIA+LQHRNLVKLLGCC   DE+MLIYEY+ NKSLD  +FD  RS LLDW 
Sbjct  557   MEEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWS  616

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
             +R +II G+ARGLLYLHQDSR RIIHRDLKASNVLLD  MNPKISDFG+AR FG D+TEA
Sbjct  617   KRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTEA  676

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               TKR+VGTYGYMSPEYA+DGLFSVKSD FSFGVLVLE++ G+KN+GF    ++ NLLG 
Sbjct  677   -NTKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHADHDHNLLGH  735

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             AWRLW E R  EL+D    S  +S    + +RCIQVGLLCVQ++ EDRPNM++V+LML G
Sbjct  736   AWRLWIEERPLELIDQ---SLDNSCSFSEALRCIQVGLLCVQQRPEDRPNMSSVVLMLSG  792

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             +  SLPQP+QPGF       + +SSS+     S N++T+++L+AR
Sbjct  793   E-RSLPQPQQPGFFTGRNLPESESSSSRQYSASTNEITLSVLEAR  836


 Score = 55.5 bits (132),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCC +  E+MLI      KSLD F+FD T+   L+W K
Sbjct  571  QHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWSK  617



>ref|XP_006452072.1| hypothetical protein CICLE_v10007451mg [Citrus clementina]
 gb|ESR65312.1| hypothetical protein CICLE_v10007451mg [Citrus clementina]
Length=836

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/825 (51%), Positives = 556/825 (67%), Gaps = 53/825 (6%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKI-GE  917
             +TLVSA   F+LGFFSPG NS   Y+GIWYK+I + T+ WVANRD PL + +G L+I GE
Sbjct  58    ETLVSAKASFELGFFSPG-NSNIRYLGIWYKKIAEGTVTWVANRDAPLSDRSGVLRINGE  116

Query  918   -DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
              +G + L++ T +++WSS+++ +   P   VA L++SGN VV+   D NP+N LWQSFDY
Sbjct  117   RNGILVLLNSTNDTVWSSNSSISAQKP---VAALMESGNLVVKDGKDNNPDNILWQSFDY  173

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             P DTLLPGMKLG +  TG NR++SSW+S  DP+ GD T+ LD  G+P+  LR   II +R
Sbjct  174   PCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGDFTYGLDPRGIPQLVLRKNSIITFR  233

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             +G WNG+ ++GVP+++P  V  F ++  + E +Y++ + N ++ SR+++N    ++RYTW
Sbjct  234   AGLWNGLHWTGVPQLQPNPVYTFEYVSNEKEAFYTYNLSNSSVPSRMVINPAGTVQRYTW  293

Query  1455  IPENRIW---NRFWNAPKDQCDNYRECGSFGICDTDM-SPVCGCPVGFKPRNQQAWSLRD  1622
             +   + W   +RF     DQCD+Y  CG++  C+ +  SP C C  GF P +Q+ W ++ 
Sbjct  294   MERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNINSNSPECECLQGFVPNSQREWDMQY  353

Query  1623  GSGGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
              SGGC R   LDC   DGFL     KLP++  S+VD  ++L ECKE+C +NCSCTAY+N 
Sbjct  354   KSGGCVRRTPLDCKHGDGFLEHKAVKLPDTRFSWVDKNITLWECKELCSKNCSCTAYANA  413

Query  1800  NISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVIL  1979
             ++   GSGC++W  +L DI++   E GQ L++R+AAS+ +    V R      K + +I+
Sbjct  414   DVRGRGSGCLLWFHDLIDIKEL-PESGQDLFIRMAASELDN---VERRRQSKNKKQVMII  469

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
                                        T  I + G   R             +++HS + 
Sbjct  470   I--------------------TSISLATAVIFIGGLMYR-------------RKKHSNQG  496

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
                +E ELPIFD   IA ATDNF+  NKLG+GGFG VYKGML+ G+EIAVKRLSK S QG
Sbjct  497   NEKEEMELPIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRLSKGSGQG  556

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              EEFKNE+ LIA+LQHRNLVKLLGCC   DE+MLIYEY+ NKSLD  +FD  RS LLDW 
Sbjct  557   MEEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWS  616

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
             +R +II G+ARGLLYLHQDSR RIIHRDLKASNVLLD  MNPKISDFG+AR FG D+TEA
Sbjct  617   KRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLARSFGVDQTEA  676

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               TKR+VGTYGYMSPEYA+DGLFSVKSD FSFGVLVLE++ G+KN+GF    ++ NLLG 
Sbjct  677   -NTKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHADHDHNLLGH  735

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             AWRLW E R  EL+D    S  +S    + +RCIQVGLLCVQ++ EDRPNM++V+LML G
Sbjct  736   AWRLWIEERPLELIDQ---SLDNSCSFSEALRCIQVGLLCVQQRPEDRPNMSSVVLMLSG  792

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             +  SLPQP+QPGF       + +SSS+     S N++T+++L+AR
Sbjct  793   E-RSLPQPQQPGFFTGRNLPESESSSSRQYSASTNEITLSVLEAR  836


 Score = 55.5 bits (132),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCC +  E+MLI      KSLD F+FD T+   L+W K
Sbjct  571  QHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWSK  617



>ref|XP_006475244.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Citrus sinensis]
Length=841

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/825 (51%), Positives = 556/825 (67%), Gaps = 53/825 (6%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKI-GE  917
             +TLVSA   F+LGFFSPG NS   Y+GIWYK+I + T+ WVANRD PL + +G L+I GE
Sbjct  63    ETLVSAKASFELGFFSPG-NSNIRYLGIWYKKIAEGTVTWVANRDAPLSDRSGVLRINGE  121

Query  918   -DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
              +G + L++ T +++WSS+++ +   P   VA L++SGN VV+   D NP+N LWQSFDY
Sbjct  122   RNGILVLLNSTNDTVWSSNSSISAQKP---VAALMESGNLVVKDGKDNNPDNILWQSFDY  178

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             P DTLLPGMKLG +  TG NR++SSW+S  DP+ GD T+ LD  G+P+  LR   II +R
Sbjct  179   PCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGDFTYGLDPRGIPQLVLRKNSIITFR  238

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             +G WNG+ ++GVP+++P  V  F ++  + E +Y++ + N ++ SR+++N    ++RYTW
Sbjct  239   AGLWNGLHWTGVPQLQPNPVYTFEYVSNEKEAFYTYNLSNSSVPSRMVINPAGTVQRYTW  298

Query  1455  IPENRIW---NRFWNAPKDQCDNYRECGSFGICDTDM-SPVCGCPVGFKPRNQQAWSLRD  1622
             +   + W   +RF     DQCD+Y  CG++  C+ +  SP C C  GF P +Q+ W ++ 
Sbjct  299   MERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNINSNSPECECLQGFVPNSQREWDMQY  358

Query  1623  GSGGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
              SGGC R   LDC   DGFL     KLP++  S+VD  ++L ECKE+C +NCSCTAY+N 
Sbjct  359   KSGGCVRRTPLDCKHGDGFLEHKAVKLPDTRFSWVDKNITLWECKELCSKNCSCTAYANA  418

Query  1800  NISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVIL  1979
             ++   GSGC++W  +L DI++   E GQ L++R+AAS+ +    V R      K + +I+
Sbjct  419   DVRGRGSGCLLWFHDLIDIKEL-PESGQDLFIRMAASELDN---VERRRQSKNKKQVMII  474

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
                                        T  I + G   R             +++HS + 
Sbjct  475   I--------------------TSISLATAVIFIGGLMYR-------------RKKHSNQG  501

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
                +E ELPIFD   IA ATDNF+  NKLG+GGFG VYKGML+ G+EIAVKRLSK S QG
Sbjct  502   NEKEEMELPIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRLSKGSGQG  561

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              EEFKNE+ LIA+LQHRNLVKLLGCC   DE+MLIYEY+ NKSLD  +FD  RS LLDW 
Sbjct  562   MEEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWS  621

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
             +R +II G+ARGLLYLHQDSR RIIHRDLKASNVLLD  MNPKISDFG+AR FG D+TEA
Sbjct  622   KRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLARSFGVDQTEA  681

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               TKR+VGTYGYMSPEYA+DGLFSVKSD FSFGVLVLE++ G+KN+GF    ++ NLLG 
Sbjct  682   -NTKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHADHDHNLLGH  740

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             AWRLW E R  EL+D    S  +S    + +RCIQVGLLCVQ++ EDRPNM++V+LML G
Sbjct  741   AWRLWIEERPLELIDQ---SLDNSCSFSEALRCIQVGLLCVQQRPEDRPNMSSVVLMLSG  797

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             +  SLPQP+QPGF       + +SSS+     S N++T+++L+AR
Sbjct  798   E-RSLPQPQQPGFFTGRNLPESESSSSRQYSASTNEITLSVLEAR  841


 Score = 55.5 bits (132),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCC +  E+MLI      KSLD F+FD T+   L+W K
Sbjct  576  QHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWSK  622



>ref|XP_011029379.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=824

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/825 (49%), Positives = 554/825 (67%), Gaps = 39/825 (5%)
 Frame = +3

Query  726   PLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFL  905
             P++  QT+VS GE F+LGFFSPG +S   Y+GIWYK+I   T+VWVANR+ PL +  G L
Sbjct  37    PISDGQTIVSPGESFELGFFSPG-SSRNRYLGIWYKKISMGTVVWVANREAPLFDHLGVL  95

Query  906   KIGEDGNIHLVDGTGNSIWSSSNTNN-QSVPGNTVAQLLDSGNFVVRRENDENPENYLWQ  1082
             K+   GN+ L++ T   +WSS+ +   +++P    A+LL+SGN VV   ND++P+ YLWQ
Sbjct  96    KVTAQGNLVLLNSTKGIVWSSNTSRGAENIPD---ARLLESGNLVVEDGNDDDPDKYLWQ  152

Query  1083  SFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDI  1262
             SFDYP DTLLPGMKLG +  +G + ++SSW+S  DP+ GD TF++D++G+P+  L+    
Sbjct  153   SFDYPCDTLLPGMKLGRNLASGFDWFLSSWKSTDDPAHGDFTFRIDLHGVPQLVLKKGSA  212

Query  1263  IIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLE  1442
             I +R+G WNG+ ++G   M    V  + F+  +  VYY +E+ N ++FSR+++N + + +
Sbjct  213   IQFRAGSWNGIRWTGAQAMVRNPVYTYEFVSNETYVYYKYELLNSSVFSRMVLNASGVSQ  272

Query  1443  RYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRD  1622
             R+TWI  +  W  ++    DQCDNY  CG++  C+ D SPVC C  GF+P++ + WS  D
Sbjct  273   RFTWIDRSHSWVLYYAVIVDQCDNYAFCGAYASCNIDKSPVCSCLQGFEPKSPRDWSFLD  332

Query  1623  GSGGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
              S GC R   LDC   DGFL     KLP+++ + V+ ++  ++C E+C  NCSCTAY+N 
Sbjct  333   WSDGCARRTLLDCDKGDGFLKHAEVKLPDTTYASVNKSIGPEKCGELCSNNCSCTAYANS  392

Query  1800  NISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVIL  1979
             ++  GGSGC++W ++L DIR+++ +GGQ LY+RVAAS+    G V R  N   K   +I 
Sbjct  393   DVRGGGSGCILWFSDLIDIREFS-DGGQDLYIRVAASELGNIG-VKRSSND-KKLLGIIF  449

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
                                       +     +R  + +++    N+       E   E 
Sbjct  450   G----------------SVIFIAMLAIGLIFYIRKKKAKTK----NSLEKDCNDEDENEV  489

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
             M     ELPIFD   I  AT+NF+   KLG+GGFG+VYKG L  G+EIAVKRLS++S QG
Sbjct  490   M-----ELPIFDMKTIIKATENFSIDKKLGEGGFGTVYKGNLNEGQEIAVKRLSQDSGQG  544

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EFKNE+ LIA+LQHRNLVKLLGCCV+ DE+MLIYEYM NKSLD  +FD+ R   LDW 
Sbjct  545   LKEFKNEVILIAKLQHRNLVKLLGCCVERDERMLIYEYMPNKSLDYFIFDESRRKELDWH  604

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
              R NII G+ARGLLYLHQDSR RIIHRDLKASNVLLD  MNPKISDFG+AR+ GGDETEA
Sbjct  605   NRINIINGIARGLLYLHQDSRLRIIHRDLKASNVLLDSNMNPKISDFGLARMCGGDETEA  664

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               TK++VGTYGYMSPEYA+DGLFSVKSD FSFGVLVLE+VSGRKN+GF  P ++ NLLG 
Sbjct  665   -NTKKVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVSGRKNRGFNHPDHQHNLLGH  723

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             AWRLW E R  EL+D ++     S  + +V+RCI V LLCVQ++ +DRP+M+ V+LM  G
Sbjct  724   AWRLWMEERPLELIDDILG---ESCALSEVLRCIHVALLCVQQRPDDRPSMSTVVLMF-G  779

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
               T LPQPKQPGF      V+ + S++  +  + N++T+++L+ R
Sbjct  780   SDTMLPQPKQPGFFTERNVVEAECSASKNDSSTKNEITISLLEPR  824


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLV+LLGCC+E  E+MLI      KSLD F+FD ++R  L+W
Sbjct  559  QHRNLVKLLGCCVERDERMLIYEYMPNKSLDYFIFDESRRKELDW  603



>gb|AID21691.1| SRKp [Arabidopsis lyrata]
Length=856

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/835 (49%), Positives = 567/835 (68%), Gaps = 31/835 (4%)
 Frame = +3

Query  729   LTL--NQTLVSAGEVFQLGFF---SPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNS  893
             LTL  N+T+VS+ +VF+LGFF   S   +    Y+GIWYK+I +RT VWVANRD PL  S
Sbjct  40    LTLFNNRTIVSSSDVFELGFFKITSSSPDDDRWYLGIWYKKIPERTYVWVANRDDPLSTS  99

Query  894   TGFLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENY  1073
             +G LKI  D  + L+D     I  S N +   V    VA+LLD+GNFVV+     NP  +
Sbjct  100   SGTLKIS-DNKLLLLDQVDTPI-VSWNLSGGGVRSPVVAELLDNGNFVVKESKANNPNGF  157

Query  1074  LWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRN  1253
             LWQSFD+PTDTLLP MK+GWD KT  NR++ SW+SP DPS GD ++KL+I GLP+ +L  
Sbjct  158   LWQSFDFPTDTLLPQMKMGWDRKTANNRFLRSWKSPYDPSSGDYSYKLEIQGLPQFYLWT  217

Query  1254  KDIIIYRSGGWNGVAFSGVPEMEP--KEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNY  1427
              +  ++RSG W+G+ FSG+PEM+      I ++F   + E+ ++F   + + +SRL ++ 
Sbjct  218   SNAQVFRSGPWDGIRFSGMPEMQRWNNADIVYNFTDNREEIAFTFRDADPSSYSRLKMST  277

Query  1428  TQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQA  1607
               LLE  TW+P    W  FW +  + CD Y ECG +  CDT+  P+C C  GF P N   
Sbjct  278   LGLLELSTWVPTTPGWKNFWISSINPCDMYEECGPYSYCDTNTLPMCNCIKGFDPMNSDE  337

Query  1608  WSLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTA  1787
             W+ +DGS GC R   L C    F+ +   KLP+++   VD  + ++EC+  C+ +C+CTA
Sbjct  338   WNSKDGSSGCVRRTPLSCKEKEFVQLKKMKLPDTTEVTVDRIVGVEECQNRCITDCNCTA  397

Query  1788  YSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTK  1967
             ++N  I NGG GCVIWT +L D+R Y  + GQ LYV+VAASD  +  +          T 
Sbjct  398   FANV-IRNGGLGCVIWTRKLQDMRNY-PDSGQDLYVKVAASDLGEERD----------TN  445

Query  1968  KVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREH  2147
             K+I++  + + + ++L  +++   ++ ++            ER+++ LMN   ISS R  
Sbjct  446   KIIISVTVGVTVMLLLSFIIVCFWKRKQKRTKTR---EAPIERNQNLLMNGVVISSGRHL  502

Query  2148  S--GETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLS  2321
             S   E  I ++ ELP+ +FNAIAMAT NF++ NKLG+GGFGSVYKG L  G++IAVKRLS
Sbjct  503   SDLSEESIAEDLELPLMEFNAIAMATKNFSDCNKLGEGGFGSVYKGRLANGQDIAVKRLS  562

Query  2322  KNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRS  2501
             + S QG  EFKNE++LIARLQH NLV++LGCC +  EK+LIYEY+EN SLD  LFDK RS
Sbjct  563   EMSHQGTNEFKNEVKLIARLQHINLVRILGCCFNAKEKVLIYEYLENLSLDRYLFDKTRS  622

Query  2502  SLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFG  2681
             S L+W++R++I  G+ARG+LYLHQDSR +IIHRDLKASNVLLDK+M PKISDFGMAR+F 
Sbjct  623   SKLNWQKRFDIANGIARGILYLHQDSRCKIIHRDLKASNVLLDKDMTPKISDFGMARIFA  682

Query  2682  GDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNE  2861
              D+ EA  T+RIVGTYGYMSPEYAM+G+FSVKSD FSFGVL+LE+VSG++N+GF   +++
Sbjct  683   RDDGEA-ITRRIVGTYGYMSPEYAMEGIFSVKSDVFSFGVLLLEIVSGKRNRGFDNSNHD  741

Query  2862  ENLLGLAWRLWGEGRGSELLDSVIASESHSEFV--DQVMRCIQVGLLCVQEKAEDRPNMA  3035
              NLLG  WR W EG+G ++LD +I   S S  +   +++RCIQ+GLLCVQE +EDRP M+
Sbjct  742   SNLLGYTWRNWKEGKGLDILDPIIVDPSSSSPLRTQEILRCIQIGLLCVQELSEDRPTMS  801

Query  3036  AVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQS--LNQLTVTMLDAR  3194
             +V+LML  +   +P+PK PG+ +   P    SSS   +D+S  +NQ+T++++DAR
Sbjct  802   SVILMLGSETALIPEPKPPGYWVGRSPETFSSSSKQQDDESFTVNQITLSIIDAR  856



>gb|KDP38978.1| hypothetical protein JCGZ_00735 [Jatropha curcas]
Length=819

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/819 (50%), Positives = 553/819 (68%), Gaps = 37/819 (5%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             +T+VS+   F+LGFFSP G S   YVGIWY    + T+VWVANR+ PL +S+G L++   
Sbjct  37    ETIVSSSGRFELGFFSPSG-STNRYVGIWYP-FSNSTLVWVANREMPLNDSSGVLQLTSR  94

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             G + L + T   +WS++ +     P   VAQLL+SGN V+R  ND + +NYLWQSFDY T
Sbjct  95    GILVLHNSTNVVVWSTNASKEAETP---VAQLLNSGNLVIREANDTDEDNYLWQSFDYLT  151

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DT LPG+K G +  TG +R++ SW+S  DPS GD T KLD +G P+ ++R  + I +RSG
Sbjct  152   DTFLPGVKFGRNLLTGHDRFLVSWKSSNDPSLGDATTKLDPSGYPQIYIRKGENISFRSG  211

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ FSG+P + P  +  + F+  + E+YY +++   ++ S +++N   + +R+TW  
Sbjct  212   PWNGLRFSGMPNLRPNPIYTYEFVYNQKEIYYRYDLIGNSVVSMMVLNNEGVFQRFTWSN  271

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
               + WN +  A  D CD Y  CG++G C+ + SP C C  GF P+N+QAW   D S GC 
Sbjct  272   STKTWNLYLTAQMDNCDRYATCGAYGTCNINNSPPCACLNGFVPQNEQAWDSGDWSAGCV  331

Query  1641  RYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGG  1817
             R +   C   +GF  M+  KLP++  S+ + TM L EC+ +C+RNCSCTAYS  NI++G 
Sbjct  332   RKNASICGAGEGFQIMSSVKLPDTRNSWYNRTMDLRECERVCLRNCSCTAYSTLNITDG-  390

Query  1818  SGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivl  1997
             +GC++W  EL DIR+Y  E GQ  Y+R++ASD      V+ GG+  G    +I  C +V 
Sbjct  391   TGCLLWFDELIDIREYN-ENGQDFYIRLSASDL-----VSSGGSKKGTRVWLIAVCVLVA  444

Query  1998  gigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEY  2177
                ++                   + +R  R+R       +  +  +R +  E+   D  
Sbjct  445   VAALLGLF----------------LILRFRRKRIER--QESIVMMQERGYMDESSQKD-L  485

Query  2178  ELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKN  2357
             ELP+FDF+ IA ATDNF++ NKLG+GGFG VYKG L  G EIAVKRLSK+S QG +EFKN
Sbjct  486   ELPLFDFSTIATATDNFSDYNKLGEGGFGPVYKGTLNDGHEIAVKRLSKDSTQGLDEFKN  545

Query  2358  ELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNII  2537
             E+ LIA+LQHRNLVKLLGCC+ ++EKMLIYEYM NKSLD+ +FD+K+  LLDW  R++II
Sbjct  546   EVILIAKLQHRNLVKLLGCCIQLEEKMLIYEYMPNKSLDAFIFDQKQRKLLDWPMRFHII  605

Query  2538  CGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRI  2717
              G+ARGLLYLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMAR FGG+E + G TKR+
Sbjct  606   NGIARGLLYLHQDSRLRIIHRDLKASNILLDFEMNPKISDFGMARSFGGNEIQ-GNTKRV  664

Query  2718  VGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWG  2897
             VGTYGYMSPEYA+DGLFS+KSD FSFGVLVLE++SGR+N+GFY P ++ NLLG AWRL+ 
Sbjct  665   VGTYGYMSPEYAIDGLFSIKSDVFSFGVLVLEIISGRRNRGFYHPDHKHNLLGHAWRLYL  724

Query  2898  EGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLP  3077
             E +  EL+D  +     S  + QVMR IQVGLLCVQ+  +DRPNMA V+LML     +LP
Sbjct  725   EEKSLELIDETL---KESCILSQVMRSIQVGLLCVQQSPDDRPNMATVVLMLTSD-IALP  780

Query  3078  QPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             QPK+PGF    K  + +SSS+  +  S N++T+T+L AR
Sbjct  781   QPKEPGFFTERKVFEQESSSSKVDTCSANEITITLLAAR  819


 Score = 57.0 bits (136),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLV+LLGCCI+  EKMLI      KSLD F+FD  +R  L+W
Sbjct  554  QHRNLVKLLGCCIQLEEKMLIYEYMPNKSLDAFIFDQKQRKLLDW  598



>gb|KDP34761.1| hypothetical protein JCGZ_10541 [Jatropha curcas]
Length=823

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/821 (51%), Positives = 569/821 (69%), Gaps = 37/821 (5%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             +T++S+G+ ++LGFF+PG +SG  Y+GIW+K+I   T+VWVANR+  L +  G L     
Sbjct  37    ETIISSGQTYELGFFTPGSSSG-RYLGIWFKKISTGTVVWVANRETQLPDDKGVLNFTTQ  95

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             G + L++ +   IWSS+ T   S   N +AQLLDSGNFVV+  N+ NPENYLWQSFD+P 
Sbjct  96    GILLLLNSSNGVIWSSNKT---STVKNPIAQLLDSGNFVVKNGNEPNPENYLWQSFDFPG  152

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DT LPGMKLG +  TG +  ISSW+S  DP+ GD TF +D NG P+   +  + I +R+G
Sbjct  153   DTNLPGMKLGRNLVTGLDWTISSWKSLNDPARGDYTFGIDPNGYPQLLYKKGNTIKFRAG  212

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ F+G   + P  V  + F+  + EVYY+  + N ++ SRL+VN + + ER TWI 
Sbjct  213   SWNGIRFTGASRLRPNPVYEYEFVLNEKEVYYNIHLLNNSVMSRLVVNASGITERLTWID  272

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
             +   W  ++   +DQCDNY  CG+  IC+ + SP+C C  GF+P++ + W+ +D S GC 
Sbjct  273   QTHSWATYFTVGEDQCDNYNHCGANAICNINKSPMCACLEGFEPKSVRDWNFQDWSSGCL  332

Query  1641  RYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGG  1817
             R   L C   +GF+     K+P++S S+ D  MSL EC+EMC++NCSC AY+N +I+ GG
Sbjct  333   RKIALACNRGEGFVKHTGKKMPDTSGSWFDKRMSLKECEEMCLKNCSCVAYANTDITGGG  392

Query  1818  SGCVIWTAELFDIRQYTAEGGQLLYVRVAAS--DAEQTGEVARGGNGFGKTKKVILACgi  1991
             +GC++W ++L D+R++T + GQ LYVR++A   D  +    +R     G     I+ C  
Sbjct  393   NGCLLWFSDLIDLREFT-DTGQDLYVRMSAPYLDGIKRRRESRRQKRIG-----IIVCST  446

Query  1992  vlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITD  2171
             +LG+G++  G +L  R++  +           +ER R  +         R+H+ ++  T+
Sbjct  447   ILGMGVLALGWILYVRKRKLK----------IQERMRSII--------DRDHNQKSK-TE  487

Query  2172  EYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEF  2351
             ++ELPI D   I  ATDNF++ NKLGQGGFG VYKG L  G+EIAVKRLS +S QG EEF
Sbjct  488   DFELPIIDLITIMKATDNFSSNNKLGQGGFGPVYKGTLFDGQEIAVKRLSMSSCQGLEEF  547

Query  2352  KNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYN  2531
             KNE+ LIA+LQHRNLVKLLGCC++ DE+MLIYEYM NKSLD  +FD+ RS LLDW +R N
Sbjct  548   KNEVVLIAKLQHRNLVKLLGCCIEGDERMLIYEYMPNKSLDFFIFDQSRSKLLDWNKRIN  607

Query  2532  IICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTK  2711
             II G+ARGLLYLHQDSR RIIHRDLKASNVLLDK+MNPKISDFGMAR+FGGD+TEA  T 
Sbjct  608   IIDGIARGLLYLHQDSRLRIIHRDLKASNVLLDKDMNPKISDFGMARIFGGDQTEA-NTN  666

Query  2712  RIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRL  2891
             R+VGT+GYM+PEYA+DGLFSVKSD FSFGVLVLE+VSGRKN+GF++  +  NL+G AWRL
Sbjct  667   RVVGTFGYMAPEYAVDGLFSVKSDIFSFGVLVLEIVSGRKNRGFHSHDHLHNLVGHAWRL  726

Query  2892  WGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTS  3071
             W E R  EL+D+++     S  + +++RCI VGLLC Q++ EDRPNM+ V+LML G+ +S
Sbjct  727   WMEERPLELMDNMLG---ESATLSEIIRCIHVGLLCAQQRPEDRPNMSTVVLMLGGE-SS  782

Query  3072  LPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             LPQPKQPGF       + +SSS+ Y   S N++T T L+ R
Sbjct  783   LPQPKQPGFFTERNVPEAESSSSYYKSTSTNEITFTELNPR  823


 Score = 60.1 bits (144),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCCIEG E+MLI      KSLD F+FD ++   L+W K
Sbjct  558  QHRNLVKLLGCCIEGDERMLIYEYMPNKSLDFFIFDQSRSKLLDWNK  604



>ref|XP_006377797.1| hypothetical protein POPTR_0011s12930g [Populus trichocarpa]
 gb|ERP55594.1| hypothetical protein POPTR_0011s12930g [Populus trichocarpa]
Length=817

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/819 (50%), Positives = 553/819 (68%), Gaps = 37/819 (5%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             +T+VSAG  F+LGFFSP   S   YVGIWYK     T+VWVANR+ PL +++G L++   
Sbjct  35    ETIVSAGSNFELGFFSPRSTSLR-YVGIWYK-FSSETLVWVANREAPLNDTSGVLQVTSK  92

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             G + L + T   +WS   TN   VP N VAQLLDSGN V+R  ND N ++YLW SFDYP 
Sbjct  93    GILVLHNSTNVVLWS---TNTSRVPQNPVAQLLDSGNLVIREANDTNEDDYLWDSFDYPG  149

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             +T LPG+K G +  TG +RY+ SW+S  DPS GD T  LD  G P+ F+R  + II+RSG
Sbjct  150   NTFLPGLKFGRNLITGLDRYLVSWKSTNDPSLGDSTTMLDPGGYPQIFIRVGENIIFRSG  209

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ FSG+P ++P  +  + F+  + E+YY +++ + ++ +R+++    +L+R+TW  
Sbjct  210   PWNGLKFSGMPNLKPNPIYTYEFVYNEKEIYYRYDLTDSSVVTRMLLTNDGILQRFTWTS  269

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
               R WN +  A  D CD Y  CG++GIC+ D SP C C  GF+P+++Q W   D SGGC 
Sbjct  270   STRTWNLYLTAQMDNCDRYAVCGAYGICNIDNSPACACLDGFQPKSRQDWDSGDWSGGCV  329

Query  1641  RYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGG  1817
             R +E  C   +GF  +   KLP++ TS  + TM L+EC+ +C+ NCSCTAYS  NI++G 
Sbjct  330   RKNESICRAGEGFQKVTSVKLPDTRTSSFNMTMDLEECRRVCLMNCSCTAYSTLNITDG-  388

Query  1818  SGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivl  1997
             +GC++W  +L DIR+YT E GQ  Y+R++ASD E T    R    +     +I  C +V 
Sbjct  389   TGCLLWFEDLLDIREYT-ETGQDFYIRLSASDLEPTRSPKRTTRVW-----IIAICLLVA  442

Query  1998  gigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEY  2177
             GI ++ F LL L RR+  +     + M+      RD  +N+T                + 
Sbjct  443   GITILGFCLLFLMRRRKMKTAARMVSMQ-----ERDYSINSTG--------------KDL  483

Query  2178  ELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKN  2357
             ELP+FDF  IA+AT NF+ ANKLG+GGFG VYKG L  G+EIAVKRLSK S QG +EFKN
Sbjct  484   ELPVFDFATIAIATSNFSGANKLGEGGFGPVYKGKLEDGQEIAVKRLSKTSTQGLDEFKN  543

Query  2358  ELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNII  2537
             E+  IA+LQHRNLVKLLGCC++ +E ML+YEYM NKSLD+ +FD+K+S LLDW  RYNII
Sbjct  544   EVICIAKLQHRNLVKLLGCCIESEETMLVYEYMPNKSLDAFIFDQKQSKLLDWSMRYNII  603

Query  2538  CGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRI  2717
              GVARGLLYLHQDSR RIIHRDLKASN+L+D +MNPKISDFGMAR FGG+E + G TKR+
Sbjct  604   NGVARGLLYLHQDSRLRIIHRDLKASNILVDYDMNPKISDFGMARSFGGNEIQ-GNTKRV  662

Query  2718  VGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWG  2897
             VGTYGYMSPEYA DG+FS+KSD FSFGVLVLE+V+G++N+GF    ++ NLLG AW+L+ 
Sbjct  663   VGTYGYMSPEYATDGIFSIKSDVFSFGVLVLEIVNGKRNRGFIHQDHKHNLLGHAWKLYK  722

Query  2898  EGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLP  3077
             E R  EL++  +    +   + +V+R I VGLLCVQ+  EDRP M+ V+LML     +LP
Sbjct  723   EERSFELINDSLKDTCN---LSEVLRVIHVGLLCVQQAPEDRPTMSTVVLML-SSNIALP  778

Query  3078  QPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
              PK+PGF    K    +SSS+  +  S N++T+T+L AR
Sbjct  779   DPKEPGFFTERKLFDHESSSSKVDTCSANEITITLLTAR  817



>ref|XP_009408779.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=824

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/823 (49%), Positives = 536/823 (65%), Gaps = 41/823 (5%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             + L+S G  F LGFFSP G S   Y+GIWYK+I  +T+VWVANR +P+  S G L +  +
Sbjct  38    EPLISEGGSFALGFFSPNG-SDSRYIGIWYKKISVQTVVWVANRQRPVAGSHGSLSVATN  96

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRE--NDENPENYLWQSFDY  1094
             G + +       +WSS +        + VA LLD GNFVVR    N  +P ++ WQSFDY
Sbjct  97    GTLVITGENSTVVWSSPSLTLS----DPVAHLLDDGNFVVREADGNPSDPNSFAWQSFDY  152

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PTDTLLPGMKLGW+  TG NR ++SW S  DP+ G+ TF +D+ G P+ F  +    ++R
Sbjct  153   PTDTLLPGMKLGWNLTTGFNRTLTSWASANDPAPGEYTFGIDLRGDPQIFEWSGTRQVWR  212

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             +G WNG+ F+GVP+M    ++   F+    +V Y F   +    SRL+VN +  L+R  W
Sbjct  213   AGPWNGLRFTGVPQMTSYNMLPLQFVVDATQVVYVFHTIDIWNVSRLVVNQSGTLQRLVW  272

Query  1455  IPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGG  1634
             + +++ WN FW AP D CDN   CG   ICDT  SP+CGCP GF+P+N   W  RDGS G
Sbjct  273   VNDSKFWNAFWYAPMDPCDNIFPCGPNAICDTSRSPLCGCPQGFQPKNPTNWGFRDGSDG  332

Query  1635  CFRYDELDC--PTDGFLSMNYTKLPESSTSFVD-ATMSLDECKEMCVRNCSCTAYSNYNI  1805
             C R   +DC   TDGF+ ++  KLP++S+S V+    +LD+C+  C++NCSCTAY+  NI
Sbjct  333   CVRKTAVDCRNGTDGFVLVSGAKLPDTSSSTVEWVGTTLDQCRAKCLKNCSCTAYAQANI  392

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
             S  GSGC++W+  L D+R +   GGQ LYVR AA+D +      R          VILA 
Sbjct  393   SGSGSGCILWSTNLTDLRVF-GSGGQDLYVRAAAADVDSESSHHRI---HLTVISVILAL  448

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              I                      +   +     R ++R   M+  AIS    H+ E   
Sbjct  449   FIS---------------------ILAFVGCCVWRRKNRS--MSGMAISLTERHNDEGTE  485

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
              ++ +LP+FD   +A AT NF+  +KLG+GGFG VYKG L   +EIAVKRLSK S QG +
Sbjct  486   ANDLDLPLFDLGTVADATGNFSIESKLGEGGFGPVYKGKLEDEQEIAVKRLSKTSVQGID  545

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE+ LIA+LQHRNLV+LLGCC++ +E+MLIYEYM N SLDS LFDK +  LL+W  R
Sbjct  546   EFKNEVVLIAKLQHRNLVRLLGCCIEGEERMLIYEYMPNGSLDSFLFDKAKGWLLNWPTR  605

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             Y+II G+ARGLLYLHQDSR RIIHRDLKA N+LLD  MNPKISDFGMAR+FGGDE+E   
Sbjct  606   YSIIVGIARGLLYLHQDSRLRIIHRDLKAGNILLDMHMNPKISDFGMARIFGGDESEV-N  664

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
             TKR+VGTYGYMSPEYAMDG+FSVKSD FSFGVL+LE++SG+KN+G Y  S   NLLG  W
Sbjct  665   TKRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLILEIISGKKNRGIYDSSRSLNLLGYTW  724

Query  2886  RLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKG  3065
              LW EG+G +L+D  I  +S+ +   +V+RC++VGLLCVQE+ EDRP M++V+ ML    
Sbjct  725   SLWREGKGLDLVDEAIG-DSYPK--AEVLRCMKVGLLCVQERPEDRPTMSSVLFMLGSDS  781

Query  3066  TSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
               LPQP+QPGF     P++ DSS +  +  S+N ++VTM + R
Sbjct  782   ALLPQPRQPGFVAMRGPLEPDSSRSKQDSLSINNVSVTMFEGR  824


 Score = 60.8 bits (146),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRLLGCCIEG E+MLI       SLD+F+FD  K   LNW
Sbjct  558  QHRNLVRLLGCCIEGEERMLIYEYMPNGSLDSFLFDKAKGWLLNW  602



>gb|KDP38970.1| hypothetical protein JCGZ_00727 [Jatropha curcas]
Length=783

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/817 (50%), Positives = 549/817 (67%), Gaps = 39/817 (5%)
 Frame = +3

Query  744   TLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGEDG  923
             TL+SA   F+LGFFSP  +S  +Y+GIWY+ I  RT++WVANR  P  +++G L++ E+G
Sbjct  6     TLISADGTFELGFFSPDNSSSRIYLGIWYRRIPIRTVIWVANRATPFLSTSGVLQVNEEG  65

Query  924   NIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPTD  1103
             +I +++ T  ++WSS+++ +   P   VA+LLDSGN VV+  N  NPEN LWQSFD+P D
Sbjct  66    SIIVLNSTNGTVWSSNSSRSTQNP---VAKLLDSGNLVVKDGNGSNPENILWQSFDFPYD  122

Query  1104  TLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSGG  1283
             TLLP MKLGW+  T  NR+++SW+S  DPS GD +  + + G+P+ F+   D +  RSG 
Sbjct  123   TLLPDMKLGWNLDTRMNRFLTSWKSIDDPSMGDFSCLIKLGGVPQLFIMKGDTVHTRSGS  182

Query  1284  WNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIPE  1463
             WNG+ F+G P+++P  +  F ++  ++E+YYS+E+ N ++ SRLI++    L RY WI  
Sbjct  183   WNGLQFTGSPQLKPNPLFNFMYVSNEHEIYYSYELKNSSIVSRLILSEQGGLNRYVWIDR  242

Query  1464  NRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCFR  1643
              + W  F+  P DQCD Y+ CG +  C+ +  PVC C  GF P++   W   D S GC R
Sbjct  243   TQSWTLFFGVPTDQCDTYQLCGPYASCNINNYPVCACLEGFVPKSPTDWKASDWSDGCVR  302

Query  1644  YDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGSG  1823
               +LDC +DGF      KLP++S+S+VD ++ L EC+E+C RNCSC AY+N +I   GSG
Sbjct  303   RTQLDCHSDGFQKHAEMKLPDTSSSWVDKSIGLMECEELCRRNCSCLAYANSDIR--GSG  360

Query  1824  CVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlgi  2003
             C++W   L D+R++T EGGQ LY+R+AAS   +   V   G    K K  I+   + L +
Sbjct  361   CLLWFDNLIDMREFT-EGGQDLYIRLAAS---ELAPVEAKGQSNKKRKIAIIVSSLTLAM  416

Query  2004  gmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEYEL  2183
             GM+  GL                       R++  L       +  E  G+       EL
Sbjct  417   GMLSLGLFFYM-------------------RNQQLLQEGFTEQTDIEDHGDN------EL  451

Query  2184  PIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNEL  2363
               FD   I  AT+NF++ NKLG+GGFG VYKG+L+ G+E+AVKRLS+ S QG +EFKNE+
Sbjct  452   HTFDLTTIKNATNNFSSNNKLGEGGFGPVYKGILLDGQEVAVKRLSETSGQGRKEFKNEV  511

Query  2364  RLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIICG  2543
              LIA+LQHRNLVKLLGCC++ DEKMLIYEYM NKSLDS +F + R  LLDW  R++II G
Sbjct  512   ILIAKLQHRNLVKLLGCCIEGDEKMLIYEYMPNKSLDSFIFGETRGKLLDWHMRFHIIAG  571

Query  2544  VARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIVG  2723
             +ARGLLYLHQDSR RIIHRDLKASNVLLD +MNPKISDFG+AR FG D+T A  TKR+VG
Sbjct  572   IARGLLYLHQDSRLRIIHRDLKASNVLLDSDMNPKISDFGLARTFGKDQTVA-KTKRVVG  630

Query  2724  TYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGEG  2903
             TYGYMSPEYA+DG FSVKSD FSFGVLVLE+VSG++N+GF    +  NLLG  WRLW E 
Sbjct  631   TYGYMSPEYAVDGHFSVKSDVFSFGVLVLEIVSGKRNRGFCHSDHGHNLLGHGWRLWMEE  690

Query  2904  RGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQP  3083
             R  EL+DS++ S S SE   QV+RCI +GLLCVQ    DRP+M+AV++ML G  +SLP+P
Sbjct  691   RPLELVDSLLQS-SFSE--SQVLRCINIGLLCVQRSPADRPDMSAVVVML-GSESSLPEP  746

Query  3084  KQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             KQPGF       + +SSS+     S N+++ T+++ R
Sbjct  747   KQPGFYTERNSFEAESSSSKEGKWSRNEISTTLIEPR  783


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLV+LLGCCIEG EKMLI      KSLD+F+F  T+   L+W
Sbjct  518  QHRNLVKLLGCCIEGDEKMLIYEYMPNKSLDSFIFGETRGKLLDW  562



>ref|XP_009377300.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Pyrus x bretschneideri]
 ref|XP_009377328.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Pyrus x bretschneideri]
Length=826

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/826 (50%), Positives = 554/826 (67%), Gaps = 36/826 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             L+  ++LVS+G  F+LGFFSPG NS   YVGIW+  I  + +VWVANR+ PL + +G L 
Sbjct  32    LSDGESLVSSGGTFELGFFSPG-NSKNRYVGIWFNGISPQIVVWVANRETPLTDHSGALN  90

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYL-WQS  1085
             I + G + L     +SIWSS+ T+   +  + VAQLL+SGN VV+  ND+N E+ L WQS
Sbjct  91    ITDGGVLVLFSDKNSSIWSSNFTSR--ILRSPVAQLLESGNLVVKDGNDDNSESTLVWQS  148

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FDYP +TLLPGMKLGW+S TG NR++SSW++  DPS G+ ++ +D  G P+  LR   + 
Sbjct  149   FDYPGNTLLPGMKLGWNSATGINRFLSSWKAAEDPSPGEFSYSIDHGGYPQLVLRKGRVP  208

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
              YR G WNG+ F+G PE+ P E     F+   +E YY F++    + SRL++N +  L+R
Sbjct  209   HYRLGSWNGLGFTGSPELTPNEAFKIEFVSNDSEAYYKFDLMKDTMHSRLVLNLSGGLQR  268

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             + WI +    N  ++AP D+CD Y  CG+F  C  D  P+C C  GF P + + W+L++ 
Sbjct  269   FLWIDKTHSGNMIYSAPADRCDTYDLCGAFAFCKLDSDPLCSCLQGFVPNSPRDWTLKNT  328

Query  1626  SGGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             S GC R     C   D F      KLP++S+S ++ TMSL+ECK+MC+ NCSCTAY+N +
Sbjct  329   SSGCLRKGPSGCTNQDEFQKFIRVKLPDTSSSRINKTMSLEECKKMCLTNCSCTAYANLD  388

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             +  GG+GC++W   L DI+++ A GGQ L+VR+  S+ + T       +G  +   +I++
Sbjct  389   VRGGGTGCLLWFGNLIDIKEFDA-GGQDLFVRIPPSELDGTKTSKH--SGVKRKVAIIVS  445

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETM  2162
             CG V+   ++L  +                 +R  + +SR  + N    +   E   E M
Sbjct  446   CGAVVTGVLILGLV---------------FNIRKKKSKSRGNMKNIREKNFGFEGGSEDM  490

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
                  EL  FD   ++ ATDNF+N NKLGQGGFG VYKG+L  G+ IAVKRLSK S QG 
Sbjct  491   -----ELITFDLATVSRATDNFSNNNKLGQGGFGPVYKGILEEGQNIAVKRLSKCSGQGI  545

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
             +EF NE+ LIA+LQHRNLVKLLGCC++ DEKMLIYEYM NKSLD  +FD  RS LL+W +
Sbjct  546   KEFMNEVVLIAKLQHRNLVKLLGCCIEGDEKMLIYEYMPNKSLDYFIFDDTRSKLLNWDQ  605

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R NII G+ARGLLYLHQDSR RIIHRDLK SNVLLDK+MNPKISDFG AR FGGD+TE  
Sbjct  606   RINIIGGIARGLLYLHQDSRLRIIHRDLKTSNVLLDKDMNPKISDFGTARAFGGDQTEE-  664

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
              T R+VGTYGYMSPEY +DGLFSVKSD +SFGV++LE++SG+KN+GF+ P ++ NLLG A
Sbjct  665   NTNRVVGTYGYMSPEYVVDGLFSVKSDVYSFGVMILEILSGKKNRGFHHPDHQLNLLGHA  724

Query  2883  WRLWGEGRGSELLD-SVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             W LW EGR +E++D  ++ S +  E    V RCI + LLCVQ++ EDRPNMA+V+LML G
Sbjct  725   WMLWIEGRPTEIMDEKLVGSCAQPE----VSRCIHIALLCVQQQPEDRPNMASVVLMLGG  780

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTS-YNDQSLNQLTVTMLDAR  3194
             +G SLP PKQPGF      V+  +SS S Y   S+N++++T+L+AR
Sbjct  781   EG-SLPIPKQPGFFTERNSVEAKASSPSKYESHSINEMSLTLLEAR  825


 Score = 63.5 bits (153),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLV+LLGCCIEG EKMLI      KSLD F+FD T+   LNW
Sbjct  559  QHRNLVKLLGCCIEGDEKMLIYEYMPNKSLDYFIFDDTRSKLLNW  603



>gb|KHN36756.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Glycine soja]
Length=833

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/827 (49%), Positives = 549/827 (66%), Gaps = 45/827 (5%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N TLVS    F+LGFF+PG NS   Y+GIWY++I  +T+VWVANR  P+ +S+G L++  
Sbjct  44    NTTLVSKDGTFELGFFTPG-NSQKRYLGIWYRKIPIQTVVWVANRLNPINDSSGILRMNP  102

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
                  ++   G  IWS+++      P + VA LL+SGN V+R E D N E+YLW+SF+YP
Sbjct  103   STGTLVLTHNGTVIWSTASIRR---PESPVALLLNSGNLVIRDEKDANSEDYLWESFNYP  159

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
             TDT LP MK GWD +TG NR + +W+SP DPS  D +F + +N  PEA++   D   YRS
Sbjct  160   TDTFLPEMKFGWDLRTGLNRKLIAWKSPDDPSPSDFSFGMVLNNYPEAYMMKGDQKFYRS  219

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL-ERYTW  1454
             G WNG+  SG P+++   +  F F+  K+E+YY++ + N ++ SRL++N T  + +RY W
Sbjct  220   GPWNGLHSSGSPQVKANPIYDFKFVSNKDELYYTYSLKNSSMISRLVLNATSYVRKRYVW  279

Query  1455  IPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGG  1634
             I   + W  + + P D CD+Y  CG+   C    SPVC C  GFKP+  +AWS  D S G
Sbjct  280   IESKQRWEVYTSVPLDLCDSYSLCGANANCVISDSPVCQCLQGFKPKLPEAWSSMDWSHG  339

Query  1635  CFRYDELDCPT---DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
             C R  EL C     DGF  +   K P+++ S++D T+ L+ECK  C+ NCSC AY+N +I
Sbjct  340   CIRNKELSCENKNKDGFNKLTLLKTPDTTHSWLDQTIGLEECKAKCLDNCSCMAYANSDI  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGE-VARGGNGFGKTKKVILA  1982
             S  GSGC +W  +L DIRQ+ A GGQ +YVR+ AS+ E   E   +GG     T  + LA
Sbjct  400   SGQGSGCAMWFGDLIDIRQFAA-GGQDVYVRIDASELEHANEGHKKGGVLVAVTVTLALA  458

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRG--TRERSRDPLMNATAISSK-REHSG  2153
                                      V   + + G   R++SR  +   +  S K  ++SG
Sbjct  459   A------------------------VAGILIILGWCYRKKSRCSVKERSDFSIKSNQNSG  494

Query  2154  ETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSR  2333
               M  D+ +LP+FD + IA AT NF   NK+G+GGFG VY+G L  G+EIAVKRLS +S 
Sbjct  495   --MQVDDMDLPVFDLSTIAKATSNFTVKNKIGEGGFGPVYRGSLTDGQEIAVKRLSASSG  552

Query  2334  QGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLD  2513
             QG  EFKNE++LIA+LQHRNLVKLLGCC++ +EKML+YEYM N SLDS +FD++RS  LD
Sbjct  553   QGLTEFKNEVKLIAKLQHRNLVKLLGCCLEGEEKMLVYEYMLNGSLDSFIFDEQRSGSLD  612

Query  2514  WKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDET  2693
             W +R+NIICG+A+GLLYLHQDSR RIIHRDLKASNVLLD E+NPKISDFGMAR+FG D+ 
Sbjct  613   WSKRFNIICGIAKGLLYLHQDSRLRIIHRDLKASNVLLDSELNPKISDFGMARIFGVDQQ  672

Query  2694  EAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLL  2873
             E G TKRIVGTYGYM+PEYA DGLFSVKSD FSFGVL+LE++SG++++G+Y  ++ +NL+
Sbjct  673   E-GNTKRIVGTYGYMAPEYATDGLFSVKSDVFSFGVLLLEIISGKRSRGYYNQNHSQNLI  731

Query  2874  GLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLML  3053
             G AW+LW EGR  EL+D  I   S    + Q++ CI V LLCVQ+  EDRP M++V+LML
Sbjct  732   GHAWKLWKEGRPLELIDKSIEDSSS---LSQMLHCIHVSLLCVQQNPEDRPGMSSVLLML  788

Query  3054  IGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             + +   LP+PKQPGF       + DSS++     S N++T+T+L+AR
Sbjct  789   VSE-LELPEPKQPGF-FGKYSGEADSSTSKQQLSSTNEITITLLEAR  833


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCC+EG EKML+       SLD+F+FD  +   L+W K
Sbjct  569  QHRNLVKLLGCCLEGEEKMLVYEYMLNGSLDSFIFDEQRSGSLDWSK  615



>ref|XP_009377299.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009377326.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Pyrus x bretschneideri]
Length=849

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/842 (49%), Positives = 563/842 (67%), Gaps = 45/842 (5%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             L+  ++LVS+G  F+LGFFSPG NS   YVGIW+  I  + +VWVANR+ PL + +G L 
Sbjct  32    LSDGESLVSSGGTFELGFFSPG-NSKNRYVGIWFNGISPQIVVWVANRETPLTDHSGALN  90

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYL-WQS  1085
             I + G + L     +SIWSS+ T+   +  + VAQLL+SGN VV+  ND+N E+ L WQS
Sbjct  91    ITDGGVLVLFSDKNSSIWSSNFTSR--ILRSPVAQLLESGNLVVKDGNDDNSESTLVWQS  148

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FDYP +TLLPGMKLGW+S TG NR++SSW++  DPS G+ ++ +D  G P+  LR   + 
Sbjct  149   FDYPGNTLLPGMKLGWNSATGINRFLSSWKAAEDPSPGEFSYSIDHGGYPQLVLRKGRVP  208

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
              YR G WNG+ F+G PE+ P E     F+   +E YY F++    + SRL++N +  L+R
Sbjct  209   HYRLGSWNGLGFTGSPELTPNEAFKIEFVSNDSEAYYKFDLMKDTMHSRLVLNLSGGLQR  268

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             + WI +    N  ++AP D+CD Y  CG+F  C  D  P+C C  GF P + + W+L++ 
Sbjct  269   FLWIDKTHSGNMIYSAPADRCDTYDLCGAFAFCKLDSDPLCSCLQGFVPNSPRDWTLKNT  328

Query  1626  SGGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             S GC R     C   D F      KLP++S+S ++ TMSL+ECK+MC+ NCSCTAY+N +
Sbjct  329   SSGCLRKGPSGCTNQDEFQKFIRVKLPDTSSSRINKTMSLEECKKMCLTNCSCTAYANLD  388

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             +  GG+GC++W   L DI+++ A GGQ L+VR+  S+ + T       +G  +   +I++
Sbjct  389   VRGGGTGCLLWFGNLIDIKEFDA-GGQDLFVRIPPSELDGTKTSKH--SGVKRKVAIIVS  445

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRD-----------PLMNATAI  2129
             CG V+   ++L              +  NI  + ++ R R+            L++++ +
Sbjct  446   CGAVVTGVLILG-------------LVFNIRKKKSKSRGRNYSVKRLVVMVKLLIDSSTV  492

Query  2130  SSKREHSGETMI-----TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGG  2294
             S   ++  E        +++ EL  FD   ++ ATDNF+N NKLGQGGFG VYKG+L  G
Sbjct  493   SGNMKNIREKNFGFEGGSEDMELITFDLATVSRATDNFSNNNKLGQGGFGPVYKGILEEG  552

Query  2295  EEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLD  2474
             + IAVKRLSK S QG +EF NE+ LIA+LQHRNLVKLLGCC++ DEKMLIYEYM NKSLD
Sbjct  553   QNIAVKRLSKCSGQGIKEFMNEVVLIAKLQHRNLVKLLGCCIEGDEKMLIYEYMPNKSLD  612

Query  2475  SILFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKIS  2654
               +FD  RS LL+W +R NII G+ARGLLYLHQDSR RIIHRDLK SNVLLDK+MNPKIS
Sbjct  613   YFIFDDTRSKLLNWDQRINIIGGIARGLLYLHQDSRLRIIHRDLKTSNVLLDKDMNPKIS  672

Query  2655  DFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKN  2834
             DFG AR FGGD+TE   T R+VGTYGYMSPEY +DGLFSVKSD +SFGV++LE++SG+KN
Sbjct  673   DFGTARAFGGDQTEE-NTNRVVGTYGYMSPEYVVDGLFSVKSDVYSFGVMILEILSGKKN  731

Query  2835  QGFYTPSNEENLLGLAWRLWGEGRGSELLD-SVIASESHSEFVDQVMRCIQVGLLCVQEK  3011
             +GF+ P ++ NLLG AW LW EGR +E++D  ++ S +  E    V RCI + LLCVQ++
Sbjct  732   RGFHHPDHQLNLLGHAWMLWIEGRPTEIMDEKLVGSCAQPE----VSRCIHIALLCVQQQ  787

Query  3012  AEDRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTS-YNDQSLNQLTVTMLD  3188
              EDRPNMA+V+LML G+G SLP PKQPGF      V+  +SS S Y   S+N++++T+L+
Sbjct  788   PEDRPNMASVVLMLGGEG-SLPIPKQPGFFTERNSVEAKASSPSKYESHSINEMSLTLLE  846

Query  3189  AR  3194
             AR
Sbjct  847   AR  848


 Score = 63.5 bits (153),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLV+LLGCCIEG EKMLI      KSLD F+FD T+   LNW
Sbjct  582  QHRNLVKLLGCCIEGDEKMLIYEYMPNKSLDYFIFDDTRSKLLNW  626



>dbj|BAE95185.1| S-locus receptor kinase [Brassica oleracea]
Length=849

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/832 (50%), Positives = 558/832 (67%), Gaps = 36/832 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+TLVS G+VF+LGFF         Y+G+WYK++  RT +WVANRD PL NSTG LK
Sbjct  44    ISSNRTLVSPGDVFELGFFETNSR---WYLGMWYKKLPYRTYIWVANRDNPLSNSTGTLK  100

Query  909   IGEDGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
             I    N+ ++  +  S+WS++ T  N+  P   VA+LL +GNFV+R  N+ +   + WQS
Sbjct  101   IS-GSNLVILGHSNKSVWSTNLTRGNERSP--VVAELLANGNFVMRDSNNNDASKFSWQS  157

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FDYPTDTLLP MKLG++ K G NR++ SWRS  DPS GD ++KL+   LPE +L   D+ 
Sbjct  158   FDYPTDTLLPEMKLGYNLKKGLNRFLVSWRSSDDPSSGDYSYKLEPRRLPEFYLLQGDVR  217

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
              +RSG WNG+ FSG+ E +    + ++F     EV Y+F + N + +SRL ++ T   ER
Sbjct  218   EHRSGPWNGIRFSGILEDQKLSYMVYNFTENSEEVAYTFRMTNNSFYSRLTLSSTGYFER  277

Query  1446  YTWIPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRD  1622
              TW P + IWN FW++P + QCD YR CG +  CD + SP C C  GF PRN Q W+LR 
Sbjct  278   LTWAPSSVIWNVFWSSPANPQCDMYRMCGPYSYCDVNTSPSCNCIQGFDPRNLQQWALRI  337

Query  1623  GSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
                GC R   L C  DGF  M   KLPE++ + VD ++ L EC++ C+ +C+CTA++N +
Sbjct  338   SLRGCKRRTLLSCNGDGFTRMKNMKLPETTMAIVDRSIGLKECEKRCLSDCNCTAFANAD  397

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             I NGG+GCVIWT  L D+R Y A+G Q LYVR+A +D      + +  N  GK   +I+ 
Sbjct  398   IRNGGTGCVIWTGNLADMRNYVADG-QDLYVRLAVAD------LVKKSNANGKIISLIVG  450

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETM  2162
               ++L + M         R K       N      R+R+++  MN   +SSKR+ SGE  
Sbjct  451   VSVLLLLIMFCLWKRKQNREKSSAASIAN------RQRNQNLPMNGIVLSSKRQLSGENK  504

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
             I +     + +  AI  AT+NF+N+NK+GQGGFG VYKG+L+ G+EIAVKRLSK S QG 
Sbjct  505   IEELELP-LIELEAIVKATENFSNSNKIGQGGFGIVYKGILLDGQEIAVKRLSKTSVQGV  563

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
             +EF NE+ LIARLQH NLV++LGCC+D DEKMLIYEY+EN SLDS LF K R S L+WK 
Sbjct  564   DEFMNEVTLIARLQHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNWKE  623

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R++I  GVARGLLYLHQDSRFRIIHRDLK SN+LLD+ M PKISDFGMAR+F  DETEA 
Sbjct  624   RFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDRNMVPKISDFGMARIFARDETEAN  683

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
             T K +VGTYGYMSPEYAM G+FS KSD FSFGV+VLE+++G++N+GFY    E+NLL  A
Sbjct  684   TMK-VVGTYGYMSPEYAMGGIFSEKSDVFSFGVMVLEIITGKRNRGFY----EDNLLSYA  738

Query  2883  WRLWGEGRGSELLDSVIA---SESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLM  3050
             WR W  GR  E++D VI    S   S F + +V++CIQ+GLLCVQE AE+RP M++V+ M
Sbjct  739   WRNWKGGRALEIVDPVIVNSFSPLSSTFQLQEVLKCIQIGLLCVQELAENRPTMSSVVWM  798

Query  3051  LIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ----SLNQLTVTMLDAR  3194
             L  + T +PQPK PG C+   P ++D SS+   D     ++NQ T +++DAR
Sbjct  799   LGNEATEIPQPKSPG-CVKRSPYELDPSSSRQRDDDESWTVNQYTCSVIDAR  849


 Score = 54.7 bits (130),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLV++LGCCI+  EKMLI       SLD+++F  T+R++LNW
Sbjct  577  QHVNLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRRSKLNW  621



>ref|XP_006594796.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X1 [Glycine max]
Length=833

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/827 (49%), Positives = 549/827 (66%), Gaps = 45/827 (5%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N TLVS    F+LGFF+PG NS   Y+GIWY++I  +T+VWVANR  P+ +S+G L++  
Sbjct  44    NTTLVSKDGTFELGFFTPG-NSQKRYLGIWYRKIPIQTVVWVANRLNPINDSSGILRMNP  102

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
                  ++   G  IWS+++      P + VA LL+SGN V+R E D N E+YLW+SF+YP
Sbjct  103   STGTLVLTHNGTVIWSTASIRR---PESPVALLLNSGNLVIRDEKDANSEDYLWESFNYP  159

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
             TDT LP MK GWD +TG NR + +W+SP DPS  D +F + +N  PEA++   D   YRS
Sbjct  160   TDTFLPEMKFGWDLRTGLNRKLIAWKSPDDPSPSDFSFGMVLNNYPEAYMMKGDQKFYRS  219

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL-ERYTW  1454
             G WNG+  SG P+++   +  F F+  K+E+YY++ + N ++ SRL++N T  + +RY W
Sbjct  220   GPWNGLHSSGSPQVKANPIYDFKFVSNKDELYYTYSLKNSSMISRLVLNATSYVRKRYVW  279

Query  1455  IPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGG  1634
             I   + W  + + P D CD+Y  CG+   C    SPVC C  GFKP+  +AWS  D S G
Sbjct  280   IESKQRWEVYTSVPLDLCDSYSLCGANANCVISDSPVCQCLQGFKPKLPEAWSSMDWSHG  339

Query  1635  CFRYDELDCPT---DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
             C R  EL C     DGF  +   K P+++ S++D T+ L+ECK  C+ NCSC AY+N +I
Sbjct  340   CIRNKELSCENKNKDGFNKLTLLKTPDTTHSWLDQTIGLEECKAKCLDNCSCMAYANSDI  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGE-VARGGNGFGKTKKVILA  1982
             S  GSGC +W  +L DIRQ+ A GGQ +YVR+ AS+ E   E   +GG     T  + LA
Sbjct  400   SGQGSGCAMWFGDLIDIRQFAA-GGQDVYVRIDASELEHANEGHKKGGVLVAVTVTLALA  458

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRG--TRERSRDPLMNATAISSK-REHSG  2153
                                      V   + + G   R++SR  +   +  S K  ++SG
Sbjct  459   A------------------------VAGILIILGWCYRKKSRCSVKERSDFSIKSNQNSG  494

Query  2154  ETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSR  2333
               M  D+ +LP+FD + IA AT NF   NK+G+GGFG VY+G L  G+EIAVKRLS +S 
Sbjct  495   --MQVDDMDLPVFDLSTIAKATSNFTVKNKIGEGGFGPVYRGSLTDGQEIAVKRLSASSG  552

Query  2334  QGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLD  2513
             QG  EFKNE++LIA+LQHRNLVKLLGCC++ +EKML+YEYM N SLDS +FD++RS  LD
Sbjct  553   QGLTEFKNEVKLIAKLQHRNLVKLLGCCLEGEEKMLVYEYMLNGSLDSFIFDEQRSGSLD  612

Query  2514  WKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDET  2693
             W +R+NIICG+A+GLLYLHQDSR RIIHRDLKASNVLLD E+NPKISDFGMAR+FG D+ 
Sbjct  613   WSKRFNIICGIAKGLLYLHQDSRLRIIHRDLKASNVLLDSELNPKISDFGMARIFGVDQQ  672

Query  2694  EAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLL  2873
             E G TKRIVGTYGYM+PEYA DGLFSVKSD FSFGVL+LE++SG++++G+Y  ++ +NL+
Sbjct  673   E-GNTKRIVGTYGYMAPEYATDGLFSVKSDVFSFGVLLLEIISGKRSRGYYNQNHSQNLI  731

Query  2874  GLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLML  3053
             G AW+LW EGR  EL+D  I   S    + Q++ CI V LLCVQ+  EDRP M++V+LML
Sbjct  732   GHAWKLWKEGRPLELIDKSIEDSSS---LSQMLHCIHVSLLCVQQNPEDRPGMSSVLLML  788

Query  3054  IGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             + +   LP+PKQPGF       + DSS++     S N++T+T+L+AR
Sbjct  789   VSE-LELPEPKQPGF-FGKYSGEADSSTSKQQLSSTNEITITLLEAR  833


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCC+EG EKML+       SLD+F+FD  +   L+W K
Sbjct  569  QHRNLVKLLGCCLEGEEKMLVYEYMLNGSLDSFIFDEQRSGSLDWSK  615



>ref|XP_011030934.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=817

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/819 (50%), Positives = 553/819 (68%), Gaps = 37/819 (5%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             +T+VSAG  F+LGFFSP   S   YVGIWYK     T+VWVANR+ PL +++G L++   
Sbjct  35    ETIVSAGSNFELGFFSPRSTSLR-YVGIWYK-FSSETLVWVANREAPLNDTSGVLQVTSK  92

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             G + L + T   +WS   TN   VP N VAQLL+SGN V+R  ND N ++YLW SFDYP 
Sbjct  93    GILVLHNSTNVVLWS---TNTSRVPQNPVAQLLNSGNLVIREANDTNEDDYLWDSFDYPG  149

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             +T LPG+K G +  TG +RY+ SW+S  DPS GD T  LD  G P+ F+R  + I++RSG
Sbjct  150   NTFLPGLKFGRNLITGLDRYLVSWKSTNDPSLGDSTTMLDPGGYPQIFIRVGENIVFRSG  209

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ FSG+P ++P  +  + F+  + E+YY +++ + ++ +R+++    +L+R+TW  
Sbjct  210   PWNGLKFSGMPNLKPNLIYTYEFVYNEKEIYYRYDLTDSSVVTRMLLTNDGILQRFTWTS  269

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
               R WN +  A  D CD Y  CG++GIC+ D SP C C  GF+P+++Q W   D SGGC 
Sbjct  270   STRTWNLYLTAQMDNCDRYAVCGAYGICNIDNSPACACLDGFQPKSRQDWDSGDWSGGCV  329

Query  1641  RYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGG  1817
             R +E  C   +GF  +   KLP++ TS  + TM L+EC+ +C+ NCSCTAYS  NI++G 
Sbjct  330   RKNESICRAGEGFQKVTSVKLPDTRTSSFNMTMDLEECRRVCLMNCSCTAYSTLNITDG-  388

Query  1818  SGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivl  1997
             +GC++W  +L DIR+Y +E GQ  Y+R++ASD E T    R    +     +I  C +V 
Sbjct  389   TGCLLWFEDLLDIREY-SETGQDFYIRLSASDLEPTRSPKRTTRVW-----IIAICLLVA  442

Query  1998  gigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEY  2177
             GI ++ F LL L RR+  + V   + M+      RD  +N+T                + 
Sbjct  443   GITILGFCLLFLMRRRKMKTVARMVSMQ-----ERDYSINST--------------DKDL  483

Query  2178  ELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKN  2357
             ELP+FDF  IA AT NF+ ANKLG+GGFG VYKG L  G+EIAVKRLSK S QG +EFKN
Sbjct  484   ELPVFDFATIATATSNFSGANKLGEGGFGPVYKGKLEDGQEIAVKRLSKTSTQGLDEFKN  543

Query  2358  ELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNII  2537
             E+  IA+LQHRNLVKLLGCC++ +E ML+YEYM NKSLD+ +FD+K+S LLDW  RYNII
Sbjct  544   EVICIAKLQHRNLVKLLGCCIESEETMLVYEYMPNKSLDAFIFDQKQSKLLDWSMRYNII  603

Query  2538  CGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRI  2717
              GVARGLLYLHQDSR RIIHRDLKASN+L+D +MNPKISDFGMAR FGG+E + G TKR+
Sbjct  604   NGVARGLLYLHQDSRLRIIHRDLKASNILVDYDMNPKISDFGMARSFGGNEIQ-GNTKRV  662

Query  2718  VGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWG  2897
             VGTYGYMSPEYA DG+FS+KSD FSFGVLVLE+V+G++N+GF    ++ NLLG AW+L+ 
Sbjct  663   VGTYGYMSPEYATDGIFSIKSDVFSFGVLVLEIVNGKRNRGFIHQDHKHNLLGHAWKLYK  722

Query  2898  EGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLP  3077
             E R  EL++  +    +   + +V+R I VGLLCVQ+  EDRP M+ V+LML     +LP
Sbjct  723   EERSFELINDSLKDTCN---LSEVLRVIHVGLLCVQQAPEDRPTMSTVVLML-SSNIALP  778

Query  3078  QPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
              PK+PGF    K    +SSST  +  S N++T+T+L AR
Sbjct  779   DPKEPGFFTERKLFDHESSSTKVDACSANEITITLLTAR  817



>dbj|BAF91397.1| S-locus receptor kinase [Brassica rapa]
Length=847

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/831 (50%), Positives = 562/831 (68%), Gaps = 23/831 (3%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ ++TLVS G VF+LGFF    +S   Y+G+WYK+   RT VWVANRD PL N  G LK
Sbjct  31    ISSSRTLVSPGNVFELGFFKTTSSSR-WYLGMWYKKFPYRTYVWVANRDNPLSNDIGTLK  89

Query  909   IGEDGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
                + N+ L+D +  S+WS++ T  N+  P   VA+LL +GNFV+R  N+ N   +LWQS
Sbjct  90    TSGN-NLVLLDHSNKSVWSTNVTRGNERSP--VVAELLANGNFVMRDSNNNNASQFLWQS  146

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FDYPTDTLLP MKLG+D KTG NR+++SWRS  DPS GD ++KL++  LPE +L    I 
Sbjct  147   FDYPTDTLLPEMKLGYDLKTGLNRFLTSWRSSDDPSSGDYSYKLELRRLPEFYLWKGSIR  206

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
              +RSG W+G+ FSG+PE +    + ++F     EV Y+F++ N + +S L ++ T   ER
Sbjct  207   THRSGPWSGIQFSGIPEDQRLSNMVYNFTENSEEVAYTFQMTNNSFYSTLTISSTGYFER  266

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
              TW P + +WN FW++P  QCD YR CG +  CD + SP C C  GF+P+N+Q W LR  
Sbjct  267   LTWAPSSVVWNVFWSSPNHQCDMYRICGPYTYCDVNTSPSCNCIQGFRPKNRQQWDLRIP  326

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
               GC R   L C  DGF  M   KLP+++ + VD ++ L ECK+ C+ +C+CTA++N +I
Sbjct  327   ISGCKRRTRLSCNGDGFTRMKNMKLPDTTMAIVDRSIVLKECKKRCLGDCNCTAFANADI  386

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
              NGG+GCVIW  EL DIR Y A+GGQ LYVR+AA+D      + +  NG  K   +I+  
Sbjct  387   RNGGTGCVIWIGELADIRNY-ADGGQDLYVRLAAAD------LVKKRNGNWKIISLIVGV  439

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGT-RERSRDPLMNATAISSKREHSGETM  2162
              +VL + ++L  L++    K ++   + +      ++R+++ LMN    S+KR+ S E  
Sbjct  440   SVVLLLLLLLLLLIMFCLWKRKQNRAKAMATSIVNQQRNQNVLMNTMTQSNKRQLSRENE  499

Query  2163  ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGA  2342
               DE+ELP+ +  A+  AT+NF+N N+LG+GGFG VYKGML  G+E+AVKRLSK S QG 
Sbjct  500   -ADEFELPLIELEAVVKATENFSNCNELGRGGFGIVYKGML-DGQEVAVKRLSKTSLQGI  557

Query  2343  EEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKR  2522
             +EF NE+RLIARLQH NLV++LGCC++  EK+LIYEY+EN SLD  LF KKRSS L+WK 
Sbjct  558   DEFMNEVRLIARLQHINLVRILGCCIEAGEKILIYEYLENSSLDYFLFGKKRSSNLNWKD  617

Query  2523  RYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAG  2702
             R+ I  GVARGLLYLHQDSRFRIIHRDLK  N+LLDK M PKISDFGMAR+F  DET+  
Sbjct  618   RFAITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKISDFGMARIFARDETQV-  676

Query  2703  TTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLA  2882
              T   VGTYGYMSPEYAM G+ S K+D FSFGV+VLE+V G++N+GFY  + E NL   A
Sbjct  677   RTDNAVGTYGYMSPEYAMYGVISEKTDVFSFGVIVLEIVIGKRNRGFYQVNPENNLPSYA  736

Query  2883  WRLWGEGRGSELLDSVI---ASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLM  3050
             W  W EGR  E++D VI    S   S F   +V++CIQ+GLLC+QE+AE RP M++V+ M
Sbjct  737   WTHWAEGRALEIVDPVILDSLSSLPSTFKPKEVLKCIQIGLLCIQERAEHRPTMSSVVWM  796

Query  3051  LIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             L  + T +PQPK P +CL S      SSS  ++D    ++N+ T +++DAR
Sbjct  797   LGSEATEIPQPKPPVYCLISYYANNPSSSRQFDDDESWTVNKYTCSVIDAR  847


 Score = 53.9 bits (128),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QH NLVR+LGCCIE GEK+LI       SLD F+F   + + LNW
Sbjct  571  QHINLVRILGCCIEAGEKILIYEYLENSSLDYFLFGKKRSSNLNW  615



>ref|XP_006370395.1| hypothetical protein POPTR_0001s42210g [Populus trichocarpa]
 gb|ERP66964.1| hypothetical protein POPTR_0001s42210g [Populus trichocarpa]
Length=828

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/819 (51%), Positives = 556/819 (68%), Gaps = 28/819 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             ++ +VSA   F+LGFFSPG +S   Y+GIWY +I  RT+VWVANR+ PL  S+G L++  
Sbjct  38    SEVMVSADGSFKLGFFSPG-SSQNRYLGIWYNKISGRTVVWVANREIPLTVSSGVLRVTH  96

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
              G + L++  GN IWS   TN+     N VAQLLDSGN +V+ E D + EN LWQSFDYP
Sbjct  97    RGVLVLLNHNGNIIWS---TNSSRSVRNPVAQLLDSGNLIVKDEGDGSMENLLWQSFDYP  153

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
              DTLLPGMKLG ++ TG +RY+SSW++P  PS G  T+ L   G PE  LR   + +YRS
Sbjct  154   CDTLLPGMKLGRNTMTGLDRYLSSWKTPDHPSRGVFTYGLKAAGYPEKVLRANSLQMYRS  213

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWI  1457
             G WNG+ FSG P+M+P  V  + F+ T+ E+YYS+++ ++++ SR+I+     ++R+TW 
Sbjct  214   GPWNGIRFSGCPQMQPNPVYTYGFVFTEKEMYYSYQLLDRSILSRVILTQNGNIQRFTWS  273

Query  1458  PENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGC  1637
                  W  +  A  D C+ Y  CG +G C  + SP+CGC  GF P+  + W + +  GGC
Sbjct  274   SSAHSWVFYLTAQVDDCNRYALCGVYGSCHINDSPMCGCLRGFIPKVPKDWQMMNWLGGC  333

Query  1638  FRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGG  1817
              R   L+C TDGF   +  KLPE++ S+   +M+L+ECK MC +NCSC AY+N +I  GG
Sbjct  334   ERRTPLNCSTDGFRKYSGVKLPETANSWFSKSMNLEECKNMCTKNCSCIAYTNLDIREGG  393

Query  1818  SGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivl  1997
             SGC++W ++L DIR+   E GQ +Y+R+AAS+ +   +         K +  I+    + 
Sbjct  394   SGCLLWFSDLIDIRRLN-ENGQDIYIRMAASELDHDNDTKNNYKSNKKKQMRIIVISTLP  452

Query  1998  gigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEY  2177
                ++L  LL+L   K +R   +N  M G  ERS                S +     + 
Sbjct  453   TGMLLLGLLLVLCFWKKKRQ--KNGNMTGIIERS----------------SNKNSTEQDQ  494

Query  2178  ELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKN  2357
             EL +FD  A+A+AT+NF+  NKLG+GGFG VYKG+L  G+EIAVKRLS+NSRQG EEFKN
Sbjct  495   ELQMFDLGAMAIATENFSVTNKLGEGGFGPVYKGILKDGQEIAVKRLSRNSRQGPEEFKN  554

Query  2358  ELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNII  2537
             E++ IA+LQHRNLVKLLGCC+  DE+MLIYE+M N+SLDS++F K RS+ LDW  RY+II
Sbjct  555   EVKHIAKLQHRNLVKLLGCCIQEDERMLIYEFMPNRSLDSLIFGKTRSTQLDWPNRYHII  614

Query  2538  CGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRI  2717
              G+ARGLLYLHQDSR RIIHRDLKASN+LLD +MNPKISDFG+AR FG +ETEA  T R+
Sbjct  615   HGIARGLLYLHQDSRLRIIHRDLKASNILLDNDMNPKISDFGLARSFGENETEA-ITSRV  673

Query  2718  VGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWG  2897
             VGTYGY+SPEYA+DGL+S+KSD FSFGVLVLE+VSG +N+GF  P ++ NLLG AWRL+ 
Sbjct  674   VGTYGYISPEYAIDGLYSIKSDVFSFGVLVLEIVSGNRNRGFCHPDHDLNLLGHAWRLFQ  733

Query  2898  EGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLP  3077
             EGR  EL+   +  ES++  + +V+R I VGLLCVQ    DRP+M++V+LML G+G +LP
Sbjct  734   EGRHFELIPGPV-EESYN--LSEVLRSIHVGLLCVQCSPNDRPSMSSVVLMLCGEG-ALP  789

Query  3078  QPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             QPKQPGF       + + SS      S+NQ T+T L+AR
Sbjct  790   QPKQPGFFNERDLAEANHSSRQNTSCSVNQFTITQLEAR  828



>emb|CAB41878.1| SRK5 protein [Brassica oleracea]
Length=848

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/828 (50%), Positives = 570/828 (69%), Gaps = 29/828 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G VF+LGFF P G S   Y+GIWYK++  +T  WVANRD PL NS G LKI  
Sbjct  41    NRTLVSPGGVFELGFFKPLGRSR-WYLGIWYKKVSQKTYAWVANRDSPLTNSIGTLKISG  99

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ L+  + N++WS++ T  N   P   +A+LL +GNFV+R  N+++P  +LWQSFD+
Sbjct  100   N-NLVLLGQSNNTVWSTNITRGNARSP--VIAELLPNGNFVMRYSNNKDPSGFLWQSFDF  156

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFL----RNKD  1259
             PTDTLLP MKLG+D KTGRNR+++SW+   DPS G+  +KLDI  GLPE  L     N+ 
Sbjct  157   PTDTLLPEMKLGYDLKTGRNRFLTSWKGSDDPSSGNFVYKLDIRRGLPEFILINTFLNQR  216

Query  1260  IIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRL-IVNYTQL  1436
             +   RSG WNG+ FSG+PE++    + +++     E+ YSF + N++++SRL +  +T  
Sbjct  217   VETQRSGPWNGIEFSGIPEVQGLNYMVYNYTENSEEIAYSFHMTNQSIYSRLTLTEFT--  274

Query  1437  LERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSL  1616
             L+R+TWIP +  W+ FW  P D CD    CGS+  CD   SP C C  GF P+N Q W L
Sbjct  275   LDRFTWIPPSWGWSLFWTLPTDVCDPLYLCGSYSYCDLITSPNCNCIRGFVPKNPQQWDL  334

Query  1617  RDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSN  1796
             RDG+ GC R  ++ C  DGFL +N   LP++ T+ VD T+ + +C+E C+ +C+CT+++ 
Sbjct  335   RDGTQGCVRTTQMSCSGDGFLRLNNMNLPDTKTATVDRTIDVKKCEERCLSDCNCTSFAI  394

Query  1797  YNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVI  1976
              ++ NGG GCV WT EL  IR++ A GGQ LYVR+ A+D + +      G    +T K+I
Sbjct  395   ADVRNGGLGCVFWTGELIAIRKF-AVGGQDLYVRLDAADLDISS-----GEKRDRTGKII  448

Query  1977  LACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAIS-SKREHSG  2153
                  V  + ++   +    RR+ ++   +   + G +      LMN   +   KR+ SG
Sbjct  449   GWSIGVSVMLILSVIVFCFWRRRQKQAKADATPIVGNK-----VLMNEVVLPRKKRDFSG  503

Query  2154  ETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSR  2333
             E  + +  ELP+ +F A+  AT++F++ NK+G+GGFG VYKG LV G+EIAVKRLS+ S 
Sbjct  504   EEEV-ENLELPLMEFEAVVTATEHFSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSA  562

Query  2334  QGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLD  2513
             QG +EF NE+RLIA+LQH NLV+LLGCCV   EK+LIYEY+EN SLDS LFD+ RS +L+
Sbjct  563   QGTDEFMNEVRLIAKLQHYNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLN  622

Query  2514  WKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDET  2693
             W+ R++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DET
Sbjct  623   WQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDET  682

Query  2694  EAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLL  2873
             EA  T+++VGTYGYMSPEYAM+G FS+KSD FSFGVL+LE++SG++N+G     +  NLL
Sbjct  683   EAD-TRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGLCDSDSSLNLL  741

Query  2874  GLAWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLM  3050
             G  WR W EG+G E++D VI   S   F   ++ RC+Q+GLLCVQE+ EDRP M++V+LM
Sbjct  742   GCVWRNWKEGQGLEIVDRVIIDSSSPMFRPREISRCLQIGLLCVQERVEDRPMMSSVVLM  801

Query  3051  LIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             L  +   +PQPKQPG+C++   ++  S     N  ++NQ+T++++DAR
Sbjct  802   LGSEAALIPQPKQPGYCVSGSSLETYSRRDDEN-CTVNQITMSIIDAR  848



>ref|XP_009402881.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=831

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/849 (48%), Positives = 553/849 (65%), Gaps = 48/849 (6%)
 Frame = +3

Query  681   GTADDIL**GPPWNPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVW  860
              T  D+L    P  P L    TL+SAG  F+LGFFSP G S   YVGIW+ ++  +T++W
Sbjct  20    ATGGDVL---TPHRPILDDGTTLISAGGAFELGFFSPVG-SDNRYVGIWFHKVSLQTVIW  75

Query  861   VANRDKPLRNSTGFLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVV  1040
             VANR +P+   TG L +  +G + + D +   +WSS +        N VAQLLD GN VV
Sbjct  76    VANRQRPVAGRTGSLSLAANGTLFVTDNS-TVVWSSGS----PALANPVAQLLDDGNLVV  130

Query  1041  RREND--ENPENYLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFK  1214
                    ++P ++ WQ FD+PTDTLLP MKLGW+  +G NR ++SW S +DP+ G+ T  
Sbjct  131   MESGSSGKDPNSFAWQGFDFPTDTLLPNMKLGWNLTSGLNRNLTSWASLSDPAIGNYTMG  190

Query  1215  LDINGLPEAFLRNKDIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHN  1394
             +D++G P+ FL ++D   +R+G WNG+ FSG+P+M+     +F F+   +EV+YSF +H+
Sbjct  191   VDVDGDPQGFLWSRDSKQWRAGSWNGIQFSGIPDMKTYSQFSFEFIIRPDEVFYSFFVHD  250

Query  1395  KNLFSRLIVNYTQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGC  1574
              ++ SRL V  + +L+R  WI  +++W+ FW AP+DQCD    CG  G+CD++ SP+C C
Sbjct  251   DSIISRLTVLPSGILQRLVWIEHSKLWSVFWFAPRDQCDYVSPCGPNGVCDSNNSPICEC  310

Query  1575  PVGFKPRNQQAWSLRDGSGGCFRYDELDCP--TDGFLSMNYTKLPESSTSFVDATMSLDE  1748
               GF+P+N   W LRDGS GC R   LDC   TDGF  ++  KLP++S + V+ +++L +
Sbjct  311   LHGFRPKNPTNWDLRDGSDGCVRETALDCRNGTDGFNQLSNAKLPDTSRAVVNRSLNLQQ  370

Query  1749  CKEMCVRNCSCTAYS--NYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQ  1922
             C++ C RNCSCT Y+  ++N S   +GC++WT  L D+R Y + GGQ LYVRVAA+D +Q
Sbjct  371   CRDACSRNCSCTGYAAASFNSSGIWNGCIMWTTHLTDLRVYVS-GGQDLYVRVAAADLDQ  429

Query  1923  TGEVARGGNGFGKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSR  2102
             +    +  +   +T+  ++   ++    +                +   +     R++  
Sbjct  430   SDSETKHSH---RTRVFVIVVAVLAPAIL----------------LAACVACCVGRKKM-  469

Query  2103  DPLMNATAISSKREHSGETMITD-----EYELPIFDFNAIAMATDNFANANKLGQGGFGS  2267
               +M   A S  +  SG   I D     + +LP+FD   IA ATDNF+  NKLG+GG+G 
Sbjct  470   --IMTRRATSGTKSLSGH-HIDDGAEGKDLDLPLFDLGTIADATDNFSIHNKLGEGGYGP  526

Query  2268  VYKGMLVGGEEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIY  2447
             VYKG L   +E+A+KRLSK S QG +EFKNE+ +IA+LQHRNLV+LLGCC+   E++LIY
Sbjct  527   VYKGKLEEEQEVAIKRLSKTSMQGLDEFKNEVTVIAKLQHRNLVRLLGCCIQAGERVLIY  586

Query  2448  EYMENKSLDSILFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLL  2627
             EYM N SLD+ LFDK +  LL+W+ RY II G+ARGLLYLH+DSR RIIHRDLKASN+LL
Sbjct  587   EYMPNGSLDAFLFDKVKGELLNWRSRYTIIVGIARGLLYLHEDSRLRIIHRDLKASNILL  646

Query  2628  DKEMNPKISDFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLV  2807
             DK+MNPKISDFGMAR+FGGDETE   T R+VGTYGYMSPEYAMDG+FSVKSD FSFGVLV
Sbjct  647   DKDMNPKISDFGMARIFGGDETEV-NTMRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLV  705

Query  2808  LEVVSGRKNQGFYTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQV  2987
             LE+VSG+KN+G Y      NLL   W LW E R  E++D  I     S   D+V+RCI+V
Sbjct  706   LEIVSGKKNRGVYYSGRHLNLLAYTWSLWKEDRVLEMVDESIG---ESFPTDEVLRCIKV  762

Query  2988  GLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQ  3167
             GLLCVQE  EDRP M++V LML      LPQP  PGF  A  P++MDSS +     S+N 
Sbjct  763   GLLCVQEMPEDRPTMSSVALMLGSDSALLPQPAHPGFVSARCPIEMDSSISKQESMSINN  822

Query  3168  LTVTMLDAR  3194
             ++VTM + R
Sbjct  823   VSVTMFEGR  831


 Score = 58.9 bits (141),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRLLGCCI+ GE++LI       SLD F+FD  K   LNW
Sbjct  565  QHRNLVRLLGCCIQAGERVLIYEYMPNGSLDAFLFDKVKGELLNW  609



>dbj|BAE93137.1| S-receptor kinase [Brassica rapa]
Length=855

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/827 (50%), Positives = 568/827 (69%), Gaps = 27/827 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+T+VS G VF+LGFF+P G S   Y+GIWYKE+  +T  WVANRD PL NS G LK+  
Sbjct  48    NRTVVSPGGVFELGFFTPLGRSR-WYLGIWYKEVPRKTYAWVANRDNPLSNSIGTLKVSG  106

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ L   + N++WS++ T  N   P   +A+LL +GNFV+R  N+++P  +LWQSFD+
Sbjct  107   N-NLVLQGQSNNTVWSTNITRGNARSP--VIAELLPNGNFVMRYSNNKDPSGFLWQSFDF  163

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFL----RNKD  1259
             PTDTLLP MKLG+D KTGRNR+++SW+   DPS G+  +KLDI  GLPE  L     N+ 
Sbjct  164   PTDTLLPEMKLGYDLKTGRNRFLTSWKGSDDPSSGNFVYKLDIRRGLPEFILINTFLNQR  223

Query  1260  IIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL  1439
             +   RSG WNG+ FSG+PE++    + +++     E+ YSF++ N++++SRL V+   L 
Sbjct  224   VETQRSGPWNGIEFSGIPEVQGLNYMVYNYTENSEEIAYSFQMTNQSIYSRLTVSEFTL-  282

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             +R+TWIP +  W+ FW  P D CD    CGS+  CD   SP C C  GF P+N Q W LR
Sbjct  283   DRFTWIPPSWGWSLFWTLPTDVCDPLYLCGSYSYCDLITSPNCNCISGFVPKNPQQWDLR  342

Query  1620  DGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
             DG+ GC R   L C  D FL +N   LP++ T+ VD T+ + +C+E C+ +C+CT+++  
Sbjct  343   DGTQGCVRRTRLSCSEDEFLRLNNMNLPDTKTATVDRTIDVKKCEERCLSDCNCTSFAIA  402

Query  1800  NISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVIL  1979
             ++ NGG GCV WT EL  IR++ A GGQ LYVR+ A+D + +      G    +T K+I 
Sbjct  403   DVRNGGLGCVFWTGELVAIRKF-AVGGQDLYVRLNAADLDISS-----GEKRDRTGKIIG  456

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAIS-SKREHSGE  2156
                 V  + ++   +    RR+ ++   +   + G +      LMN   +   KR  SGE
Sbjct  457   WSIGVSVMLILSVIVFCFWRRRQKQAKADATPIVGNQ-----VLMNEVVLPRKKRIFSGE  511

Query  2157  TMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQ  2336
               + + +ELP+ +F A+  AT++F++ NK+G+GGFG VYKG LV G+EIAVKRLS+ S Q
Sbjct  512   EEV-ENFELPLMEFEAVVTATEHFSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSSQ  570

Query  2337  GAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
             G +EF NE+RLIA+LQH NLV+LLGCCV   EK+LIYEYMEN SLDS LFD+ R  +L+W
Sbjct  571   GTDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYMENLSLDSHLFDETRGCMLNW  630

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
             + R++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETE
Sbjct  631   QMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETE  690

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             A  T+++VGTYGYMSPEYAM+G FS+KSD FSFGVL+LE++SG++N+GF    +  NLLG
Sbjct  691   AD-TRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSSLNLLG  749

Query  2877  LAWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLML  3053
               WR W EG+G E++D VI   S   F   ++ RC+Q+GLLCVQE+ EDRP M++V+LML
Sbjct  750   CVWRNWKEGQGLEIVDRVIIDSSSPTFRPSEISRCLQIGLLCVQERVEDRPMMSSVVLML  809

Query  3054  IGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
               +   +PQPKQPG+C++   ++  S     N  ++NQ+T++++DAR
Sbjct  810   GSEAALIPQPKQPGYCVSGSSLETYSRRDDEN-WTVNQITMSIIDAR  855



>dbj|BAA34911.1| SRK45 [Brassica rapa]
Length=846

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/839 (50%), Positives = 563/839 (67%), Gaps = 40/839 (5%)
 Frame = +3

Query  711   PPWNPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRN  890
             P  +  ++ N+TLVS G+VF+LGFF         Y+G+WYK++ +RT VWVANRD P+ N
Sbjct  37    PTESLTISSNRTLVSPGDVFELGFFRTNSR---WYLGMWYKKVSERTYVWVANRDNPISN  93

Query  891   STGFLKIGEDGNIHLVDGTGN-SIWSSSNT--NNQSVPGNTVAQLLDSGNFVVRRENDEN  1061
             S G LKI   GN  ++ G  N S+WS++ T  N +S+    +A+LL +GNFV+R  N+++
Sbjct  94    SIGSLKIL--GNNLVLRGNSNKSVWSTNITRRNERSL---VLAELLGNGNFVMRDSNNKD  148

Query  1062  PENYLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEA  1241
                YLWQSFDYPTDTLLP MKLG+  KTG NR+++SWRS  DPS GD ++KL+   LPE 
Sbjct  149   ASEYLWQSFDYPTDTLLPEMKLGFQPKTGLNRFLTSWRSSDDPSSGDFSYKLEAQRLPEF  208

Query  1242  FLRNKDII-IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLI  1418
             +L NK++  ++RSG WNG+ FSG+PE +    + ++F     EV Y+F + N +++SRLI
Sbjct  209   YLWNKELFRVHRSGPWNGIRFSGIPEDQKLSYMVYNFTENSEEVAYTFLLTNSSIYSRLI  268

Query  1419  VNYTQLLERYTWIPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPR  1595
             V+    +ER TW P   +WN FW+ P D QC++YR CG +  CD + SPVC C  GF P 
Sbjct  269   VSSEGYIERQTWNPTLGMWNVFWSFPLDSQCESYRMCGPYSYCDVNTSPVCNCIQGFNPS  328

Query  1596  NQQAWSLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNC  1775
             N + W LR  SGGC R   + C  DGF  M   KLPE++ + VD ++ + EC++ C+ +C
Sbjct  329   NVEQWDLRSWSGGCIRRTRVSCSGDGFTRMKNMKLPETTMATVDRSIGVKECEKKCLSDC  388

Query  1776  SCTAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGF  1955
             +CTA++N +I NGG+GCVIWT  L D+R Y A+ GQ LYVR+AA+D      + +  N  
Sbjct  389   NCTAFANADIRNGGTGCVIWTGRLDDMRNYVADHGQDLYVRLAAAD------LVKKRNAD  442

Query  1956  GKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISS  2135
             GK     +A  ++L + M        KR K       N      R+R+++  MN   + S
Sbjct  443   GKIISSTVAVSVLLLLIMFCLWKRKQKRAKASATSIAN------RQRNQNLSMNGMVLLS  496

Query  2136  KREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKR  2315
             KRE S +  I +     I    A+  ATDNF+N NKLGQGGFG VYKG L+ G+EIAVKR
Sbjct  497   KREFSVKNKIEELELPLIEL-EAVVKATDNFSNCNKLGQGGFGIVYKGRLLDGQEIAVKR  555

Query  2316  LSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKK  2495
             LS+ S QG +EF NE+ LIARLQH NLV++LGCC++ DEKMLIYEY+EN SLDS LF K 
Sbjct  556   LSETSVQGTDEFMNEVTLIARLQHINLVQILGCCIEADEKMLIYEYLENLSLDSYLFGKT  615

Query  2496  RSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARL  2675
             + S L+WK R++I  GVARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+
Sbjct  616   QRSKLNWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARI  675

Query  2676  FGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPS  2855
             F  DETEA T K +VGTYGYMSPEYAM+G+FS KSD FSFGV+VLE+V+G++N+G+    
Sbjct  676   FARDETEANTMK-VVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTGKRNRGY----  730

Query  2856  NEENLLGLAWRLWGEGRGSELLDSVIASES-HSEFV-DQVMRCIQVGLLCVQEKAEDRPN  3029
                N L  AW  W EGR  EL+D VI   S  S F  ++V++CIQ+GLLCVQE AE RP 
Sbjct  731   ---NFLSYAWSHWKEGRTLELVDPVIVDSSLPSTFQPEEVLKCIQIGLLCVQELAEHRPT  787

Query  3030  MAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ----SLNQLTVTMLDAR  3194
             M++V+ ML  + T +P PK PG C+   P +++ SS+   D+    ++NQ T +++DAR
Sbjct  788   MSSVVWMLGSEATEIPHPKPPGCCIGRSPYELEPSSSRQCDEDESWTVNQYTCSVIDAR  846


 Score = 55.5 bits (132),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLV++LGCCIE  EKMLI       SLD+++F  T+R++LNW
Sbjct  578  QHINLVQILGCCIEADEKMLIYEYLENLSLDSYLFGKTQRSKLNW  622



>gb|EEC82243.1| hypothetical protein OsI_26417 [Oryza sativa Indica Group]
Length=857

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/841 (48%), Positives = 553/841 (66%), Gaps = 33/841 (4%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSP-GGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNST  896
             N  L   Q LVSAG VF+LGFF+P G  +   ++GIWY++I   T+VWVANRD P+  + 
Sbjct  34    NSSLADGQKLVSAGGVFELGFFTPPGSTTAARFLGIWYRDIDPPTVVWVANRDAPVSGTA  93

Query  897   GFLKI---------GEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRE  1049
             G L +         G  G + L DG+G  +WSS+  +N +      A+LLDSGNFV+   
Sbjct  94    GSLAVVVNGGGGGGGGGGRLVLGDGSGRVVWSSA-PSNVTASDPVAARLLDSGNFVL--A  150

Query  1050  NDENPENYLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDING  1229
                   + +WQSFDYP+DTLLPGMK GWD  TG +RY+++WRS  DPS GD TFK+D  G
Sbjct  151   GGGGAGDVIWQSFDYPSDTLLPGMKFGWDLTTGLDRYLTTWRSAGDPSPGDYTFKIDPRG  210

Query  1230  LPEAFL-RNKDIIIYRSGGWNGVAFSGVPEMEPKEV-IAFSFMRTKNEVYYSFEIHNKN-  1400
              PE F+  N    +YR+G W+G+ FSG PEMEP      F F+  + +VYY+F +     
Sbjct  211   APEGFIWYNGTSPVYRNGPWDGLQFSGEPEMEPNNTSFRFEFVANRTDVYYTFVVDGGGG  270

Query  1401  --LFSRLIVNYTQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGC  1574
               + SR ++N +   +RY W+P+   W+ +W+ P+DQCD Y  CG++G+CD   + +CGC
Sbjct  271   GGVLSRFVLNQSSA-QRYVWLPQAGGWSLYWSLPRDQCDQYAHCGAYGVCDVGAASMCGC  329

Query  1575  PVGFKPRNQQAWSLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECK  1754
             P GF P + + W LRD S GC R   L+C  DGFL +   KLP+++ + VDA +++D+C+
Sbjct  330   PAGFAPASPRNWELRDSSAGCARRTRLNCTGDGFLPLRGVKLPDTTNATVDAAIAVDQCR  389

Query  1755  EMCVRNCSCTAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEV  1934
               C+ NCSC AY+  ++  GGSGC++W++ L DIR+++  GG+ L++R+AASD    G+ 
Sbjct  390   ARCLANCSCVAYAASDVRGGGSGCIMWSSPLVDIRKFS-YGGEDLFMRLAASDLPTNGDD  448

Query  1935  ARGGNGFGKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLM  2114
             +       +   V+     + G+ ++      +  +  R  V      R T   S  PL 
Sbjct  449   S------SRKNTVLAVVLSLSGVVLLALAAFFVWDKLFRNKVRFQSPQRFTSFDSSIPLN  502

Query  2115  NATAISSKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGG  2294
                     R+   ET  ++E  + +FDFN IA +TDNFAN  KLG+GGFG VYKG L GG
Sbjct  503   QV----QDRKMEDETRHSNELNVTLFDFNTIAFSTDNFANLAKLGEGGFGPVYKGELDGG  558

Query  2295  EEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLD  2474
             + +AVKRLSK S QG +EFKNE+ LIARLQH NLV+LLGCC+  +E+ML+YEYMENKSLD
Sbjct  559   QTVAVKRLSKFSTQGLDEFKNEVMLIARLQHVNLVRLLGCCIHGEERMLVYEYMENKSLD  618

Query  2475  SILFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKIS  2654
             + +FDK RS+ L+W +R+NII G+ARGLLYLHQDSRF+IIHRDLKA N+LLD +MNPKIS
Sbjct  619   NFIFDKARSAQLNWSKRFNIILGIARGLLYLHQDSRFKIIHRDLKAGNILLDGDMNPKIS  678

Query  2655  DFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKN  2834
             DFG+AR+F GD+T++  T+++VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE+VSGRKN
Sbjct  679   DFGVARIF-GDDTDS-HTRKVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLELVSGRKN  736

Query  2835  QGFYTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFV-DQVMRCIQVGLLCVQEK  3011
             +G Y+   + +LL  AWRLW EG    LLD  +A      +   +V+RC+QVGLLCVQE+
Sbjct  737   RGMYSSGEQTSLLSHAWRLWREGNALALLDEAVAGGGGGGYSRSEVLRCVQVGLLCVQER  796

Query  3012  AEDRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDA  3191
              EDRP+MAAV +ML      +PQP+ PGFC         +     +  ++N +TVT+++ 
Sbjct  797   PEDRPHMAAVFMMLGNLSAVVPQPRHPGFCSDRGGGGGSTDGEWSSTCTVNDVTVTIVEG  856

Query  3192  R  3194
             R
Sbjct  857   R  857


 Score = 62.0 bits (149),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCCI G E+ML+      KSLD F+FD  + A+LNW K
Sbjct  588  QHVNLVRLLGCCIHGEERMLVYEYMENKSLDNFIFDKARSAQLNWSK  634



>gb|KDP38980.1| hypothetical protein JCGZ_00737 [Jatropha curcas]
Length=827

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/823 (49%), Positives = 556/823 (68%), Gaps = 41/823 (5%)
 Frame = +3

Query  747   LVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGEDGN  926
             LVSAG  F+LGFFSP G S   Y+GIWY  +  +T+VWVANR+ P+ +S+G L+I + G 
Sbjct  39    LVSAGGSFRLGFFSPLGTSKNKYLGIWYNNLPGQTVVWVANREIPITDSSGVLRISDQGM  98

Query  927   IHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPTDT  1106
             + L  G G+ IWSS++T     P   +AQLLDSGN VV+ E D+NPENYLWQSFDYPTDT
Sbjct  99    LVLTVGNGSIIWSSNSTRASRNP---IAQLLDSGNLVVKNEGDDNPENYLWQSFDYPTDT  155

Query  1107  LLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSGGW  1286
              LPGMKLGW+ + G  RY++ W++  +P+ G+ +  +D  G P+  +R    +++R+G W
Sbjct  156   FLPGMKLGWNREKGLGRYLTPWKTSDNPARGNFSCGVDAAGYPQLVVRKNSKLVFRAGSW  215

Query  1287  NGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSR-LIVNYTQLLERYTWIPE  1463
             NG+ FSG P ++P  +  F F+  + E+YY +E+ N +L SR +I N   L +R+ W  +
Sbjct  216   NGLRFSGAPGLKPNSIYTFGFVLNEKELYYHYELRNSSLLSRSMINNVNGLFQRFLWNEQ  275

Query  1464  NRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCFR  1643
              R W  +     D CD Y  CGS+G C+ + SP C C  GF+P+  + W   D S GC R
Sbjct  276   TREWRLYSTVQMDNCDQYALCGSYGSCNINNSPTCSCLEGFEPKVPKEWDTVDWSSGCVR  335

Query  1644  YDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGSG  1823
                L+C  DGF   +  KLP++  S+ + +M+L+EC+ MC++NCSC AY+N +I  GGSG
Sbjct  336   KIPLNCAGDGFRRYSAVKLPDTQKSWYNKSMNLEECRTMCLKNCSCIAYTNLDIRGGGSG  395

Query  1824  CVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTK----KVILACgi  1991
             C+IW  +L D R +  E GQ +Y+R+AAS      E+A   N   K+K    ++IL+  +
Sbjct  396   CLIWYDDLLDTR-HLDENGQDIYIRMAAS------EIAFDENMKTKSKSNKTRIILSTVL  448

Query  1992  vlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITD  2171
               G+ ++   +L+              + +  + R +  +++  A  + +E        +
Sbjct  449   PAGMLLLGLTMLVCLW-----------KKKQQKHRIKTGIVDRNAYDNTKE--------E  489

Query  2172  EYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEF  2351
             E ELP+FDFN IA ATDNF+  NKLG+GGFG V+KG L  G+EIAVKRLSKNS QG  EF
Sbjct  490   ELELPLFDFNTIASATDNFSINNKLGEGGFGPVFKGTLKDGQEIAVKRLSKNSNQGLNEF  549

Query  2352  KNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYN  2531
             KNE+  IA+LQHRNLVKLLGCC++ +EKML+YE+M N SLD  LFD+K+S LLDW  RY 
Sbjct  550   KNEVMHIAKLQHRNLVKLLGCCIESEEKMLVYEFMPNTSLDCFLFDEKQSKLLDWPARYQ  609

Query  2532  IICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTK  2711
             II G+ARGLLYLHQDSR RIIHRDLKA N+LLD EMNPKISDFG+AR FGG+ETEA T K
Sbjct  610   IINGIARGLLYLHQDSRLRIIHRDLKAGNMLLDYEMNPKISDFGLARSFGGNETEANTNK  669

Query  2712  RIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRL  2891
              +VGTYGYMSPEYA++G++SVKSD FSFGV+VLE+VSG++N+GF    ++ NLLG AW+L
Sbjct  670   -VVGTYGYMSPEYAIEGIYSVKSDVFSFGVIVLEIVSGKRNRGFSHEDHDLNLLGHAWQL  728

Query  2892  WGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTS  3071
               EGR  EL+D+   S  +S  + +V+R + VGLLCVQ   EDRP+M+AV+ ML  +G +
Sbjct  729   HKEGRSIELIDT---SLRNSYNLSEVLRSVHVGLLCVQGSIEDRPSMSAVVYMLGSEG-A  784

Query  3072  LPQPKQPGFCLASKPVKMDSSSTS--YNDQSLNQLTVTMLDAR  3194
             LP+PK PGF      ++++++ST+  +   S N LT+T+LDAR
Sbjct  785   LPEPKLPGFFTERDLIELEANSTTRKHTASSTNGLTITVLDAR  827



>ref|XP_010434187.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Camelina sativa]
 ref|XP_010434188.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Camelina sativa]
Length=684

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/696 (56%), Positives = 505/696 (73%), Gaps = 16/696 (2%)
 Frame = +3

Query  1119  MKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSGGWNGVA  1298
             MKLGWD KTG NR+I SW+S  DPS GD +FKL+  G PE FL N++  +YRSG WNG+ 
Sbjct  1     MKLGWDLKTGFNRFIRSWKSSDDPSSGDYSFKLETGGFPEVFLWNRESRVYRSGPWNGIR  60

Query  1299  FSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIPENRIWN  1478
             FSGVPEM+  + + F+F  +K EV YSF +   +++SRL ++ T +LER+TWI   + WN
Sbjct  61    FSGVPEMQRFDYMVFNFTASKEEVTYSFRVTKDDIYSRLSLSSTGVLERFTWIEAAQTWN  120

Query  1479  RFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCFRYDELD  1658
             RFW APKDQCD+Y+ECG +G CD++ SPVC C  GFKPRN Q W LRDGS GC R   L 
Sbjct  121   RFWYAPKDQCDDYKECGVYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGSDGCVRKTLLT  180

Query  1659  C-PTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGSGCVIW  1835
             C   +GF  +   KLP+++ + V+  + + EC++ C+++C+CTA++N +I   GSGCVIW
Sbjct  181   CGGKEGFARLKKMKLPDTTAASVNRGIGVKECEQKCLKDCNCTAFANTDIRGAGSGCVIW  240

Query  1836  TAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlgigmvl  2015
             T EL DIR Y A+GGQ LYVR+AA+D E   +  R     G +  VI    I+  I   L
Sbjct  241   TGELLDIRNY-AKGGQDLYVRLAATDLED--KRNRSAKIIGSSIGVISVLLILSFIIFCL  297

Query  2016  fgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEYELPIFD  2195
             +     +   +   + + +       RSRD LMN   ISS+R H      TD+ ELP+ +
Sbjct  298   WKRKQKQSAAVETPIVDQV-------RSRDLLMNEVVISSRR-HISRDKNTDDLELPLME  349

Query  2196  FNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNELRLIA  2375
             F+ +AMAT+NF+N NKLG+G FG VYKG L+ G+EIAVKRLSK S QG +EFKNE++LIA
Sbjct  350   FDEVAMATNNFSNENKLGKGVFGIVYKGRLLDGQEIAVKRLSKTSVQGTDEFKNEVKLIA  409

Query  2376  RLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIICGVARG  2555
             RLQH NLV+LL CCVD+DEKMLIYEY+EN SLDS LFDKKRSS L+W+ R++II G+ARG
Sbjct  410   RLQHINLVRLLACCVDVDEKMLIYEYLENLSLDSHLFDKKRSSKLNWQMRFDIINGIARG  469

Query  2556  LLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIVGTYGY  2735
             LLYLHQDSRFRIIHRDLKASNVLLDK M PKISDFG+AR+FG D+TEA  T+++VGTYGY
Sbjct  470   LLYLHQDSRFRIIHRDLKASNVLLDKYMTPKISDFGIARIFGRDDTEA-ITRKVVGTYGY  528

Query  2736  MSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGEGRGSE  2915
             MSPEYAMDG+FS+KSD FSFGVL+LE++SG++N+GFY    + NLLG  WR W EG+G E
Sbjct  529   MSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRNKGFYNSDRDLNLLGCVWRNWKEGKGLE  588

Query  2916  LLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQPKQPG  3095
             ++D +    S +    + +RCIQ+GLLCVQE+AEDRP M+ V+LML  + T++PQPK PG
Sbjct  589   IIDPINTDSSSTVRQHEFLRCIQIGLLCVQERAEDRPTMSLVVLMLGSESTTIPQPKPPG  648

Query  3096  FCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             + L   P++ DSSS+  +D    ++NQ+TV++LDAR
Sbjct  649   YSLGRSPLETDSSSSKPHDDESWTVNQITVSVLDAR  684



>dbj|BAF91375.1| S receptor kinase [Brassica rapa]
Length=858

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/828 (51%), Positives = 563/828 (68%), Gaps = 24/828 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G+VF+LGFF+PG +S   Y+GIWYK++   T VWVANRD PL NSTG LKI  
Sbjct  46    NRTLVSPGDVFELGFFTPGSSSR-WYLGIWYKKLPYITYVWVANRDNPLSNSTGTLKISG  104

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ L+  +  SIWS++ T  N+  P   VA+LL +GNFV+R  N+ +   +LWQSFDY
Sbjct  105   N-NLFLLGDSNKSIWSTNLTRGNERSP--VVAELLANGNFVMRDSNNNDASGFLWQSFDY  161

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PTDTLLP MKLG+D KTG NR+++S R+  DPS GD ++KL+   LPE +L   D+  +R
Sbjct  162   PTDTLLPEMKLGYDLKTGLNRFLTSSRNFDDPSSGDYSYKLEPRRLPEFYLLLGDVREHR  221

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             SG WNG+ FSG+PE +    + ++F +   EV Y+F + N + +SRL +N    LER TW
Sbjct  222   SGPWNGIQFSGIPEDQKLSYMVYNFTKNSEEVAYTFRMTNNSFYSRLTINSEGYLERLTW  281

Query  1455  IPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGG  1634
              P + +WN FW++P  QCD YR CG +  CD + SP C C  GF P N Q W+LR+   G
Sbjct  282   APSSVVWNVFWSSPNHQCDMYRMCGPYSYCDVNTSPSCNCIQGFNPGNVQQWALRNQISG  341

Query  1635  CFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNG  1814
             C R   L C  DGF  M   KLP++  + VD ++ L EC++ C+ +C+CTA++N +I N 
Sbjct  342   CKRRTRLSCNGDGFTRMKNIKLPDTRMAIVDRSIGLKECEKRCLSDCNCTAFANADIRNR  401

Query  1815  GSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgiv  1994
              +GCVIWT EL D+R Y AEGGQ LYVR+AA+D      + +  NG  K   +I+   +V
Sbjct  402   VTGCVIWTGELEDMRNY-AEGGQDLYVRLAAAD------LVKKRNGNWKIISLIVGVSVV  454

Query  1995  lgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDE  2174
             L + ++L  +  L +RK  R       +   ++R+++ LMN    S+KR+ S E    DE
Sbjct  455   LLLLLLLLIMFCLWKRKQNRAKAMATSIVN-QQRNQNVLMNTMTQSNKRQLSRENK-ADE  512

Query  2175  YELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFK  2354
             +ELP+ +  A+  AT+NF+N N+LG+GGFG VYKGML  G+E+AVKRLSK S QG +EF 
Sbjct  513   FELPLIELEAVVKATENFSNCNELGRGGFGIVYKGML-DGQEVAVKRLSKTSLQGIDEFM  571

Query  2355  NELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNI  2534
             NE+RLIARLQH NLV++LGCC++  EK+LIYEY+EN SLD  LF KKRSS L+WK R+ I
Sbjct  572   NEVRLIARLQHINLVRILGCCIEAGEKILIYEYLENSSLDYFLFGKKRSSNLNWKDRFAI  631

Query  2535  ICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKR  2714
               GVARGLLYLHQDSRFRIIHRDLK  N+LLDK M PKISDFGMAR+F  DET+   T  
Sbjct  632   TNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKISDFGMARIFARDETQV-RTDN  690

Query  2715  IVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLW  2894
              VGTYGYMSPEYAM G+ S K+D FSFGV+VLE+V G++N+GFY  + E NL   AW  W
Sbjct  691   AVGTYGYMSPEYAMYGVISEKTDVFSFGVIVLEIVIGKRNRGFYQVNPENNLPSYAWTHW  750

Query  2895  GEGRGSELLDSVI---ASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK  3062
              EGR  E++D VI    S   S F   +V++CIQ+GLLC+QE+AE RP M++V+ ML  +
Sbjct  751   AEGRALEIVDPVILDSLSSLPSTFKPKEVLKCIQIGLLCIQERAEHRPTMSSVVWMLGSE  810

Query  3063  GTSLPQPKQPGFCL-ASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              T +PQPK P +CL AS      SSS  ++D    ++N+ T +++DAR
Sbjct  811   ATEIPQPKPPVYCLIASYYANNPSSSRQFDDDESWTVNKYTCSVIDAR  858


 Score = 54.3 bits (129),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QH NLVR+LGCCIE GEK+LI       SLD F+F   + + LNW
Sbjct  581  QHINLVRILGCCIEAGEKILIYEYLENSSLDYFLFGKKRSSNLNW  625



>ref|XP_009617832.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana tomentosiformis]
Length=827

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/822 (49%), Positives = 545/822 (66%), Gaps = 35/822 (4%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             +T+VS+ E F++GFFSP   S   YVGIWYK+I   T VWVANR  P+ N +G LK+ + 
Sbjct  37    ETIVSSDETFEMGFFSPLDTSANRYVGIWYKKISLITPVWVANRVAPVTNKSGVLKVIQS  96

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             G + LV+ T  ++WS   TN+ +   N VAQLLD+GNFVVR  +D NPEN+LWQSFDYPT
Sbjct  97    GLVVLVNDTNATVWS---TNSSTTVQNPVAQLLDTGNFVVRDADDPNPENFLWQSFDYPT  153

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DTL+  MKLG D  TG  RY++SWRS  DP+ G+ T+  D  G P+  +R    +IYR+G
Sbjct  154   DTLIASMKLGKDLVTGFERYLTSWRSNDDPAPGEYTYHCDPTGYPQDLMRKGPNVIYRAG  213

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ +SG P M    + +F  +    E+YY +E+ NK++ + L++       R  WI 
Sbjct  214   PWNGLRWSGAPNMVNNSITSFGLIMNSKEIYYKYELVNKSVINTLVIKPNGNTMRMIWIE  273

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
             + + W  + +   D CD Y+ CG++G C+    PVC C   F+P++   W+  D S GC 
Sbjct  274   KTQGWVNYHSTDADDCDAYKLCGAYGTCNVLSDPVCQCLDKFEPKHPYDWNRADWSSGCV  333

Query  1641  RYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGS  1820
             R   ++C  DGFL  +  KLP++  S+   TM+LDEC+E+C+RNCSC  Y+N +I NGGS
Sbjct  334   RKRSINCTGDGFLMYSGIKLPDTRNSWFSETMALDECREVCLRNCSCMGYTNLDIRNGGS  393

Query  1821  GCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlg  2000
             GC++W  EL DIRQ  ++ GQ +Y+R++ASD         G  G    K VILA  + L 
Sbjct  394   GCLLWIDELVDIRQL-SQSGQDIYIRMSASDI--------GSAGSKGKKAVILAVALPLL  444

Query  2001  igmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNAT----AISSKREHSGETMIT  2168
             + ++L GL +                   R+R  DP++         S+K + S +    
Sbjct  445   VALILLGLGVGLILYK-------------RKRREDPVLTTKRRLGGHSNKNDDSNQNHHE  491

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             D +ELP+FD   +  AT+NF+  NK+G+GGFG V+KG+L GG+E+AVKRLS+ S+QG  E
Sbjct  492   D-FELPLFDLFTLTKATNNFSFENKIGEGGFGQVHKGVLEGGQEVAVKRLSETSKQGLHE  550

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             FKNE+  IA+LQHRNLVKLLGCC+  +EKML+YEY+ NKSLD  +FD++RS+LLDW +R+
Sbjct  551   FKNEVNCIAKLQHRNLVKLLGCCIQAEEKMLVYEYLPNKSLDLYIFDEERSALLDWPKRF  610

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             NII G+ARGL+YLHQDSR RIIHRDLKASNVLLD EM PKISDFGMAR FGGDET A  T
Sbjct  611   NIINGIARGLMYLHQDSRLRIIHRDLKASNVLLDIEMIPKISDFGMARSFGGDETGA-NT  669

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             +R+VGTYGYMSPEYA+DG+FSVKSD FSFGVLVLE+VSG+KN+ F  P +  NLLG  W 
Sbjct  670   RRVVGTYGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSGKKNRRFVHPDHHLNLLGHTWM  729

Query  2889  LWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGT  3068
             L  EGR  EL+D  +     S +V +V+R I VGLLCVQ+  EDRPNM+ V++ML  +G 
Sbjct  730   LHKEGRQLELVDPNLVD---SCYVSEVLRSIHVGLLCVQQNPEDRPNMSTVIMMLSNEGI  786

Query  3069  SLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
              LP PK PGF         + S ++    S+N++T+T+L+AR
Sbjct  787   -LPPPKHPGFFTERNVKDAEFSWSTQTPSSINEVTITLLNAR  827


 Score = 57.4 bits (137),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCCI+  EKML+      KSLD ++FD  + A L+W K
Sbjct  562  QHRNLVKLLGCCIQAEEKMLVYEYLPNKSLDLYIFDEERSALLDWPK  608



>ref|XP_009611412.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana tomentosiformis]
Length=828

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/822 (49%), Positives = 546/822 (66%), Gaps = 33/822 (4%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             +T+VS+G  F+LGFFSPG  S   YVGIWYK+    T VWVANR  P+ N +G LK+ + 
Sbjct  36    ETIVSSGGSFELGFFSPGETSTNRYVGIWYKKPSVITPVWVANRVAPVTNKSGVLKVIQL  95

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             G + LV+ T  ++WS   TN+ +   N VAQLLD+GNFVVR  +D NPEN+LWQSFDYP+
Sbjct  96    GVVVLVNDTNATVWS---TNSSTTVQNPVAQLLDTGNFVVRDADDPNPENFLWQSFDYPS  152

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             +TLL GMKLG D  TG  RY+SSWRS  DP+ GD T+  D  G P+  +R    + +R+G
Sbjct  153   NTLLAGMKLGTDLVTGLERYLSSWRSNDDPAPGDYTYHCDPTGYPQNLMRKGPNVTFRAG  212

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ +SG P M    +I+F  +    E+YY++E+ NK++ S L++       R  WI 
Sbjct  213   PWNGLRWSGAPNMVNNSIISFGLIMNSREIYYNYELVNKSVISTLVIKPFGKTMRIIWIE  272

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
             + + W  + +A  D CD Y+ CG +  C+    P C C   F+P++   W   D S GC 
Sbjct  273   KTQSWVNYHSADADDCDTYKLCGVYSTCNILSDPFCQCLDKFEPKHPDDWIRSDWSSGCV  332

Query  1641  RYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGS  1820
             R   L+C  D FL  +  KLP++  S+ + TM+LDEC+ +C+RNCSCT Y+N +I NGGS
Sbjct  333   RKHPLNCTGDRFLKYSGVKLPDTRFSWFNKTMTLDECRAVCLRNCSCTGYTNLDIRNGGS  392

Query  1821  GCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlg  2000
             GC++W  EL DIRQ  ++ GQ +Y+R++A D +  G     G      K VILA  + L 
Sbjct  393   GCLLWIGELVDIRQL-SQSGQDIYIRMSALDIDVAGSAGSKGK-----KAVILAVALPLL  446

Query  2001  igmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAI----SSKREHSGETMIT  2168
             + ++L                  + +   + R  DP++         S+K ++S ++  +
Sbjct  447   VALILL--------------GLGVGLILYKRRREDPVITTKGTLSGHSNKNDNSNQSH-S  491

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             +++ELP+FD   +  ATDNF+  NK+G+GGFG VYKG+L  G+E+AVKRLS+ S QG  E
Sbjct  492   EDFELPLFDLFTLTKATDNFSFVNKIGEGGFGQVYKGVLEDGQEVAVKRLSETSEQGLHE  551

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             FKNE+  IA+LQHRNLVKLLGCC+   EKML+YEY+ NKSLD  LF ++RS++LDW +R+
Sbjct  552   FKNEVNCIAKLQHRNLVKLLGCCIQGVEKMLVYEYLPNKSLDLFLFGEERSAILDWPKRF  611

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             NII G+ARGL+YLHQDSR RIIHRDLKASNVLLD EMNPKISDFGMAR FGGDET A  T
Sbjct  612   NIIKGIARGLMYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGMARSFGGDETGA-NT  670

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             +R+VGTYGYMSPEYA+DG+FSVKSD FSFGVLVLE+VSG+KN+ F  P +  NLLG AW 
Sbjct  671   RRVVGTYGYMSPEYAIDGIFSVKSDVFSFGVLVLEIVSGKKNRRFVHPDHHLNLLGHAWL  730

Query  2889  LWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGT  3068
             L  EGR  EL+DS +     S +V +V+R I VGLLCVQ+  EDRP+M+ V++ML  +G 
Sbjct  731   LHEEGRQLELVDSNLVD---SCYVSEVLRSIHVGLLCVQQNPEDRPSMSTVIMMLSNEGI  787

Query  3069  SLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
              LP PK PGF        ++ S ++    S+N++T+T+L+AR
Sbjct  788   -LPPPKHPGFFTERNVKDVEFSWSTQTPSSINEITITLLNAR  828


 Score = 57.4 bits (137),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCCI+G EKML+      KSLD F+F   + A L+W K
Sbjct  563  QHRNLVKLLGCCIQGVEKMLVYEYLPNKSLDLFLFGEERSAILDWPK  609



>dbj|BAF57002.1| S receptor kinase [Brassica napus]
 emb|CDY36217.1| BnaC06g27610D [Brassica napus]
Length=856

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/829 (49%), Positives = 572/829 (69%), Gaps = 30/829 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G VF+LGFF P G S   Y+GIWYK++  +T  WVANRD PL NS G LKI  
Sbjct  48    NRTLVSHGGVFELGFFKPLGRSR-WYLGIWYKKVSQKTYAWVANRDSPLSNSIGTLKISG  106

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             + N+ L+  + N++WS+ N   ++V    +A+LL +GNFV+R  ++++   +LWQSFD+P
Sbjct  107   N-NLVLLGQSNNTVWST-NLTRENVRSPVIAELLPNGNFVMRYSSNKDSSGFLWQSFDFP  164

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFLRNK----DI  1262
             TDTLLP MKLG+D KTGRNR+++SWRS  DPS G  T++LDI  GLPE  L N+     +
Sbjct  165   TDTLLPEMKLGYDFKTGRNRFLTSWRSYDDPSSGKFTYELDIQRGLPEFILINRFLNQRV  224

Query  1263  IIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLE  1442
             ++ RSG WNG+ F+G+PE++    + +++     E+ Y+F + N++++SRL V     L 
Sbjct  225   VMQRSGPWNGIEFNGIPEVQGLNYMVYNYTENSEEIAYTFHMTNQSIYSRLTVT-DYALN  283

Query  1443  RYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRD  1622
             RYT IP +  W+ FW+ P D CD+   CGS+  CD + SP C C  GF P+N+Q W LRD
Sbjct  284   RYTRIPPSWGWSMFWSLPTDVCDSLYFCGSYSYCDLNTSPYCNCIRGFVPKNRQRWDLRD  343

Query  1623  GSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             GS GC R  ++ C  DGFL +N  KLP++ T+ VD T  + +C+E C+ +C+CT+++  +
Sbjct  344   GSHGCVRRTQMSCSGDGFLRLNNMKLPDTKTATVDRTTDVKKCEEKCLSDCNCTSFATAD  403

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             + NGG GCV WT +L +IR+  A  GQ LYVR+ A+D          G    +TKK+I  
Sbjct  404   VRNGGLGCVFWTGDLVEIRK-QAVVGQDLYVRLNAADLA-------SGEKRDRTKKIIGW  455

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKR-EHSGET  2159
                V  + ++   +    RR+ ++   +   + G +      LMN   +  K+   SGE 
Sbjct  456   SIGVTVMLILSVIVFCFWRRRQKQAKADATPIVGNQ-----VLMNEVVLPRKKINFSGED  510

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
              + +  EL + +F A+  AT++F++ NK+G+GGFG VYKG LV G+EIAVKRLS+ S QG
Sbjct  511   EV-ENLELSL-EFEAVVTATEHFSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQG  568

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EF NE+RLIA+LQH NLV+LLGCCV   EK+LIYEY+EN SLDS LFD+ RS +L+W+
Sbjct  569   TDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQ  628

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
              R++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETEA
Sbjct  629   MRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA  688

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               T+++VGTYGYMSPEYAM+G FS+KSD FSFGVL+LE++SG++N+GF    +  NLLG 
Sbjct  689   D-TRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSNLNLLGC  747

Query  2880  AWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              WR W EG+G E++D VI   S   F   +++RC+Q+GLLCVQE+ EDRP M++V+LML 
Sbjct  748   VWRNWKEGQGLEIVDRVIIDSSSPTFRPREILRCLQIGLLCVQERVEDRPMMSSVVLMLG  807

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              +   +PQPKQPG+C++   ++  SS +   D    ++NQ+T++++DAR
Sbjct  808   SETALIPQPKQPGYCVSQSSLETYSSWSKLRDDENWTVNQITMSIIDAR  856



>emb|CAB41879.1| SRK15 protein [Brassica oleracea var. viridis]
Length=849

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/829 (49%), Positives = 572/829 (69%), Gaps = 30/829 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G VF+LGFF P G S   Y+GIWYK++  +T  WVANRD PL NS G LKI  
Sbjct  41    NRTLVSHGGVFELGFFKPLGRSR-WYLGIWYKKVSQKTYAWVANRDSPLSNSIGTLKISG  99

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             + N+ L+  + N++WS+ N   ++V    +A+LL +GNFV+R  ++++   +LWQSFD+P
Sbjct  100   N-NLVLLGQSNNTVWST-NLTRENVRSPVIAELLPNGNFVMRYSSNKDSSGFLWQSFDFP  157

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFLRNK----DI  1262
             TDTLLP MKLG+D KTGRNR+++SWRS  DPS G  T++LDI  GLPE  L N+     +
Sbjct  158   TDTLLPEMKLGYDFKTGRNRFLTSWRSYDDPSSGKFTYELDIQRGLPEFILINRFLNQRV  217

Query  1263  IIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLE  1442
             ++ RSG WNG+ F+G+PE++    + +++     E+ Y+F + N++++SRL V     L 
Sbjct  218   VMQRSGPWNGIEFNGIPEVQGLNYMVYNYTENSEEIAYTFHMTNQSIYSRLTVT-DYALN  276

Query  1443  RYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRD  1622
             RYT IP +  W+ FW+ P D CD+   CGS+  CD + SP C C  GF P+N+Q W LRD
Sbjct  277   RYTRIPPSWGWSMFWSLPTDVCDSLYFCGSYSYCDLNTSPYCNCIRGFVPKNRQRWDLRD  336

Query  1623  GSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             GS GC R  ++ C  DGFL +N  KLP++ T+ VD T  + +C+E C+ +C+CT+++  +
Sbjct  337   GSHGCVRRTQMSCSGDGFLRLNNMKLPDTKTATVDRTTDVKKCEEKCLSDCNCTSFATAD  396

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             + NGG GCV WT +L +IR+  A  GQ LYVR+ A+D          G    +TKK+I  
Sbjct  397   VRNGGLGCVFWTGDLVEIRK-QAVVGQDLYVRLNAADLA-------SGEKRDRTKKIIGW  448

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKR-EHSGET  2159
                V  + ++   +    RR+ ++   +   + G +      LMN   +  K+   SGE 
Sbjct  449   SIGVTVMLILSVIVFCFWRRRQKQAKADATPIVGNQ-----VLMNEVVLPRKKINFSGED  503

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
              + +  EL + +F A+  AT++F++ NK+G+GGFG VYKG LV G+EIAVKRLS+ S QG
Sbjct  504   EV-ENLELSL-EFEAVVTATEHFSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQG  561

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EF NE+RLIA+LQH NLV+LLGCCV   EK+LIYEY+EN SLDS LFD+ RS +L+W+
Sbjct  562   TDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQ  621

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
              R++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETEA
Sbjct  622   MRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA  681

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               T+++VGTYGYMSPEYAM+G FS+KSD FSFGVL+LE++SG++N+GF    +  NLLG 
Sbjct  682   D-TRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSNLNLLGC  740

Query  2880  AWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              WR W EG+G E++D VI   S   F   +++RC+Q+GLLCVQE+ EDRP M++V+LML 
Sbjct  741   VWRNWKEGQGLEIVDRVIIDSSSPTFRPREILRCLQIGLLCVQERVEDRPMMSSVVLMLG  800

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              +   +PQPKQPG+C++   ++  SS +   D    ++NQ+T++++DAR
Sbjct  801   SETALIPQPKQPGYCVSQSSLETYSSWSKLRDDENWTVNQITMSIIDAR  849



>dbj|BAA07576.1| receptor protein kinase SRK8 [Brassica rapa subsp. oleifera]
 prf||2106157A S-receptor kinase
Length=858

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/828 (51%), Positives = 563/828 (68%), Gaps = 24/828 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G+VF+LGFF+PG +S   Y+GIWYK++   T VWVANRD PL NSTG LKI  
Sbjct  46    NRTLVSPGDVFELGFFTPGSSSR-WYLGIWYKKLPYITYVWVANRDNPLSNSTGTLKISG  104

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ L+  +  SIWS++ T  N+  P   VA+LL +GNFV+R  N+ +   +LWQSFDY
Sbjct  105   N-NLFLLGDSNKSIWSTNLTRGNERSP--VVAELLANGNFVMRDSNNNDASGFLWQSFDY  161

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PTDTLLP MKLG+D KTG NR+++S R+  DPS GD ++KL+   LPE +L   D+  +R
Sbjct  162   PTDTLLPEMKLGYDLKTGLNRFLTSSRNFDDPSSGDYSYKLEPRRLPEFYLLLGDVREHR  221

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             SG WNG+ FSG+PE +    + ++F +   EV Y+F + N + +SRL +N    LER TW
Sbjct  222   SGPWNGIQFSGIPEDQKLSYMVYNFTKNSEEVAYTFRMTNNSFYSRLTINSEGYLERLTW  281

Query  1455  IPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGG  1634
              P + +WN FW++P  QCD YR CG +  CD + SP C C  GF P N Q W+LR+   G
Sbjct  282   APSSVVWNVFWSSPNHQCDMYRMCGPYSYCDVNTSPSCNCIQGFNPGNVQQWALRNQISG  341

Query  1635  CFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNG  1814
             C R   L C  DGF  M   KLP++  + VD ++ L EC++ C+ +C+CTA++N +I N 
Sbjct  342   CKRRTRLSCNGDGFTRMKNIKLPDTRMAIVDRSIGLKECEKRCLSDCNCTAFANADIRNR  401

Query  1815  GSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgiv  1994
              +GCVIWT EL D+R Y AEGGQ LYVR+AA+D      + +  NG  K   +I+   +V
Sbjct  402   VTGCVIWTGELEDMRNY-AEGGQDLYVRLAAAD------LVKKRNGNWKIISLIVGVSVV  454

Query  1995  lgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDE  2174
             L + ++L  +  L +RK  R       +   ++R+++ LMN    S+KR+ S E    DE
Sbjct  455   LLLLLLLLIMFCLWKRKQNRAKAMATSIVN-QQRNQNVLMNTMTQSNKRQLSRENK-ADE  512

Query  2175  YELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFK  2354
             +ELP+ +  A+  AT+NF+N N+LG+GGFG VYKGML  G+E+AVKRLSK S QG +EF 
Sbjct  513   FELPLIELEAVVKATENFSNCNELGRGGFGIVYKGML-DGQEVAVKRLSKTSLQGIDEFM  571

Query  2355  NELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNI  2534
             NE+RLIARLQH NLV++LGCC++  EK+LIYEY+EN SLD  LF KKRSS L+WK R+ I
Sbjct  572   NEVRLIARLQHINLVRILGCCIEAGEKILIYEYLENSSLDYFLFGKKRSSNLNWKDRFAI  631

Query  2535  ICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKR  2714
               GVARGLLYLHQDSRFRIIHRDLK  N+LLDK M PKISDFGMAR+F  DET+   T  
Sbjct  632   TNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKISDFGMARIFARDETQV-RTDN  690

Query  2715  IVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLW  2894
              VGTYGYMSPEYAM G+ S K+D FSFGV+VLE+V G++N+GFY  + E NL   AW  W
Sbjct  691   AVGTYGYMSPEYAMYGVISEKTDVFSFGVIVLEIVIGKRNRGFYQVNPENNLPSYAWTHW  750

Query  2895  GEGRGSELLDSVI---ASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK  3062
              EGR  E++D VI    S   S F   +V++CIQ+GLLC+QE+AE RP M++V+ ML  +
Sbjct  751   AEGRALEIVDPVILDSLSSLPSTFKPKEVLKCIQIGLLCIQERAEHRPTMSSVVWMLGSE  810

Query  3063  GTSLPQPKQPGFCL-ASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              T +PQPK P +CL AS      SSS  ++D    ++N+ T +++DAR
Sbjct  811   ATEIPQPKPPVYCLIASYYANNPSSSRQFDDDEPWTVNKYTCSVIDAR  858


 Score = 54.3 bits (129),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QH NLVR+LGCCIE GEK+LI       SLD F+F   + + LNW
Sbjct  581  QHINLVRILGCCIEAGEKILIYEYLENSSLDYFLFGKKRSSNLNW  625



>dbj|BAE95187.1| S-locus receptor kinase [Brassica oleracea]
Length=856

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/829 (49%), Positives = 572/829 (69%), Gaps = 30/829 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G VF+LGFF P G S   Y+GIWYK++  +T  WVANRD PL NS G LKI  
Sbjct  48    NRTLVSHGGVFELGFFKPLGRSR-WYLGIWYKKVSQKTYAWVANRDSPLSNSIGTLKISG  106

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             + N+ L+  + N++WS+ N   ++V    +A+LL +GNFV+R  ++++   +LWQSFD+P
Sbjct  107   N-NLVLLGQSNNTVWST-NLTRENVRSPVIAELLPNGNFVMRYSSNKDSSGFLWQSFDFP  164

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFLRNK----DI  1262
             TDTLLP MKLG+D KTGRNR+++SWRS  DPS G  T++LDI  GLPE  L N+     +
Sbjct  165   TDTLLPEMKLGYDFKTGRNRFLTSWRSYDDPSSGKFTYELDIQRGLPEFILINRFLNQRV  224

Query  1263  IIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLE  1442
             ++ RSG WNG+ F+G+PE++    + +++     E+ Y+F + N++++SRL V     L 
Sbjct  225   VMQRSGPWNGIEFNGIPEVQGLNYMVYNYTENSEEIAYTFHMTNQSIYSRLTVT-DYALN  283

Query  1443  RYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRD  1622
             RYT IP +  W+ FW+ P D CD+   CGS+  CD + SP C C  GF P+N+Q W LRD
Sbjct  284   RYTRIPPSWGWSMFWSLPTDVCDSLYFCGSYSYCDLNTSPYCNCIRGFVPKNRQRWDLRD  343

Query  1623  GSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             GS GC R  ++ C  DGFL +N  KLP++ T+ VD T  + +C+E C+ +C+CT+++  +
Sbjct  344   GSHGCVRRTQMSCSGDGFLRLNNMKLPDTKTATVDRTTDVKKCEEKCLSDCNCTSFATAD  403

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             + NGG GCV WT +L +IR+  A  GQ LYVR+ A+D          G    +TKK+I  
Sbjct  404   VRNGGLGCVFWTGDLVEIRK-QAVVGQDLYVRLNAADLA-------SGEKRDRTKKIIGW  455

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKR-EHSGET  2159
                V  + ++   +    RR+ ++   +   + G +      LMN   +  K+   SGE 
Sbjct  456   SIGVTVMLILSVIVFCFWRRRQKQAKADATPIVGNQ-----VLMNEVVLPRKKINFSGED  510

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
              + +  EL + +F A+  AT++F++ NK+G+GGFG VYKG LV G+EIAVKRLS+ S QG
Sbjct  511   EV-ENLELSL-EFEAVVTATEHFSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQG  568

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EF NE+RLIA+LQH NLV+LLGCCV   EK+LIYEY+EN SLDS LFD+ RS +L+W+
Sbjct  569   TDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQ  628

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
              R++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETEA
Sbjct  629   MRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA  688

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               T+++VGTYGYMSPEYAM+G FS+KSD FSFGVL+LE++SG++N+GF    +  NLLG 
Sbjct  689   D-TRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSNLNLLGC  747

Query  2880  AWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              WR W EG+G E++D VI   S   F   +++RC+Q+GLLCVQE+ EDRP M++V+LML 
Sbjct  748   VWRNWKEGQGLEIVDRVIIDSSSPTFRPREILRCLQIGLLCVQERVEDRPMMSSVVLMLG  807

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              +   +PQPKQPG+C++   ++  SS +   D    ++NQ+T++++DAR
Sbjct  808   SETALIPQPKQPGYCVSQSSLETYSSWSKLRDDENWTVNQITMSIIDAR  856



>dbj|BAF91395.1| S-locus receptor kinase [Brassica rapa]
Length=846

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/830 (50%), Positives = 558/830 (67%), Gaps = 30/830 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G+VF+LGFF+   +S   Y+GIWYK++  +T VWVANRD PL N+TG LKI  
Sbjct  36    NRTLVSPGDVFELGFFTTTSSSR-WYLGIWYKKVYFKTYVWVANRDSPLSNATGTLKITG  94

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ L+D +  S+WS++ T  N+  P   VA+LL +GNFV+R  N+ +   +LWQSFD+
Sbjct  95    N-NLVLLDFSNKSVWSTNLTRGNERSP--VVAELLANGNFVMRDSNNNDASEFLWQSFDF  151

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFLRNKDIIIY  1271
             PTDTLLP MKLG+D KTG  R+++SWR+  DPS G+I++ LD   G+PE FL     II+
Sbjct  152   PTDTLLPEMKLGYDLKTGHKRFLTSWRNSDDPSSGEISYILDTQRGMPEFFLLENGFIIH  211

Query  1272  RSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYT  1451
             RSG WNGV FSG+P+ +    + ++F+    EV Y+F + N +++SRL ++    LER T
Sbjct  212   RSGPWNGVQFSGIPDDQKLSYMVYNFIENSEEVAYTFRVTNNSIYSRLKISSEGFLERLT  271

Query  1452  WIPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
               P +  WN  W++P D +CD Y  CG +  CD + SP+C C  GF P   Q W + DG+
Sbjct  272   LTPMSSAWNLLWSSPVDIRCDVYIVCGPYSYCDGNTSPLCNCIQGFMPFIVQRWDMGDGA  331

Query  1629  GGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
             GGC R   L C  DGF  M   KLP+++ + VD  + + ECK+ C+ NC+CTA++N +I 
Sbjct  332   GGCIRRTPLSCSGDGFTRMKNMKLPDTTMAIVDRRIGVKECKKRCLSNCNCTAFANADIR  391

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             NGG+GCVIWT  L DIR Y  + GQ LYVR+AA+D  Q        N  GK   +I+   
Sbjct  392   NGGTGCVIWTGALQDIRTY-YDDGQDLYVRLAAADLVQKR------NAKGKIITLIVGVS  444

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
             ++L I M        KR K       N       +R+++ +MN    SSK + S     T
Sbjct  445   VLLLIIMFCLWKRKQKRVKAMSASIVN------GQRNQNVIMNGMTQSSKTQLSIRENKT  498

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             +E+ELP+ +  A+  AT+NF+N N+LGQGGFG VYKGML  G+E+A+KRLSK S QG +E
Sbjct  499   EEFELPLIELEAVVKATENFSNFNELGQGGFGIVYKGML-DGQEVAIKRLSKTSLQGIDE  557

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             F NE+RLIARLQH NLV++LGCC++ DEK+LIYEY+EN SLD  LF KKRSS L+WK R+
Sbjct  558   FMNEVRLIARLQHINLVRILGCCIEADEKILIYEYLENSSLDYFLFGKKRSSHLNWKDRF  617

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
              I  GVARGLLYLHQDSRFRIIHRD+K  N+LLDK M PKISDFGMAR+F  DET+A  T
Sbjct  618   AITNGVARGLLYLHQDSRFRIIHRDMKPGNILLDKYMIPKISDFGMARIFARDETQA-RT  676

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
                VGTYGYMSPEYAMDG+ S K+D FSFGV+VLE+VSG++N+GFY  + E NL   AW 
Sbjct  677   DNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRNRGFYQVNPENNLPSYAWT  736

Query  2889  LWGEGRGSELLDSVIA---SESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              W EGR  E++D VI    S   S F   +V++CIQ+GLLC+QE+AE RP M++V+ ML 
Sbjct  737   HWAEGRALEIVDPVIVDSLSSLPSTFKPKEVLKCIQIGLLCIQERAEHRPTMSSVVWMLG  796

Query  3057  GKGTSLPQPKQPGFCL-ASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              + T +PQPK P +CL AS      SSS  ++D    ++N+ T +++DAR
Sbjct  797   SEATEIPQPKPPVYCLIASYYANNPSSSRQFDDDESWTVNKYTCSVIDAR  846



>emb|CAA82930.1| srk29 [Brassica oleracea var. alboglabra]
Length=857

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/834 (51%), Positives = 559/834 (67%), Gaps = 32/834 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+TLVS G +F+LGFF    +S   Y+G+WYK++ DRT VWVANRD PL NS G LK
Sbjct  44    ISSNRTLVSPGNIFELGFFRTTSSSR-WYLGMWYKKLSDRTYVWVANRDNPLSNSIGTLK  102

Query  909   IGEDGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
             I  + N+ ++  +  S+WS++ T  N+  P   VA+LL +GNFV+R  N+ +   +LWQS
Sbjct  103   ISGN-NLVILGDSNKSVWSTNITRGNERSP--VVAELLANGNFVMRDSNNNDGSGFLWQS  159

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFL-RNKDI  1262
             FDYPTDTLLP MKLG+D  TG NR+++S RS  DPS GD ++K +   LPE +L +    
Sbjct  160   FDYPTDTLLPEMKLGYDLITGLNRFLTSSRSLDDPSSGDYSYKFESRRLPEFYLLKGSGF  219

Query  1263  IIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLE  1442
              ++RSG WNGV FSG+PE +    + ++F +   EV Y+F + N +++SRL ++    LE
Sbjct  220   RVHRSGPWNGVQFSGMPEDQKLSYMVYNFTQNSEEVVYTFRMTNNSIYSRLTISSEGYLE  279

Query  1443  RYTWIPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             R TW P + +WN FW++P D QCD Y+ CG +  CD + SPVC C  GF P N   W LR
Sbjct  280   RLTWTPSSGMWNVFWSSPVDLQCDVYKICGPYSYCDVNTSPVCNCIQGFNPLNVHQWDLR  339

Query  1620  DGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
             DG+ GC R   L C  DGF  M   KLPE++ + VD ++ L ECK+ C+ +C+CTA++N 
Sbjct  340   DGTSGCIRRTRLSCSGDGFTRMKNKKLPETTMAIVDHSIGLKECKKWCLSDCNCTAFANT  399

Query  1800  NISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVIL  1979
             +I NGG+GCVIWT  L DIR Y  + GQ LYVR+AA+D      + +  N  GK   +I+
Sbjct  400   DIRNGGTGCVIWTERLEDIRTYFTD-GQDLYVRLAAAD------LVKKRNANGKIASLIV  452

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKRE-HSGE  2156
                ++L + M         R K       N      R+R+++  MN   +SSK++   G 
Sbjct  453   GASVLLLLIMFCLWKRKQNRVKASAISIAN------RQRNKNLPMNGMVLSSKKQLRRGN  506

Query  2157  TMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQ  2336
                T+E ELP+ +  A+  AT+NF+N NKLG+GGFG VYKG L+ G+EIAVKRLSK S Q
Sbjct  507   K--TEELELPLIELEAVVKATENFSNCNKLGEGGFGIVYKGRLLDGQEIAVKRLSKTSVQ  564

Query  2337  GAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
             G +EF NE+ LIARLQH NLV++ GCC+  DEKMLIYEY+EN SLDS LF K RSS L+W
Sbjct  565   GTDEFMNEVTLIARLQHINLVQIFGCCIQADEKMLIYEYLENSSLDSYLFGKTRSSKLNW  624

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
             K R+ I  GVARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  +ETE
Sbjct  625   KERFEITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFAREETE  684

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             A T K +VGTYGYMSPEYAM G+FS KSD FSFGV+VLE+V+G++N+ FY  + E+NLL 
Sbjct  685   ANTMK-VVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVTGKRNRVFYNLNYEDNLLN  743

Query  2877  LAWRLWGEGRGSELLDSVI---ASESHSEFVDQ-VMRCIQVGLLCVQEKAEDRPNMAAVM  3044
              AW  W EGR  E++D  I    S   S F  Q V++CIQ+GLLCVQ+ AE+RP M++V+
Sbjct  744   YAWNNWKEGRALEIVDPAILDSLSSLPSTFQPQDVLKCIQIGLLCVQDLAENRPTMSSVV  803

Query  3045  LMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ----SLNQLTVTMLDAR  3194
              ML  + T +PQPK PG+CL   P + D SS    +     ++NQ T +++DAR
Sbjct  804   WMLGSEATEIPQPKPPGYCLVRSPYEPDPSSNRQREDDESWTVNQYTCSVIDAR  857



>ref|XP_009402882.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=830

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/847 (48%), Positives = 552/847 (65%), Gaps = 48/847 (6%)
 Frame = +3

Query  681   GTADDIL**GPPWNPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVW  860
              T  D+L    P  P L    TL+SAG  F+LGFFSP G S   YVGIW+ ++  +T++W
Sbjct  20    ATGGDVL---TPHRPILDDGTTLISAGGAFELGFFSPVG-SDNRYVGIWFHKVSLQTVIW  75

Query  861   VANRDKPLRNSTGFLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVV  1040
             VANR +P+   TG L +  +G + + D +   +WSS +        N VAQLLD GN VV
Sbjct  76    VANRQRPVAGRTGSLSLAANGTLFVTDNS-TVVWSSGS----PALANPVAQLLDDGNLVV  130

Query  1041  RREND--ENPENYLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFK  1214
                    ++P ++ WQ FD+PTDTLLP MKLGW+  +G NR ++SW S +DP+ G+ T  
Sbjct  131   MESGSSGKDPNSFAWQGFDFPTDTLLPNMKLGWNLTSGLNRNLTSWASLSDPAIGNYTMG  190

Query  1215  LDINGLPEAFLRNKDIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHN  1394
             +D++G P+ FL ++D   +R+G WNG+ FSG+P+M+     +F F+   +EV+YSF +H+
Sbjct  191   VDVDGDPQGFLWSRDSKQWRAGSWNGIQFSGIPDMKTYSQFSFEFIIRPDEVFYSFFVHD  250

Query  1395  KNLFSRLIVNYTQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGC  1574
              ++ SRL V  + +L+R  WI  +++W+ FW AP+DQCD    CG  G+CD++ SP+C C
Sbjct  251   DSIISRLTVLPSGILQRLVWIEHSKLWSVFWFAPRDQCDYVSPCGPNGVCDSNNSPICEC  310

Query  1575  PVGFKPRNQQAWSLRDGSGGCFRYDELDCP--TDGFLSMNYTKLPESSTSFVDATMSLDE  1748
               GF+P+N   W LRDGS GC R   LDC   TDGF  ++  KLP++S + V+ +++L +
Sbjct  311   LHGFRPKNPTNWDLRDGSDGCVRETALDCRNGTDGFNQLSNAKLPDTSRAVVNRSLNLQQ  370

Query  1749  CKEMCVRNCSCTAYS--NYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQ  1922
             C++ C RNCSCT Y+  ++N S   +GC++WT  L D+R Y + GGQ LYVRVAA+D +Q
Sbjct  371   CRDACSRNCSCTGYAAASFNSSGIWNGCIMWTTHLTDLRVYVS-GGQDLYVRVAAADLDQ  429

Query  1923  TGEVARGGNGFGKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSR  2102
             +    +  +   +T+  ++   ++    +                +   +     R++  
Sbjct  430   SDSETKHSH---RTRVFVIVVAVLAPAIL----------------LAACVACCVGRKKM-  469

Query  2103  DPLMNATAISSKREHSGETMITD-----EYELPIFDFNAIAMATDNFANANKLGQGGFGS  2267
               +M   A S  +  SG   I D     + +LP+FD   IA ATDNF+  NKLG+GG+G 
Sbjct  470   --IMTRRATSGTKSLSGH-HIDDGAEGKDLDLPLFDLGTIADATDNFSIHNKLGEGGYGP  526

Query  2268  VYKGMLVGGEEIAVKRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIY  2447
             VYKG L   +E+A+KRLSK S QG +EFKNE+ +IA+LQHRNLV+LLGCC+   E++LIY
Sbjct  527   VYKGKLEEEQEVAIKRLSKTSMQGLDEFKNEVTVIAKLQHRNLVRLLGCCIQAGERVLIY  586

Query  2448  EYMENKSLDSILFDKKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLL  2627
             EYM N SLD+ LFDK +  LL+W+ RY II G+ARGLLYLH+DSR RIIHRDLKASN+LL
Sbjct  587   EYMPNGSLDAFLFDKVKGELLNWRSRYTIIVGIARGLLYLHEDSRLRIIHRDLKASNILL  646

Query  2628  DKEMNPKISDFGMARLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLV  2807
             DK+MNPKISDFGMAR+FGGDETE   T R+VGTYGYMSPEYAMDG+FSVKSD FSFGVLV
Sbjct  647   DKDMNPKISDFGMARIFGGDETEV-NTMRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLV  705

Query  2808  LEVVSGRKNQGFYTPSNEENLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQV  2987
             LE+VSG+KN+G Y      NLL   W LW E R  E++D  I     S   D+V+RCI+V
Sbjct  706   LEIVSGKKNRGVYYSGRHLNLLAYTWSLWKEDRVLEMVDESIG---ESFPTDEVLRCIKV  762

Query  2988  GLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQ  3167
             GLLCVQE  EDRP M++V LML      LPQP  PGF  A  P++MDSS +     S+N 
Sbjct  763   GLLCVQEMPEDRPTMSSVALMLGSDSALLPQPAHPGFVSARCPIEMDSSISKQESMSINN  822

Query  3168  LTVTMLD  3188
             ++VTM +
Sbjct  823   VSVTMFE  829


 Score = 58.9 bits (141),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRLLGCCI+ GE++LI       SLD F+FD  K   LNW
Sbjct  565  QHRNLVRLLGCCIQAGERVLIYEYMPNGSLDAFLFDKVKGELLNW  609



>gb|KCW76536.1| hypothetical protein EUGRSUZ_D00923 [Eucalyptus grandis]
Length=701

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/675 (57%), Positives = 491/675 (73%), Gaps = 12/675 (2%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNS-T  896
             N  +  +QTL SA +VFQLGFF+P  ++   YVGIWYK I DRT VWVANRD P+ NS T
Sbjct  33    NESIASDQTLASANDVFQLGFFTP--DNANYYVGIWYKNIPDRTYVWVANRDGPVANSST  90

Query  897   GFLKIGEDGN--IHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPEN  1070
                KIG+ GN  + L     N +WSS+ T   S P N VAQLLD+GN VVR   DE+  +
Sbjct  91    VVFKIGDKGNNVVILDQANKNILWSSNQTRANSSPVNPVAQLLDNGNLVVREAGDESSSD  150

Query  1071  YLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLR  1250
             YLWQSFD+PTDTLLP MKLGWD   G +R+++SW++P DPS GD +FK+D +G PE FL 
Sbjct  151   YLWQSFDFPTDTLLPEMKLGWDLTQGLDRFLNSWKTPQDPSSGDFSFKIDYHGYPEVFLW  210

Query  1251  NKDIIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYT  1430
             +K   +YRSG WNG+ FSGVPEM+    + F+F+  + +VYYSFE++  N+ SRL VN T
Sbjct  211   DKSTKLYRSGPWNGIRFSGVPEMQSSSTMDFTFVSDQQQVYYSFEVNTPNIISRLTVNST  270

Query  1431  QLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAW  1610
               L+RYTW+ +++ W+ FW APKDQCD++ ECG +G CDT+ SP+C C  GF P+N QAW
Sbjct  271   GTLQRYTWVEDSKSWSMFWEAPKDQCDHFSECGPYGFCDTNASPICNCTRGFSPKNLQAW  330

Query  1611  SLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAY  1790
             +LRDGS GC R  ELDC +DGFL +   KLPESS + VD  MSLD+C++ C +NCSCT Y
Sbjct  331   NLRDGSAGCVRRTELDCSSDGFLLLKGMKLPESSNTVVDMAMSLDDCRKGCAKNCSCTGY  390

Query  1791  SNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVA---RGGNGFGK  1961
             S+ NISNG +GCV+W  EL D+R Y    GQ  YV+++ASD    G +       NG G 
Sbjct  391   SSANISNGEAGCVMWFGELLDMRHYVG-AGQDFYVKLSASDIVAFGGLVTQNSSSNGLGT  449

Query  1962  TKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKR  2141
                V +A G  + +  +   L+  ++  L   +  N E +G RERS+D L+N   ISSKR
Sbjct  450   LAIVGIAAGGSVLLLALTAFLMWKRKTSLNPHI-RNTEPQGARERSQDFLLNEVVISSKR  508

Query  2142  EHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLS  2321
             E+S E    +E ELP+F FNAIA+AT NF++ NKLGQGGFG VY+  +  G  +AVKRLS
Sbjct  509   EYSRENK-PEELELPLFAFNAIALATKNFSDENKLGQGGFGCVYECRIEEGPVVAVKRLS  567

Query  2322  KNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRS  2501
             KNS QG EEFKNE++LIARLQHRNLV+L+GCCV++DEK+LIYEYME+KSLDS+LF K +S
Sbjct  568   KNSGQGMEEFKNEVQLIARLQHRNLVRLIGCCVEMDEKILIYEYMEHKSLDSVLFSKTKS  627

Query  2502  SLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFG  2681
             S+L+W+RR+NIICG+ARGLLYLHQDSRFRIIHRDLKASN+LLD E+NPKISDFGMAR+FG
Sbjct  628   SMLNWERRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDGELNPKISDFGMARIFG  687

Query  2682  GDETEAGTTKRIVGT  2726
              D+ EA  TKR+VGT
Sbjct  688   RDQVEA-NTKRVVGT  701


 Score = 53.9 bits (128),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRL+GCC+E  EK+LI      KSLD+ +F  TK + LNW
Sbjct  588  QHRNLVRLIGCCVEMDEKILIYEYMEHKSLDSVLFSKTKSSMLNW  632



>dbj|BAF56998.1| S receptor kinase [Brassica napus]
Length=855

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/828 (49%), Positives = 571/828 (69%), Gaps = 30/828 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G VF+LGFF P G S   Y+GIWYK++  +T  WVANRD PL NS G LKI  
Sbjct  48    NRTLVSHGGVFELGFFKPLGRSR-WYLGIWYKKVSQKTYAWVANRDSPLSNSIGTLKISG  106

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             + N+ L+  + N++WS+ N   ++V    +A+LL +GNFV+R  ++++   +LWQSFD+P
Sbjct  107   N-NLVLLGQSNNTVWST-NLTRENVRSPVIAELLPNGNFVMRYSSNKDSSGFLWQSFDFP  164

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFLRNK----DI  1262
             TDTLLP MKLG+D KTGRNR+++SWRS  DPS G  T++LDI  GLPE  L N+     +
Sbjct  165   TDTLLPEMKLGYDFKTGRNRFLTSWRSYDDPSSGKFTYELDIQRGLPEFILINRFLNQRV  224

Query  1263  IIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLE  1442
             ++ RSG WNG+ F+G+PE++    + +++     E+ Y+F + N++++SRL V     L 
Sbjct  225   VMQRSGPWNGIEFNGIPEVQGLNYMVYNYTENSEEIAYTFHMTNQSIYSRLTVT-DYALN  283

Query  1443  RYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRD  1622
             RYT IP +  W+ FW+ P D CD+   CGS+  CD + SP C C  GF P+N+Q W LRD
Sbjct  284   RYTRIPPSWGWSMFWSLPTDVCDSLYFCGSYSYCDLNTSPYCNCIRGFVPKNRQRWDLRD  343

Query  1623  GSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             GS GC R  ++ C  DGFL +N  KLP++ T+ VD T  + +C+E C+ +C+CT+++  +
Sbjct  344   GSHGCVRRTQMSCSGDGFLRLNNMKLPDTKTATVDRTTDVKKCEEKCLSDCNCTSFATAD  403

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             + NGG GCV WT +L +IR+  A  GQ LYVR+ A+D          G    +TKK+I  
Sbjct  404   VRNGGLGCVFWTGDLVEIRK-QAVVGQDLYVRLNAADLA-------SGEKRDRTKKIIGW  455

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKR-EHSGET  2159
                V  + ++   +    RR+ ++   +   + G +      LMN   +  K+   SGE 
Sbjct  456   SIGVTVMLILSVIVFCFWRRRQKQAKADATPIVGNQ-----VLMNEVVLPRKKINFSGED  510

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
              + +  EL + +F A+  AT++F++ NK+G+GGFG VYKG LV G+EIAVKRLS+ S QG
Sbjct  511   EV-ENLELSL-EFEAVVTATEHFSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQG  568

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EF NE+RLIA+LQH NLV+LLGCCV   EK+LIYEY+EN SLDS LFD+ RS +L+W+
Sbjct  569   TDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQ  628

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
              R++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETEA
Sbjct  629   MRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA  688

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               T+++VGTYGYMSPEYAM+G FS+KSD FSFGVL+LE++SG++N+GF    +  NLLG 
Sbjct  689   D-TRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSNLNLLGC  747

Query  2880  AWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              WR W EG+G E++D VI   S   F   +++RC+Q+GLLCVQE+ EDRP M++V+LML 
Sbjct  748   VWRNWKEGQGLEIVDRVIIDSSSPTFRPREILRCLQIGLLCVQERVEDRPMMSSVVLMLG  807

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ---SLNQLTVTMLDA  3191
              +   +PQPKQPG+C++   ++  SS +   D    ++NQ+T++++DA
Sbjct  808   SETALIPQPKQPGYCVSQSSLETYSSWSKLRDDENWTVNQITMSIIDA  855



>dbj|BAE93138.1| S-receptor kinase [Brassica rapa]
Length=854

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/827 (50%), Positives = 565/827 (68%), Gaps = 27/827 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G VF+LGFF P G S   Y+GIWY ++  +T  WVANRD PL +S G LKI  
Sbjct  47    NRTLVSPGGVFELGFFKPLGRSR-WYLGIWYIKVPLKTYAWVANRDNPLSSSIGTLKISG  105

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ L+  + N++WS++ T  N   P   +A+LL +GNFV+R  N+++   +LWQSFD+
Sbjct  106   N-NLVLLGQSNNTVWSTNLTRGNARSP--VIAELLPNGNFVIRHSNNKDSSGFLWQSFDF  162

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFL----RNKD  1259
             PTDTLLP MKLG+D KTGRNR+++SW+   DPS G+  +KLDI  GLPE  L     N+ 
Sbjct  163   PTDTLLPEMKLGYDLKTGRNRFLTSWKGSDDPSRGNFVYKLDIRRGLPEFILINQFLNQR  222

Query  1260  IIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL  1439
             +   RSG WNG+ FSG+PE++    + +++     E+ YSF + N++++SRL V+     
Sbjct  223   VETQRSGPWNGMEFSGIPEVQGLNYMVYNYTENSEEISYSFHMTNQSIYSRLTVSEFTF-  281

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             +R TWIP +R W+ FW  P D CD    CGS+  CD   SP C C  GF P+N Q W LR
Sbjct  282   DRLTWIPPSRDWSLFWTLPTDVCDPLYLCGSYSYCDLITSPNCNCIRGFVPKNPQQWDLR  341

Query  1620  DGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
             DG+ GC R  ++ C  DGFL +N   LP++ T+ VD TM + +C+E C+ +C+CT+++  
Sbjct  342   DGTQGCVRRTQMSCGRDGFLRLNNMNLPDTKTATVDRTMDVKKCEERCLSDCNCTSFAAA  401

Query  1800  NISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVIL  1979
             ++ NGG GCV WT EL  IR++ A GGQ LYVR+ A+D + +      G    +T K+I 
Sbjct  402   DVKNGGIGCVFWTGELVAIRKF-AVGGQDLYVRLNAADLDISS-----GEKRDRTGKIIG  455

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAIS-SKREHSGE  2156
                 V  + ++   +    RR+ ++   +   + G +      LMN   +   KR  SGE
Sbjct  456   WSIGVSVMLILSVIVFCFWRRRQKQAKADATPIVGNQ-----VLMNEVVLPRKKRNFSGE  510

Query  2157  TMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQ  2336
               + +  ELP+ +F A+  AT++F++ NK+G+GGFG VYKG LV G+EIAVKRLS+ S Q
Sbjct  511   DEV-ENLELPLMEFEAVVTATEHFSDLNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQ  569

Query  2337  GAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
             G +EF NE+RLIA+LQH NLV+LLGCCV   EK+LIYEY+EN SLDS LFD+ RS +L+W
Sbjct  570   GTDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNW  629

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
             + R++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETE
Sbjct  630   QMRFDIISGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETE  689

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             A  T+++VGTYGYMSPEYAM+G FS+KSD FSFGVL+LE++SG++N+GF    +  NLLG
Sbjct  690   A-DTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSTLNLLG  748

Query  2877  LAWRLWGEGRGSELLDSVIASESHSEFVD-QVMRCIQVGLLCVQEKAEDRPNMAAVMLML  3053
               WR W EG+G E++D  I   S   F   +++RC+Q+GLLCVQE+ EDRP M++V+LML
Sbjct  749   CVWRNWKEGQGLEIVDKFINDSSSPTFKPREILRCLQIGLLCVQERVEDRPMMSSVVLML  808

Query  3054  IGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
               +   +PQPKQPG+C++   ++  S     N  ++NQ+T++ +DAR
Sbjct  809   GSEAALIPQPKQPGYCVSGSSLETYSRRDDEN-WTVNQITMSNIDAR  854



>ref|XP_006360116.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Solanum tuberosum]
Length=829

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/823 (50%), Positives = 552/823 (67%), Gaps = 34/823 (4%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             +T+VS+   F+LGFFSPG  S   YVGIWYK+I   T VWVANR  PL N +G LK+ + 
Sbjct  36    ETIVSSDGTFELGFFSPGNTSTNRYVGIWYKKISVITPVWVANRLVPLTNKSGVLKVIQS  95

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             G + L + T ++IWS   TN+     N VAQLLD+GNFV+R  ND NPEN+LWQSFDYPT
Sbjct  96    GGVALQNVTNSTIWS---TNSSRFVQNPVAQLLDTGNFVLRDANDPNPENFLWQSFDYPT  152

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DTL+  MKLG D  TG  RY+SSW+S  DP+ GD T+  D  G P+  +R    +IYR+G
Sbjct  153   DTLIANMKLGRDLITGFERYLSSWKSSDDPAPGDYTYHCDPTGYPQDVMRKGADVIYRAG  212

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ +SG P M    + +F  +    E+YY +E+ NK++ S L+V       R  WI 
Sbjct  213   PWNGLRWSGAPNMVNNSITSFGLVMNNKEIYYKYELVNKSVVSALVVKPNGNTMRLIWIA  272

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
             + + W  + +A  D CD Y+ CG++G C+    PVC C   F+P++Q  W+  D + GC 
Sbjct  273   KTQGWVNYHSADADDCDTYKLCGAYGTCNILSDPVCHCLDKFEPKHQDDWNRADWTSGCV  332

Query  1641  RYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGS  1820
             R   L+C  DGF+  +  KLP++ TS+ + TMSLDEC+ +C+RNCSC  Y+N +I NGGS
Sbjct  333   RKTPLNCTGDGFIMYSGVKLPDTRTSWFNETMSLDECRAVCLRNCSCMGYTNLDIRNGGS  392

Query  1821  GCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlg  2000
             GC+IW  EL DIRQ  ++ GQ +Y+R++AS+    G  ++G       K VILA  + L 
Sbjct  393   GCLIWIEELIDIRQL-SQSGQDIYIRMSASEIGSAGSSSKG------DKSVILAVALPLL  445

Query  2001  igmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNA----TAISSKREHSGETMIT  2168
               ++L GL +                   R R  DP++      +  ++K +++ ++   
Sbjct  446   FALILLGLGVGLILYK-------------RRRREDPVVMTRGRFSGHNNKNDNTNQSHHE  492

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             D +ELP+ D   +  ATDNF+ ANK+G+GGFG VYKG+L GG+E+AVKRLS+ S+QG  E
Sbjct  493   D-FELPLLDLLTLINATDNFSIANKIGEGGFGLVYKGVLEGGQEVAVKRLSETSKQGIHE  551

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             FKNE+  IA+LQHRNLVKLLGCCV  +EKML+YEY++NKSLD  +FD++RS+LLDW +R+
Sbjct  552   FKNEVNCIAKLQHRNLVKLLGCCVQGEEKMLVYEYLQNKSLDIYIFDEERSALLDWPKRF  611

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
             NII G+ARGL+YLHQDSR RIIHRDLKASNVLLD EMNPKISDFGMAR FGGDET A  T
Sbjct  612   NIINGIARGLMYLHQDSRLRIIHRDLKASNVLLDTEMNPKISDFGMARSFGGDETGA-NT  670

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
             +R+VGTYGYMSPEYA+DG+FSVKSD FSFGVLVLE+VSG+KN+ F  P +  NLLG  + 
Sbjct  671   RRVVGTYGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSGKKNRRFVHPDHHLNLLGHTYM  730

Query  2889  LWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGT  3068
             L  EGR  EL+D  +    +   + +V+R I VGLLCVQ+  EDRP+M+ V++ML  +G 
Sbjct  731   LHKEGRSLELVDPKLVDSCN---ISEVLRSIHVGLLCVQQNPEDRPSMSTVIMMLSNEGI  787

Query  3069  SLPQPKQPGFCLASKPVKMDSSS-TSYNDQSLNQLTVTMLDAR  3194
              LP  K PGF    K   +D  S ++    S+N++T+T+LDAR
Sbjct  788   -LPSAKHPGFFTERKIGDVDQFSWSTQTPSSINEVTITLLDAR  829


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCC++G EKML+      KSLD ++FD  + A L+W K
Sbjct  563  QHRNLVKLLGCCVQGEEKMLVYEYLQNKSLDIYIFDEERSALLDWPK  609



>dbj|BAF91385.1| S-locus receptor kinase [Brassica rapa]
Length=842

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/833 (49%), Positives = 545/833 (65%), Gaps = 37/833 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TL S G+VF+LGFF    +S   Y+GIWYK++ DRT VWVANRD PL +S G LKI  
Sbjct  33    NRTLASPGDVFELGFFRTNSSSP-WYLGIWYKKVSDRTYVWVANRDNPLSSSIGTLKISG  91

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ ++D +  S+WS++ T  N+  P   VA+LL +GNFV+R  N+ +   +LWQSF++
Sbjct  92    N-NLVILDHSNKSVWSTNLTRGNERSP--VVAELLANGNFVMRDSNNNDASGFLWQSFNF  148

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PTDTLLP MKLG+  KTG +R+++SWRS  DPS G+  +KL     PE +L +   ++YR
Sbjct  149   PTDTLLPEMKLGFKLKTGLDRFLTSWRSSDDPSSGEFLYKLQTRRFPEFYLSSGVFLLYR  208

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             SG WNG+ FSG+P+ +    + ++F +   EV Y+F + N + +SRL +N+   +ER TW
Sbjct  209   SGPWNGIRFSGLPDDQKLSYLVYNFTKNNEEVAYTFRMTNNSFYSRLTLNFLGYIERQTW  268

Query  1455  IPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
              P   +W+RFW  P D QCD YR CG +  CD + SP+C C  GF P N + W  R  + 
Sbjct  269   NPSLGMWSRFWAFPLDSQCDTYRACGPYSYCDLNTSPICNCIQGFNPSNVEQWDQRVWAN  328

Query  1632  GCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             GC R   L C  DGF  M   KLPE++ + VD ++ + EC++ C+ +C+CTA++N +I N
Sbjct  329   GCMRRTRLSCSGDGFTKMKNMKLPETTMAIVDRSIGVKECEKRCLNDCNCTAFANADIRN  388

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDA----EQTGEVARGGNGFGKTKKVIL  1979
             GG+GCVIWT EL D+R Y A  GQ LYVR+AA D         ++     G      +I+
Sbjct  389   GGTGCVIWTGELEDMRNYAA-AGQDLYVRLAAGDLVTKRNANWKIISLAVGVSVLLLLII  447

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
              C               +                  R+R+++  MN   +S+KRE  GE 
Sbjct  448   FCVWKRKQKQAKAKATSI----------------ANRQRNQNLPMNGMVLSTKREFPGEK  491

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
              I +     + +   +  AT+NF++ NKLGQGGFG VYKG L+ G+EIAVKRLSK S QG
Sbjct  492   KIEELELP-LIELETVVKATENFSDCNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQG  550

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EF NE+ LIARLQH NLV+++GCC++ DEKMLIYEY+EN SLD  LF K + S L+WK
Sbjct  551   TDEFMNEVTLIARLQHINLVQIIGCCIEADEKMLIYEYLENLSLDCYLFGKTQRSKLNWK  610

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
              R++II GVARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  DETEA
Sbjct  611   ERFDIINGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA  670

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
              T K +VGTYGYMSPEYAM G+FS KSD FSFGV+VLE+VSG+KN  FY  + E +LL  
Sbjct  671   NTMK-VVGTYGYMSPEYAMRGIFSEKSDVFSFGVIVLEIVSGKKNSRFYKLNCENDLLSY  729

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFV----DQVMRCIQVGLLCVQEKAEDRPNMAAVML  3047
             AW  W EGR  E++D VI     S  +     +V++CIQ+GLLCVQE+AE RP MA+V+ 
Sbjct  730   AWSHWKEGRALEIVDPVIVDSLPSLPLTSQPQEVLKCIQIGLLCVQERAEHRPTMASVVW  789

Query  3048  MLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ----SLNQLTVTMLDAR  3194
             ML  + T +PQPK PG+C+   P ++D SS+   ++    ++NQ T +++DAR
Sbjct  790   MLGSEATDIPQPKPPGYCIQRSPYELDPSSSRQCNEDESWTVNQYTCSLIDAR  842



>dbj|BAA83746.1| SRK2-b [Brassica oleracea]
Length=854

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/826 (49%), Positives = 564/826 (68%), Gaps = 25/826 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G VF+LGFF P G S   Y+GIWYK++  +T  WVANRD PL +S G LKI  
Sbjct  47    NRTLVSPGGVFELGFFKPLGRSR-WYLGIWYKKVPWKTYAWVANRDNPLSSSIGTLKISG  105

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             + N+ L+  + N++WS+ N    +     +A+LL +GNFV+R  N+++   +LWQSFD+P
Sbjct  106   N-NLVLLGQSNNTVWST-NLTRGNARSQVIAELLPNGNFVMRHSNNKDSSGFLWQSFDFP  163

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFL----RNKDI  1262
             TDTLLP MKLG+D KT RNR+++SW+   DPS G+  +KLDI  GLPE  L     N+ +
Sbjct  164   TDTLLPEMKLGYDLKTRRNRFLTSWKGSDDPSSGNFVYKLDIRRGLPEFILINQFLNQRV  223

Query  1263  IIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLE  1442
                RSG WNG+ FSG+PE++    + +++     E+ YSF + N++++SRL V+   L +
Sbjct  224   ETQRSGPWNGMEFSGIPEVQGLNYMVYNYTENSEEIAYSFYMTNQSIYSRLTVSELTL-D  282

Query  1443  RYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRD  1622
             R TWIP +R W+ FW  P D CD    CGS+  CD   SP C C  GF P+N Q W LRD
Sbjct  283   RLTWIPPSRDWSLFWTLPTDVCDPLYLCGSYSYCDLITSPNCNCIRGFVPKNPQQWDLRD  342

Query  1623  GSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             G+ GC R  ++ C  DGFL +N   LP++ T+ VD TM + +C+E C+ +C+CT+++  +
Sbjct  343   GTQGCVRTTQMSCGRDGFLRLNNMNLPDTKTATVDRTMDVKKCEERCLSDCNCTSFAIAD  402

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             + NGG GCV WT EL  IR++ A GGQ LYVR+ A+D + +      G    +T K+I  
Sbjct  403   VRNGGLGCVFWTGELVAIRKF-AVGGQDLYVRLNAADLDISS-----GEKRDRTGKIISW  456

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAIS-SKREHSGET  2159
                V  + ++   +    RR+ ++   +   + G +      LMN   +   KR  SGE 
Sbjct  457   SIGVSVMLILSVIVFCFWRRRQKQAKADATPIVGNQ-----VLMNEVVLPRKKRIFSGED  511

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
              + +  ELP+ +F A+  AT++F++ NK+G+GGFG VYKG LV G+EIAVKRLS+ S QG
Sbjct  512   EV-ENLELPLMEFEAVVTATEHFSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQG  570

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EF NE+RLIA+LQH NLV+LLGCCV   EK+LIYEY+EN SLDS LFD+ RS +L+W+
Sbjct  571   TDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQ  630

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
              R++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETEA
Sbjct  631   MRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA  690

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               T+++VGTYGYMSPEYAM+G FS+KSD FSFGVL+LE++SG++N+ F    +  NLLG 
Sbjct  691   D-TRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKVFCDSDSSLNLLGC  749

Query  2880  AWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              WR W EG+G E++D VI   S   F   ++ RC+Q+GLLCVQE+ EDRP M++++LML 
Sbjct  750   VWRNWKEGQGLEIVDKVIVDSSSPTFRPREISRCLQIGLLCVQERVEDRPMMSSIVLMLG  809

Query  3057  GKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
              +   +PQPKQPG+C++   ++  S     N  ++NQ+T++++DAR
Sbjct  810   SEAALIPQPKQPGYCVSGSSLETYSRRDDEN-CTVNQITMSIIDAR  854



>dbj|BAF91411.1| S-locus receptor kinase [Brassica oleracea]
Length=846

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/834 (50%), Positives = 557/834 (67%), Gaps = 31/834 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+TLVS G +F+LGFF         Y+GIWYK++  RT VWVANRD PL NSTG LK
Sbjct  32    ISSNRTLVSPGSIFELGFFRTNSR---WYLGIWYKKLPYRTYVWVANRDNPLSNSTGTLK  88

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  + N+ ++  +  S+WS+ N    S     VA+LL +GNFV+R  N+ +   +LWQSF
Sbjct  89    ISGN-NLVILGHSNKSVWST-NLTRGSERSTVVAELLANGNFVMRDSNNNDASGFLWQSF  146

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII-  1265
             DYPTDTLLP MKLG+D KTG NR+++SWRS  DPS G+ ++KL+   LPE +L +  I  
Sbjct  147   DYPTDTLLPEMKLGYDLKTGLNRFLTSWRSSDDPSSGNFSYKLENQRLPEFYLSSHGIFR  206

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             ++RSG WNG+ FSG+PE E    + ++F     EV Y+F + N +++SRL +++    +R
Sbjct  207   LHRSGPWNGIGFSGIPEDEKLSYMVYNFTENSEEVAYTFRMTNNSIYSRLTLSFEGDFQR  266

Query  1446  YTWIPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRD  1622
              TW P   +WN FW++P D QCD+Y  C +   CD + SPVC C  GF PRN Q W  R 
Sbjct  267   LTWNPSLELWNLFWSSPVDPQCDSYIMCAAHAYCDVNTSPVCNCIQGFDPRNTQQWDQRV  326

Query  1623  GSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
              SGGC R   L C  DGF  M   KLPE++ + VD ++ + EC++ C+ +C+CTA++N +
Sbjct  327   WSGGCIRRTRLSCSGDGFTRMKNMKLPETTMAIVDRSIGVRECEKRCLSDCNCTAFANAD  386

Query  1803  ISNGGSGCVIWTAELFDIRQYT--AEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVI  1976
             I NGG+GCVIWT  L+D+R Y   A  GQ LYVR+AA+D  +     R  NG     K+I
Sbjct  387   IRNGGTGCVIWTGLLYDMRNYAIGAIDGQDLYVRLAAADIAK----KRNANG-----KII  437

Query  1977  LACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGE  2156
                  V  + +++   L   ++K  +    +I     R+R+++ LMN   +SSKRE SGE
Sbjct  438   SLTVGVSVLLLLVMFCLWKIKQKRAKASATSI---ANRQRNQNLLMNGMVLSSKREFSGE  494

Query  2157  TMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQ  2336
                 +     I    A+  AT+NF+N  KLG+GGFG VYKG L+ G+EIAVKRLSK S Q
Sbjct  495   NKFEELELPLIEL-EAVVKATENFSNCKKLGEGGFGIVYKGRLLDGQEIAVKRLSKTSGQ  553

Query  2337  GAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
             G +EF NE+ LIARLQH NLV+++GCC++ DEKMLIYEY+EN SLDS LF K  S  L+W
Sbjct  554   GTDEFMNEVTLIARLQHINLVQIIGCCIEADEKMLIYEYLENLSLDSYLFGKTGSCKLNW  613

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
             K R++I  GVARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  +ETE
Sbjct  614   KERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFAREETE  673

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             A T K +VGTYGYMSPEYAM G+FS KSD FSFGV+VLE+V+G++N+ FY  + E+NLL 
Sbjct  674   ANTMK-VVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVTGKRNRVFYNLNYEDNLLN  732

Query  2877  LAWRLWGEGRGSELLDSVIASE----SHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVM  3044
              AW  W EGR  E++D  I       S +    +V++CI++GLLCVQE AE RP M++V+
Sbjct  733   YAWNNWKEGRALEIVDPDIVDSFSPLSPTIQPQEVLKCIKIGLLCVQELAEHRPTMSSVV  792

Query  3045  LMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSY--NDQS--LNQLTVTMLDAR  3194
              ML  + T +PQPK PG+C+     ++D SS+    +DQS  +NQ T +++DAR
Sbjct  793   WMLGSEVTEIPQPKPPGYCVRRSSYELDPSSSRQCDDDQSWTVNQYTCSVIDAR  846



>dbj|BAA06285.1| S-receptor kinase SRK9 [Brassica rapa]
Length=839

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/827 (51%), Positives = 554/827 (67%), Gaps = 37/827 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G +F+LGFF         Y+G+WYK++  RT VWVANRD PL NS G LKI  
Sbjct  42    NRTLVSPGNIFELGFFRTNSR---WYLGMWYKKLSGRTYVWVANRDNPLSNSIGTLKIS-  97

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             + N+ L+D +  S+WS+ N   ++V    VA+LL +GNFVVR     +P  +LWQSFDYP
Sbjct  98    NMNLVLLDHSNKSVWST-NLTRENVRSPVVAELLANGNFVVR-----DPSGFLWQSFDYP  151

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFLRNKDIIIYR  1274
             TDTLLP MKLG+D KTG NR++ SWRS  DPS GD ++KLDI  GLPE +    + +++R
Sbjct  152   TDTLLPEMKLGYDLKTGLNRFLVSWRSSDDPSSGDFSYKLDIQRGLPEFYTFKDNTLVHR  211

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             +G WNG+ FSG+PE +    + ++F     EV Y+F + N +++SRL +N++   ER TW
Sbjct  212   TGPWNGIRFSGIPEEQQLSYMVYNFTENSEEVAYTFLVTNNSIYSRLTINFSGFFERLTW  271

Query  1455  IPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
              P   IWN  W++P   QCD Y  CG    CD +  P+C C  GFKP N Q W +RD + 
Sbjct  272   TPSLVIWNPIWSSPASFQCDPYMICGPGSYCDVNTLPLCNCIQGFKPLNVQEWDMRDHTR  331

Query  1632  GCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             GC R   L C  DGF  M   KLPE++ + VD ++ + EC++ C+ +C+CTA++N +I +
Sbjct  332   GCIRRTRLSCRGDGFTRMKNMKLPETTMATVDRSIGVKECEKKCLSDCNCTAFANADIRD  391

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgi  1991
             GG+GCVIWT  L D+R Y A  GQ LYVR+AA+D  +     R  NG      ++  C +
Sbjct  392   GGTGCVIWTGRLDDMRNY-AVSGQDLYVRLAAADVVE----KRTANG-KIVSLIVGVCVL  445

Query  1992  vlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITD  2171
             +L I   L+     + + +   +         R+R +  LMN   +S+ R+ S E   T 
Sbjct  446   LLLIFFCLWKRKQRRAKAMATSIVH-------RQRKQILLMNGMTLSNNRQLSRENK-TG  497

Query  2172  EYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEF  2351
             E+ELP+ +  A+  +T+NF+N NKLGQGGFG VYKG L  G+EIAVKRLSK S QGA+EF
Sbjct  498   EFELPLIELEAVVKSTENFSNCNKLGQGGFGIVYKGTL-DGQEIAVKRLSKTSVQGADEF  556

Query  2352  KNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYN  2531
              NE+ LIARLQH NLV++LGCC+D DEKMLIYEY+EN SLDS LF K RSS L+WK R++
Sbjct  557   MNEVTLIARLQHINLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRSSKLNWKERFD  616

Query  2532  IICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTK  2711
             I  G+ARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  DETEA T  
Sbjct  617   ITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEANTM-  675

Query  2712  RIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRL  2891
             R+VGTYGYMSPEYAM+G+FS KSD FSFGV+VLE+V+G++N+     +NE NLL  AW  
Sbjct  676   RVVGTYGYMSPEYAMEGIFSEKSDVFSFGVIVLEIVTGKRNR---EFNNENNLLSYAWSN  732

Query  2892  WGEGRGSELLDSVIA---SESHSEFVDQ-VMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             W EGR  E++D  I    S   S F  Q V++CIQ+GLLCVQE AE RP M++V+ ML  
Sbjct  733   WKEGRALEIVDPDIVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVWMLGS  792

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQS--LNQLTVTMLDAR  3194
             + T +PQPK PG+ +     ++D SS+  +D S  +NQ T +++DAR
Sbjct  793   EATEIPQPKPPGYWVRRSSYELDPSSSKCDDDSWTVNQYTCSVIDAR  839



>ref|XP_007021187.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate 
binding [Theobroma cacao]
 gb|EOY12712.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate 
binding [Theobroma cacao]
Length=823

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/786 (51%), Positives = 530/786 (67%), Gaps = 33/786 (4%)
 Frame = +3

Query  744   TLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGEDG  923
             T+VSAG  F+LGFFSPG  S   Y+ IWYK+I  +T VWVANR+ PL +S+GFLK+ + G
Sbjct  37    TIVSAGGRFELGFFSPGA-SRKKYLAIWYKQIPVKTAVWVANRELPLNDSSGFLKLTKQG  95

Query  924   NIHLVDGTGNSIWSSSNTNNQSVPG-NTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
              + L+D    ++WSS    N S P  N VAQLLDSGN +VR END NPEN LWQSFDYP 
Sbjct  96    ILVLLDRNRRTVWSS----NSSRPARNPVAQLLDSGNLIVREENDSNPENLLWQSFDYPC  151

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DTLL GMKLG +  TG +RY+SSW+SP DPS G+ T++ ++ G PE  LR   ++ +  G
Sbjct  152   DTLLQGMKLGRNLITGLDRYLSSWKSPDDPSHGNFTYRFEVGGFPELILREGSVVRFPPG  211

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG+ FSG PE+ P +    S +  + EVY ++E+HN  + SR++++   L ER TW  
Sbjct  212   PWNGLRFSGTPELRPNKFFTVSVVINETEVYDTYELHNSTILSRMVLSQNGLWERLTWTD  271

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
               + W  F     D CDNY  CG++G C+   +P C C  GF P+  + W  ++ S GC 
Sbjct  272   RTQSWEVFVIVQMDNCDNYALCGAYGSCNASNTPECSCLKGFVPQFPKNWDAKNWSNGCA  331

Query  1641  RYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGS  1820
             R   L+C TDGFL  +  KLP+S  S+ + +M+L+ECK +C +NCSCTAYSN +I +GGS
Sbjct  332   RKTPLNCSTDGFLKFSGVKLPDSRKSWFNYSMTLEECKNLCTKNCSCTAYSNIDIRDGGS  391

Query  1821  GCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlg  2000
             GC++W  +L DI+Q+T E GQ +Y+R+AAS+ +Q   +        +  +V   C +   
Sbjct  392   GCLLWFVDLVDIQQFT-ENGQEIYIRMAASELDQIESIKSKEK---ERVRVAFVCVLTAA  447

Query  2001  igmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEYE  2180
             + +V               ++  + +   R   +  L+     SS    S      ++ E
Sbjct  448   VLIVG--------------LSLVLYLWRKRYHEKPGLLTYVPESS----SNVKNQNEDLE  489

Query  2181  LPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNE  2360
             LP FD  AI  ATDNF+  NKLG+GGFG+VYKG+L  G EIAVKRLSK+S QG +EFKNE
Sbjct  490   LPSFDLAAIVFATDNFSMKNKLGEGGFGAVYKGILKDGLEIAVKRLSKSSGQGLDEFKNE  549

Query  2361  LRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIIC  2540
             +  IA+L+HRNLV+LLGCC+  DEKMLIYE+M NKSLD ++FD+ +S  LDW  RYNII 
Sbjct  550   VIHIAKLKHRNLVELLGCCIQGDEKMLIYEFMPNKSLDFLIFDETQSMSLDWPMRYNIIN  609

Query  2541  GVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIV  2720
             G+ARGLLYLHQDSR RIIHRDLKA+NVLLD EMNPKISDFG+AR FG  ETEA  T+++V
Sbjct  610   GIARGLLYLHQDSRQRIIHRDLKAANVLLDSEMNPKISDFGLARSFGDKETEA-NTRKVV  668

Query  2721  GTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGE  2900
             GTYGYM+PEYA+DGL+S+KSD FSFGVLVLE+V+G  N+GF  P ++ NLLG AWRL+ E
Sbjct  669   GTYGYMAPEYAIDGLYSIKSDVFSFGVLVLEIVNGNCNRGFCHPDHQLNLLGHAWRLFAE  728

Query  2901  GRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQ  3080
             G+  EL+ S I    ++    +V+R I VGLLCVQ   EDRPNM+ V++ML  +G  LPQ
Sbjct  729   GKSFELVASAIRDTGNAS---EVLRSIHVGLLCVQHSPEDRPNMSNVVMMLGSQG-PLPQ  784

Query  3081  PKQPGF  3098
             P+QPGF
Sbjct  785   PRQPGF  790


 Score = 55.5 bits (132),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            +HRNLV LLGCCI+G EKMLI      KSLD  +FD T+   L+W
Sbjct  557  KHRNLVELLGCCIQGDEKMLIYEFMPNKSLDFLIFDETQSMSLDW  601



>dbj|BAA21132.1| S-receptor kinase [Brassica rapa]
Length=841

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/827 (51%), Positives = 555/827 (67%), Gaps = 37/827 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G +F+LGFF     +   Y+G+WYK++  RT VWVANRD PL NS G LKI  
Sbjct  44    NRTLVSPGNIFELGFFR---TNSRWYLGMWYKKLSGRTYVWVANRDNPLSNSIGTLKIS-  99

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             + N+ L+D +  S+WS+ N   ++V    VA+LL +GNFVVR     +P  +LWQSFDYP
Sbjct  100   NMNLVLLDHSNKSVWST-NLTRENVRSPVVAELLANGNFVVR-----DPSGFLWQSFDYP  153

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFLRNKDIIIYR  1274
             TDTLLP MKLG+D KTG NR++ SWRS  DPS GD ++KLDI  GLPE +    + +++R
Sbjct  154   TDTLLPEMKLGYDLKTGLNRFLVSWRSSDDPSSGDFSYKLDIQRGLPEFYTFKDNTLVHR  213

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             +G WNG+ FSG+PE +    + ++F     EV Y+F + N +++SRL +N++   ER TW
Sbjct  214   TGPWNGIRFSGIPEEQQLSYMVYNFTENSEEVAYTFLVTNNSIYSRLTINFSGFFERLTW  273

Query  1455  IPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
              P   IWN  W++P   QCD Y  CG    CD +  P+C C  GFKP N Q W +RD + 
Sbjct  274   TPSLVIWNPIWSSPASFQCDPYMICGPGSYCDVNTLPLCNCIQGFKPLNVQEWDMRDHTR  333

Query  1632  GCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             GC R   L C  DGF  M   KLPE++ + VD ++ + EC++ C+ +C+CTA++N +I +
Sbjct  334   GCIRRTRLSCRGDGFTRMKNMKLPETTMATVDRSIGVKECEKKCLSDCNCTAFANADIRD  393

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgi  1991
             GG+GCVIWT  L D+R Y A  GQ LYVR+AA+D  +     R  NG      ++  C +
Sbjct  394   GGTGCVIWTGRLDDMRNY-AVSGQDLYVRLAAADVVE----KRTANG-KIVSLIVGVCVL  447

Query  1992  vlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITD  2171
             +L I   L+     + + +   +         R+R +  LMN   +S+ R+ S E   T 
Sbjct  448   LLLIFFCLWKRKQRRAKAMATSIVH-------RQRKQILLMNGMTLSNNRQLSRENK-TG  499

Query  2172  EYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEF  2351
             E+ELP+ +  A+  +T+NF+N NKLGQGGFG VYKG L  G+EIAVKRLSK S QGA+EF
Sbjct  500   EFELPLIELEAVVKSTENFSNCNKLGQGGFGIVYKGTL-DGQEIAVKRLSKTSVQGADEF  558

Query  2352  KNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYN  2531
              NE+ LIARLQH NLV++LGCC+D DEKMLIYEY+EN SLDS LF K RSS L+WK R++
Sbjct  559   MNEVTLIARLQHINLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRSSKLNWKERFD  618

Query  2532  IICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTK  2711
             I  G+ARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  DETEA T  
Sbjct  619   ITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEANTM-  677

Query  2712  RIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRL  2891
             R+VGTYGYMSPEYAM+G+FS KSD FSFGV+VLE+V+G++N+     +NE NLL  AW  
Sbjct  678   RVVGTYGYMSPEYAMEGIFSEKSDVFSFGVIVLEIVTGKRNR---EFNNENNLLSYAWSN  734

Query  2892  WGEGRGSELLDSVIA---SESHSEFVDQ-VMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             W EGR  E++D  I    S   S F  Q V++CIQ+GLLCVQE AE RP M++V+ ML  
Sbjct  735   WKEGRALEIVDPDIVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVWMLGS  794

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQS--LNQLTVTMLDAR  3194
             + T +PQPK PG+ +     ++D SS+  +D S  +NQ T +++DAR
Sbjct  795   EATEIPQPKPPGYWVRRSSYELDPSSSKCDDDSWTVNQYTCSVIDAR  841



>dbj|BAE92528.1| BoSRK-28 [Brassica oleracea]
Length=847

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/829 (50%), Positives = 566/829 (68%), Gaps = 27/829 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G+VF+LGFF    +S   Y+GIWYK++  RT VWVANRD PL  S G L+I  
Sbjct  36    NRTLVSPGDVFELGFFRTTSSSR-WYLGIWYKKVYFRTYVWVANRDNPLSRSIGTLRIS-  93

Query  918   DGNIHLVDGTGNSIWSSSNT-NNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ L+D +  S+WS++ T  N+  P   VA+LL +GNFV+R  N+ +   +LWQSFD+
Sbjct  94    NMNLVLLDHSNKSVWSTNLTRENERSP--VVAELLANGNFVMRDSNNNDASGFLWQSFDF  151

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PTDTLLP MKLG++ KTG NR++++WR+  DPS GD ++KL+   LPE +L      ++R
Sbjct  152   PTDTLLPEMKLGYNLKTGLNRFLTAWRNSDDPSSGDYSYKLENRELPEFYLLKSGFQVHR  211

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             SG WNGV FSG+PE +    + ++F     EV Y+F + N + +SRL V+    L+R T 
Sbjct  212   SGPWNGVRFSGIPENQKLSYMVYNFTENSEEVAYTFRMTNNSFYSRLKVSSDGYLQRLTL  271

Query  1455  IPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
             IP + +WN FW++P D +CD +R CG +  CD + SP+C C  GF P N Q W + + +G
Sbjct  272   IPISIVWNLFWSSPVDIRCDMFRVCGPYAYCDGNTSPLCNCIQGFDPWNLQQWDIGEPAG  331

Query  1632  GCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             GC R   L C  DGF  M   KLP++  + VD ++ L EC++ C+ +C+CTA++N +I N
Sbjct  332   GCVRRTLLSCSGDGFTKMKKMKLPDTRLAIVDRSIGLKECEKRCLSDCNCTAFANADIRN  391

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgi  1991
             GG+GCVIWT  L DIR Y A+G Q LYVR+AA+D      + +  N   K   +I+   +
Sbjct  392   GGTGCVIWTGHLQDIRTYFADG-QDLYVRLAAAD------LVKKKNANWKIISLIVGVSV  444

Query  1992  vlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITD  2171
             VL + +++   L  +++   + +  +I     ++R+++ LMN    S+KR+ S E    D
Sbjct  445   VLLLLLLIMFCLWKRKQNRAKAMATSIV---NQQRNQNVLMNGMTQSNKRQLSRENK-AD  500

Query  2172  EYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEF  2351
             E+ELP+ +  A+  AT+NF+N N+LGQGGFG VYKGML  G+E+AVKRLSK S QG +EF
Sbjct  501   EFELPLIELEAVVKATENFSNCNELGQGGFGIVYKGML-DGQEVAVKRLSKTSLQGIDEF  559

Query  2352  KNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYN  2531
              NE+RLIARLQH NLV++LGCC++ DEK+LIYEY+EN SLD  LF KKRSS L+WK R+ 
Sbjct  560   MNEVRLIARLQHINLVRILGCCIEADEKILIYEYLENSSLDYFLFGKKRSSNLNWKDRFA  619

Query  2532  IICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTK  2711
             I  GVARGLLYLHQDSRFRIIHRDLK  N+LLDK M PKISDFGMAR+F  DET+A  T 
Sbjct  620   ITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKISDFGMARIFARDETQA-RTD  678

Query  2712  RIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRL  2891
               VGTYGYMSPEYAMDG+ S K+D FSFGV+VLE+VSG++N+GFY  + E NLL  AW  
Sbjct  679   NAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRNRGFYQVNPENNLLSYAWSH  738

Query  2892  WGEGRGSELLDSVI----ASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             W EGR  E++D VI    AS   +    +V++CIQ+GLLC+QE+AE RP M++V+ ML  
Sbjct  739   WAEGRALEIVDPVIVDPLASLPSTFQPKEVLKCIQIGLLCIQERAEHRPTMSSVVWMLGS  798

Query  3060  KGTSLPQPKQPGFCL-ASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             + T +PQPK P +CL AS      SSS  ++D    ++N+ T +++DAR
Sbjct  799   EATEIPQPKPPVYCLMASYYANNPSSSRQFDDDESWTVNKYTCSVIDAR  847



>ref|XP_010247745.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nelumbo nucifera]
Length=855

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/871 (49%), Positives = 565/871 (65%), Gaps = 51/871 (6%)
 Frame = +3

Query  618   FFLSSIQTPLVAKQSCRWPESGTADDIL**GPPWNPPLTLNQTLVSAGEVFQLGFFSPGG  797
             +FL S  T L+    C +P +  A D        +      QTLVS    F+LGFFSP  
Sbjct  24    YFLISCSTALL----CFFPATSFAADTF--TQSQSISDEQGQTLVSKEGSFELGFFSPE-  76

Query  798   NSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGEDGNIHLVDGTGNSIWSSS--  971
             NS   YVGIWYK I   T+VWV NRD PL NSTG LKI   GN  L +GT   IWSS+  
Sbjct  77    NSKNRYVGIWYKNIPILTVVWVLNRDHPLTNSTGVLKIDNKGNFVLFNGTNGPIWSSNFT  136

Query  972   --NTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPTDTLLPGMKLGWDSKT  1145
                    +   + V QLL+SGN V++   D + E++LWQSFDYP DTLLPGMKLGW+ KT
Sbjct  137   KATIAAAAATESLVVQLLESGNLVLKDGKDGSSESFLWQSFDYPCDTLLPGMKLGWNLKT  196

Query  1146  GRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSGGWNGVAFSGVPEMEP  1325
             G N  +SSW+S  DPS GD+T+ +++N  PE  +R      YR+G WNG+ +SG PE++ 
Sbjct  197   GMNWRLSSWKSVDDPSTGDLTYGIELNEYPETVMRKGSKENYRAGPWNGLRYSGAPELKT  256

Query  1326  KEVIAFSFMRTKNEVYYSFEIHNKN-LFSRLIVNYTQ----LLERYTWIPENRIWNRFWN  1490
               + +F F    +EV Y +++ N N + SRL++N +      L+RYTW   +R W  F +
Sbjct  257   NLIFSFKFTWNNDEVSYMYQLLNDNSVISRLVLNQSTGNGGELQRYTWNTLSRNWQLFLS  316

Query  1491  APKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCFRYDELDC-PT  1667
              P+D CD+Y  CG++  CD + SPVC C  GFKP++   W+L D SGGC     L+C   
Sbjct  317   VPRDYCDSYGLCGAYSDCDMNESPVCQCLKGFKPKSPSDWNLMDWSGGCVHQASLNCRKG  376

Query  1668  DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGSGCVIWTAEL  1847
             +GF+     KLP++  ++VD  ++L +C+  C++NCSCTAY+N +IS GGSGC IW  +L
Sbjct  377   EGFVKFTGVKLPDTRYTWVDKNINLKDCEVECLKNCSCTAYANSDISGGGSGCAIWFGDL  436

Query  1848  FDIRQYT-AEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlgigmvlfgl  2024
              DIR+++   GGQ LY+R+AAS+     +         K K+VI+    V+   ++L   
Sbjct  437   IDIRRFSNGGGGQDLYIRMAASELAHDSK---------KKKRVIMIVLTVVPGMLLLGWF  487

Query  2025  lllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITDEYELPIFDFNA  2204
                  +K +  V       G  ER+ +           R +  E+ I D  ELP FDF  
Sbjct  488   GWYFYKKEKSEV-------GKVERNEE-----------RSYRDESNI-DNLELPSFDFAT  528

Query  2205  IAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNELRLIARLQ  2384
             I  ATDNF++ NKLG+GGFG VYKG  V G+EIAVKRLSK+S QG +EFKNE+ LI++LQ
Sbjct  529   IVKATDNFSDTNKLGEGGFGPVYKGKSVEGQEIAVKRLSKSSIQGLDEFKNEVILISKLQ  588

Query  2385  HRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIICGVARGLLY  2564
             HRNLVKLLGCC+  +E+MLIYEYM+NKSLDS +FD+KRS L+DW+ R +II G+ARGLLY
Sbjct  589   HRNLVKLLGCCIQGEERMLIYEYMDNKSLDSFIFDEKRSKLMDWEMRLHIIMGIARGLLY  648

Query  2565  LHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIVGTYGYMSP  2744
             LHQDSR RIIHRDLKASN+LLD +M PKISDFG+AR+F  D+TEA  T+R+VGTYGYMSP
Sbjct  649   LHQDSRLRIIHRDLKASNILLDSKMEPKISDFGLARIFARDQTEA-ETRRVVGTYGYMSP  707

Query  2745  EYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGEGRGSELLD  2924
             EYA+DGLFSVKSD +SFGV+VLE++SG+KN+GFY P  + NLLG AW L   GR  EL+D
Sbjct  708   EYAIDGLFSVKSDVYSFGVIVLEIISGKKNRGFYHPEFQLNLLGHAWTLCNGGRAMELID  767

Query  2925  SVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQPKQPGFCL  3104
               +     +   D+V+RCI VGLLCVQ+  EDRP M++V+LML   G SLP+P+QPGF  
Sbjct  768   PSMGELGSA--TDEVVRCIHVGLLCVQQNTEDRPTMSSVVLML-SSGCSLPKPQQPGFFA  824

Query  3105  ASKPVKM-DSSSTSYNDQSLNQLTVTMLDAR  3194
                PV   DSSS+         +++T+L+ R
Sbjct  825   QRYPVMAPDSSSSKQESYITGDMSITLLEGR  855


 Score = 57.4 bits (137),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLV+LLGCCI+G E+MLI      KSLD+F+FD  +   ++W
Sbjct  588  QHRNLVKLLGCCIQGEERMLIYEYMDNKSLDSFIFDEKRSKLMDW  632



>ref|XP_006594797.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X2 [Glycine max]
Length=809

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/825 (49%), Positives = 542/825 (66%), Gaps = 65/825 (8%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N TLVS    F+LGFF+PG NS   Y+GIWY++I  +T+VWVANR  P+ +S+G L++  
Sbjct  44    NTTLVSKDGTFELGFFTPG-NSQKRYLGIWYRKIPIQTVVWVANRLNPINDSSGILRMNP  102

Query  918   DGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
                  ++   G  IWS+++      P + VA LL+SGN V+R E D N E+YLW+SF+YP
Sbjct  103   STGTLVLTHNGTVIWSTASIRR---PESPVALLLNSGNLVIRDEKDANSEDYLWESFNYP  159

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
             TDT LP MK GWD +TG NR + +W+SP DPS  D +F + +N  PEA++   D   YRS
Sbjct  160   TDTFLPEMKFGWDLRTGLNRKLIAWKSPDDPSPSDFSFGMVLNNYPEAYMMKGDQKFYRS  219

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL-ERYTW  1454
             G WNG+  SG P+++   +  F F+  K+E+YY++ + N ++ SRL++N T  + +RY W
Sbjct  220   GPWNGLHSSGSPQVKANPIYDFKFVSNKDELYYTYSLKNSSMISRLVLNATSYVRKRYVW  279

Query  1455  IPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGG  1634
             I   + W  + + P D CD+Y  CG+   C    SPVC C  GFKP+  +AWS  D S G
Sbjct  280   IESKQRWEVYTSVPLDLCDSYSLCGANANCVISDSPVCQCLQGFKPKLPEAWSSMDWSHG  339

Query  1635  CFRYDELDCPT---DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
             C R  EL C     DGF  +   K P+++ S++D T+ L+ECK  C+ NCSC AY+N +I
Sbjct  340   CIRNKELSCENKNKDGFNKLTLLKTPDTTHSWLDQTIGLEECKAKCLDNCSCMAYANSDI  399

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA-  1982
             S  GSGC +W  +L DIRQ+ A GGQ +YVR+ AS      E+  G         +IL  
Sbjct  400   SGQGSGCAMWFGDLIDIRQFAA-GGQDVYVRIDAS------ELVAG-------ILIILGW  445

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSK-REHSGET  2159
             C                                  R++SR  +   +  S K  ++SG  
Sbjct  446   CY---------------------------------RKKSRCSVKERSDFSIKSNQNSG--  470

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
             M  D+ +LP+FD + IA AT NF   NK+G+GGFG VY+G L  G+EIAVKRLS +S QG
Sbjct  471   MQVDDMDLPVFDLSTIAKATSNFTVKNKIGEGGFGPVYRGSLTDGQEIAVKRLSASSGQG  530

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
               EFKNE++LIA+LQHRNLVKLLGCC++ +EKML+YEYM N SLDS +FD++RS  LDW 
Sbjct  531   LTEFKNEVKLIAKLQHRNLVKLLGCCLEGEEKMLVYEYMLNGSLDSFIFDEQRSGSLDWS  590

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
             +R+NIICG+A+GLLYLHQDSR RIIHRDLKASNVLLD E+NPKISDFGMAR+FG D+ E 
Sbjct  591   KRFNIICGIAKGLLYLHQDSRLRIIHRDLKASNVLLDSELNPKISDFGMARIFGVDQQE-  649

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
             G TKRIVGTYGYM+PEYA DGLFSVKSD FSFGVL+LE++SG++++G+Y  ++ +NL+G 
Sbjct  650   GNTKRIVGTYGYMAPEYATDGLFSVKSDVFSFGVLLLEIISGKRSRGYYNQNHSQNLIGH  709

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             AW+LW EGR  EL+D  I   S    + Q++ CI V LLCVQ+  EDRP M++V+LML+ 
Sbjct  710   AWKLWKEGRPLELIDKSIEDSSS---LSQMLHCIHVSLLCVQQNPEDRPGMSSVLLMLVS  766

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             +   LP+PKQPGF       + DSS++     S N++T+T+L+AR
Sbjct  767   E-LELPEPKQPGF-FGKYSGEADSSTSKQQLSSTNEITITLLEAR  809


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCC+EG EKML+       SLD+F+FD  +   L+W K
Sbjct  545  QHRNLVKLLGCCLEGEEKMLVYEYMLNGSLDSFIFDEQRSGSLDWSK  591



>ref|XP_008651809.1| PREDICTED: uncharacterized LOC100501883 isoform X1 [Zea mays]
Length=848

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/836 (49%), Positives = 549/836 (66%), Gaps = 32/836 (4%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG  899
             N  L+  QTLVSAG VFQLGFF+P  +S   ++GIWY  +  +T+VWVANR+ P+  +T 
Sbjct  34    NSSLSDGQTLVSAGGVFQLGFFTPA-SSTARFLGIWYMGLAPQTVVWVANREAPITGTTA  92

Query  900   FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLW  1079
              L I   G++ L D +G   WSS  +N  S      AQLLDSGNFV++          LW
Sbjct  93    SLAINATGSLVLADPSGRVFWSSPQSNMSSTGSPVGAQLLDSGNFVLQGGGGA----VLW  148

Query  1080  QSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKD  1259
             QSFDYP+DTLLPGMKLGWD  TG +R++++WRS  DPS GD TF  D+ G+PE F+R   
Sbjct  149   QSFDYPSDTLLPGMKLGWDLTTGLDRHLTTWRSTGDPSPGDYTFGFDLRGVPEGFIRRDG  208

Query  1260  II-IYRSGGWNGVAFSGVPEMEPKEV-IAFSFMRTKNEVYYSFEIHNKNLFS------RL  1415
              + +YR+G WNG+ FSG PEMEP      F F+   ++VYY+F +             R 
Sbjct  209   TVPVYRNGPWNGLQFSGEPEMEPNNSNFQFEFVDNASDVYYTFLVDGGGGSGNGGVVSRF  268

Query  1416  IVNYTQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDM-SPVCGCPVGFKP  1592
             ++N + + +RY W P  + W+ +W+ P+DQCDNY  CG+FG CDT   S  C C  GF P
Sbjct  269   VLNQSSV-QRYVWPPGGQGWSLYWSLPRDQCDNYAHCGAFGACDTSGGSAACACVHGFTP  327

Query  1593  RNQQAWSLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRN  1772
              + + W LRD S GC R   L+C  DGFL +   KLP+++ +  DAT+++D+C++ C+ N
Sbjct  328   ASPRDWELRDSSAGCRRLTRLNCTGDGFLPLRGVKLPDTTNATEDATITVDQCRQRCLAN  387

Query  1773  CSCTAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNG  1952
             CSC AY+  +I  G SGC+IW++ L DIR + + GGQ L+VR+AASD    G+       
Sbjct  388   CSCLAYAASSIKGGDSGCIIWSSPLIDIRHFPS-GGQDLFVRLAASDLPSDGD-------  439

Query  1953  FGKTKKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAIS  2132
              G  KK ++   +V    ++L G+      K              R  S D  +  T + 
Sbjct  440   -GSRKKNVVVAVVVSLSAVLLVGVGGFFLWKKLFRNKAGRFQSAQRFSSFDSSVPLTPVQ  498

Query  2133  -SKREHSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAV  2309
                R    E   + +  + +FD +AIA++TDNFA  NKLG+GGFG+VYKG L GG+ +AV
Sbjct  499   LQDRSKEDEAGQSSDLNVTLFDMDAIALSTDNFAAWNKLGEGGFGAVYKGQLEGGQAVAV  558

Query  2310  KRLSKNSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFD  2489
             KRLSK S QG  EFKNE+ LIA+LQH NLV+LLGCCV  +E+ML+YEYMENKSLD+ +FD
Sbjct  559   KRLSKYSTQGLGEFKNEVMLIAKLQHVNLVRLLGCCVHGEERMLVYEYMENKSLDNFIFD  618

Query  2490  KKRSSLLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMA  2669
             K RS+ L W +R++II G+ARGLLYLHQDSR+++IHRDLKA N+LLDK+MNPKISDFG+A
Sbjct  619   KNRSAQLHWSKRFDIILGIARGLLYLHQDSRYKVIHRDLKAGNILLDKDMNPKISDFGVA  678

Query  2670  RLFGGDETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYT  2849
             R+F GD+T++  T+++VGTYGYMSPEYAMDG+FSVKSD FSFGVLVLE+VSGRKN+G Y+
Sbjct  679   RIF-GDDTDS-HTRKVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIVSGRKNRGMYS  736

Query  2850  PSNEENLLGLAWRLWGEGRGSELLD-SVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRP  3026
                + +LL  AWRLW EG    LLD +V+ + +H     +V+RC+QV LLCVQE+ +DRP
Sbjct  737   SGEQTSLLSQAWRLWREGNALALLDEAVVRAGTHRS--SEVLRCVQVALLCVQERPDDRP  794

Query  3027  NMAAVMLMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             +MAAV L L      LPQP+ PG+C        D   +S    ++N +TVT+++ R
Sbjct  795   HMAAVFLALGNPSAVLPQPRHPGYCTDRGSASTDGEWSSTC--TVNDVTVTIVEGR  848


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QH NLVRLLGCC+ G E+ML+      KSLD F+FD  + A+L+W K
Sbjct  583  QHVNLVRLLGCCVHGEERMLVYEYMENKSLDNFIFDKNRSAQLHWSK  629



>gb|AIZ68213.1| receptor-like serine/threonine-protein kinase SD1-8 [Galtonia 
saundersiae]
Length=829

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/827 (48%), Positives = 544/827 (66%), Gaps = 37/827 (4%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG  899
             N PL++N++LVS+   F LGFFSP  ++  L++G+WYK I +++++WV NR  P+ N+T 
Sbjct  31    NKPLSVNESLVSSDGTFTLGFFSPTNSNNNLFIGVWYKRIPEQSVIWVGNRRNPVTNTTA  90

Query  900   FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLW  1079
              L +  +G++ + DG     WSS++T +   P   + QLLD+GNFVVR  +  N + + W
Sbjct  91    VLTLTNNGSLLITDGKSEVFWSSASTTSVRNP---IGQLLDTGNFVVRDASTTNSKIFAW  147

Query  1080  QSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKD  1259
             QSFDYPTDTL+PGMKLGW+  +G NR +++W SPTDPS G+ T  +D+ G P+ +  N  
Sbjct  148   QSFDYPTDTLVPGMKLGWNLTSGLNRNLTAWASPTDPSPGNYTLAMDLRGDPQLYFWNSG  207

Query  1260  IIIYRSGGWNGVAFSG--VPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQ  1433
             ++ +RSG W G+ FSG     M       FSF+  K EVYY+  + NK+  +RL+VN + 
Sbjct  208   VVQWRSGPWTGLDFSGQFPATMTYTNTFVFSFVNNKEEVYYATGVINKSTLTRLVVNQSG  267

Query  1434  LLERYTWIPENRIWNRFWNAPKDQCD-NYRECGSFGICDTDMSPVCGCPVGFKPRNQQAW  1610
             + + + W+  +  WN +W  PK QCD  Y  CG +G C  D SP+C C  GF+P++ + W
Sbjct  268   ITQSFVWLDGSNTWNLYWYNPKGQCDVGYIACGPYGACLQDGSPMCSCLQGFQPKSPKDW  327

Query  1611  SLRDGSGGCFRYDELDCP--TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCT  1784
             +LR  SGGC R  ELDC   +DGF+++    LP++  S VD TM+LDEC+  C++NCSCT
Sbjct  328   ALRYTSGGCIRKTELDCKNRSDGFVTVPQAMLPDTVNSTVDMTMNLDECRAACLKNCSCT  387

Query  1785  AYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKT  1964
             AY++ +I   G GC+IW+  L D   + +EGGQ  Y+R+AA+D   T   +       +T
Sbjct  388   AYASADIRGSGRGCIIWSTALLDTGLF-SEGGQDFYLRLAAADIGSTSSHSD------ET  440

Query  1965  KKVILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKRE  2144
                 LA  + + +G++L  +  +              M+  R R  +        +S+ E
Sbjct  441   AGSTLAIVLSVVLGVILLVVGSVCYAW----------MKKKRSRGNN--------NSRNE  482

Query  2145  HSGETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSK  2324
              S      D+ EL  FD  AI  ATD F+N NKLG+GGFG V+KG    G+EIA KRLSK
Sbjct  483   QSAAKSKGDDMELLQFDLAAIEAATDGFSNENKLGEGGFGPVFKGKTEEGQEIAAKRLSK  542

Query  2325  NSRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSS  2504
              S QG +E K E+ L+A+LQHRNLV+LLGCC++ DE++LIYEYM NKSLD+ LFD+++S 
Sbjct  543   TSAQGLDELKAEMMLVAKLQHRNLVRLLGCCIEGDERILIYEYMPNKSLDAFLFDEQKSV  602

Query  2505  LLDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGG  2684
             LLDW  RY II G+ARGLLYLHQDSRFRIIHRDLKA N+LLD +MNPKISDFG+AR+FGG
Sbjct  603   LLDWSTRYQIILGIARGLLYLHQDSRFRIIHRDLKAGNILLDGDMNPKISDFGLARIFGG  662

Query  2685  DETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEE  2864
             DET+   T+R+VGTYGYMSPEYA++G+FSVKSD FSFGV+VLE++SG++N+G +    +E
Sbjct  663   DETKT-KTRRVVGTYGYMSPEYALNGIFSVKSDVFSFGVIVLEIISGKRNKGVFLSDAKE  721

Query  2865  NLLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVM  3044
              LLG AW LW EG G ELLD+ +A    S  + +V+RC++V LLCVQE+ EDRP M++V+
Sbjct  722   YLLGKAWVLWKEGNGLELLDAPLA---QSFSMGEVLRCMKVALLCVQERPEDRPTMSSVV  778

Query  3045  LMLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTML  3185
             LML      LP+P  PGF    +     SSS      S+N LTVT +
Sbjct  779   LMLGSDHAFLPEPNPPGFVARQRSPDESSSSMKDTSNSVNGLTVTTM  825


 Score = 60.5 bits (145),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLVRLLGCCIEG E++LI      KSLD F+FD  K   L+W
Sbjct  562  QHRNLVRLLGCCIEGDERILIYEYMPNKSLDAFLFDEQKSVLLDW  606



>dbj|BAA31252.1| SRK29 [Brassica rapa]
Length=854

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/827 (50%), Positives = 564/827 (68%), Gaps = 27/827 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G VF+LGFF     S   Y+GIWYK++  +T  WVANRD PL NS G LKI  
Sbjct  47    NRTLVSPGGVFELGFFKTLERSR-WYLGIWYKKVPWKTYAWVANRDNPLSNSIGTLKISG  105

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ L+  + N++WS++ T  N   P   +A+LL +GNFV+R  N+++   +LWQSFD+
Sbjct  106   N-NLVLLGQSNNTVWSTNFTRGNARSP--VIAELLPNGNFVMRHSNNKDSNGFLWQSFDF  162

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDIN-GLPEAFL----RNKD  1259
             PTDTLLP MKLG++ KTGRNR+++SW+S  DPS G+  +KLD+  GLPE  L     N+ 
Sbjct  163   PTDTLLPEMKLGYNLKTGRNRFLTSWKSSDDPSSGNFAYKLDLRRGLPEFILINTFLNQR  222

Query  1260  IIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL  1439
             +   RSG WNG+ FSG+PE++    + +++     E+ YSF + N++++SRL V+   L 
Sbjct  223   VETQRSGPWNGMEFSGIPEVQGLNYMVYNYTENSEEISYSFHMTNQSIYSRLTVSELTL-  281

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
              R+TWIP +  W+ FW  P D CD    CGS+  CD   SP C C  GF P+N Q W LR
Sbjct  282   NRFTWIPPSSAWSLFWTLPTDVCDPLYLCGSYSYCDLITSPNCNCIRGFVPKNPQQWDLR  341

Query  1620  DGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNY  1799
             DG+ GC R  ++ C  DGFL +N   LP++ T+ VD T+ + +C+E C+ +C+CT+++  
Sbjct  342   DGTQGCVRTTQMSCSGDGFLRLNNMNLPDTKTATVDRTIDVKKCEERCLSDCNCTSFAAA  401

Query  1800  NISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVIL  1979
             ++ NGG GCV WT EL  IR++ A GGQ LYVR+ A+D + +      G    +T K+I 
Sbjct  402   DVRNGGLGCVFWTGELVAIRKF-AVGGQDLYVRLNAADLDLSS-----GEKRDRTGKIIG  455

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAIS-SKREHSGE  2156
                 V  + ++   +    RRK ++   +   + G +      LMN   +   KR  SGE
Sbjct  456   WSIGVSVMLILSVIVFCFWRRKHKQAKADATPIVGNQ-----VLMNEVVLPRKKRNFSGE  510

Query  2157  TMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQ  2336
               + +  ELP+ +F A+  AT++F++ NK+G+GGFG VYKG LV G+EIAVKRLS+ S Q
Sbjct  511   DEV-ENLELPLMEFEAVVTATEHFSDFNKVGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQ  569

Query  2337  GAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDW  2516
             G +EF NE+RLIA+LQH NLV+LLGCCV   EK+LIYEY+EN SLDS LFD  RS  L+W
Sbjct  570   GTDEFMNEVRLIAKLQHNNLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDGSRSCKLNW  629

Query  2517  KRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETE  2696
             + R++II G+ARGLLYLHQDSRFRIIHRDLKASNVLLDK+M PKISDFGMAR+FG DETE
Sbjct  630   QMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETE  689

Query  2697  AGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLG  2876
             A  T+++VGTYGYMSPEYAM+G FS+KSD FSFGVL+LE++SG++N+GF    +  NLLG
Sbjct  690   AD-TRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSSLNLLG  748

Query  2877  LAWRLWGEGRGSELLDSVIASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLML  3053
               WR W EG+G E++D VI   S   F   ++ RC+Q+GLLCVQE+ EDRP M++V+LML
Sbjct  749   CVWRNWKEGQGLEIVDRVIIDSSSPTFRPSEISRCLQIGLLCVQERVEDRPMMSSVVLML  808

Query  3054  IGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
               +   +PQPKQPG+C++   ++  S     N  ++NQ+T++++DAR
Sbjct  809   GSEAALIPQPKQPGYCVSGSSLETYSRRDDEN-WTVNQITMSIIDAR  854



>gb|KDP38975.1| hypothetical protein JCGZ_00732 [Jatropha curcas]
Length=820

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/829 (48%), Positives = 543/829 (66%), Gaps = 42/829 (5%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG  899
             N PL    TL+S  + F+LGFFS   +    Y+G+WYK+I   TIVWVANR+ P+ ++ G
Sbjct  30    NKPLRDGNTLLSPNQTFELGFFSLT-DPKVRYLGLWYKKISSGTIVWVANRETPISDTVG  88

Query  900   FLKIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLW  1079
              L I   GN+ LV+GT + +WSS   N  ++  + VA+L D+GNFVVR  ND N EN+LW
Sbjct  89    TLNITGQGNLILVNGTNHVVWSS---NTSAIAKSPVAELFDNGNFVVREANDSNSENFLW  145

Query  1080  QSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKD  1259
             QS+DYPT T+LPGMK G +  TG   + SSW+S  DP++G  +  LD++G P+  +R  +
Sbjct  146   QSYDYPTQTVLPGMKFGTNLVTGHESFQSSWKSSDDPAQGQFSVHLDLHGYPQMLIRKDN  205

Query  1260  IIIYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL  1439
              I YRSG WNG+ F+G P + P  +  + F   + EVY+ +++ N++LF+R  ++ + LL
Sbjct  206   DIQYRSGSWNGLRFTGTPVLRPDPIFTYEFEMNEREVYFRYDVLNRSLFARYTISPSGLL  265

Query  1440  ERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLR  1619
             +R++W      W     A  DQC+NY  CG++  C+ + +PVC C  GF P+  + W++ 
Sbjct  266   QRFSWSDRINDWVIIATAQTDQCENYGFCGAYATCEINNNPVCSCLEGFIPKTPKDWNML  325

Query  1620  DGSGGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSN  1796
               S GC R   L+C   DGF+     KLP++S+++ + T+ L EC ++C+RNCSCTAY+ 
Sbjct  326   LWSDGCVRRTPLNCSNNDGFVRHPGIKLPDTSSTWYNRTIGLKECADVCLRNCSCTAYAT  385

Query  1797  YNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVI  1976
              +I  GGSGC+IW  EL DIR+    GGQ LY++VAAS+ +      +  +   K   VI
Sbjct  386   LDIRGGGSGCLIWLNELIDIRELPV-GGQDLYIKVAASELDN---FDKKNSSAKKVAGVI  441

Query  1977  LACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGE  2156
                 I +   +  +                 +  R  R R          I  KR    E
Sbjct  442   AGAVIFIISLITAYC----------------LWWRNQRNRR---------IEKKRGMRNE  476

Query  2157  T---MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKN  2327
             T      D+ ELP+FD   IA AT++F+++NKLG+GGFG VY+G L+ G+EIAVKRLSK+
Sbjct  477   TSQGKKDDDMELPMFDLTTIANATNDFSHSNKLGEGGFGPVYRGTLLEGQEIAVKRLSKS  536

Query  2328  SRQGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSL  2507
             S QG  EFKNE+ LIA+LQHRNLVKLLGCC+D DEKMLIYEYM NKSLD  +FD+ RS L
Sbjct  537   SGQGLNEFKNEVILIAKLQHRNLVKLLGCCIDDDEKMLIYEYMHNKSLDCFIFDQTRSKL  596

Query  2508  LDWKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGD  2687
             LDW +R +II G+ARGLLYLHQDSR RIIHRDLKASN+LLD ++NPKISDFG+AR FG D
Sbjct  597   LDWNKRMHIISGIARGLLYLHQDSRLRIIHRDLKASNILLDSDLNPKISDFGLARTFGLD  656

Query  2688  ETEAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEEN  2867
             +T A T K +VGTYGYMSPEYA+DGLFSVKSD FSFGVLVLE++SG++N+ F  P +  N
Sbjct  657   QTSANTQK-VVGTYGYMSPEYAVDGLFSVKSDVFSFGVLVLEILSGKRNRAFSHPDHNLN  715

Query  2868  LLGLAWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVML  3047
             LLG AW LW +G   EL+D  +A    S  + +++RCI + LLCVQ+K EDRPNM++V++
Sbjct  716   LLGHAWVLWTKGTPLELIDENLAD---SYVLSEIVRCINIALLCVQQKPEDRPNMSSVVV  772

Query  3048  MLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             ML      L QPKQPGF +   P   D+SS+  +  S N++T+T LDAR
Sbjct  773   ML-NSENPLAQPKQPGFFMERTPFDKDTSSSKNHSYSANEITITELDAR  820


 Score = 59.7 bits (143),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCCI+  EKMLI      KSLD F+FD T+   L+W K
Sbjct  555  QHRNLVKLLGCCIDDDEKMLIYEYMHNKSLDCFIFDQTRSKLLDWNK  601



>ref|XP_010247747.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Nelumbo nucifera]
Length=854

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/878 (48%), Positives = 562/878 (64%), Gaps = 66/878 (8%)
 Frame = +3

Query  618   FFLSSIQTPLVAKQSCRWPESGTADDIL**GPPWNPPLTLNQTLVSAGEVFQLGFFSPGG  797
             +FL S  T L+    C +P +  A D        +      QTLVS    F+LGFFSP  
Sbjct  24    YFLISCSTALL----CFFPATSFAADTF--TQSQSISDEQGQTLVSKEGSFELGFFSPE-  76

Query  798   NSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGEDGNIHLVDGTGNSIWSSS--  971
             NS   YVGIWYK I   T+VWV NRD PL NSTG LKI   GN  L +GT   IWSS+  
Sbjct  77    NSKNRYVGIWYKNIPILTVVWVLNRDHPLTNSTGVLKIDNKGNFVLFNGTNGPIWSSNFT  136

Query  972   --NTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPTDTLLPGMKLGWDSKT  1145
                    +   + V QLL+SGN V++   D + E++LWQSFDYP DTLLPGMKLGW+ KT
Sbjct  137   KATIAAAAATESLVVQLLESGNLVLKDGKDGSSESFLWQSFDYPCDTLLPGMKLGWNLKT  196

Query  1146  GRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSGGWNGVAFSGVPEMEP  1325
             G N  +SSW+S  DPS GD+T+ +++N  PE  +R      YR+G WNG+ +SG PE++ 
Sbjct  197   GMNWRLSSWKSVDDPSTGDLTYGIELNEYPETVMRKGSKENYRAGPWNGLRYSGAPELKT  256

Query  1326  KEVIAFSFMRTKNEVYYSFEIHNKN-LFSRLIVNYTQ----LLERYTWIPENRIWNRFWN  1490
               + +F F    +EV Y +++ N N + SRL++N +      L+RYTW   +R W  F +
Sbjct  257   NLIFSFKFTWNNDEVSYMYQLLNDNSVISRLVLNQSTGNGGELQRYTWNTLSRNWQLFLS  316

Query  1491  APKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCFRYDELDC-PT  1667
              P+D CD+Y  CG++  CD + SPVC C  GFKP++   W+L D SGGC     L+C   
Sbjct  317   VPRDYCDSYGLCGAYSDCDMNESPVCQCLKGFKPKSPSDWNLMDWSGGCVHQASLNCRKG  376

Query  1668  DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGSGCVIWTAEL  1847
             +GF+     KLP++  ++VD  ++L +C+  C++NCSCTAY+N +IS GGSGC IW  +L
Sbjct  377   EGFVKFTGVKLPDTRYTWVDKNINLKDCEVECLKNCSCTAYANSDISGGGSGCAIWFGDL  436

Query  1848  FDIRQYT-AEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlgigmvlfgl  2024
              DIR+++   GGQ LY+R+AAS+     +         K K+VI+               
Sbjct  437   IDIRRFSNGGGGQDLYIRMAASELAHDSK---------KKKRVIMIVLT-----------  476

Query  2025  lllkrrklrrgVTENIEMRG-------TRERSRDPLMNATAISSKREHSGETMITDEYEL  2183
                        V   + + G        +E+S   +      + +R +  E+ I D  EL
Sbjct  477   -----------VVPGMLLLGWFGWYFYKKEKSEGKVER----NEERSYRDESNI-DNLEL  520

Query  2184  PIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFKNEL  2363
             P FDF  I  ATDNF++ NKLG+GGFG VYKG  V G+EIAVKRLSK+S QG +EFKNE+
Sbjct  521   PSFDFATIVKATDNFSDTNKLGEGGFGPVYKGKSVEGQEIAVKRLSKSSIQGLDEFKNEV  580

Query  2364  RLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNIICG  2543
              LI++LQHRNLVKLLGCC+  +E+MLIYEYM+NKSLDS +FD+KRS L+DW+ R +II G
Sbjct  581   ILISKLQHRNLVKLLGCCIQGEERMLIYEYMDNKSLDSFIFDEKRSKLMDWEMRLHIIMG  640

Query  2544  VARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKRIVG  2723
             +ARGLLYLHQDSR RIIHRDLKASN+LLD +M PKISDFG+AR+F  D+TEA  T+R+VG
Sbjct  641   IARGLLYLHQDSRLRIIHRDLKASNILLDSKMEPKISDFGLARIFARDQTEA-ETRRVVG  699

Query  2724  TYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLWGEG  2903
             TYGYMSPEYA+DGLFSVKSD +SFGV+VLE++SG+KN+GFY P  + NLLG AW L   G
Sbjct  700   TYGYMSPEYAIDGLFSVKSDVYSFGVIVLEIISGKKNRGFYHPEFQLNLLGHAWTLCNGG  759

Query  2904  RGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSLPQP  3083
             R  EL+D  +     +   D+V+RCI VGLLCVQ+  EDRP M++V+LML   G SLP+P
Sbjct  760   RAMELIDPSMGELGSA--TDEVVRCIHVGLLCVQQNTEDRPTMSSVVLML-SSGCSLPKP  816

Query  3084  KQPGFCLASKPVKM-DSSSTSYNDQSLNQLTVTMLDAR  3194
             +QPGF     PV   DSSS+         +++T+L+ R
Sbjct  817   QQPGFFAQRYPVMAPDSSSSKQESYITGDMSITLLEGR  854


 Score = 57.4 bits (137),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QHRNLV+LLGCCI+G E+MLI      KSLD+F+FD  +   ++W
Sbjct  587  QHRNLVKLLGCCIQGEERMLIYEYMDNKSLDSFIFDEKRSKLMDW  631



>dbj|BAA34231.1| SRK46Bra [Brassica rapa]
 dbj|BAE95180.1| S-locus receptor kinase [Brassica rapa]
Length=860

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/830 (50%), Positives = 562/830 (68%), Gaps = 27/830 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             ++TLVS G+VF+LGFF    +S   Y+GIWYK++  RT VWVANRD PL NS G LKI  
Sbjct  47    SRTLVSPGDVFELGFFKTTSSSR-WYLGIWYKKLPGRTYVWVANRDNPLSNSIGTLKIS-  104

Query  918   DGNIHLVDGTGNSIWSSSNT--NNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFD  1091
             + N+ ++D +  S+WS+++T  N +S+    VA+LL +GNF++R  N  +   +LWQSFD
Sbjct  105   NMNLVILDHSNKSVWSTNHTRGNERSL---VVAELLANGNFLMRDSNSNDAYGFLWQSFD  161

Query  1092  YPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLD-INGLPEAFLRNKDIII  1268
             YPTDTLLP MKLG+D K G NR ++SWRSP DPS G  ++KL+    LPE +L   D+  
Sbjct  162   YPTDTLLPEMKLGYDLKIGLNRSLTSWRSPDDPSSGYFSYKLEGSRRLPEFYLMQGDVRE  221

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             +RSG WNG+ F G+PE +    + ++F     EV Y+F + N  ++SRL ++    LER 
Sbjct  222   HRSGPWNGIQFIGIPEDQKSSYMMYNFTDNSEEVAYTFVMTNNGIYSRLKLSSDGYLERL  281

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TW P +  WN FW++P  QCD YR CG++  CD + SP C C  GF P+N+Q W LR   
Sbjct  282   TWAPSSGAWNVFWSSPNHQCDMYRMCGTYSYCDVNTSPSCNCIPGFNPKNRQQWDLRIPI  341

Query  1629  GGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
              GC R   L C  DGF  M   KLP+++ + VD +M + EC++ C+ +C+CTA++N +I 
Sbjct  342   SGCKRRTRLSCNGDGFTRMKNMKLPDTTMAIVDRSMGVKECEKRCLSDCNCTAFANADIR  401

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             NGG+GCVIWT EL D+R Y AEGGQ LYVR+AA+D      + +  NG  K   +I+   
Sbjct  402   NGGTGCVIWTGELEDMRNY-AEGGQELYVRLAAAD------LVKKRNGNWKIISLIVGVS  454

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
             +VL + ++L  +  L +RK  R       +   ++R+++ LMN    S+KR+ S E    
Sbjct  455   VVLLLLLLLLIMFCLWKRKQNRAKAMATSIVN-QQRNQNVLMNTMTQSNKRQLSRENK-A  512

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             DE+ELP+ +  A+  AT+NF+N N+LG+GGFG VYKGML  G+E+AVKRLSK S QG +E
Sbjct  513   DEFELPLIELEAVVKATENFSNCNELGRGGFGIVYKGML-DGQEVAVKRLSKTSLQGIDE  571

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             F NE+RLIARLQH NLV++LGCC++  EK+LIYEY+EN SLD  LF KKRSS L+WK R+
Sbjct  572   FMNEVRLIARLQHINLVRILGCCIEAGEKILIYEYLENSSLDYFLFGKKRSSNLNWKDRF  631

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
              I  GVARGLLYLHQDSRFRIIHRDLK  N+LLDK M PKISDFGMAR+F  DET+   T
Sbjct  632   AITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKISDFGMARIFARDETQV-RT  690

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
                VGTYGYMSPEYAM G+ S K+D FSFGV+VLE+V G++N+GFY  + E NL   AW 
Sbjct  691   DNAVGTYGYMSPEYAMYGVISEKTDVFSFGVIVLEIVIGKRNRGFYQVNPENNLPSYAWT  750

Query  2889  LWGEGRGSELLDSVI---ASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              W EGR  E++D VI    S   S F   +V++CIQ+GLLC+QE+AE RP M++V+ ML 
Sbjct  751   HWAEGRALEIVDPVILDSLSSLPSTFKPKEVLKCIQIGLLCIQERAEHRPTMSSVVWMLG  810

Query  3057  GKGTSLPQPKQPGFCL-ASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              + T +PQPK P +CL AS      SSS  ++D    ++N+ T +++DAR
Sbjct  811   SEATEIPQPKPPVYCLIASYYANNPSSSRQFDDDESWTVNKYTCSVIDAR  860


 Score = 53.9 bits (128),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QH NLVR+LGCCIE GEK+LI       SLD F+F   + + LNW
Sbjct  583  QHINLVRILGCCIEAGEKILIYEYLENSSLDYFLFGKKRSSNLNW  627



>dbj|BAF91378.1| S receptor kinase [Brassica rapa]
Length=860

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/830 (50%), Positives = 562/830 (68%), Gaps = 27/830 (3%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             ++TLVS G+VF+LGFF    +S   Y+GIWYK++  RT VWVANRD PL NS G LKI  
Sbjct  47    SRTLVSPGDVFELGFFKTTSSSR-WYLGIWYKKLPGRTYVWVANRDNPLSNSIGTLKIS-  104

Query  918   DGNIHLVDGTGNSIWSSSNT--NNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFD  1091
             + N+ ++D +  S+WS+++T  N +S+    VA+LL +GNF++R  N  +   +LWQSFD
Sbjct  105   NMNLVILDHSNKSVWSTNHTRGNERSL---VVAELLANGNFLMRDSNSNDAYGFLWQSFD  161

Query  1092  YPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLD-INGLPEAFLRNKDIII  1268
             YPTDTLLP MKLG+D K G NR ++SWRSP DPS G  ++KL+    LPE +L   D+  
Sbjct  162   YPTDTLLPEMKLGYDLKIGLNRSLTSWRSPDDPSSGYFSYKLEGSRRLPEFYLMQGDVRE  221

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             +RSG WNG+ F G+PE +    + ++F     EV Y+F + N  ++SRL ++    LER 
Sbjct  222   HRSGPWNGIQFIGIPEDQKSSYMMYNFTDNSEEVAYTFVMTNNGIYSRLKLSSDGYLERL  281

Query  1449  TWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGS  1628
             TW P +  WN FW++P  QCD YR CG++  CD + SP C C  GF P+N+Q W LR   
Sbjct  282   TWAPSSGAWNVFWSSPNHQCDMYRMCGTYSYCDVNTSPSCNCIPGFNPKNRQQWDLRIPI  341

Query  1629  GGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNIS  1808
              GC R   L C  DGF  M   KLP+++ + VD +M + EC++ C+ +C+CTA++N +I 
Sbjct  342   SGCKRRTRLSCNGDGFTRMKNMKLPDTTMAIVDRSMGVKECEKRCLSDCNCTAFANADIR  401

Query  1809  NGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACg  1988
             NGG+GCVIWT EL D+R Y AEGGQ LYVR+AA+D      + +  NG  K   +I+   
Sbjct  402   NGGTGCVIWTGELEDMRNY-AEGGQELYVRLAAAD------LVKKRNGNWKIISLIVGVS  454

Query  1989  ivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMIT  2168
             +VL + ++L  +  L +RK  R       +   ++R+++ LMN    S+KR+ S E    
Sbjct  455   VVLLLLLLLLIMFCLWKRKQNRAKAMATSIVN-QQRNQNVLMNTMTQSNKRQLSRENK-A  512

Query  2169  DEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEE  2348
             DE+ELP+ +  A+  AT+NF+N N+LG+GGFG VYKGML  G+E+AVKRLSK S QG +E
Sbjct  513   DEFELPLIELEAVVKATENFSNCNELGRGGFGIVYKGML-DGQEVAVKRLSKTSLQGIDE  571

Query  2349  FKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRY  2528
             F NE+RLIARLQH NLV++LGCC++  EK+LIYEY+EN SLD  LF KKRSS L+WK R+
Sbjct  572   FMNEVRLIARLQHINLVRILGCCIEAGEKILIYEYLENSSLDYFLFGKKRSSNLNWKDRF  631

Query  2529  NIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTT  2708
              I  GVARGLLYLHQDSRFRIIHRDLK  N+LLDK M PKISDFGMAR+F  DET+   T
Sbjct  632   AITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKISDFGMARIFARDETQV-RT  690

Query  2709  KRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWR  2888
                VGTYGYMSPEYAM G+ S K+D FSFGV+VLE+V G++N+GFY  + E NL   AW 
Sbjct  691   DNAVGTYGYMSPEYAMYGVISEKTDVFSFGVIVLEIVIGKRNRGFYQVNPENNLPSYAWT  750

Query  2889  LWGEGRGSELLDSVI---ASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLI  3056
              W EGR  E++D VI    S   S F   +V++CIQ+GLLC+QE+AE RP M++V+ ML 
Sbjct  751   HWAEGRALEIVDPVILDSLSSLPSTFKPKEVLKCIQIGLLCIQERAEHRPTMSSVVWMLG  810

Query  3057  GKGTSLPQPKQPGFCL-ASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
              + T +PQPK P +CL AS      SSS  ++D    ++N+ T +++DAR
Sbjct  811   SEATEIPQPKPPVYCLIASYYANNPSSSRQFDDDDSWTVNKYTCSVIDAR  860


 Score = 54.3 bits (129),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNW  118
            QH NLVR+LGCCIE GEK+LI       SLD F+F   + + LNW
Sbjct  583  QHINLVRILGCCIEAGEKILIYEYLENSSLDYFLFGKKRSSNLNW  627



>ref|XP_010324340.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Solanum lycopersicum]
Length=829

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/821 (49%), Positives = 539/821 (66%), Gaps = 34/821 (4%)
 Frame = +3

Query  744   TLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGEDG  923
             T+VS+   F+LGFFS G  S   YVGIWYK+    T VWVANR  P+ N  G LK+ + G
Sbjct  39    TIVSSRGTFELGFFSRGETSTNHYVGIWYKKTSATTPVWVANRLAPITNKYGVLKVFQPG  98

Query  924   NIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPTD  1103
              I LVD T   +WS   TN+     N VAQLLD+GNFVVR  ND NPEN+LWQSFDYP+D
Sbjct  99    LIVLVDDTNAIVWS---TNSSKSVQNPVAQLLDTGNFVVRDANDPNPENFLWQSFDYPSD  155

Query  1104  TLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSGG  1283
             TLL GMKLG D  TG  RY++SWRS  DP+ GD T+  D  G P+  +R +  + +R+G 
Sbjct  156   TLLEGMKLGTDLVTGLERYLTSWRSSDDPAPGDYTYHCDPAGYPQNLMRKRGNVTFRAGP  215

Query  1284  WNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIPE  1463
             WNG+ +SG P +    +I+F  +    E+YY +E+ NK++ S  ++       R  WI +
Sbjct  216   WNGIRWSGAPNLVNNSIISFGVVINSREIYYKYEMVNKSVISTFVLEPYGKAMRIIWIGK  275

Query  1464  NRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCFR  1643
              R W  + +A  D CD Y+ CG++G C+    P C C   F+P++   W   D S GC R
Sbjct  276   ARGWVNYHSAAVDDCDTYKLCGAYGTCNILSDPFCQCLDKFEPKHPDDWERSDWSSGCVR  335

Query  1644  YDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGGSG  1823
                L+C  DGF+  +  KLP++  S+ + TM+L EC+ +C+RNCSCTAY+N +I NGGSG
Sbjct  336   KIPLNCTGDGFIKYSGVKLPDTRNSWFNETMTLHECRVVCLRNCSCTAYTNLDIRNGGSG  395

Query  1824  CVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivlgi  2003
             C+IW  EL DIRQ  ++ GQ +Y+R++AS+         G  G  +   VILA  + L +
Sbjct  396   CLIWIDELIDIRQL-SQSGQDIYIRMSASEI--------GSAGSTRKITVILAIALPLLV  446

Query  2004  gmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAI---SSKREHSGETMITDE  2174
              ++L                    +   R+R  +P++  T I    S +  +   +  + 
Sbjct  447   ALILLA-------------LGLGLILCKRKRRENPVLTTTGILGGHSNKNDNSNQIHQEN  493

Query  2175  YELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEFK  2354
             +ELP+FD   +  AT+NF+ ANK+G+GGFG VYKG+L GG+E+AVKRLS+ S QG  EFK
Sbjct  494   FELPLFDLLTLTNATNNFSLANKIGEGGFGQVYKGVLEGGQEVAVKRLSETSEQGLHEFK  553

Query  2355  NELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYNI  2534
             NE++ IA+LQHRNLVKLLGCC+  +EKML+YEY+ NKSL+  +FD++R +LLDW +R+NI
Sbjct  554   NEVKCIAKLQHRNLVKLLGCCIQGEEKMLVYEYLPNKSLELYIFDEERRALLDWPKRFNI  613

Query  2535  ICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTKR  2714
             I G+ARGL+YLHQDSR RIIHRDLKASNVLLD EMNPKISDFGMAR F GDET A  T+R
Sbjct  614   INGIARGLMYLHQDSRLRIIHRDLKASNVLLDIEMNPKISDFGMARSFRGDETGA-NTRR  672

Query  2715  IVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRLW  2894
             +VGTYGYMSPEYA++G+FSVKSD FSFGVLVLE+VSG+KN+ F  P +  NLLG AW L 
Sbjct  673   VVGTYGYMSPEYAVEGIFSVKSDVFSFGVLVLEIVSGKKNRRFVHPDHHLNLLGHAWMLH  732

Query  2895  GEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTSL  3074
              E R  EL+D  +     S ++ +V+R + VGLLCVQ+  EDRPNM+ V++ML  +G  L
Sbjct  733   NEERMLELVDPYLVD---SYYISEVLRSVHVGLLCVQQNPEDRPNMSTVIMMLSNEGI-L  788

Query  3075  PQPKQPGFCLASKPVKMDSSS-TSYNDQSLNQLTVTMLDAR  3194
             P PK PGF    K   +D  S ++    S+N++T+T L+AR
Sbjct  789   PLPKHPGFFTERKVKDIDQFSWSTQTPSSINEITITQLNAR  829


 Score = 60.5 bits (145),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCCI+G EKML+      KSL+ ++FD  +RA L+W K
Sbjct  563  QHRNLVKLLGCCIQGEEKMLVYEYLPNKSLELYIFDEERRALLDWPK  609



>ref|XP_006370370.1| hypothetical protein POPTR_0001s42050g [Populus trichocarpa]
 gb|ERP66939.1| hypothetical protein POPTR_0001s42050g [Populus trichocarpa]
Length=799

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/821 (50%), Positives = 528/821 (64%), Gaps = 60/821 (7%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             +TLVS G  F+LGFF+P G S   Y+G+WYK+   +T+VWVANR  P+ N  G L +   
Sbjct  36    ETLVSTGGSFELGFFTPAG-STSRYLGLWYKK-SPQTVVWVANRGIPISNKFGTLNVTSQ  93

Query  921   GNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYPT  1100
             G + L++GT N +WSS   N  +   N VAQLLDSGN VVR  ND   +N+LWQSFDYP 
Sbjct  94    GILVLLNGTNNIVWSS---NTSTTAQNPVAQLLDSGNLVVRDGNDNKADNFLWQSFDYPC  150

Query  1101  DTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRSG  1280
             DTLLPGMKLG +  TG NR++SSW+   +P+ G  T  +D+ G P+  LR +  I+YR G
Sbjct  151   DTLLPGMKLGSNLVTGLNRFLSSWKGKENPAPGQFTLGIDVQGYPQLILRKETRIMYRVG  210

Query  1281  GWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTWIP  1460
              WNG  F+G PE++P  +  F F+  +NEVY+ FE+ N             L++ +TW  
Sbjct  211   SWNGQYFTGFPELKPDPIYTFEFVFNRNEVYFKFELQN------------SLVQLFTWSH  258

Query  1461  ENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGGCF  1640
             +   W  F  A  D+C+NY  CG+   CD++ SPVC C  GF  ++   W+ ++ +GGC 
Sbjct  259   QTNDWYVFATAVVDRCENYALCGANARCDSNSSPVCDCLDGFIHKSPTEWNSQNWTGGCI  318

Query  1641  RYDELDCP-TDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISNGG  1817
             R   LDC   DGF S    KLP++S+S+ D + SL EC+ +C++NCSC AY+N +    G
Sbjct  319   RRTPLDCTDKDGFQSYTGVKLPDTSSSWYDDSFSLVECEGLCIQNCSCFAYANLDFRGRG  378

Query  1818  SGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgivl  1997
             SGC+ W  +L D R+  AEGGQ +Y+R+AAS +  TGE  R      KT   ++      
Sbjct  379   SGCLRWFGDLIDTRRL-AEGGQDIYIRLAASQSGVTGEKKRKK----KTHAGVIG-----  428

Query  1998  gigmvlfgllllkrrklrrgVTENIEMRGTR--ERSRDPLMNATAISSKREHSGETMITD  2171
                                 +  +I + G     R R    N      K E         
Sbjct  429   ----------------GAVILGSSILILGIVFCIRRRKHRKNGNFEDRKEE---------  463

Query  2172  EYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEF  2351
             E ELP+ D   I  ATDNF+++ KLG+GGFG+VYKG L+ G+EIAVKRLSK+S QG  EF
Sbjct  464   EMELPMLDLTTIEHATDNFSSSKKLGEGGFGAVYKGELIEGQEIAVKRLSKSSGQGLNEF  523

Query  2352  KNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYN  2531
             KNE+ LIA+LQHRNLVKLLGCC+  DEKMLIYEYM N+SLDS +FD  R   LDW +R +
Sbjct  524   KNEVLLIAKLQHRNLVKLLGCCIHEDEKMLIYEYMPNRSLDSFIFDPTRRKFLDWSKRTH  583

Query  2532  IICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTK  2711
             II G+ARGLLYLHQDSR RIIHRD+KASN+LLD E+NPKISDFG+AR+FGGD+TEA  TK
Sbjct  584   IIDGIARGLLYLHQDSRLRIIHRDIKASNILLDNELNPKISDFGLARMFGGDQTEA-NTK  642

Query  2712  RIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRL  2891
             R+VGTYGYMSPEYA+DG FSVKSD FSFGVLVLE+VSG+KN+GF  P   +NLLG AW L
Sbjct  643   RVVGTYGYMSPEYALDGHFSVKSDVFSFGVLVLEIVSGKKNRGFCHPDYNQNLLGHAWML  702

Query  2892  WGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTS  3071
             W  G   EL+D   A         + +RCI V LLCVQ++ EDRPNM++V+LML G    
Sbjct  703   WFNGIPLELIDECFADSCTPS---EALRCIHVALLCVQQRPEDRPNMSSVVLML-GSENP  758

Query  3072  LPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             LPQPKQPGF + S P + D+SS  +   S N++TVT+L AR
Sbjct  759   LPQPKQPGFFMGSNPPEKDTSSNKHQSHSANEVTVTLLQAR  799


 Score = 64.3 bits (155),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCCI   EKMLI      +SLD+F+FDPT+R  L+W K
Sbjct  534  QHRNLVKLLGCCIHEDEKMLIYEYMPNRSLDSFIFDPTRRKFLDWSK  580



>ref|XP_011095279.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Sesamum indicum]
Length=788

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/824 (50%), Positives = 545/824 (66%), Gaps = 47/824 (6%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTG-FL  905
             +T   TL+S+   F+LGFFSP  NS   YVGIWYK++   T+VWVANRD PL N++G  L
Sbjct  10    ITDGHTLISSDGSFELGFFSPA-NSKNRYVGIWYKKVTAFTVVWVANRDNPLTNTSGAVL  68

Query  906   KIGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQS  1085
             K+ E G + L++G+ + IWSS   N   V    VAQLLDSGN VV+  ND+N + YLWQS
Sbjct  69    KVIEPGILALLNGSNSMIWSS---NTSGVARTPVAQLLDSGNLVVKEANDDNSDKYLWQS  125

Query  1086  FDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDII  1265
             FDYPTDTLLPGMKLG +  TG   YI++W+S  DP  GD  + LD  G P+A L  + + 
Sbjct  126   FDYPTDTLLPGMKLGRNFVTGYETYITAWKSSEDPGTGDYAYHLDPTGYPQAVLTRRSVE  185

Query  1266  IYRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLER  1445
             ++RSG WNGV +SG+P ++   +  F  +  KNE YY +E+ NK++FSRL VN + + +R
Sbjct  186   LFRSGPWNGVGYSGLPSLKNNSIYTFELVFNKNEAYYHYELLNKSVFSRLSVNQSGVAQR  245

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             +TW+   + W     AP D CD+Y++CG++G C+   SP+CGC   F PRN   W   D 
Sbjct  246   WTWVDRTQGWIMHLTAPVDNCDSYKQCGAYGTCNIYDSPICGCLTKFIPRNPDEWMAADW  305

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
             S GC R   LDC +DGF      KLP++  S+ + +M+L+EC+   +++C+CTAY+N +I
Sbjct  306   SDGCVRRAPLDCRSDGFQKYTDIKLPDTKYSWFNTSMTLEECQVEYIKDCNCTAYTNLDI  365

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILAC  1985
               GGSGC++W  +L DI+      GQ LY+RVA+S+ +  GE           K+  L  
Sbjct  366   RRGGSGCLLWFGDLVDIKVVYG-AGQDLYIRVASSEVDSNGE-----------KRKTLIA  413

Query  1986  givlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMI  2165
              +    G+ L GL L+      +   EN+  +G RE   + L                  
Sbjct  414   VLTSLAGISLLGLSLILFIWKMKKNYENMRKQGHREGQEEDL------------------  455

Query  2166  TDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAE  2345
                 ELP FD  AI  AT++FA + KLG+GGFG VY+GML  G+EIAVKRLS+ S QG +
Sbjct  456   ----ELPTFDLLAITRATNSFATSYKLGEGGFGPVYRGMLEDGKEIAVKRLSRTSLQGLD  511

Query  2346  EFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRR  2525
             EFKNE+  IA LQHRNLV+LLGCC+  +EKMLIYEYM N SLD ILFDK++S  LDW +R
Sbjct  512   EFKNEVICIANLQHRNLVRLLGCCIQGEEKMLIYEYMPNGSLDLILFDKRKSKQLDWPKR  571

Query  2526  YNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGT  2705
             ++II G+ARGLLYLHQDS  RIIHRDLKASN+LLD +MNPKISDFGMAR F G+ETEA T
Sbjct  572   FHIINGIARGLLYLHQDSLLRIIHRDLKASNILLDADMNPKISDFGMARSFAGNETEANT  631

Query  2706  TKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAW  2885
               R+VGTYGYMSPEYA+DGLFSVKSD +SFGVLVLE+VSG+KN+GF    ++ NLLG AW
Sbjct  632   M-RVVGTYGYMSPEYAIDGLFSVKSDVYSFGVLVLEIVSGQKNRGFRHKDHQHNLLGHAW  690

Query  2886  RLWGEGRGSELLD-SVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGK  3062
                 E R  +L+D +++ S + SE    V+R I V LLCVQ+  EDRP+M++V+LML  +
Sbjct  691   MQHKERRSMDLVDVNLVGSFTFSE----VVRSIHVALLCVQQSPEDRPSMSSVVLMLGSE  746

Query  3063  GTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             GT LPQPKQPGF    + V    S+TS    S N +T+T+LDAR
Sbjct  747   GT-LPQPKQPGF-FTERDVFAAESTTSTKASSSNNVTITLLDAR  788


 Score = 58.5 bits (140),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCCI+G EKMLI       SLD  +FD  K  +L+W K
Sbjct  524  QHRNLVRLLGCCIQGEEKMLIYEYMPNGSLDLILFDKRKSKQLDWPK  570



>dbj|BAA07577.2| receptor protein kinase SRK12 [Brassica rapa subsp. oleifera]
Length=856

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/829 (50%), Positives = 551/829 (66%), Gaps = 30/829 (4%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TLVS G VF+LGFF    NS   Y+GIWYK + DRT VWVANRD  L N+ G LK   
Sbjct  48    NRTLVSPGHVFELGFFKNTLNSR-WYLGIWYKNLSDRTYVWVANRDSSLSNAIGTLKFS-  105

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
               N+ L   +   +WS++ T  N+  P   VA+LL +GNFV+R   + +   +LWQSFD+
Sbjct  106   GSNLVLRGRSNKFVWSTNLTRGNERSP--VVAELLANGNFVIRYSYNNDASGFLWQSFDF  163

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PTDTLLP MKLG+  KTG NR+++SWR+  DPS G+ ++KL+   LPE +L        R
Sbjct  164   PTDTLLPEMKLGYYLKTGLNRFLTSWRNFDDPSSGEFSYKLETRRLPEFYLLKNGSPGQR  223

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             SG WNGV FSG+PE +    + ++F     EV Y+F + + +++SR+ ++   LLER TW
Sbjct  224   SGPWNGVQFSGIPEDQTLSYMVYNFTENSEEVAYTFRMTDNSIYSRIQLSPEGLLERLTW  283

Query  1455  IPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
              P +  WN FW+AP D QCD Y  CG +  CD + SPVC C  GF P + Q W+LRDG+G
Sbjct  284   TPTSGTWNLFWSAPVDIQCDVYMTCGPYAYCDVNTSPVCNCIQGFMPFDMQQWALRDGTG  343

Query  1632  GCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             GC R   L C +DGF  M   KLP++  + VD ++ + EC++ C+ +C+CTA++N +I N
Sbjct  344   GCIRRTRLSCSSDGFTRMKNMKLPDTKMAIVDRSIDVKECEKRCLSDCNCTAFANADIRN  403

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgi  1991
             GG+GCV WT EL DIR Y    GQ LYVR+AA+D  +     R  NG  K   +I+   +
Sbjct  404   GGTGCVTWTGELEDIRNYIG-NGQDLYVRLAAADLVK----KRKANG--KIISLIVGVSV  456

Query  1992  vlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITD  2171
             +L + M         R K      +N      ++R+++ LMN    S+KR+ S E   T+
Sbjct  457   LLLLIMFCLWKRKKNRAKASATSIDN------QQRNQNVLMNGMTQSNKRQLSRENK-TE  509

Query  2172  EYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEF  2351
             E+ELP+ +  A+  AT+NF+N N+LGQGGFG VYKGML  G+E+AVKRLSK S QG +EF
Sbjct  510   EFELPLIELEAVVKATENFSNCNELGQGGFGIVYKGML-DGQEVAVKRLSKTSLQGIDEF  568

Query  2352  KNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYN  2531
              NE+RLIARLQH NLV++LGCC++ DEK+LIYEY+EN SLD  LF KKRSS L+WK R+ 
Sbjct  569   MNEVRLIARLQHINLVRILGCCIEADEKILIYEYLENSSLDYFLFGKKRSSNLNWKDRFA  628

Query  2532  IICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTK  2711
             I  GVARGLLYLHQDSRFRIIHRDLK  N+LLDK M PKISDFGMAR+F  DE +A  T 
Sbjct  629   ITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKISDFGMARIFARDEIQA-RTD  687

Query  2712  RIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRL  2891
               VGTYGYMSPEYAMDG+ S K+D FSFGV+VLE+VSG++N+GFY  + E NL    W  
Sbjct  688   NAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRNRGFYQVNPENNLPSYVWTH  747

Query  2892  WGEGRGSELLDSVI---ASESHSEF-VDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             W EGR  E++D VI    S   S F   +V++CIQ+GLLC+QE+AE RP M++V+ ML  
Sbjct  748   WAEGRALEIVDPVILDSLSSLPSTFKPKEVLKCIQIGLLCIQERAEHRPTMSSVVWMLGS  807

Query  3060  KGTSLPQPKQPGFCL-ASKPVKMDSSSTSYNDQ---SLNQLTVTMLDAR  3194
             + T +PQPK P +CL AS      SSS  ++D    ++N+ T +++DAR
Sbjct  808   EATEIPQPKPPVYCLIASYYANNPSSSRQFDDDESWTVNKYTCSVIDAR  856



>dbj|BAF91401.1| S-locus receptor kinase [Brassica oleracea]
Length=849

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/833 (49%), Positives = 550/833 (66%), Gaps = 39/833 (5%)
 Frame = +3

Query  738   NQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGE  917
             N+TL S G+VF+LGFF    +S   Y+GIWYK++ DRT VWVANRD PL +S G LKI  
Sbjct  42    NRTLASPGDVFELGFFRTNSSSP-WYLGIWYKKVSDRTYVWVANRDNPLSSSIGTLKISG  100

Query  918   DGNIHLVDGTGNSIWSSSNTN-NQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDY  1094
             + N+ ++D +  S+WS++ T  N+  P   VA+LL +GNFV+R  N+ +   +LWQSFD+
Sbjct  101   N-NLVILDHSNKSVWSTNLTRGNERSP--VVAELLANGNFVMRDSNNNDASGFLWQSFDF  157

Query  1095  PTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYR  1274
             PTDTLLP MKL +D KTG NR+++S RS  DPS GD ++KL+   LPE +L +   ++YR
Sbjct  158   PTDTLLPEMKLSYDLKTGLNRFLTSRRSSDDPSSGDFSYKLEPRRLPEFYLSSGVFLLYR  217

Query  1275  SGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERYTW  1454
             SG WNG+ FSG+P+ +    + ++F     EV Y+F++ N + +SRL +N+   +ER TW
Sbjct  218   SGPWNGIRFSGLPDDQKLSYLVYNFTENNEEVAYTFQMTNNSFYSRLTLNFLGYIERQTW  277

Query  1455  IPENRIWNRFWNAPKD-QCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSG  1631
              P   +WNRFW  P D QCD YR CG +  CD + SP+C C  GF P N + W  R  + 
Sbjct  278   NPSLGMWNRFWAFPLDSQCDTYRACGPYSYCDLNTSPICNCIQGFNPSNVEQWDQRVWAN  337

Query  1632  GCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             GC R   L C  DGF  +   KLPE++ + VD ++ + EC++ C+ +C+CTA++N +I N
Sbjct  338   GCMRRTRLSCSGDGFTRIKNMKLPETTMAIVDRSIGVKECEKRCLNDCNCTAFANADIRN  397

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDA----EQTGEVARGGNGFGKTKKVIL  1979
             GG+GCVIWT  L D+R Y A  GQ LYVR+AA D     +   ++     G      +I+
Sbjct  398   GGTGCVIWTGRLDDMRNYAA-AGQDLYVRLAAGDLVTKRDANWKIISLTVGVSVLLLLIM  456

Query  1980  ACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGET  2159
              C                           +IE    R+R+++  MN   +S+KRE  GE 
Sbjct  457   FCLWKRKQKQAK---------------ATSIE---NRQRNQNLPMNGMVLSTKREFPGEK  498

Query  2160  MITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
              I +     I     +  AT+NF++ NKLGQGGFG VYKG L+ G+E+AVKRLSK S QG
Sbjct  499   KIEELELPLIELETVVK-ATENFSDCNKLGQGGFGLVYKGRLLDGQEVAVKRLSKTSVQG  557

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
              +EF NE+ LIARLQH NLV+++GCC++ DEKMLIYEY+EN SLD  LF K R S L+WK
Sbjct  558   TDEFMNEVTLIARLQHINLVQIIGCCIEADEKMLIYEYLENLSLDCYLFGKTRRSKLNWK  617

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
              R++II GVARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  DETEA
Sbjct  618   ERFDIINGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA  677

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
              T K +VGTYGYMSPEYAM G+FS KSD FSFGV+VLE+VSG+KN GFY  + E +LL  
Sbjct  678   NTMK-VVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVSGKKNSGFYKLNCENDLLSY  736

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFV----DQVMRCIQVGLLCVQEKAEDRPNMAAVML  3047
             AW  W EGR  E++D VI   S S  +     +V++CIQ+GLLCVQE+AE RP M++V+ 
Sbjct  737   AWSHWKEGRALEIIDPVIVDSSPSLPLTSQPQEVLKCIQIGLLCVQERAEHRPTMSSVVW  796

Query  3048  MLIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ----SLNQLTVTMLDAR  3194
             ML  + T +PQPK PG+C+   P ++D SS+   ++    ++NQ T +++DAR
Sbjct  797   MLGSEATEIPQPKPPGYCIQRIPYELDPSSSRQCNEDESWTVNQYTCSLIDAR  849



>gb|AAA62232.1| S-receptor kinase [Brassica napus]
Length=849

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/832 (49%), Positives = 533/832 (64%), Gaps = 36/832 (4%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             ++ N+TLVS G+VF+LGFF         Y+G+WYK++  RT VWVANRD PL NS G LK
Sbjct  44    ISSNRTLVSPGDVFELGFFETNSR---WYLGMWYKKLPFRTYVWVANRDNPLSNSIGTLK  100

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I  + N+ ++  +  S+WS++ T         VA+LL +GNFV+R  N+ +   +LWQSF
Sbjct  101   ISGN-NLVILGHSNKSVWSTNLTRGID-RSTVVAELLANGNFVMRDSNNNDASQFLWQSF  158

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             DYPTDTLLP MKLG D KTG NR+++SWRS  DPS G+  ++L+   LPE +L       
Sbjct  159   DYPTDTLLPEMKLGNDLKTGLNRFLTSWRSSDDPSSGEFLYELETGRLPEFYLSKGIFPA  218

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLLERY  1448
             YRSG WNG+ FSG+P+ +    + ++F     EV Y+F + N +++S+L V+ +   ER 
Sbjct  219   YRSGPWNGIRFSGIPDDQKLSYLVYNFTENSEEVVYTFRMTNNSIYSKLTVSLSGYFERQ  278

Query  1449  TWIPENRIWNRFWNAP-KDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             TW     +WN  W+ P   QCD YR CG +  CD   SP+C C  GF P N Q W  R  
Sbjct  279   TWNASLGMWNVSWSLPLPSQCDTYRRCGPYAYCDVSTSPICNCIQGFNPSNVQQWDQRSW  338

Query  1626  SGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNI  1805
             SGGC R   L C  DGF  M   +LPE++ + VD ++ + ECK+ C+ +C+CTA++N ++
Sbjct  339   SGGCIRRTRLSCSGDGFTRMENMELPETTMAIVDRSIGVKECKKRCLSDCNCTAFANADV  398

Query  1806  SNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQ----TGEVARGGNGFGKTKKV  1973
              NGG+GC+IW  EL DIR Y A+G Q LYVR+AA+D  +     G++     G      +
Sbjct  399   QNGGTGCIIWAGELEDIRNYAADG-QDLYVRLAAADLVKRRNANGQIISLTVGVSVLLLL  457

Query  1974  ILACgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSG  2153
             I+ C                           N      R+R+++  MN   +SSKRE   
Sbjct  458   IMFCLWKRKQKR----------------ANANATSIANRQRNQNLPMNGMVLSSKREFLE  501

Query  2154  ETMITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSR  2333
             E  I +     I     +  AT+NF+N NKLGQGGFG VYKG L+ G+EIAVKRLSK S 
Sbjct  502   EKKIEELELPLIELETVVK-ATENFSNCNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSV  560

Query  2334  QGAEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLD  2513
             QG +EF NE+ LIARLQH NLV+++GCC++ DEKML+YEY+EN SLDS LF K R S L+
Sbjct  561   QGTDEFMNEVTLIARLQHINLVQIIGCCIEADEKMLVYEYLENLSLDSYLFGKTRRSKLN  620

Query  2514  WKRRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDET  2693
             WK R++II GVARGLLYLHQDSRFRIIHRDLK SN+LLDK M PKISDFGMAR+F  DET
Sbjct  621   WKERFDIINGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMTPKISDFGMARIFARDET  680

Query  2694  EAGTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLL  2873
             EA T K +VGTYGYMSPEYAM  +FS KSD FSFGV+VLE+VSG+KN   Y  + + NLL
Sbjct  681   EANTVK-VVGTYGYMSPEYAMHEIFSEKSDVFSFGVIVLEIVSGKKNS--YNLNYKNNLL  737

Query  2874  GLAWRLWGEGRGSELLDSVIASESHSEFVDQ-VMRCIQVGLLCVQEKAEDRPNMAAVMLM  3050
               AW  W EGR  E++D VI     S F  Q V++CIQ+GLLCVQE AE RP M++V+ M
Sbjct  738   SYAWSQWEEGRALEIIDPVIVDSLPSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVWM  797

Query  3051  LIGKGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQ----SLNQLTVTMLDAR  3194
             L  +   +PQPKQPG C+   P  +D SS+S  D     ++NQ T +++DAR
Sbjct  798   LGSEAKEIPQPKQPGHCIGRSPYDLDPSSSSQCDDDESWTVNQYTCSLVDAR  849


 Score = 54.7 bits (130),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 6/45 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLIK------SLDTFMFDPTKRARLNW  118
            QH NLV+++GCCIE  EKML+       SLD+++F  T+R++LNW
Sbjct  577  QHINLVQIIGCCIEADEKMLVYEYLENLSLDSYLFGKTRRSKLNW  621



>ref|XP_007021377.1| S-locus lectin protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY12902.1| S-locus lectin protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=815

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/825 (49%), Positives = 544/825 (66%), Gaps = 42/825 (5%)
 Frame = +3

Query  729   LTLNQTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLK  908
             LT   TLVS    F LGFF+PG +S   Y+GIWY  I  + +VWVANR  P+ ++TG LK
Sbjct  30    LTDGMTLVSNDGSFALGFFNPG-SSENRYLGIWYNNIPMQNVVWVANRITPINDTTGLLK  88

Query  909   IGEDGNIHLVDGTGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSF  1088
             I   G + L+     ++WS    N+     N + QLLDSGN VVR  ND N ENYLWQSF
Sbjct  89    IESTGRVVLLGQNQTTVWS---INSTKAAQNPILQLLDSGNLVVRDGNDGNSENYLWQSF  145

Query  1089  DYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIII  1268
             D+PTDT+LPGMK+GWD +TG NR +++W++  DPS GD+T+ +++ G PE  +R      
Sbjct  146   DHPTDTMLPGMKIGWDLRTGLNRRLAAWKNSDDPSPGDLTYGVELQGNPEMVIRKGSEKY  205

Query  1269  YRSGGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQ-LLER  1445
             YRSG WNG  FSG P +    V  + F+  + EVYY + + NK++ SR ++N T+ + +R
Sbjct  206   YRSGLWNGDGFSGTPNLRSNPVFDYDFVWNEEEVYYIYYLKNKSVMSRFVLNQTESVRQR  265

Query  1446  YTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDG  1625
             YTW PE + W  F   P D CD    CG+ G CD    P C C   F+P++ + W+  D 
Sbjct  266   YTWNPETQTWKLFSIMPSDYCDRRGLCGANGNCDNSKLPACQCLKAFRPKSLEKWNSSDW  325

Query  1626  SGGCFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYN  1802
             S GC     L+C + DGFL +   K P++S S+V+ TM+L EC+  C++NCSC AY+N +
Sbjct  326   SDGCVHNKPLNCQSGDGFLRIGRVKTPDTSLSWVNKTMNLKECRARCLQNCSCMAYTNAD  385

Query  1803  ISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILA  1982
             I  GGSGC +W  +L DI+Q+ +  GQ LY+RV+AS+AE              T+K  LA
Sbjct  386   IRGGGSGCAMWFDDLIDIKQFQS-FGQDLYIRVSASEAE-----------LKNTRKAKLA  433

Query  1983  CgivlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETM  2162
               I   I + L              +     +R  R + +D       +  ++E+  +  
Sbjct  434   VIIATPIALFLGI------------LVAIYYVRRRRRKLKD------EVDERKENDQKNQ  475

Query  2163  -ITDEYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQG  2339
               T++ +L +F+   IA ATD+F+  NKLG+GGFG VYKG L  G+EIAVKRLSK+S QG
Sbjct  476   GRTEDMDLAVFELGTIARATDSFSFNNKLGEGGFGPVYKGTLANGQEIAVKRLSKSSGQG  535

Query  2340  AEEFKNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWK  2519
               EFK E++LIA+LQHRNLV+LLGCC+  +EKML+YEYM N+SLDS +FD++R  +LDW 
Sbjct  536   LNEFKTEVKLIAKLQHRNLVRLLGCCIHGEEKMLVYEYMPNRSLDSFIFDQRRCKVLDWP  595

Query  2520  RRYNIICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEA  2699
             +R+ IICG+ARGLLYLHQDSR RIIHRDLKASNVLLD EMNPKISDFGMAR FGGD+TEA
Sbjct  596   KRFQIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDSEMNPKISDFGMARTFGGDQTEA  655

Query  2700  GTTKRIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGL  2879
               T R+VGTYGYM+PEYA+DGLFSVKSD FSFG+L+LE++SGRKN+GFY  +   NL+  
Sbjct  656   -NTNRVVGTYGYMAPEYAIDGLFSVKSDVFSFGILLLEIISGRKNRGFYHQNQSGNLIEH  714

Query  2880  AWRLWGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIG  3059
             AWRLW EG+   L D ++A       + QV+RCI + LLCVQ+  E+RP+M++V+LML G
Sbjct  715   AWRLWKEGKPLNLADDLLAETGS---LSQVLRCIHISLLCVQQHPEERPSMSSVVLML-G  770

Query  3060  KGTSLPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
                 LP PKQPGF   + P + +SSS ++   S N++++++LDAR
Sbjct  771   SENELPLPKQPGFLFHNSPFEAESSSGNHGSSSRNEISLSLLDAR  815


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLVRLLGCCI G EKML+      +SLD+F+FD  +   L+W K
Sbjct  550  QHRNLVRLLGCCIHGEEKMLVYEYMPNRSLDSFIFDQRRCKVLDWPK  596



>ref|XP_011012090.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=824

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/821 (49%), Positives = 544/821 (66%), Gaps = 37/821 (5%)
 Frame = +3

Query  741   QTLVSAGEVFQLGFFSPGGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNSTGFLKIGED  920
             +TLVS    F+LGFFSPG  S   Y+GIWYK I DRT VWVANR  P+ +S+  LKI + 
Sbjct  38    KTLVSRDGTFELGFFSPGF-SNNRYLGIWYKIIPDRTTVWVANRLHPINDSSSLLKIDDT  96

Query  921   GNIHLVDGTGN-SIWSSSNTNNQSVPGNTVAQLLDSGNFVVRRENDENPENYLWQSFDYP  1097
             GN+ ++    +  +WSS+ T     P   + QLLDSGN V+R +ND N    LWQSFDYP
Sbjct  97    GNLVILRNNSDIVVWSSNTTIKAQSP---ILQLLDSGNLVLRDKNDGN-NGILWQSFDYP  152

Query  1098  TDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLPEAFLRNKDIIIYRS  1277
              DT+LPGMKLGWD +TG +RY+SSW+S  DPS GD T+ +   G PE          YRS
Sbjct  153   CDTMLPGMKLGWDLRTGFDRYLSSWKSLDDPSPGDFTWGVQPEGNPEMVSWKGSSKYYRS  212

Query  1278  GGWNGVAFSGVPEMEPKEVIAFSFMRTKNEVYYSFEIHNKNLFSRLIVNYTQLL-ERYTW  1454
             G WNG+ FSG PE+ P    +FSF+    E+YY++ ++NK++ +R+++N T    +RY W
Sbjct  213   GPWNGIGFSGAPEIRPNPFFSFSFISNDKELYYTYNLNNKSIITRIVLNQTTYHRQRYIW  272

Query  1455  IPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPVGFKPRNQQAWSLRDGSGG  1634
               E R W  + + P+D CDNY  CG+ G C T   PVC C   FKP++ +AW+  D S G
Sbjct  273   SEETRSWILYVSVPRDYCDNYGLCGANGKCITSAMPVCQCLEKFKPKSPEAWNTMDWSHG  332

Query  1635  CFRYDELDCPT-DGFLSMNYTKLPESSTSFVDATMSLDECKEMCVRNCSCTAYSNYNISN  1811
             C R  EL+C   DGF+  +  KLP++   +V+ TM+L EC+  C++NCSCTAY+N++I  
Sbjct  333   CKRNKELECHNGDGFIKFDGLKLPDAKDCWVNKTMNLKECRAKCLQNCSCTAYTNFDIRG  392

Query  1812  GGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVARGGNGFGKTKKVILACgi  1991
             GGSGC IW  +L DIRQ  A GGQ LY+RV AS      E+A       K K  I     
Sbjct  393   GGSGCAIWFGDLMDIRQVLA-GGQELYIRVLAS------EIADREEAKAKPKMKIAVITT  445

Query  1992  vlgigmvlfgllllkrrklrrgVTENIEMRGTRERSRDPLMNATAISSKREHSGETMITD  2171
                  ++               +  +  +  ++ +  D + N      K +H  +    +
Sbjct  446   ATIFVVLGI-------------LAASYCLWKSKAKCSDRMENY----RKNDHEIDDGQKE  488

Query  2172  EYELPIFDFNAIAMATDNFANANKLGQGGFGSVYKGMLVGGEEIAVKRLSKNSRQGAEEF  2351
             + ELP F+F A+A AT+NF+  NKLG+GG+G VY GML  G+EIAVKRLS++S QG  E 
Sbjct  489   DLELPHFEFTAVANATNNFSINNKLGEGGYGPVYGGMLEDGQEIAVKRLSRSSGQGLNEV  548

Query  2352  KNELRLIARLQHRNLVKLLGCCVDIDEKMLIYEYMENKSLDSILFDKKRSSLLDWKRRYN  2531
             KNE+ L+ +LQHRNLVKLLGCC+  +EKMLIYEYM N+SLDS +FD+ +  LL W RR+N
Sbjct  549   KNEVILMKKLQHRNLVKLLGCCIQREEKMLIYEYMPNRSLDSFIFDQAKGKLLGWSRRFN  608

Query  2532  IICGVARGLLYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARLFGGDETEAGTTK  2711
             IICG ARGLLYLHQDSR+RI+HRDLKASNVLLD +MNPKISDFG+AR+F   +TE G T 
Sbjct  609   IICGTARGLLYLHQDSRWRIVHRDLKASNVLLDNDMNPKISDFGLARMFVAGQTE-GETS  667

Query  2712  RIVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEVVSGRKNQGFYTPSNEENLLGLAWRL  2891
             +++GTYGYM+PEYA DGLFSVKSD FSFG+L+LE++SG+K++GFY P N ++L+G AWRL
Sbjct  668   KVIGTYGYMAPEYATDGLFSVKSDVFSFGILLLEIISGKKSRGFYHPDNSQSLIGHAWRL  727

Query  2892  WGEGRGSELLDSVIASESHSEFVDQVMRCIQVGLLCVQEKAEDRPNMAAVMLMLIGKGTS  3071
             W EG+  +L+DS +  ESH+    +VMRCI V LLCVQ+  +DRP MA+V+ ML G+  +
Sbjct  728   WNEGKALDLIDS-LRDESHNP--SEVMRCIHVSLLCVQQHPDDRPCMASVVWMLGGE-RA  783

Query  3072  LPQPKQPGFCLASKPVKMDSSSTSYNDQSLNQLTVTMLDAR  3194
             LP+PK+PGF     P +   +S+++   S N++T ++L+ R
Sbjct  784   LPKPKEPGFLNHRSPHESSFTSSNFGLSSTNKITASLLEPR  824


 Score = 55.1 bits (131),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 6/47 (13%)
 Frame = +2

Query  2    QHRNLVRLLGCCIEGGEKMLI------KSLDTFMFDPTKRARLNWGK  124
            QHRNLV+LLGCCI+  EKMLI      +SLD+F+FD  K   L W +
Sbjct  559  QHRNLVKLLGCCIQREEKMLIYEYMPNRSLDSFIFDQAKGKLLGWSR  605



>dbj|BAC80024.1| putative receptor protein kinase [Oryza sativa Japonica Group]
 dbj|BAD30704.1| putative receptor protein kinase [Oryza sativa Japonica Group]
Length=860

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/841 (48%), Positives = 553/841 (66%), Gaps = 30/841 (4%)
 Frame = +3

Query  720   NPPLTLNQTLVSAGEVFQLGFFSP-GGNSGGLYVGIWYKEIRDRTIVWVANRDKPLRNST  896
             N  L   Q LVSAG VF+LGFF+P G  +   ++GIWY++I   T+VWVANRD P+  + 
Sbjct  34    NSSLADGQKLVSAGGVFELGFFTPPGSTTAARFLGIWYRDIDPPTVVWVANRDAPVSGTA  93

Query  897   GFLKIGEDGNIHLVDG-------TGNSIWSSSNTNNQSVPGNTVAQLLDSGNFVVRREND  1055
             G L +  +G      G       +G  +WSS+  +N +      A+LLDSGNFV+     
Sbjct  94    GSLAVVVNGGGGGGGGRLVLGDGSGRVVWSSA-PSNVTASDPVAARLLDSGNFVL--AGG  150

Query  1056  ENPENYLWQSFDYPTDTLLPGMKLGWDSKTGRNRYISSWRSPTDPSEGDITFKLDINGLP  1235
                 + +WQSFDYP+DTLLPGMK GWD  TG +RY+++WRS  DPS GD TFK+D  G P
Sbjct  151   GGSGDVIWQSFDYPSDTLLPGMKFGWDLTTGLDRYLTTWRSAGDPSPGDYTFKIDPRGAP  210

Query  1236  EAFL-RNKDIIIYRSGGWNGVAFSGVPEMEPKEV-IAFSFMRTKNEVYYSFEIHNKN---  1400
             E F+  N    +YR+G W+G+ FSG PEMEP      F F+  + +VYY+F +       
Sbjct  211   EGFIWYNGTSPVYRNGPWDGLQFSGEPEMEPNNTSFRFEFVANRTDVYYTFVVDGGGGGG  270

Query  1401  LFSRLIVNYTQLLERYTWIPENRIWNRFWNAPKDQCDNYRECGSFGICDTDMSPVCGCPV  1580
             + SR ++N +   +RY W+P+   W+ +W+ P+DQCD Y  CG++G+CD   + +CGCP 
Sbjct  271   VLSRFVLNQSSA-QRYVWLPQAGGWSLYWSLPRDQCDQYAHCGAYGVCDVGAASMCGCPA  329

Query  1581  GFKPRNQQAWSLRDGSGGCFRYDELDCPTDGFLSMNYTKLPESSTSFVDATMSLDECKEM  1760
             GF P + + W LRD S GC R   L+C  DGFL +   KLP+++ + VDA +++D+C+  
Sbjct  330   GFAPASPRNWELRDSSAGCARRTRLNCTGDGFLPLRGVKLPDTTNATVDAAIAVDQCRAR  389

Query  1761  CVRNCSCTAYSNYNISNGGSGCVIWTAELFDIRQYTAEGGQLLYVRVAASDAEQTGEVAR  1940
             C+ NCSC AY+  ++  GGSGC++W++ L DIR+++  GG+ L++R+AASD    G+ + 
Sbjct  390   CLANCSCVAYAASDVRGGGSGCIMWSSPLVDIRKFS-YGGEDLFMRLAASDLPTNGDDSS  448

Query  1941  GGNGFGKTKKVILACgivlgigmvlfgl-lllkrrklrrgVTENIEMRGTRERSRDPLMN  2117
               N       V+L+   V+ + +  F +   L R K+   V      R T   S  PL  
Sbj