BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25430_g1_i1 len=2091 path=[1978:0-100 5680:101-102 2081:103-142
5250:143-163 2142:164-208 6172:209-242 2218:243-271 6506:272-274
2250:275-313 5538:314-322 2298:323-349 6384:350-352 2325:353-417
6289:418-441 2414:442-477 5936:478-490 2463:491-571 6714:572-577
5870:578-586 2559:587-732 6743:733-733 4240:734-795 4302:796-822
3979:823-873 2757:874-934 5008:935-1011 2895:1012-1052
6470:1053-1065 2949:1066-1091 6090:1092-1146 3030:1147-1201
5338:1202-1278 6874:1279-1280 3164:1281-1309 5108:1310-1357
3241:1358-1409 5641:1410-1425 3309:1426-1483 5730:1484-1490
3378:1491-2090]

Length=2091
                                                                      Score     E

ref|XP_009631932.1|  PREDICTED: putative pectinesterase 14 isofor...    301   6e-131   
ref|XP_010654005.1|  PREDICTED: probable pectinesterase 15 isofor...    311   3e-129   
emb|CBI30191.3|  unnamed protein product                                311   4e-129   
ref|XP_009796875.1|  PREDICTED: probable pectinesterase 15              295   2e-128   
ref|XP_004249469.1|  PREDICTED: probable pectinesterase 15              293   4e-124   
ref|XP_009609998.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    281   3e-122   
emb|CDP15307.1|  unnamed protein product                                308   9e-122   
ref|XP_003553567.1|  PREDICTED: probable pectinesterase 15-like         298   8e-121   
gb|KHN02285.1|  Putative pectinesterase 15                              298   8e-121   
ref|XP_006339309.1|  PREDICTED: probable pectinesterase 15-like         293   9e-120   
ref|XP_007203100.1|  hypothetical protein PRUPE_ppa023784mg             311   1e-119   
ref|XP_009780329.1|  PREDICTED: probable pectinesterase 15              290   1e-119   
ref|XP_008241442.1|  PREDICTED: probable pectinesterase 15              311   4e-119   
ref|XP_011077480.1|  PREDICTED: probable pectinesterase 15              291   8e-119   
gb|EYU38584.1|  hypothetical protein MIMGU_mgv1a007131mg                307   1e-118   
ref|XP_007162815.1|  hypothetical protein PHAVU_001G183100g             293   3e-118   
ref|XP_009341090.1|  PREDICTED: probable pectinesterase 15              312   5e-116   
ref|XP_010683975.1|  PREDICTED: probable pectinesterase 15 isofor...    298   1e-115   
ref|XP_010037120.1|  PREDICTED: probable pectinesterase 15              296   1e-115   
ref|XP_006381362.1|  hypothetical protein POPTR_0006s12170g             292   1e-114   
ref|XP_008387553.1|  PREDICTED: probable pectinesterase 15              309   2e-114   
ref|XP_007027515.1|  Pectin lyase-like superfamily protein              292   3e-114   
ref|XP_009631933.1|  PREDICTED: probable pectinesterase 15 isofor...    244   1e-113   
ref|XP_004137990.1|  PREDICTED: probable pectinesterase 15-like         276   1e-113   
ref|XP_004494018.1|  PREDICTED: probable pectinesterase 15-like         283   2e-113   
ref|XP_008442748.1|  PREDICTED: putative pectinesterase 14 isofor...    280   4e-113   
ref|XP_004494095.1|  PREDICTED: probable pectinesterase 15-like         288   6e-112   
ref|XP_011018831.1|  PREDICTED: probable pectinesterase 15 isofor...    290   7e-112   
ref|XP_009386766.1|  PREDICTED: putative pectinesterase 14              293   1e-111   
ref|XP_010098841.1|  putative pectinesterase 15                         292   7e-110   
gb|KHG12413.1|  putative pectinesterase 15 -like protein                287   1e-109   
ref|XP_003625727.1|  Pectinesterase                                     283   2e-109   
ref|XP_010654006.1|  PREDICTED: probable pectinesterase 15 isofor...    239   5e-108   
ref|XP_006428522.1|  hypothetical protein CICLE_v10013444mg             284   4e-107   
ref|XP_006491830.1|  PREDICTED: probable pectinesterase 15-like         283   4e-107   
gb|KDO54339.1|  hypothetical protein CISIN_1g039329mg                   282   8e-107   
ref|XP_004306176.1|  PREDICTED: probable pectinesterase 15-like         308   1e-106   
ref|XP_010241677.1|  PREDICTED: probable pectinesterase 15              272   2e-106   
ref|XP_006401814.1|  hypothetical protein EUTSA_v10015978mg             271   8e-104   
ref|XP_002519425.1|  Pectinesterase PPE8B precursor, putative           291   2e-103   Ricinus communis
ref|NP_181209.1|  putative pectinesterase 15                            274   6e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879623.1|  pectinesterase family protein                      267   2e-102   
gb|AAO22722.1|  putative pectinesterase family protein                  271   5e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505218.1|  PREDICTED: probable pectinesterase 15              268   1e-101   
gb|EPS73183.1|  pectinesterase                                          267   9e-101   
ref|XP_010509442.1|  PREDICTED: probable pectinesterase 15              263   1e-100   
ref|XP_010516895.1|  PREDICTED: probable pectinesterase 15              265   2e-100   
ref|XP_010546523.1|  PREDICTED: probable pectinesterase 15 isofor...    279   6e-100   
ref|XP_010513018.1|  PREDICTED: probable pectinesterase 15              281   2e-99    
ref|XP_002881462.1|  hypothetical protein ARALYDRAFT_902790             279   4e-99    
ref|XP_010546522.1|  PREDICTED: probable pectinesterase 15 isofor...    279   1e-98    
gb|KFK36544.1|  hypothetical protein AALP_AA4G137600                    279   6e-96    
ref|XP_010546521.1|  PREDICTED: probable pectinesterase 15 isofor...    265   1e-95    
gb|AFI23413.1|  pectin methylesterase                                   306   6e-95    
ref|XP_010546520.1|  PREDICTED: probable pectinesterase 15 isofor...    264   3e-94    
ref|XP_004956260.1|  PREDICTED: probable pectinesterase 15-like         270   2e-93    
ref|XP_010543016.1|  PREDICTED: probable pectinesterase 8               269   1e-92    
ref|XP_009144121.1|  PREDICTED: probable pectinesterase 15              261   3e-92    
emb|CDY33185.1|  BnaC04g08540D                                          261   5e-92    
ref|XP_006296290.1|  hypothetical protein CARUB_v10025460mg             256   8e-92    
ref|XP_006285001.1|  hypothetical protein CARUB_v10006308mg             270   2e-91    
dbj|BAJ99366.1|  predicted protein                                      263   3e-91    
ref|XP_010093131.1|  putative pectinesterase 8                          262   6e-91    
ref|XP_010534682.1|  PREDICTED: probable pectinesterase 15              259   9e-91    
ref|XP_009612401.1|  PREDICTED: probable pectinesterase 8               270   1e-90    
ref|XP_006429777.1|  hypothetical protein CICLE_v10011953mg             262   6e-90    
ref|XP_006659931.1|  PREDICTED: probable pectinesterase 8-like          274   8e-90    
gb|KFK42874.1|  hypothetical protein AALP_AA1G050100                    263   1e-89    
ref|XP_011001039.1|  PREDICTED: probable pectinesterase 8               266   2e-89    
ref|XP_009772188.1|  PREDICTED: probable pectinesterase 8               268   2e-89    
ref|XP_006481444.1|  PREDICTED: probable pectinesterase 8-like          259   3e-89    
ref|XP_007162301.1|  hypothetical protein PHAVU_001G140600g             262   5e-89    
ref|XP_002323171.2|  hypothetical protein POPTR_0016s01920g             265   6e-89    Populus trichocarpa [western balsam poplar]
ref|XP_002892282.1|  predicted protein                                  264   7e-89    
ref|XP_011073122.1|  PREDICTED: probable pectinesterase 8               257   1e-88    
ref|XP_006418040.1|  hypothetical protein EUTSA_v10009800mg             262   1e-88    
ref|XP_011014966.1|  PREDICTED: probable pectinesterase 8               264   1e-88    
gb|EEC85099.1|  hypothetical protein OsI_32473                          241   2e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_004305897.1|  PREDICTED: probable pectinesterase 8-like          260   2e-88    
ref|NP_001063991.1|  Os09g0571100                                       241   2e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008809346.1|  PREDICTED: probable pectinesterase 8               263   2e-88    
gb|KHG03314.1|  putative pectinesterase 8 -like protein                 259   2e-88    
ref|XP_004493561.1|  PREDICTED: probable pectinesterase 8-like          258   4e-88    
ref|NP_172023.1|  putative pectinesterase 8                             262   4e-88    Arabidopsis thaliana [mouse-ear cress]
gb|KHN26371.1|  Putative pectinesterase 8                               258   5e-88    
ref|XP_003553427.1|  PREDICTED: probable pectinesterase 8-like          258   5e-88    
ref|XP_010260644.1|  PREDICTED: probable pectinesterase 8               263   6e-88    
gb|KDP42780.1|  hypothetical protein JCGZ_00479                         259   7e-88    
gb|KDP29213.1|  hypothetical protein JCGZ_16602                         293   7e-88    
ref|XP_008787556.1|  PREDICTED: putative pectinesterase 14              294   8e-88    
ref|XP_009803530.1|  PREDICTED: probable pectinesterase 8 isoform X1    257   1e-87    
emb|CDP08865.1|  unnamed protein product                                261   2e-87    
ref|XP_004243648.1|  PREDICTED: probable pectinesterase 8               257   2e-87    
ref|XP_009349568.1|  PREDICTED: probable pectinesterase 8               253   2e-87    
ref|XP_010935867.1|  PREDICTED: putative pectinesterase 14              292   3e-87    
ref|XP_007049055.1|  Pectinesterase                                     254   3e-87    
gb|EEE68230.1|  hypothetical protein OsJ_26414                          262   3e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010457617.1|  PREDICTED: probable pectinesterase 8               259   4e-87    
ref|XP_010475224.1|  PREDICTED: probable pectinesterase 8               259   5e-87    
gb|EEC83093.1|  hypothetical protein OsI_28228                          262   5e-87    Oryza sativa Indica Group [Indian rice]
ref|XP_009610336.1|  PREDICTED: probable pectinesterase 8 isoform X1    256   6e-87    
ref|XP_003625222.1|  hypothetical protein MTR_7g092780                  256   6e-87    
ref|XP_008378333.1|  PREDICTED: probable pectinesterase 8               251   8e-87    
ref|XP_006357894.1|  PREDICTED: probable pectinesterase 8-like          255   1e-86    
ref|XP_010267309.1|  PREDICTED: putative pectinesterase 14 isofor...    290   2e-86    
ref|XP_009803531.1|  PREDICTED: probable pectinesterase 8 isoform X2    253   2e-86    
ref|XP_002521065.1|  Pectinesterase-1 precursor, putative               254   3e-86    Ricinus communis
ref|XP_006661576.1|  PREDICTED: probable pectinesterase 15-like         238   4e-86    
ref|XP_008451885.1|  PREDICTED: probable pectinesterase 8               253   5e-86    
ref|NP_181208.1|  putative pectinesterase 14                            255   5e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484902.1|  PREDICTED: probable pectinesterase 8               256   5e-86    
gb|AAB71446.1|  Similar to Prunus pectinesterase (gb|X95991)            262   7e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004972590.1|  PREDICTED: probable pectinesterase 8-like          262   9e-86    
ref|XP_009610337.1|  PREDICTED: probable pectinesterase 8 isoform X2    252   9e-86    
ref|XP_009118594.1|  PREDICTED: probable pectinesterase 8               256   1e-85    
ref|XP_002267842.1|  PREDICTED: probable pectinesterase 8               253   1e-85    Vitis vinifera
ref|XP_008229648.1|  PREDICTED: probable pectinesterase 8               253   2e-85    
ref|XP_009119166.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    254   2e-85    
ref|XP_010025544.1|  PREDICTED: probable pectinesterase 8               254   3e-85    
ref|XP_011018832.1|  PREDICTED: probable pectinesterase 15 isofor...    285   3e-85    
ref|XP_009405469.1|  PREDICTED: probable pectinesterase 8               253   3e-85    
ref|XP_003576885.2|  PREDICTED: probable pectinesterase 15              241   3e-85    
ref|XP_002445213.1|  hypothetical protein SORBIDRAFT_07g006050          260   4e-85    Sorghum bicolor [broomcorn]
ref|XP_010686768.1|  PREDICTED: probable pectinesterase 8               256   5e-85    
ref|XP_010422119.1|  PREDICTED: putative pectinesterase 14              258   1e-84    
ref|XP_007215489.1|  hypothetical protein PRUPE_ppa006779mg             249   4e-84    
ref|XP_004168775.1|  PREDICTED: probable pectinesterase 8-like          251   6e-84    
ref|XP_010267308.1|  PREDICTED: putative pectinesterase 14 isofor...    283   7e-84    
ref|XP_004147773.1|  PREDICTED: probable pectinesterase 8-like          251   1e-83    
ref|XP_006279166.1|  hypothetical protein CARUB_v10007965mg             261   1e-83    
ref|XP_003571529.1|  PREDICTED: probable pectinesterase 8               256   3e-83    
emb|CDY33182.1|  BnaC04g08570D                                          278   5e-82    
ref|XP_009143563.1|  PREDICTED: probable pectinesterase 15              277   8e-82    
ref|XP_006294321.1|  hypothetical protein CARUB_v10023328mg             276   1e-81    
emb|CDX75019.1|  BnaA05g07650D                                          276   1e-81    
gb|EMS46468.1|  putative pectinesterase 8                               243   2e-81    
ref|XP_008442749.1|  PREDICTED: probable pectinesterase 15 isofor...    166   4e-79    
gb|KDO64378.1|  hypothetical protein CISIN_1g0167571mg                  258   1e-77    
ref|XP_002459865.1|  hypothetical protein SORBIDRAFT_02g012560          265   6e-77    Sorghum bicolor [broomcorn]
ref|XP_008662740.1|  PREDICTED: probable pectinesterase 8               264   1e-76    
ref|XP_006358730.1|  PREDICTED: probable pectinesterase 8-like          254   6e-76    
ref|XP_006303572.1|  hypothetical protein CARUB_v10011085mg             258   2e-75    
ref|XP_004955158.1|  PREDICTED: probable pectinesterase 8-like          230   7e-74    
emb|CDY63984.1|  BnaA04g21070D                                          249   1e-73    
ref|XP_009142108.1|  PREDICTED: probable pectinesterase 15              251   1e-73    
ref|XP_008653773.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    255   3e-73    
ref|XP_008353660.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    248   4e-73    
emb|CDY68894.1|  BnaCnng60960D                                          209   2e-71    
tpg|DAA60680.1|  TPA: hypothetical protein ZEAMMB73_943201              244   6e-71    
emb|CAN73254.1|  hypothetical protein VITISV_006029                     202   2e-70    Vitis vinifera
gb|EMT18708.1|  Putative pectinesterase 8                               242   6e-70    
ref|XP_011093645.1|  PREDICTED: probable pectinesterase 53 isofor...    228   6e-69    
ref|XP_002974192.1|  hypothetical protein SELMODRAFT_101090             223   2e-68    
gb|KDP46694.1|  hypothetical protein JCGZ_06482                         228   2e-68    
ref|XP_010271483.1|  PREDICTED: probable pectinesterase 53              231   3e-68    
ref|XP_002975044.1|  hypothetical protein SELMODRAFT_102829             223   3e-68    
ref|XP_009406172.1|  PREDICTED: probable pectinesterase 53 isofor...    223   8e-68    
ref|XP_010915080.1|  PREDICTED: probable pectinesterase 53 isofor...    219   1e-67    
ref|XP_002454459.1|  hypothetical protein SORBIDRAFT_04g031450          218   1e-67    Sorghum bicolor [broomcorn]
ref|XP_003631899.2|  PREDICTED: probable pectinesterase 53              220   2e-67    
ref|XP_003530551.1|  PREDICTED: probable pectinesterase 53-like i...    226   2e-67    
ref|XP_010049610.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    225   2e-67    
ref|XP_011093643.1|  PREDICTED: probable pectinesterase 53 isofor...    222   2e-67    
ref|XP_002531506.1|  Pectinesterase-2 precursor, putative               229   3e-67    Ricinus communis
ref|XP_009406173.1|  PREDICTED: probable pectinesterase 53 isofor...    222   4e-67    
ref|XP_010258939.1|  PREDICTED: probable pectinesterase 68 isofor...    221   4e-67    
ref|XP_011025911.1|  PREDICTED: probable pectinesterase 53              223   6e-67    
gb|EPS63895.1|  pectinesterase                                          224   7e-67    
ref|XP_007046753.1|  Pectin lyase-like superfamily protein isoform 1    224   7e-67    
gb|KDP33787.1|  hypothetical protein JCGZ_07358                         223   9e-67    
ref|XP_010915072.1|  PREDICTED: probable pectinesterase 53 isofor...    216   1e-66    
ref|XP_010316821.1|  PREDICTED: probable pectinesterase 53              225   1e-66    
ref|XP_008804057.1|  PREDICTED: probable pectinesterase 53              219   1e-66    
ref|XP_011100946.1|  PREDICTED: probable pectinesterase 53              223   2e-66    
ref|XP_007160279.1|  hypothetical protein PHAVU_002G308000g             224   2e-66    
gb|KHG28220.1|  putative pectinesterase 53 -like protein                228   2e-66    
ref|XP_006425546.1|  hypothetical protein CICLE_v10027321mg             221   2e-66    
ref|XP_008657240.1|  PREDICTED: probable pectinesterase 53              224   3e-66    
ref|XP_006340937.1|  PREDICTED: probable pectinesterase 53-like         221   3e-66    
ref|XP_002458469.1|  hypothetical protein SORBIDRAFT_03g034250          226   3e-66    Sorghum bicolor [broomcorn]
gb|EYU24077.1|  hypothetical protein MIMGU_mgv1a008262mg                218   3e-66    
ref|XP_010679844.1|  PREDICTED: probable pectinesterase 53              225   5e-66    
ref|XP_004503496.1|  PREDICTED: probable pectinesterase 53-like         226   5e-66    
ref|XP_003524409.1|  PREDICTED: probable pectinesterase 53-like         225   5e-66    
ref|XP_010656255.1|  PREDICTED: probable pectinesterase 53              226   6e-66    
emb|CAN63186.1|  hypothetical protein VITISV_037092                     226   6e-66    Vitis vinifera
emb|CBI27989.3|  unnamed protein product                                227   7e-66    
ref|XP_009399936.1|  PREDICTED: probable pectinesterase 68              219   8e-66    
ref|XP_010264302.1|  PREDICTED: probable pectinesterase 68              216   1e-65    
ref|XP_002961718.1|  hypothetical protein SELMODRAFT_76693              216   1e-65    
ref|XP_009402793.1|  PREDICTED: probable pectinesterase 53              219   1e-65    
ref|XP_002964788.1|  hypothetical protein SELMODRAFT_83442              218   1e-65    
ref|XP_009599854.1|  PREDICTED: probable pectinesterase 53              221   2e-65    
ref|XP_004969916.1|  PREDICTED: probable pectinesterase 53-like         225   2e-65    
ref|XP_006475589.1|  PREDICTED: probable pectinesterase 53-like i...    224   2e-65    
ref|XP_002514210.1|  Pectinesterase PPE8B precursor, putative           220   2e-65    Ricinus communis
ref|XP_001769271.1|  predicted protein                                  209   2e-65    
ref|XP_004287482.1|  PREDICTED: probable pectinesterase 53-like         223   2e-65    
emb|CDP09966.1|  unnamed protein product                                214   2e-65    
ref|XP_006451320.1|  hypothetical protein CICLE_v10010616mg             224   2e-65    
ref|XP_001769270.1|  predicted protein                                  219   2e-65    
ref|XP_002310842.1|  hypothetical protein POPTR_0007s13780g             220   2e-65    Populus trichocarpa [western balsam poplar]
ref|XP_006475590.1|  PREDICTED: probable pectinesterase 53-like i...    224   2e-65    
ref|XP_006380792.1|  hypothetical protein POPTR_0007s13780g             220   2e-65    
ref|XP_006371972.1|  hypothetical protein POPTR_0018s06820g             224   3e-65    
ref|XP_006853729.1|  hypothetical protein AMTR_s00056p00166920          221   3e-65    
gb|EEC79546.1|  hypothetical protein OsI_20666                          221   3e-65    Oryza sativa Indica Group [Indian rice]
ref|NP_001056077.1|  Os05g0521600                                       221   3e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003567104.1|  PREDICTED: probable pectinesterase 53 isofor...    224   4e-65    
ref|XP_011009863.1|  PREDICTED: probable pectinesterase 53              222   4e-65    
ref|XP_003516527.2|  PREDICTED: probable pectinesterase 53-like         220   4e-65    
ref|XP_006287923.1|  hypothetical protein CARUB_v10001159mg             221   5e-65    
ref|XP_002303355.2|  hypothetical protein POPTR_0003s07460g             211   5e-65    Populus trichocarpa [western balsam poplar]
ref|XP_008649911.1|  PREDICTED: probable pectinesterase 53              220   5e-65    
ref|XP_002962215.1|  hypothetical protein SELMODRAFT_165098             223   7e-65    
gb|KHN40374.1|  Putative pectinesterase 53                              219   7e-65    
gb|EMT14893.1|  Putative pectinesterase 53                              226   8e-65    
ref|XP_002965129.1|  hypothetical protein SELMODRAFT_167160             223   8e-65    
gb|KHG28421.1|  putative pectinesterase 53 -like protein                221   8e-65    
ref|XP_010535938.1|  PREDICTED: probable pectinesterase 53              223   8e-65    
ref|XP_010249481.1|  PREDICTED: probable pectinesterase 53              220   1e-64    
emb|CDP03246.1|  unnamed protein product                                216   1e-64    
gb|EYU33537.1|  hypothetical protein MIMGU_mgv1a008469mg                211   1e-64    
gb|EYU27258.1|  hypothetical protein MIMGU_mgv1a025960mg                202   1e-64    
ref|XP_006400534.1|  hypothetical protein EUTSA_v10013810mg             223   2e-64    
ref|XP_002881461.1|  predicted protein                                  185   2e-64    
ref|XP_008673062.1|  PREDICTED: pectinesterase isoform X1               224   2e-64    
ref|XP_010110876.1|  putative pectinesterase 53                         223   2e-64    
ref|XP_003630703.1|  Pectinesterase                                     220   2e-64    
ref|NP_001167796.1|  pectinesterase precursor                           224   2e-64    Zea mays [maize]
ref|XP_008656475.1|  PREDICTED: probable pectinesterase 53 isofor...    222   2e-64    
ref|XP_009591684.1|  PREDICTED: probable pectinesterase 53              223   2e-64    
ref|XP_002440102.1|  hypothetical protein SORBIDRAFT_09g026060          221   2e-64    Sorghum bicolor [broomcorn]
ref|XP_011078244.1|  PREDICTED: probable pectinesterase 53              219   2e-64    
ref|XP_001774315.1|  predicted protein                                  226   2e-64    
ref|XP_002871903.1|  pectinesterase family protein                      221   3e-64    
ref|NP_197474.1|  probable pectinesterase 53                            220   3e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010688346.1|  PREDICTED: probable pectinesterase 53              218   3e-64    
ref|XP_009802490.1|  PREDICTED: probable pectinesterase 53              222   3e-64    
ref|XP_004251642.1|  PREDICTED: probable pectinesterase 53              222   3e-64    
ref|XP_011031878.1|  PREDICTED: probable pectinesterase 68              210   3e-64    
gb|KHG26932.1|  putative pectinesterase 53 -like protein                221   4e-64    
emb|CDP01931.1|  unnamed protein product                                220   4e-64    
ref|XP_006353578.1|  PREDICTED: probable pectinesterase 53-like         222   4e-64    
ref|XP_008437714.1|  PREDICTED: probable pectinesterase 68              215   4e-64    
ref|XP_009120862.1|  PREDICTED: probable pectinesterase 53              222   5e-64    
ref|XP_003566023.2|  PREDICTED: probable pectinesterase 53              223   5e-64    
ref|XP_006477195.1|  PREDICTED: probable pectinesterase 68-like         207   5e-64    
gb|KDO61446.1|  hypothetical protein CISIN_1g018249mg                   207   5e-64    
ref|NP_001044216.1|  Os01g0743200                                       223   6e-64    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007155657.1|  hypothetical protein PHAVU_003G220500g             211   6e-64    
ref|XP_004961453.1|  PREDICTED: probable pectinesterase 53-like i...    222   7e-64    
ref|XP_010454257.1|  PREDICTED: probable pectinesterase 53              221   7e-64    
ref|XP_001769817.1|  predicted protein                                  227   7e-64    
gb|KHN14256.1|  Putative pectinesterase 53                              217   7e-64    
emb|CDY68784.1|  BnaCnng60500D                                          222   7e-64    
gb|KEH27219.1|  pectinesterase                                          220   7e-64    
ref|XP_010493050.1|  PREDICTED: probable pectinesterase 53              221   7e-64    
ref|XP_010420786.1|  PREDICTED: probable pectinesterase 53 isofor...    221   7e-64    
ref|XP_011070218.1|  PREDICTED: probable pectinesterase 68              208   1e-63    
ref|XP_004158420.1|  PREDICTED: probable pectinesterase 53-like         219   1e-63    
gb|KGN66185.1|  hypothetical protein Csa_1G575010                       219   1e-63    
ref|XP_006440314.1|  hypothetical protein CICLE_v10020787mg             207   1e-63    
ref|XP_007013011.1|  Pectin lyase-like superfamily protein isoform 1    219   1e-63    
ref|XP_010267113.1|  PREDICTED: probable pectinesterase 53              221   1e-63    
ref|XP_004135808.1|  PREDICTED: probable pectinesterase 53-like         219   1e-63    
ref|XP_007152966.1|  hypothetical protein PHAVU_004G175200g             216   1e-63    
ref|XP_003611307.1|  Pectinesterase                                     208   1e-63    
ref|XP_008656474.1|  PREDICTED: probable pectinesterase 53 isofor...    220   2e-63    
ref|XP_008450789.1|  PREDICTED: probable pectinesterase 53              219   2e-63    
gb|AFK39158.1|  unknown                                                 217   2e-63    
ref|XP_010113388.1|  putative pectinesterase 53                         213   2e-63    
ref|XP_001785149.1|  predicted protein                                  217   2e-63    
ref|XP_008786957.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    211   2e-63    
ref|XP_001766064.1|  predicted protein                                  224   2e-63    
ref|XP_007204399.1|  hypothetical protein PRUPE_ppa007112mg             221   3e-63    
ref|XP_002266321.3|  PREDICTED: probable pectinesterase 68              209   3e-63    Vitis vinifera
emb|CBI31927.3|  unnamed protein product                                209   3e-63    
ref|XP_008242479.1|  PREDICTED: probable pectinesterase 53              221   4e-63    
ref|XP_004164282.1|  PREDICTED: probable pectinesterase 68-like         214   4e-63    
ref|XP_004152402.1|  PREDICTED: probable pectinesterase 68-like         214   4e-63    
ref|XP_009126386.1|  PREDICTED: probable pectinesterase 53              219   4e-63    
ref|XP_006654665.1|  PREDICTED: probable pectinesterase 53-like         213   4e-63    
gb|EMT17971.1|  Putative pectinesterase 53                              222   4e-63    
ref|XP_003517421.1|  PREDICTED: probable pectinesterase 68              209   4e-63    
ref|XP_003529058.2|  PREDICTED: probable pectinesterase 53-like         217   5e-63    
gb|KHN42698.1|  Putative pectinesterase 68                              209   5e-63    
ref|XP_006646312.1|  PREDICTED: probable pectinesterase 53-like         221   5e-63    
ref|XP_004513038.1|  PREDICTED: probable pectinesterase 53-like         218   6e-63    
emb|CDY42290.1|  BnaC02g08960D                                          218   7e-63    
ref|XP_001760885.1|  predicted protein                                  221   7e-63    
ref|XP_007157353.1|  hypothetical protein PHAVU_002G063100g             201   7e-63    
ref|XP_009397881.1|  PREDICTED: probable pectinesterase 68              213   8e-63    
ref|XP_010267310.1|  PREDICTED: probable pectinesterase 15 isofor...    226   8e-63    
ref|XP_008352338.1|  PREDICTED: probable pectinesterase 53              219   1e-62    
ref|XP_008465244.1|  PREDICTED: probable pectinesterase 53              217   1e-62    
ref|XP_010055495.1|  PREDICTED: probable pectinesterase 68              209   1e-62    
ref|XP_009352561.1|  PREDICTED: probable pectinesterase 53              219   1e-62    
ref|XP_002968924.1|  hypothetical protein SELMODRAFT_65663              214   1e-62    
emb|CDY44939.1|  BnaA02g04440D                                          219   1e-62    
ref|XP_003550907.1|  PREDICTED: probable pectinesterase 68              206   1e-62    
ref|XP_008387348.1|  PREDICTED: probable pectinesterase 53              219   1e-62    
gb|KHN09819.1|  Putative pectinesterase 68                              206   1e-62    
gb|KCW71970.1|  hypothetical protein EUGRSUZ_E00425                     209   2e-62    
ref|XP_010258940.1|  PREDICTED: probable pectinesterase 68 isofor...    220   2e-62    
ref|XP_008337605.1|  PREDICTED: probable pectinesterase 53              218   2e-62    
gb|KHN26987.1|  Putative pectinesterase 53                              223   2e-62    
gb|KDP28296.1|  hypothetical protein JCGZ_14067                         224   2e-62    
ref|XP_003538735.1|  PREDICTED: probable pectinesterase 68-like         206   3e-62    
gb|EYU27262.1|  hypothetical protein MIMGU_mgv1a011822mg                219   4e-62    
ref|XP_004146488.1|  PREDICTED: probable pectinesterase 53-like         215   4e-62    
ref|XP_004172449.1|  PREDICTED: probable pectinesterase 53-like         215   5e-62    
ref|XP_001778320.1|  predicted protein                                  221   5e-62    
ref|XP_002988891.1|  hypothetical protein SELMODRAFT_128677             197   6e-62    
gb|KDP39870.1|  hypothetical protein JCGZ_03401                         204   6e-62    
ref|XP_006843863.1|  hypothetical protein AMTR_s00007p00264470          217   6e-62    
ref|XP_004229371.1|  PREDICTED: probable pectinesterase 53              223   6e-62    
ref|XP_003632380.2|  PREDICTED: probable pectinesterase 53              222   9e-62    
ref|XP_001785334.1|  predicted protein                                  220   9e-62    
ref|XP_002979836.1|  hypothetical protein SELMODRAFT_55472              219   1e-61    
ref|XP_002964173.1|  hypothetical protein SELMODRAFT_81583              195   2e-61    
gb|ABR18283.1|  unknown                                                 205   2e-61    
ref|XP_008238527.1|  PREDICTED: probable pectinesterase 68              202   2e-61    
ref|XP_002962216.1|  hypothetical protein SELMODRAFT_76951              206   2e-61    
ref|XP_007210707.1|  hypothetical protein PRUPE_ppa024139mg             202   2e-61    
ref|XP_009605554.1|  PREDICTED: probable pectinesterase 68              209   2e-61    
gb|EYU30697.1|  hypothetical protein MIMGU_mgv1a024695mg                217   3e-61    
ref|XP_010919565.1|  PREDICTED: probable pectinesterase 68              207   3e-61    
gb|ABD65006.1|  pectinesterase family protein                           205   3e-61    
ref|XP_006294320.1|  hypothetical protein CARUB_v10023328mg             220   4e-61    
ref|XP_006349162.1|  PREDICTED: probable pectinesterase 53-like         220   5e-61    
ref|XP_009414379.1|  PREDICTED: probable pectinesterase 53 isofor...    220   6e-61    
ref|XP_002965130.1|  hypothetical protein SELMODRAFT_83276              205   6e-61    
ref|XP_009414380.1|  PREDICTED: probable pectinesterase 53 isofor...    219   7e-61    
ref|XP_001752210.1|  predicted protein                                  207   7e-61    
ref|XP_006398447.1|  hypothetical protein EUTSA_v10000935mg             206   1e-60    
ref|XP_009402033.1|  PREDICTED: putative pectinesterase 63              218   1e-60    
ref|XP_001777108.1|  predicted protein                                  214   1e-60    
ref|XP_007226857.1|  hypothetical protein PRUPE_ppa017141mg             188   1e-60    
ref|XP_009414378.1|  PREDICTED: probable pectinesterase 53 isofor...    219   2e-60    
ref|XP_008223370.1|  PREDICTED: probable pectinesterase 67              187   2e-60    
ref|XP_002976448.1|  hypothetical protein SELMODRAFT_104861             217   3e-60    
ref|XP_007039841.1|  Pectin lyase-like superfamily protein              205   4e-60    
ref|XP_010530051.1|  PREDICTED: probable pectinesterase 68              200   4e-60    
ref|XP_011040796.1|  PREDICTED: probable pectinesterase 53              218   5e-60    
ref|XP_008801747.1|  PREDICTED: probable pectinesterase 53              218   5e-60    
ref|XP_006838145.1|  hypothetical protein AMTR_s00106p00092510          205   6e-60    
ref|XP_010914653.1|  PREDICTED: probable pectinesterase 53              217   7e-60    
ref|XP_006830090.1|  hypothetical protein AMTR_s00123p00050980          181   7e-60    
ref|XP_009768018.1|  PREDICTED: probable pectinesterase 68              204   7e-60    
ref|XP_011027955.1|  PREDICTED: probable pectinesterase 67              188   2e-59    
ref|XP_009803587.1|  PREDICTED: putative pectinesterase 11              208   2e-59    
ref|XP_007035815.1|  Pectin lyase-like superfamily protein isoform 1    189   2e-59    
ref|XP_001764345.1|  predicted protein                                  214   2e-59    
ref|XP_007035816.1|  Pectin lyase-like superfamily protein isoform 2    189   2e-59    
ref|XP_008340594.1|  PREDICTED: probable pectinesterase 67              186   2e-59    
ref|XP_007051206.1|  Pectinesterase                                     216   3e-59    
ref|XP_008373764.1|  PREDICTED: probable pectinesterase 68              199   3e-59    
ref|XP_004173405.1|  PREDICTED: probable pectinesterase 67-like         193   3e-59    
ref|XP_002311381.2|  hypothetical protein POPTR_0008s10440g             189   4e-59    
ref|XP_001778325.1|  predicted protein                                  214   4e-59    
ref|XP_002523016.1|  Pectinesterase-2 precursor, putative               189   7e-59    
ref|XP_006387630.1|  hypothetical protein POPTR_0746s00200g             211   8e-59    
gb|KDO71950.1|  hypothetical protein CISIN_1g046043mg                   182   8e-59    
ref|XP_004144054.1|  PREDICTED: probable pectinesterase 50-like         207   9e-59    
ref|XP_009621417.1|  PREDICTED: putative pectinesterase 11              205   9e-59    
ref|XP_006488988.1|  PREDICTED: probable pectinesterase 67-like         182   9e-59    
ref|XP_006419374.1|  hypothetical protein CICLE_v10006909mg             182   9e-59    
gb|EYU46841.1|  hypothetical protein MIMGU_mgv1a019910mg                209   1e-58    
gb|KHG12918.1|  putative pectinesterase 53 -like protein                214   1e-58    
ref|XP_009336347.1|  PREDICTED: probable pectinesterase 67              187   1e-58    
ref|XP_008390573.1|  PREDICTED: probable pectinesterase 67              187   1e-58    
ref|XP_007013013.1|  Pectin lyase-like superfamily protein isoform 3    202   1e-58    
ref|XP_004961452.1|  PREDICTED: probable pectinesterase 53-like i...    205   1e-58    
ref|XP_009787979.1|  PREDICTED: probable pectinesterase 53 isofor...    214   1e-58    
ref|XP_002272939.1|  PREDICTED: probable pectinesterase 67              187   1e-58    
ref|XP_010110829.1|  putative pectinesterase 68                         196   1e-58    
ref|XP_007042164.1|  Laccase 11                                         205   2e-58    
ref|XP_009787978.1|  PREDICTED: probable pectinesterase 53 isofor...    213   2e-58    
ref|XP_009411137.1|  PREDICTED: pectinesterase QRT1                     212   2e-58    
ref|XP_004289004.1|  PREDICTED: pectinesterase PPME1-like               213   2e-58    
ref|XP_010268104.1|  PREDICTED: probable pectinesterase 67              187   2e-58    
ref|XP_010276487.1|  PREDICTED: probable pectinesterase 53 isofor...    210   3e-58    
ref|XP_001758971.1|  predicted protein                                  184   3e-58    
ref|XP_007202075.1|  hypothetical protein PRUPE_ppa005976mg             208   3e-58    
ref|XP_004301199.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    206   4e-58    
ref|XP_004295071.1|  PREDICTED: probable pectinesterase 67-like         187   4e-58    
ref|XP_010094410.1|  putative pectinesterase 53                         212   4e-58    
gb|AFW82525.1|  hypothetical protein ZEAMMB73_386621                    202   5e-58    
ref|XP_009372133.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    185   5e-58    
ref|XP_002320279.2|  hypothetical protein POPTR_0014s11240g             212   6e-58    
gb|KDP33954.1|  hypothetical protein JCGZ_07525                         211   6e-58    
ref|XP_008450966.1|  PREDICTED: putative pectinesterase 63              205   6e-58    
ref|XP_010259708.1|  PREDICTED: probable pectinesterase 67              191   7e-58    
ref|XP_001762576.1|  predicted protein                                  206   7e-58    
gb|KCW58194.1|  hypothetical protein EUGRSUZ_H00909                     212   7e-58    
ref|XP_003594727.1|  Pectinesterase                                     181   8e-58    
ref|XP_010522833.1|  PREDICTED: probable pectinesterase 53              211   8e-58    
ref|XP_008242288.1|  PREDICTED: putative pectinesterase 63              208   9e-58    
ref|XP_010315307.1|  PREDICTED: putative pectinesterase 11              210   1e-57    
ref|XP_010069754.1|  PREDICTED: probable pectinesterase 53 isofor...    212   1e-57    
ref|XP_010548999.1|  PREDICTED: probable pectinesterase 67              197   1e-57    
ref|XP_006355453.1|  PREDICTED: probable pectinesterase 68-like         206   1e-57    
ref|XP_010679463.1|  PREDICTED: probable pectinesterase 53              211   1e-57    
ref|XP_001756557.1|  predicted protein                                  208   1e-57    
gb|KFK36657.1|  hypothetical protein AALP_AA4G153100                    206   1e-57    
ref|XP_004245767.1|  PREDICTED: probable pectinesterase 68              202   2e-57    
ref|XP_002448293.1|  hypothetical protein SORBIDRAFT_06g024730          209   2e-57    
ref|XP_007145123.1|  hypothetical protein PHAVU_007G212000g             209   3e-57    
ref|XP_010526612.1|  PREDICTED: putative pectinesterase 11              209   3e-57    
emb|CDY59753.1|  BnaC08g49280D                                          208   3e-57    
ref|XP_002263748.1|  PREDICTED: probable pectinesterase 29              192   4e-57    
ref|XP_004511684.1|  PREDICTED: probable pectinesterase 68-like         209   4e-57    
emb|CBI40838.3|  unnamed protein product                                192   4e-57    
ref|XP_001764253.1|  predicted protein                                  206   4e-57    
ref|XP_008781333.1|  PREDICTED: probable pectinesterase 67              194   5e-57    
ref|XP_010276488.1|  PREDICTED: probable pectinesterase 53 isofor...    206   6e-57    
ref|XP_010419255.1|  PREDICTED: putative pectinesterase 11              207   8e-57    
ref|XP_008669043.1|  PREDICTED: probable pectinesterase 68              207   8e-57    
ref|XP_010472159.1|  PREDICTED: putative pectinesterase 11              207   1e-56    
ref|XP_010671738.1|  PREDICTED: probable pectinesterase 67              182   1e-56    
ref|XP_008444730.1|  PREDICTED: putative pectinesterase 11              184   1e-56    
ref|NP_179755.1|  pectinesterase 11                                     207   1e-56    
dbj|BAB09076.1|  pectin methylesterase-like                             207   1e-56    
ref|XP_002528921.1|  Pectinesterase U1 precursor, putative              204   1e-56    
ref|XP_007153340.1|  hypothetical protein PHAVU_003G027000g             207   2e-56    
ref|XP_002863340.1|  pectinesterase family protein                      207   2e-56    
ref|XP_001777828.1|  predicted protein                                  205   2e-56    
gb|ABG46325.1|  putative pectin methylesterase                          207   2e-56    
emb|CDY15882.1|  BnaA04g12290D                                          206   2e-56    
ref|XP_011016271.1|  PREDICTED: putative pectinesterase 63              207   2e-56    
emb|CDX77772.1|  BnaC07g20260D                                          206   2e-56    
ref|XP_009407032.1|  PREDICTED: putative pectinesterase 11              194   3e-56    
ref|XP_006492456.1|  PREDICTED: probable pectinesterase 53-like         207   3e-56    
ref|XP_006404616.1|  hypothetical protein EUTSA_v10000702mg             206   3e-56    
ref|XP_008653334.1|  PREDICTED: pectinesterase QRT1 isoform X1          205   3e-56    
ref|NP_001053508.1|  Os04g0553500                                       201   3e-56    
ref|XP_011039979.1|  PREDICTED: putative pectinesterase 63              207   4e-56    
ref|XP_011079515.1|  PREDICTED: probable pectinesterase 53              200   4e-56    
gb|EYU27429.1|  hypothetical protein MIMGU_mgv1a008712mg                206   4e-56    
ref|XP_004976450.1|  PREDICTED: probable pectinesterase 68-like         206   4e-56    
gb|ABD64977.1|  pectinesterase family protein                           206   4e-56    
ref|XP_007207707.1|  hypothetical protein PRUPE_ppa025119mg             206   5e-56    
emb|CDY59290.1|  BnaA06g39970D                                          206   6e-56    
ref|XP_009101416.1|  PREDICTED: probable pectinesterase 68              206   6e-56    
ref|XP_008367992.1|  PREDICTED: putative pectinesterase 63              204   6e-56    
ref|XP_010027105.1|  PREDICTED: probable pectinesterase 67              178   6e-56    
ref|XP_009117678.1|  PREDICTED: putative pectinesterase 11              206   6e-56    
ref|XP_010936490.1|  PREDICTED: pectinesterase QRT1-like                206   7e-56    
gb|KCW61296.1|  hypothetical protein EUGRSUZ_H04048                     178   7e-56    
ref|XP_009128974.1|  PREDICTED: probable pectinesterase 68 isofor...    206   7e-56    
emb|CDY69057.1|  BnaCnng61650D                                          206   7e-56    
ref|XP_006365130.1|  PREDICTED: putative pectinesterase 11-like         201   7e-56    
ref|XP_010069753.1|  PREDICTED: probable pectinesterase 53 isofor...    206   9e-56    
ref|XP_006295983.1|  hypothetical protein CARUB_v10025126mg             204   9e-56    
ref|XP_003559976.2|  PREDICTED: pectinesterase QRT1-like                206   1e-55    
ref|XP_008344163.1|  PREDICTED: putative pectinesterase 63              204   1e-55    
ref|XP_010240218.1|  PREDICTED: probable pectinesterase 68              205   1e-55    
ref|XP_009343360.1|  PREDICTED: putative pectinesterase 63              205   1e-55    
ref|NP_199561.1|  pectin methylesterase 5                               205   1e-55    
ref|XP_008438961.1|  PREDICTED: probable pectinesterase 67              180   1e-55    
ref|XP_002515259.1|  pectinesterase, putative                           186   1e-55    
ref|XP_008391732.1|  PREDICTED: putative pectinesterase 63              204   1e-55    
ref|XP_007207766.1|  hypothetical protein PRUPE_ppa026550mg             205   1e-55    
ref|XP_001764301.1|  predicted protein                                  192   1e-55    
ref|XP_007206641.1|  hypothetical protein PRUPE_ppa021246mg             205   1e-55    
ref|XP_004305898.1|  PREDICTED: probable pectinesterase 15-like         197   1e-55    
ref|XP_010481313.1|  PREDICTED: probable pectinesterase 68              204   1e-55    
ref|XP_009348900.1|  PREDICTED: putative pectinesterase 63 isofor...    204   2e-55    
ref|XP_001775877.1|  predicted protein                                  202   2e-55    
ref|XP_006474682.1|  PREDICTED: putative pectinesterase 63-like         204   2e-55    
ref|XP_006452563.1|  hypothetical protein CICLE_v10010593mg             204   2e-55    
ref|XP_006280682.1|  hypothetical protein CARUB_v10026646mg             204   2e-55    
ref|XP_010656088.1|  PREDICTED: putative pectinesterase 63 isofor...    205   2e-55    
ref|XP_006475118.1|  PREDICTED: pectinesterase QRT1-like                204   2e-55    
emb|CAN78808.1|  hypothetical protein VITISV_030725                     204   2e-55    
gb|KDO73799.1|  hypothetical protein CISIN_1g047018mg                   204   2e-55    
gb|ABK27127.1|  unknown                                                 204   3e-55    
ref|XP_010252431.1|  PREDICTED: putative pectinesterase 63              204   3e-55    
ref|XP_006452876.1|  hypothetical protein CICLE_v10010655mg             204   3e-55    
ref|XP_006848989.1|  hypothetical protein AMTR_s00028p00077900          204   3e-55    
ref|XP_002277388.2|  PREDICTED: putative pectinesterase 63              205   3e-55    
emb|CAD41229.2|  OSJNBa0010H02.16                                       203   3e-55    
ref|XP_010936491.1|  PREDICTED: pectinesterase QRT1-like                204   3e-55    
ref|XP_010695152.1|  PREDICTED: probable pectinesterase 68              204   3e-55    
ref|XP_002277518.1|  PREDICTED: putative pectinesterase 63 isofor...    204   4e-55    
gb|EMT14071.1|  Putative pectinesterase 68                              203   4e-55    
gb|KDP28279.1|  hypothetical protein JCGZ_14050                         186   4e-55    
emb|CDY71138.1|  BnaAnng36260D                                          154   4e-55    
emb|CBI27759.3|  unnamed protein product                                204   4e-55    
gb|KHF99581.1|  putative pectinesterase 67 -like protein                181   6e-55    
ref|XP_006381567.1|  hypothetical protein POPTR_0006s13930g             202   1e-54    
ref|XP_002880391.1|  pectinesterase family protein                      202   1e-54    
ref|XP_010051013.1|  PREDICTED: probable pectinesterase 55              186   1e-54    
ref|XP_010066169.1|  PREDICTED: putative pectinesterase 11              189   1e-54    
gb|EMT24197.1|  Pectinesterase QRT1                                     198   2e-54    
ref|XP_001758990.1|  predicted protein                                  190   2e-54    
ref|XP_009387848.1|  PREDICTED: probable pectinesterase 67              184   2e-54    
ref|XP_003634032.1|  PREDICTED: putative pectinesterase 63              201   3e-54    
ref|XP_010088935.1|  Putative pectinesterase 11                         187   3e-54    



>ref|XP_009631932.1| PREDICTED: putative pectinesterase 14 isoform X1 [Nicotiana tomentosiformis]
Length=420

 Score =   301 bits (770),  Expect(2) = 6e-131, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 161/201 (80%), Gaps = 0/201 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP  S G  G QA+A+ + GD+ AFYGCGFYGAQD LND RGRHYFK CFIQGSIDF
Sbjct  189   QNTAPSASPGDVGAQAVALRVTGDEVAFYGCGFYGAQDTLNDDRGRHYFKDCFIQGSIDF  248

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLYE+C+INSIA E  GGI GSITAQGR+S+ E SGFSF+ C + GSGK+WLGR
Sbjct  249   IFGNGRSLYEDCRINSIAKEETGGIGGSITAQGRNSQNENSGFSFVNCAINGSGKIWLGR  308

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFSKT MS VVS D WNDW DSTRDQTV FGEY+C GPGA+   R  YAKQL
Sbjct  309   AWGAYATVVFSKTYMSNVVSSDGWNDWRDSTRDQTVLFGEYECSGPGANYEYRVPYAKQL  368

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              ++EAA ++  S+IDG+ WL+
Sbjct  369   KQNEAAQYMDISFIDGQQWLL  389


 Score =   197 bits (500),  Expect(2) = 6e-131, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 145/205 (71%), Gaps = 14/205 (7%)
 Frame = +3

Query  126  MNTRSTSILFWLIAFTIAFFSltfslysnllttttvltvntpttllpflRSVVKQTGLDD  305
            MNT   +I FW IAFTIA FS+ F LYSN  + T     +T   L    R VV+++GL D
Sbjct  1    MNTTRRTIFFWFIAFTIALFSIIFPLYSNYNSPTNNAIESTSFPLALLKR-VVEKSGLQD  59

Query  306  FLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFAS  485
            F  +  ++              R   +KCDDSKW+S L+S+Y VSHV+TVDLNGCANF+S
Sbjct  60   FFCIFQEIT-------------RLHNSKCDDSKWNSKLISVYGVSHVLTVDLNGCANFSS  106

Query  486  VQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstg  665
            +QKA+DAVPD +P  TLI++DSGTY+EKV +  +K NLIIQGQGYLNTAI+WNDTANSTG
Sbjct  107  IQKAVDAVPDDNPTRTLILVDSGTYKEKVVINTNKTNLIIQGQGYLNTAIAWNDTANSTG  166

Query  666  gtsssYTFGAFAPKFIAYNISFQVT  740
            GT++S+T   +AP FIAYNISFQ T
Sbjct  167  GTANSFTVAIYAPNFIAYNISFQNT  191



>ref|XP_010654005.1| PREDICTED: probable pectinesterase 15 isoform X1 [Vitis vinifera]
Length=427

 Score =   311 bits (796),  Expect(2) = 3e-129, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP  S G  GGQA+A+ +  DQ+AFYGCGFYGAQD L+D RGRHYF++CFIQGSIDF
Sbjct  200   QNTAPPASPGDVGGQAVALRVANDQAAFYGCGFYGAQDTLHDDRGRHYFRECFIQGSIDF  259

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSLYEEC INS A E   GISG+ITAQGR S +EK+GFSF+KC +GG+G+VWLGR
Sbjct  260   IFGNARSLYEECTINSTAKEVSSGISGAITAQGRQSVDEKTGFSFVKCVIGGTGRVWLGR  319

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFS T M+ +V+ D WNDW D +RDQTV+FGEYDC+GPG++ + R SYAKQL
Sbjct  320   AWGAYATVVFSNTYMADLVASDGWNDWRDPSRDQTVFFGEYDCKGPGSNNTYRVSYAKQL  379

Query  1361  DESEAAPFLTTSYIDGEDWLIPTP  1432
              +SEAAP+L  SYIDG +WL+P P
Sbjct  380   MQSEAAPYLDVSYIDGNEWLLPLP  403


 Score =   181 bits (459),  Expect(2) = 3e-129, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 147/202 (73%), Gaps = 6/202 (3%)
 Frame = +3

Query  141  TSILFWLIAFTIAFFSltfslysnllttttvltvntpttllpflRSVVKQTGLDDFLSVI  320
            T++ FW  AF IA  S+T +L++   +T T+   +     L   R +VKQ+G++DFLS++
Sbjct  5    TTLFFWSSAFLIALLSITVALFTISSSTATITQGDLELAFL---RRIVKQSGVEDFLSLL  61

Query  321  HQV--KQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQK  494
            +Q   + ++  HHHHHH R+P+   CDD+KW S ++S YNVS ++TVDL GCANF+SVQK
Sbjct  62   NQATDRASQRHHHHHHHHRKPEV-ICDDAKWKSKIISSYNVSLILTVDLKGCANFSSVQK  120

Query  495  AIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggts  674
            A+DAVPD S   TLII+DSG YREKV V  SK NLI QGQGYLNTAI+WNDTANSTGGTS
Sbjct  121  AVDAVPDSSLSRTLIIMDSGIYREKVVVGASKTNLIFQGQGYLNTAIAWNDTANSTGGTS  180

Query  675  ssYTFGAFAPKFIAYNISFQVT  740
             SY+   FAP F AYNISFQ T
Sbjct  181  YSYSVAIFAPNFTAYNISFQNT  202



>emb|CBI30191.3| unnamed protein product [Vitis vinifera]
Length=893

 Score =   311 bits (796),  Expect(2) = 4e-129, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP  S G  GGQA+A+ +  DQ+AFYGCGFYGAQD L+D RGRHYF++CFIQGSIDF
Sbjct  200   QNTAPPASPGDVGGQAVALRVANDQAAFYGCGFYGAQDTLHDDRGRHYFRECFIQGSIDF  259

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSLYEEC INS A E   GISG+ITAQGR S +EK+GFSF+KC +GG+G+VWLGR
Sbjct  260   IFGNARSLYEECTINSTAKEVSSGISGAITAQGRQSVDEKTGFSFVKCVIGGTGRVWLGR  319

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFS T M+ +V+ D WNDW D +RDQTV+FGEYDC+GPG++ + R SYAKQL
Sbjct  320   AWGAYATVVFSNTYMADLVASDGWNDWRDPSRDQTVFFGEYDCKGPGSNNTYRVSYAKQL  379

Query  1361  DESEAAPFLTTSYIDGEDWLIPTP  1432
              +SEAAP+L  SYIDG +WL+P P
Sbjct  380   MQSEAAPYLDVSYIDGNEWLLPLP  403


 Score =   181 bits (458),  Expect(2) = 4e-129, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 147/202 (73%), Gaps = 6/202 (3%)
 Frame = +3

Query  141  TSILFWLIAFTIAFFSltfslysnllttttvltvntpttllpflRSVVKQTGLDDFLSVI  320
            T++ FW  AF IA  S+T +L++   +T T+   +     L   R +VKQ+G++DFLS++
Sbjct  5    TTLFFWSSAFLIALLSITVALFTISSSTATITQGDLELAFL---RRIVKQSGVEDFLSLL  61

Query  321  HQV--KQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQK  494
            +Q   + ++  HHHHHH R+P+   CDD+KW S ++S YNVS ++TVDL GCANF+SVQK
Sbjct  62   NQATDRASQRHHHHHHHHRKPEV-ICDDAKWKSKIISSYNVSLILTVDLKGCANFSSVQK  120

Query  495  AIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggts  674
            A+DAVPD S   TLII+DSG YREKV V  SK NLI QGQGYLNTAI+WNDTANSTGGTS
Sbjct  121  AVDAVPDSSLSRTLIIMDSGIYREKVVVGASKTNLIFQGQGYLNTAIAWNDTANSTGGTS  180

Query  675  ssYTFGAFAPKFIAYNISFQVT  740
             SY+   FAP F AYNISFQ T
Sbjct  181  YSYSVAIFAPNFTAYNISFQNT  202



>ref|XP_009796875.1| PREDICTED: probable pectinesterase 15 [Nicotiana sylvestris]
Length=403

 Score =   295 bits (754),  Expect(2) = 2e-128, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 159/201 (79%), Gaps = 0/201 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP  S G  G QA+A+ + GD+ AFYGCGFYG QD LND RGRHYFK CFIQGSIDF
Sbjct  192   QNTAPWASPGEVGAQAVALRVTGDEVAFYGCGFYGGQDTLNDDRGRHYFKDCFIQGSIDF  251

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLYE+C INSIA E  GGI GSITAQGR+S+ E SGFSF+ C + GSGK+WLGR
Sbjct  252   IFGNGRSLYEDCTINSIAKEETGGIGGSITAQGRNSQNENSGFSFVNCGIVGSGKIWLGR  311

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATV+FSKT MS VVS D WNDW DSTRDQT+ FGEY+C GPGA+   R  YAKQL
Sbjct  312   AWGAYATVIFSKTYMSNVVSSDGWNDWRDSTRDQTILFGEYECSGPGANYEYRVPYAKQL  371

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              ++EAA ++  S+IDG+ WL+
Sbjct  372   KQNEAAQYMDISFIDGQQWLL  392


 Score =   194 bits (493),  Expect(2) = 2e-128, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 147/206 (71%), Gaps = 13/206 (6%)
 Frame = +3

Query  126  MNTRS-TSILFWLIAFTIAFFSltfslysnllttttvltvntpttllpflRSVVKQTGLD  302
            MNTR  TSILFW IAFTIA FS+ F LYSN  +   +  + T +  L  L+ VV+++GL 
Sbjct  1    MNTRRRTSILFWFIAFTIALFSIIFPLYSNFHSPANINAIETTSFSLALLKRVVEKSGLQ  60

Query  303  DFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFA  482
            D   +  ++             R    +KCDD+KW+S LVS+Y +S V+TVDLNGCANF+
Sbjct  61   DLFLIFEEIT------------RLLHNSKCDDTKWNSKLVSVYGISRVLTVDLNGCANFS  108

Query  483  SVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANst  662
            S+QKA+D+VPD SP  TLI++DSGTY EKV +  +K NLIIQGQGYLNTAI+WNDTANST
Sbjct  109  SIQKAVDSVPDDSPTTTLILVDSGTYTEKVVINTNKTNLIIQGQGYLNTAIAWNDTANST  168

Query  663  ggtsssYTFGAFAPKFIAYNISFQVT  740
            GGT++S+T   +AP FIAYNISFQ T
Sbjct  169  GGTANSFTVAIYAPNFIAYNISFQNT  194



>ref|XP_004249469.1| PREDICTED: probable pectinesterase 15 [Solanum lycopersicum]
Length=391

 Score =   293 bits (750),  Expect(2) = 4e-124, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 162/201 (81%), Gaps = 1/201 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP  S G  G QA+A+ + GDQ+AFYGCGFYGAQD LND +GRHYFK+CFIQGSIDF
Sbjct  184   QNTAPAASPGDVGAQAVAVRVSGDQTAFYGCGFYGAQDTLNDDKGRHYFKECFIQGSIDF  243

Query  1001  IFGKARSLYEECKINSIANEGGGG-ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLG  1177
             IFG ARSLYE+CKINSIA E   G I GSITAQGR+S+ E SGFSFL C + G+GK+WLG
Sbjct  244   IFGSARSLYEDCKINSIAKEETSGEIGGSITAQGRNSKNENSGFSFLNCVINGTGKIWLG  303

Query  1178  RAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             RAWG+YATV+FSKT MS V+S D WNDW D  +DQTV FGEYDC GPGA+ ++R SYAKQ
Sbjct  304   RAWGAYATVIFSKTYMSHVISSDGWNDWRDPNKDQTVLFGEYDCFGPGANYTDRVSYAKQ  363

Query  1358  LDESEAAPFLTTSYIDGEDWL  1420
             L ++EA  ++  S+IDG+ W+
Sbjct  364   LKQNEADQYMDISFIDGQQWI  384


 Score =   181 bits (460),  Expect(2) = 4e-124, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 142/206 (69%), Gaps = 20/206 (10%)
 Frame = +3

Query  123  MMNTRSTSILFWLIAFTIAFFSltfslysnllttttvltvntpttllpflRSVVKQTGLD  302
            M NT + +I FW I+FTI   S+ F LYSN  T                 +SV++++G+ 
Sbjct  1    MNNTTTRTIFFWFISFTILLSSIIFPLYSNYQTNNANFL-----------KSVIEKSGIQ  49

Query  303  DFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFA  482
            DF  V  ++ ++             +++KC++SKW+S L+S+Y VSHV+TVDLNGC NF+
Sbjct  50   DFFFVFDEITRSL---------LLLQSSKCENSKWNSKLISLYGVSHVLTVDLNGCGNFS  100

Query  483  SVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANst  662
            S+QKA+D+VPD S   TLI++DSGTY+EKV +  SKINLII+GQGY NTAI+WNDTANST
Sbjct  101  SIQKAVDSVPDDSSTTTLILVDSGTYKEKVVINSSKINLIIEGQGYQNTAIAWNDTANST  160

Query  663  ggtsssYTFGAFAPKFIAYNISFQVT  740
            GGT++S+T   +AP FIAYNISFQ T
Sbjct  161  GGTANSFTIAIYAPNFIAYNISFQNT  186



>ref|XP_009609998.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase 15 [Nicotiana 
tomentosiformis]
Length=411

 Score =   281 bits (720),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 162/207 (78%), Gaps = 9/207 (4%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP P  G  G QA+A+ + GDQ+AFYGCGFYGAQD LND RGRHYFK+CFIQGSIDF
Sbjct  205   QNTAPSPMPGDVGAQAVAVRVGGDQAAFYGCGFYGAQDTLNDDRGRHYFKECFIQGSIDF  264

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVW---  1171
             IFG  RSLYE+C I+SIA EG  G+ GSITAQGR+SE EKSGFSF+ C   G+GKVW   
Sbjct  265   IFGNGRSLYEDCTISSIAKEGTSGVGGSITAQGRNSETEKSGFSFVNC---GNGKVWLGR  321

Query  1172  ---LGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRS  1342
                LGRAWG++ATVVFSK+ MS VVS D WNDW D TRDQ V+FGEY+C G GA+ + R 
Sbjct  322   AWGLGRAWGAFATVVFSKSYMSDVVSSDGWNDWRDPTRDQRVFFGEYECYGAGANYTFRV  381

Query  1343  SYAKQLDESEAAPFLTTSYIDGEDWLI  1423
              Y+KQL ++EAA ++  S+IDG++WL+
Sbjct  382   PYSKQLKQNEAALYMDVSFIDGQEWLL  408


 Score =   187 bits (475),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 145/207 (70%), Gaps = 2/207 (1%)
 Frame = +3

Query  126  MNTRSTSILFWLIAFTIAFFSltfs--lysnllttttvltvntpttllpflRSVVKQTGL  299
            M+T   +ILFW I   IA FS+  S     +   +    T    ++ L  L  V KQ GL
Sbjct  1    MSTTRRTILFWFITLVIALFSIILSFYSNHSSTNSAIENTSTESSSGLAILLRVFKQNGL  60

Query  300  DDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANF  479
            +DF ++  ++  AR  HHHHHH+RR    KCD+SKW+S LVSMY VS VITVDLNGCANF
Sbjct  61   EDFFNIFKEIIIARRHHHHHHHRRRRHKPKCDNSKWNSKLVSMYGVSRVITVDLNGCANF  120

Query  480  ASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANs  659
            +SVQKAIDA PDFS   +LII+DSGTY+EKV +  +K NLIIQGQGYLNT ISWNDTANS
Sbjct  121  SSVQKAIDAAPDFSSTRSLIILDSGTYKEKVVINPNKTNLIIQGQGYLNTIISWNDTANS  180

Query  660  tggtsssYTFGAFAPKFIAYNISFQVT  740
            TGGT++S+T   +A  FIAYNISFQ T
Sbjct  181  TGGTANSFTVAIYASNFIAYNISFQNT  207



>emb|CDP15307.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   308 bits (789),  Expect(2) = 9e-122, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP PS G  G QA+A+ I GD++AF+GCGFYGAQD LND RGRHYFK+CFIQGSIDF
Sbjct  206   RNTAPPPSPGVVGAQAVALRISGDKAAFFGCGFYGAQDTLNDDRGRHYFKECFIQGSIDF  265

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLYE+C INS+A E   GISG+ITAQGRDS  + SGFSF+ C V GSGKVWLGR
Sbjct  266   IFGNGRSLYEDCVINSVAKEVSSGISGAITAQGRDSTSDNSGFSFVNCNVEGSGKVWLGR  325

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWGS+ATVVFSKT MS VVS D WNDW D +RDQTV+FGEY C GPGA+ + R SY +QL
Sbjct  326   AWGSFATVVFSKTYMSDVVSSDGWNDWRDPSRDQTVFFGEYGCFGPGANYTFRVSYGRQL  385

Query  1361  DESEAAPFLTTSYIDGEDWLIPTPN  1435
              +SEAA FL  +YIDG++WL+P  N
Sbjct  386   KQSEAAAFLDVTYIDGQEWLLPPIN  410


 Score =   159 bits (402),  Expect(2) = 9e-122, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = +3

Query  273  RSVVKQTGLDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVIT  452
            R ++K++G +DF+ +I ++ + RS+HHH H +R+   N CDDS W S L++ Y VS V+T
Sbjct  52   RRMIKKSGSEDFMDIIQELARRRSRHHHSHRRRKKSKNSCDDSAWKSKLIATYGVSLVLT  111

Query  453  VDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTY-REKVAVKKSKINLIIQGQGYLNT  629
            VD  GCANF+SVQKA+DAVPDFS   TLII+DSGTY REKV V  +K NL+IQGQGYLNT
Sbjct  112  VDSKGCANFSSVQKAVDAVPDFSLGRTLIIVDSGTYSREKVMVSANKTNLMIQGQGYLNT  171

Query  630  AISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
             I+WNDTANSTGGT+ S T    +  F+AYNISF+ T
Sbjct  172  TIAWNDTANSTGGTAFSSTIAISSTNFVAYNISFRNT  208



>ref|XP_003553567.1| PREDICTED: probable pectinesterase 15-like [Glycine max]
Length=410

 Score =   298 bits (762),  Expect(2) = 8e-121, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 160/201 (80%), Gaps = 0/201 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP PS G  G QA+A+ + GDQ+AFYGCGFYGAQD LND  GRHYFK+CFIQGSIDF
Sbjct  198   KNTAPPPSPGVVGAQAVALRVTGDQAAFYGCGFYGAQDTLNDDGGRHYFKECFIQGSIDF  257

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSLYE+C IN +A E   GISGSITAQGR S  E+SGFSF+ C + GSG+VWLGR
Sbjct  258   IFGNARSLYEDCTINCVAKEEKDGISGSITAQGRQSMNEESGFSFVNCSIVGSGRVWLGR  317

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFS+T MS VV+PD WNDW D +RDQ+V+FGEY C GPGA+ ++R  YAKQL
Sbjct  318   AWGAYATVVFSRTYMSDVVAPDGWNDWRDPSRDQSVFFGEYRCLGPGANYTSRVPYAKQL  377

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              + EA  +   SYIDG DWL+
Sbjct  378   RDYEANSYTNISYIDGTDWLL  398


 Score =   166 bits (420),  Expect(2) = 8e-121, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 114/154 (74%), Gaps = 6/154 (4%)
 Frame = +3

Query  279  VVKQTGLDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVD  458
            ++K +G + F+S+I  + + R  H   H +      KCD SKWDS L+  YNVS V+TVD
Sbjct  53   IIKLSGAEHFMSLITSIARRRHHHRRSHKE------KCDRSKWDSKLIQDYNVSLVLTVD  106

Query  459  LNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAIS  638
            L GCANF+SVQKA+DAVP+ S   TLIIIDSGTYREKV V+ +K NLI+QGQGYLNT I 
Sbjct  107  LKGCANFSSVQKAVDAVPESSSDTTLIIIDSGTYREKVVVQANKTNLIVQGQGYLNTTIE  166

Query  639  WNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            WNDTANSTGGTS SY+F  FA KF AYNISF+ T
Sbjct  167  WNDTANSTGGTSYSYSFAVFASKFTAYNISFKNT  200



>gb|KHN02285.1| Putative pectinesterase 15 [Glycine soja]
Length=1110

 Score =   298 bits (763),  Expect(2) = 8e-121, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 160/201 (80%), Gaps = 0/201 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP PS G  G QA+A+ + GDQ+AFYGCGFYGAQD LND  GRHYFK+CFIQGSIDF
Sbjct  898   KNTAPPPSPGVVGAQAVALRVTGDQAAFYGCGFYGAQDTLNDDGGRHYFKECFIQGSIDF  957

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSLYE+C IN +A E   GISGSITAQGR S  E+SGFSF+ C + GSG+VWLGR
Sbjct  958   IFGNARSLYEDCTINCVAKEEKDGISGSITAQGRQSMNEESGFSFVNCSIVGSGRVWLGR  1017

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFS+T MS VV+PD WNDW D +RDQ+V+FGEY C GPGA+ ++R  YAKQL
Sbjct  1018  AWGAYATVVFSRTYMSDVVAPDGWNDWRDPSRDQSVFFGEYRCLGPGANYTSRVPYAKQL  1077

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              + EA  +   SYIDG DWL+
Sbjct  1078  RDYEANSYTNISYIDGTDWLL  1098


 Score =   166 bits (419),  Expect(2) = 8e-121, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 113/154 (73%), Gaps = 6/154 (4%)
 Frame = +3

Query  279  VVKQTGLDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVD  458
            ++K +G + F+S+I  + + R  H   H +      KCD SKWDS L+  YNVS V+TVD
Sbjct  753  IIKLSGAEHFMSLITSIARRRHHHRRSHKE------KCDRSKWDSKLIQDYNVSLVLTVD  806

Query  459  LNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAIS  638
            L GCANF+SVQKA+DAVP+ S   TLIIIDSGTYREKV V+ +K NLI+QGQGYLNT I 
Sbjct  807  LKGCANFSSVQKAVDAVPESSSDTTLIIIDSGTYREKVVVQANKTNLIVQGQGYLNTTIE  866

Query  639  WNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            WNDTANSTG TS SY+F  FA KF AYNISF+ T
Sbjct  867  WNDTANSTGYTSYSYSFVIFASKFTAYNISFKNT  900



>ref|XP_006339309.1| PREDICTED: probable pectinesterase 15-like [Solanum tuberosum]
Length=328

 Score =   293 bits (750),  Expect(2) = 9e-120, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 162/201 (81%), Gaps = 1/201 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP  S G  G QA+A+ + GD+SAFYGCGFYGAQD LND +GRHYFK+CFIQGSIDF
Sbjct  121   QNTAPAASPGDVGAQAVAVRVSGDESAFYGCGFYGAQDTLNDDKGRHYFKECFIQGSIDF  180

Query  1001  IFGKARSLYEECKINSIANEGGGG-ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLG  1177
             IFG ARSLYE+CKINSIA E   G I GSITAQGR+S+ E SGFSFL C + G+GK+WLG
Sbjct  181   IFGSARSLYEDCKINSIAKEETSGEIGGSITAQGRNSKNENSGFSFLNCVINGTGKIWLG  240

Query  1178  RAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             RAWGSYATV+FSKT MS V+S D WNDW D  +DQTV FGEYDC GPGA+ ++R SYAKQ
Sbjct  241   RAWGSYATVIFSKTYMSDVISSDGWNDWRDPNKDQTVLFGEYDCFGPGANYTDRVSYAKQ  300

Query  1358  LDESEAAPFLTTSYIDGEDWL  1420
             L ++EA  ++  S++DGE W+
Sbjct  301   LKQNEANQYMDISFVDGEQWI  321


 Score =   167 bits (423),  Expect(2) = 9e-120, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYRE  566
            KC++SKW+S L+S+Y VSHV+TVDLNGC NF+S+QKA+D+VPD S   TLI++DSGTY+E
Sbjct  6    KCENSKWNSKLISLYGVSHVLTVDLNGCGNFSSIQKAVDSVPDDSSTRTLILVDSGTYKE  65

Query  567  KVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            KV +  SK NLIIQGQGY NTAI+WNDTANSTGGT++S+T   +AP FIAYNISFQ T
Sbjct  66   KVVINSSKTNLIIQGQGYQNTAIAWNDTANSTGGTANSFTVAIYAPNFIAYNISFQNT  123



>ref|XP_007203100.1| hypothetical protein PRUPE_ppa023784mg [Prunus persica]
 gb|EMJ04299.1| hypothetical protein PRUPE_ppa023784mg [Prunus persica]
Length=423

 Score =   311 bits (796),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP P  G  G QA+A+ I GDQ+AFYGCGFYGAQD LND RGRHYF +CFIQGSIDF
Sbjct  201   QNTAPPPGPGRIGAQAVALRIAGDQAAFYGCGFYGAQDTLNDDRGRHYFSECFIQGSIDF  260

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFGKA+SLYE C INSIAN    GISG++TAQGR S +E+SGFSF+ C +GGSGKVWLGR
Sbjct  261   IFGKAKSLYEGCTINSIANAVKRGISGAVTAQGRQSAQEQSGFSFVNCSIGGSGKVWLGR  320

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFSKT MS VV+ D WNDW D +RDQTV FGEYDC G G++ ++R+SYA+QL
Sbjct  321   AWGAYATVVFSKTYMSDVVASDGWNDWRDPSRDQTVLFGEYDCMGSGSNYTHRTSYARQL  380

Query  1361  DESEAAPFLTTSYIDGEDWLIPTP  1432
             +ESE APFL  SY+DG +WL+  P
Sbjct  381   NESEVAPFLDISYVDGNEWLLHPP  404


 Score =   149 bits (376),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 134/208 (64%), Gaps = 8/208 (4%)
 Frame = +3

Query  126  MNTRSTSILFWLIAFTIAFFSltfsly---snllttttvltvntpttllpflRSVVKQTG  296
            M T++T + FW  AF IA  S   SL+   S+L +T+T+      +  L  L  V K++G
Sbjct  1    MRTKTT-LFFWFSAFVIALVSTIISLHHIPSSLSSTSTIAKSAQNSFKLAILDGVFKKSG  59

Query  297  LDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCAN  476
             +  LS +  +      HHHH  +R PK   C ++KW   LVS YNVS V+TV L GC N
Sbjct  60   -ESLLSTLRSIVSRHHHHHHHRRRRSPK---CANTKWKFRLVSEYNVSLVLTVGLKGCTN  115

Query  477  FASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTAN  656
            F+SVQKA+DA P+ S   TLIIIDSGTYREKV V  +K NLI QGQGYLNT I+WNDTAN
Sbjct  116  FSSVQKAVDAAPELSNYRTLIIIDSGTYREKVTVAANKTNLIFQGQGYLNTIIAWNDTAN  175

Query  657  stggtsssYTFGAFAPKFIAYNISFQVT  740
            STGGT+ S +   FAP F AYNISFQ T
Sbjct  176  STGGTARSSSVAIFAPYFTAYNISFQNT  203



>ref|XP_009780329.1| PREDICTED: probable pectinesterase 15 [Nicotiana sylvestris]
Length=410

 Score =   290 bits (742),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 162/201 (81%), Gaps = 0/201 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP P  G  G QALAI + GDQ+AFYGCGFYGAQD LND RGRHYFK+CFIQGSIDF
Sbjct  207   QNTAPTPLPGDVGAQALAIRVGGDQAAFYGCGFYGAQDTLNDDRGRHYFKECFIQGSIDF  266

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLYE+C I+SIA EG  G+ GSITAQG++SE EKSGFSF+ C + G+GKV LGR
Sbjct  267   IFGNGRSLYEDCTISSIAKEGTSGVGGSITAQGKNSETEKSGFSFVNCSIIGTGKVRLGR  326

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG++ATVVFS T MS VVS D WNDW D T+DQTV+FGEY+C G GA+ + R  Y+KQL
Sbjct  327   AWGAFATVVFSNTYMSDVVSSDGWNDWRDPTKDQTVFFGEYECYGAGANYTFRVPYSKQL  386

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              ++EAA ++  S+IDG++WL+
Sbjct  387   KQNEAALYMDVSFIDGQEWLL  407


 Score =   170 bits (430),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 139/213 (65%), Gaps = 11/213 (5%)
 Frame = +3

Query  123  MMNTRSTSILFWLIAFTIAFFSl--tfslysnllttttvltvntpttllpflRSVVKQTG  296
            M NTR T ILFW I   IA FS+  +     +   ++   T    +  L  L  V  Q+ 
Sbjct  1    MSNTRRT-ILFWFITLVIALFSIIFSLYFNHSSTNSSIENTSVESSLGLAILPRVFMQSV  59

Query  297  LDDFLSVIHQV-----KQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDL  461
            L+DF ++  ++           HHH   + +PK   CD+SKW+S LVS+Y VS VI+VDL
Sbjct  60   LEDFFNIFKEIIITRRHHHHHHHHHRRRRHKPK---CDNSKWNSKLVSIYGVSRVISVDL  116

Query  462  NGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISW  641
             GCANF++VQKAIDA PDFS   TLII+DSGTY+EK+ +  +K NLIIQGQGYLNT ISW
Sbjct  117  YGCANFSNVQKAIDAAPDFSSTRTLIILDSGTYKEKMVINPNKTNLIIQGQGYLNTIISW  176

Query  642  NDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            NDTANSTGGT++S+T   +A  FIAYNISFQ T
Sbjct  177  NDTANSTGGTANSFTVAIYASNFIAYNISFQNT  209



>ref|XP_008241442.1| PREDICTED: probable pectinesterase 15 [Prunus mume]
Length=394

 Score =   311 bits (796),  Expect(2) = 4e-119, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP P  G  G QA+A+ I GDQ+AFYGCGFYGAQD LND RGRHYF +CFIQGSIDF
Sbjct  172   QNTAPPPGPGRIGAQAVALRIAGDQAAFYGCGFYGAQDTLNDDRGRHYFSECFIQGSIDF  231

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFGKA+SLYE C INSIAN    GISG++TAQGR S +E+SGFSF+ C +GGSGKVWLGR
Sbjct  232   IFGKAKSLYEGCTINSIANPVKRGISGAVTAQGRQSAQEQSGFSFVNCSIGGSGKVWLGR  291

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFSKT MS VV+ D WNDW D +RDQTV FGEYDC G GA+ ++R+SYA+QL
Sbjct  292   AWGAYATVVFSKTYMSDVVASDGWNDWRDPSRDQTVLFGEYDCMGSGANYTHRTSYARQL  351

Query  1361  DESEAAPFLTTSYIDGEDWLIPTP  1432
             +ESEAAPF+  SY+DG +WL+  P
Sbjct  352   NESEAAPFVDISYVDGNEWLLHPP  375


 Score =   147 bits (372),  Expect(2) = 4e-119, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +3

Query  372  RPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDS  551
            R  + KC ++KW   LVS YNVS V+TV L GC NF+SVQKA+DA P+ S   TLIIIDS
Sbjct  52   RQWSPKCANTKWKFRLVSEYNVSLVLTVGLEGCTNFSSVQKAVDAAPELSNYRTLIIIDS  111

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            GTYREKV V  +K NLI QGQGYLNT I+WNDTANSTGGT+ S +   FAP F AYNISF
Sbjct  112  GTYREKVTVAANKTNLIFQGQGYLNTIIAWNDTANSTGGTARSSSVAIFAPYFTAYNISF  171

Query  732  QVT  740
            Q T
Sbjct  172  QNT  174



>ref|XP_011077480.1| PREDICTED: probable pectinesterase 15 [Sesamum indicum]
Length=432

 Score =   291 bits (746),  Expect(2) = 8e-119, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 160/201 (80%), Gaps = 1/201 (0%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             NTAP P  G  GGQA+A+ + GDQSAFYGCGFYGAQD LND +GRHY+K+C+IQGSIDFI
Sbjct  210   NTAPAPDPGEVGGQAVALRVSGDQSAFYGCGFYGAQDTLNDDQGRHYYKECYIQGSIDFI  269

Query  1004  FGKARSLYEECKINSIANE-GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             FG  RSL+E+C INS A E   GGISG ITA GRDS  EK+GF+F+ C + GSGKVWLGR
Sbjct  270   FGNGRSLFEDCTINSTAKEVSSGGISGCITAHGRDSANEKTGFAFVNCSISGSGKVWLGR  329

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG YAT +F KT MS+ V+ + WNDW DS+RDQTV FGEY+C GPGA+ + R +Y KQL
Sbjct  330   AWGHYATTIFLKTYMSEAVAAEGWNDWRDSSRDQTVSFGEYECYGPGANSTYRVAYGKQL  389

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              +SEAAP+L  S+IDGE+WL+
Sbjct  390   KQSEAAPYLDVSFIDGEEWLV  410


 Score =   166 bits (419),  Expect(2) = 8e-119, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 119/158 (75%), Gaps = 4/158 (3%)
 Frame = +3

Query  279  VVKQTGLDDFL-SVIHQVKQARSKhhhhhhK---RRPKANKCDDSKWDSPLVSMYNVSHV  446
            V ++ G++D + S++ ++  +R  HHHHHH    RR   + C+DS W S L+S+YNVS V
Sbjct  54   VARKLGVEDIVVSILERIVYSRHHHHHHHHHHHHRRGNESSCNDSLWKSDLISLYNVSVV  113

Query  447  ITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLN  626
             TVD  GCANF+S+QKAIDA+PDFS   TLII+DSGTYREKV V  +K  LI+QGQGYLN
Sbjct  114  YTVDTKGCANFSSMQKAIDALPDFSHSWTLIILDSGTYREKVVVSSNKTKLIVQGQGYLN  173

Query  627  TAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            TAI+WNDTANSTGGTS S TF  FAP F+AYNISF  T
Sbjct  174  TAIAWNDTANSTGGTSYSSTFATFAPSFVAYNISFMNT  211



>gb|EYU38584.1| hypothetical protein MIMGU_mgv1a007131mg [Erythranthe guttata]
Length=418

 Score =   307 bits (786),  Expect(2) = 1e-118, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 170/211 (81%), Gaps = 3/211 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             NTAP P  G  GGQALA+ + GD+SAFYGCGFYGAQD LND +GRHY+K+CFIQGSIDFI
Sbjct  197   NTAPAPDPGEVGGQALALRVSGDKSAFYGCGFYGAQDTLNDDQGRHYYKECFIQGSIDFI  256

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSL+E+C INS A +    GGG+SGSITAQGRDS  EKSGFSF+KC + GSGKVWL
Sbjct  257   FGNARSLFEDCTINSTAKDVSLAGGGVSGSITAQGRDSANEKSGFSFVKCSIRGSGKVWL  316

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAWG Y+T +FSKT MS+VV+ + WNDW DS+RDQTV FGEY+C GPGA+ +NR  Y K
Sbjct  317   GRAWGHYSTTIFSKTYMSEVVAAEGWNDWRDSSRDQTVMFGEYECYGPGANSTNRVGYGK  376

Query  1355  QLDESEAAPFLTTSYIDGEDWLIPTPNTAYI  1447
             QL +SEAAP+L  S+IDGE+WL+   N+ + 
Sbjct  377   QLRQSEAAPYLDVSFIDGEEWLLDNDNSLHF  407


 Score =   149 bits (377),  Expect(2) = 1e-118, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +3

Query  297  LDDFLSVIHQV--KQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGC  470
            LD+  S++ ++  K     +HHHH+  R +   C+++ W S L+S+YNV+ V TVD  GC
Sbjct  49   LDEIFSILRRIVYKGHHHHNHHHHNHTRRQNVSCNENIWKSSLISLYNVTSVFTVDSKGC  108

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
            ANF++VQKA+D+ PDFS   TLII+ SGTYREK+ +  +K NLI+QGQGYL TAI WNDT
Sbjct  109  ANFSTVQKAVDSAPDFSRAWTLIIVGSGTYREKIEISSNKTNLIVQGQGYLKTAIEWNDT  168

Query  651  ANstggtsssYTFGAFAPKFIAYNISFQVT  740
            ANSTGGTS S TF   AP FIAYNISF  T
Sbjct  169  ANSTGGTSYSSTFAVSAPNFIAYNISFMNT  198



>ref|XP_007162815.1| hypothetical protein PHAVU_001G183100g [Phaseolus vulgaris]
 gb|ESW34809.1| hypothetical protein PHAVU_001G183100g [Phaseolus vulgaris]
Length=416

 Score =   293 bits (750),  Expect(2) = 3e-118, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 164/213 (77%), Gaps = 4/213 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP PS G  G QA+A+ + GD++AFYGCGFYGAQD LND  GRHYFK+C IQGSIDF
Sbjct  204   KNTAPPPSPGVVGAQAVALRVTGDKAAFYGCGFYGAQDTLNDDGGRHYFKECLIQGSIDF  263

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSLYE+C IN +A E    ISGSITAQGR S +E+SGFSF+ C + GSG+VWLGR
Sbjct  264   IFGNARSLYEDCTINCVAKEEKDEISGSITAQGRKSMDEESGFSFVNCSIVGSGRVWLGR  323

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG YATV+FS T MS V++P+ WNDW D +RDQ+V+FGEY C GPGA+  +R SYAKQL
Sbjct  324   AWGPYATVIFSTTYMSDVIAPEGWNDWRDPSRDQSVFFGEYRCHGPGANYESRVSYAKQL  383

Query  1361  DESEAAPFLTTSYIDGEDWLIPTP----NTAYI  1447
              ++EA  ++  SYIDG DWL+  P    N +YI
Sbjct  384   RDNEANSYMDISYIDGNDWLLSYPQSYVNPSYI  416


 Score =   162 bits (410),  Expect(2) = 3e-118, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 118/154 (77%), Gaps = 1/154 (1%)
 Frame = +3

Query  279  VVKQTGLDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVD  458
            ++K +G  D +S+I  + + R +HHHHHH+ R K  KCD +KWDS L+  YNVS V TVD
Sbjct  54   IIKLSGAQDLVSLITSIARRRHRHHHHHHRGRHK-EKCDGAKWDSRLIQHYNVSLVFTVD  112

Query  459  LNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAIS  638
            L GCANF+SVQKA+DAVP+ S   TLIIIDSGTYREKV V+ +K NLIIQGQGYLNT + 
Sbjct  113  LKGCANFSSVQKAVDAVPESSSDTTLIIIDSGTYREKVVVQGNKTNLIIQGQGYLNTIVE  172

Query  639  WNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            WNDTANSTGGTS SY+F  FA  F AYNISF+ T
Sbjct  173  WNDTANSTGGTSYSYSFAIFASMFTAYNISFKNT  206



>ref|XP_009341090.1| PREDICTED: probable pectinesterase 15 [Pyrus x bretschneideri]
Length=418

 Score =   312 bits (799),  Expect(2) = 5e-116, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP P+ G  G QA+A+ I GDQ+AFYGCGFYGAQD LND RGRHYF++CFIQGSIDF
Sbjct  197   QNTAPPPAPGRIGAQAVALRIAGDQAAFYGCGFYGAQDTLNDDRGRHYFRECFIQGSIDF  256

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFGKARSLYE C +NSIAN    GISG+ITAQGR S +E+SGFSF+ C V GSGKVWLGR
Sbjct  257   IFGKARSLYEGCILNSIANAVKSGISGAITAQGRQSMQEQSGFSFVNCSVEGSGKVWLGR  316

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFSKT MS VV+ D WNDW D +RDQTV FGEYDC G GA+ + R SY +QL
Sbjct  317   AWGAYATVVFSKTYMSDVVASDGWNDWKDPSRDQTVLFGEYDCMGSGANYTYRVSYGRQL  376

Query  1361  DESEAAPFLTTSYIDGEDWLIPTP  1432
             +ESEAAPFL  SYIDG DWL+  P
Sbjct  377   NESEAAPFLDISYIDGNDWLLHPP  400


 Score =   135 bits (341),  Expect(2) = 5e-116, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 121/206 (59%), Gaps = 11/206 (5%)
 Frame = +3

Query  132  TRSTSILFWLIAFTIAFFSltfslysn--llttttvltvntpttllpflRSVVKQTGLDD  305
            T  T++ FWL AF IA  S    L     L  T+ +      +  L     V +QTG + 
Sbjct  2    TTKTTLFFWLSAFAIALLSTFKCLPLTPFLSPTSIISESARNSFKLAIFDQVFEQTG-ES  60

Query  306  FLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKW-DSPLVSMYNVSHVITVDLNGCANFA  482
             LS +  +      H         + + CD +K  +S  +S YNVS V+TV   GC+NF 
Sbjct  61   LLSTLTSIVSRHHHHRQ-------RRHTCDQTKRKNSRFMSEYNVSLVLTVGFKGCSNFV  113

Query  483  SVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANst  662
            SVQ A+DAVP+ S   TLIII+SGTYREKV V  +K NLIIQGQGYLNT I+WNDTANST
Sbjct  114  SVQSAVDAVPELSINKTLIIINSGTYREKVTVSANKTNLIIQGQGYLNTIIAWNDTANST  173

Query  663  ggtsssYTFGAFAPKFIAYNISFQVT  740
            GGT+ S +   FAP F AYNISFQ T
Sbjct  174  GGTAFSSSVAIFAPCFTAYNISFQNT  199



>ref|XP_010683975.1| PREDICTED: probable pectinesterase 15 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=418

 Score =   298 bits (764),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 161/207 (78%), Gaps = 0/207 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAPQPS G  GGQA+A+ I  D++AFY C FYGAQD LND RGRHYFK CFIQGSIDF
Sbjct  193   QNTAPQPSPGDEGGQAVALKISSDRAAFYSCAFYGAQDTLNDDRGRHYFKDCFIQGSIDF  252

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG+ARS YE C I SIA     G+ GSITA GR S++E +GFSFL C + GSG++WLGR
Sbjct  253   IFGEARSFYENCTIKSIAQGNPQGVDGSITAHGRQSKDENTGFSFLNCNISGSGRIWLGR  312

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG Y+TV+F+KT MS+VVSPD WNDW D +RD T++FGEY+C GPGA+  NR SY+K L
Sbjct  313   AWGVYSTVIFAKTYMSEVVSPDGWNDWKDPSRDSTIFFGEYECTGPGANYENRVSYSKHL  372

Query  1361  DESEAAPFLTTSYIDGEDWLIPTPNTA  1441
              E E AP++  SYIDG +WL+P P+ +
Sbjct  373   KEYEVAPYINISYIDGNEWLLPDPSLS  399


 Score =   148 bits (374),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 105/160 (66%), Gaps = 6/160 (4%)
 Frame = +3

Query  279  VVKQTGLDDFLSVIHQVKQARSKhhhhhhKRRPKANK------CDDSKWDSPLVSMYNVS  440
            VVKQ    DFL V+  ++       HHHH      N        D S W S L S+Y VS
Sbjct  36   VVKQVTFHDFLGVLKDIRGGGFWSKHHHHHHHHHGNGSTHEMCADQSMWRSTLPSLYRVS  95

Query  441  HVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGY  620
              +TVDL+GC NF SVQKA+DAVPD S  +TLIII+SG YREKV + ++K NLII+GQGY
Sbjct  96   QTLTVDLDGCGNFTSVQKAVDAVPDLSSSSTLIIINSGLYREKVMINENKTNLIIEGQGY  155

Query  621  LNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
             NT +SWNDT+NSTGGT  S +   FAP FIAYNISFQ T
Sbjct  156  ENTILSWNDTSNSTGGTIYSASVTIFAPGFIAYNISFQNT  195



>ref|XP_010037120.1| PREDICTED: probable pectinesterase 15 [Eucalyptus grandis]
Length=402

 Score =   296 bits (757),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 159/200 (80%), Gaps = 0/200 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP PS G  GGQA+A+ I GD++AF+GCGFYGAQD L+D  GRHYF  CFI+GSIDF
Sbjct  190   QNTAPSPSPGDVGGQAVALRIAGDEAAFFGCGFYGAQDTLHDDAGRHYFGDCFIEGSIDF  249

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSLYE C INSIA +   GISG+ITAQGRDS  E +GFSF+ C +GGSG+VWLGR
Sbjct  250   IFGNARSLYEGCTINSIAKDVTAGISGAITAQGRDSGSEHTGFSFVNCRIGGSGRVWLGR  309

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFSKT MS +V P+ WNDW D +RD+TV+FGEYDCRGPGA+ + R  Y + L
Sbjct  310   AWGAYATVVFSKTYMSDIVDPEGWNDWRDPSRDETVFFGEYDCRGPGANYTTRVEYGRLL  369

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
               SEA+ FL  SYIDG DWL
Sbjct  370   KPSEASLFLDISYIDGHDWL  389


 Score =   150 bits (380),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 107/148 (72%), Gaps = 5/148 (3%)
 Frame = +3

Query  297  LDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCAN  476
            +++ LSV+  +   R  +HH     RP   +CD S W S +++ Y V  V+TVDL GCAN
Sbjct  50   VEEILSVVTSLIMPRHHNHHLT---RPV--ECDGSIWKSKVINDYQVGLVLTVDLKGCAN  104

Query  477  FASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTAN  656
            F+SVQ+A+DAVPDFSP  TLI++DSGTYREKV V  SK N+I++GQGYLNTAI+WNDTAN
Sbjct  105  FSSVQRAVDAVPDFSPSRTLILLDSGTYREKVVVNASKTNIILEGQGYLNTAIAWNDTAN  164

Query  657  stggtsssYTFGAFAPKFIAYNISFQVT  740
            STGGT  S +   FA  F AYNISFQ T
Sbjct  165  STGGTIYSPSVAVFADNFTAYNISFQNT  192



>ref|XP_006381362.1| hypothetical protein POPTR_0006s12170g [Populus trichocarpa]
 gb|ERP59159.1| hypothetical protein POPTR_0006s12170g [Populus trichocarpa]
Length=419

 Score =   292 bits (747),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 158/200 (79%), Gaps = 0/200 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP PS G  GGQA+A+ I GD++AFYGCGFYGAQD L+D  GRHYF+ CFIQGSIDF
Sbjct  196   KNTAPWPSPGEVGGQAVALRIAGDKAAFYGCGFYGAQDTLHDDSGRHYFRGCFIQGSIDF  255

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSLY+ C I+SIA +   G+SGSITAQ R S  E++GFSF+ C V GSGKVWLGR
Sbjct  256   IFGNARSLYQSCTISSIAEQPKAGVSGSITAQARQSVSEQTGFSFVNCTVIGSGKVWLGR  315

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFSKT MS  VS D WNDW D +RDQT +FGEY+C GPGA+ + R+SY KQL
Sbjct  316   AWGAYATVVFSKTYMSHAVSSDGWNDWRDPSRDQTAFFGEYECFGPGANFTFRASYGKQL  375

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EAAP++  SYIDG  WL
Sbjct  376   TQYEAAPYMDISYIDGNQWL  395


 Score =   151 bits (382),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 131/204 (64%), Gaps = 9/204 (4%)
 Frame = +3

Query  135  RSTSILFWLIAFTIAFFSltfslysnllttttvl-tvntpttllpflRSVVKQTGLDDFL  311
            R  +I FWL+AF IA  S+  +LY    + +T     N  ++ L  L+ V+K++GL+ F 
Sbjct  2    RIKAISFWLLAFAIALVSIVIALYEISPSPSTGTPISNLHSSSLTTLKRVIKKSGLEVFH  61

Query  312  SVIHQVKQARSKhhhhhhKRRPKANKCDDSKW-DSPLVSMYNVSHVITVDLNGCANFASV  488
            S++       +     HH RR    KCD +KW  S L+  Y VS V+TVDL GC NF+S+
Sbjct  62   SLV-------ASSFSRHHHRRKHKIKCDMNKWISSRLIYRYKVSLVLTVDLKGCGNFSSI  114

Query  489  QKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstgg  668
            Q+A+D VP+ S   TLII+DSGTYREKV V   K NLI+ GQGYLNTAI+WNDTANSTGG
Sbjct  115  QEAVDVVPELSSSTTLIIMDSGTYREKVTVHAKKTNLILLGQGYLNTAIAWNDTANSTGG  174

Query  669  tsssYTFGAFAPKFIAYNISFQVT  740
            T  S +   FA  FIAYNISF+ T
Sbjct  175  TVYSASVAIFASNFIAYNISFKNT  198



>ref|XP_008387553.1| PREDICTED: probable pectinesterase 15 [Malus domestica]
Length=430

 Score =   309 bits (792),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP P+ G  G QA+A+ I GDQ+AFYGCGFYGAQD LND RGRHYF++CFIQGSIDF
Sbjct  197   QNTAPPPAPGRIGAQAVALRIAGDQAAFYGCGFYGAQDXLNDDRGRHYFRECFIQGSIDF  256

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFGKARSLYE C +NSIAN    GISG+ITAQGR S +E+SGFSF+ C VGGSG VWLGR
Sbjct  257   IFGKARSLYEGCILNSIANAVKSGISGAITAQGRQSMQEQSGFSFVNCSVGGSGTVWLGR  316

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFSKT MS VV+ D WNDW D +RD TV FGEYDC G GA+ + R SY +QL
Sbjct  317   AWGAYATVVFSKTYMSDVVASDGWNDWKDPSRDPTVLFGEYDCMGSGANYTYRVSYGRQL  376

Query  1361  DESEAAPFLTTSYIDGEDWLIPTP  1432
             +ESEAAPFL  SYIDG DWL+  P
Sbjct  377   NESEAAPFLDISYIDGNDWLLHPP  400


 Score =   133 bits (335),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 123/206 (60%), Gaps = 11/206 (5%)
 Frame = +3

Query  132  TRSTSILFWLIAFTIAFFSltfslysn--llttttvltvntpttllpflRSVVKQTGLDD  305
            T  T++ FWL AF IA  S    L     L  T+ +      +  L     V +QTG + 
Sbjct  2    TTKTTLFFWLSAFAIALLSTFKCLPLTPFLSPTSIISESARNSFKLAIFDQVFEQTG-ES  60

Query  306  FLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKW-DSPLVSMYNVSHVITVDLNGCANFA  482
             LS +  +          HH  R + + CD +K  +S  +S YNVS V+TV   GC+NF+
Sbjct  61   LLSTLTSI-------VARHHHHRQRRHTCDQTKRKNSRFMSEYNVSLVLTVGFKGCSNFS  113

Query  483  SVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANst  662
            SVQ A+DAVP+ S   TLIII+SG YREKV V  +K NLIIQGQGYLNT I+WNDTANST
Sbjct  114  SVQNAVDAVPELSINRTLIIINSGIYREKVTVSANKTNLIIQGQGYLNTIIAWNDTANST  173

Query  663  ggtsssYTFGAFAPKFIAYNISFQVT  740
            GGT+ S +   FAP F AYNISFQ T
Sbjct  174  GGTAFSSSVAIFAPCFTAYNISFQNT  199



>ref|XP_007027515.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY08017.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=400

 Score =   292 bits (747),  Expect(2) = 3e-114, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 158/200 (79%), Gaps = 0/200 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP+PS G TG QA+A+ I GDQ+AFY CGFYGAQD L D RGRHYFK CFIQGSIDF
Sbjct  199   KNTAPEPSPGETGKQAVALRIAGDQAAFYNCGFYGAQDTLLDDRGRHYFKGCFIQGSIDF  258

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSLYE C I+SIA EG  G+ G ITAQ R S  E++GFSF+ C + G+G VWLGR
Sbjct  259   IFGNARSLYEGCVIHSIAKEGTSGVGGCITAQARQSMNEQTGFSFVDCIIRGTGTVWLGR  318

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFS+T MS VV+PD WNDW D TRDQTV FGEY+C GPGA+ + R+SY KQL
Sbjct  319   AWGAYATVVFSRTYMSDVVAPDGWNDWRDPTRDQTVLFGEYECLGPGANYTFRASYGKQL  378

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              E EAA ++  SYIDG +WL
Sbjct  379   IEYEAAAYMNISYIDGNEWL  398


 Score =   150 bits (378),  Expect(2) = 3e-114, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 136/207 (66%), Gaps = 12/207 (6%)
 Frame = +3

Query  135  RSTSILFWLIAFTIAFFSltfslysnllttttvltvntpttllpflRSVVKQTGLDDFLS  314
            R  +I FWL+AF I  FS+  +LY+    + + +T ++  +       V +Q+G  +FLS
Sbjct  2    RIKTISFWLLAFLIPLFSILIALYTVPPPSKSSVTPDSHDSF-----EVARQSG--EFLS  54

Query  315  VIHQV-----KQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANF  479
            ++ ++           HHHHHH R  + +KCD +KW S L+S Y VS V+TVD NGCANF
Sbjct  55   LLTRMVSRHHHHHHHHHHHHHHHRGRRKHKCDHNKWTSSLISQYKVSLVLTVDSNGCANF  114

Query  480  ASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANs  659
            +SVQ+AID VPD SP  TLI+I SGTYREKV +  +K NLIIQG+G+L TAI WNDTA+S
Sbjct  115  SSVQQAIDVVPDSSPSKTLIVIYSGTYREKVVIHANKSNLIIQGEGFLKTAIEWNDTADS  174

Query  660  tggtsssYTFGAFAPKFIAYNISFQVT  740
            TGGT  S +   FAP F  YNISF+ T
Sbjct  175  TGGTVYSSSVAIFAPNFTVYNISFKNT  201



>ref|XP_009631933.1| PREDICTED: probable pectinesterase 15 isoform X2 [Nicotiana tomentosiformis]
Length=358

 Score =   244 bits (622),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP  S G  G QA+A+ + GD+ AFYGCGFYGAQD LND RGRHYFK CFIQGSIDF
Sbjct  189   QNTAPSASPGDVGAQAVALRVTGDEVAFYGCGFYGAQDTLNDDRGRHYFKDCFIQGSIDF  248

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLYE+C+INSIA E  GGI GSITAQGR+S+ E SGFSF+ C + GSGK+WLGR
Sbjct  249   IFGNGRSLYEDCRINSIAKEETGGIGGSITAQGRNSQNENSGFSFVNCAINGSGKIWLGR  308

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVY  1291
             AWG+YATVVFSKT MS VVS D WNDW DSTRD  ++
Sbjct  309   AWGAYATVVFSKTYMSNVVSSDGWNDWRDSTRDHIIW  345


 Score =   196 bits (498),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 145/205 (71%), Gaps = 14/205 (7%)
 Frame = +3

Query  126  MNTRSTSILFWLIAFTIAFFSltfslysnllttttvltvntpttllpflRSVVKQTGLDD  305
            MNT   +I FW IAFTIA FS+ F LYSN  + T     +T   L    R VV+++GL D
Sbjct  1    MNTTRRTIFFWFIAFTIALFSIIFPLYSNYNSPTNNAIESTSFPLALLKR-VVEKSGLQD  59

Query  306  FLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFAS  485
            F  +  ++              R   +KCDDSKW+S L+S+Y VSHV+TVDLNGCANF+S
Sbjct  60   FFCIFQEIT-------------RLHNSKCDDSKWNSKLISVYGVSHVLTVDLNGCANFSS  106

Query  486  VQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstg  665
            +QKA+DAVPD +P  TLI++DSGTY+EKV +  +K NLIIQGQGYLNTAI+WNDTANSTG
Sbjct  107  IQKAVDAVPDDNPTRTLILVDSGTYKEKVVINTNKTNLIIQGQGYLNTAIAWNDTANSTG  166

Query  666  gtsssYTFGAFAPKFIAYNISFQVT  740
            GT++S+T   +AP FIAYNISFQ T
Sbjct  167  GTANSFTVAIYAPNFIAYNISFQNT  191



>ref|XP_004137990.1| PREDICTED: probable pectinesterase 15-like [Cucumis sativus]
 ref|XP_004171894.1| PREDICTED: probable pectinesterase 15-like [Cucumis sativus]
 gb|KGN59019.1| hypothetical protein Csa_3G745520 [Cucumis sativus]
Length=409

 Score =   276 bits (706),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 158/202 (78%), Gaps = 1/202 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP+ + G  GGQA+A+ I GD++AFYGCGFYGAQD L D +GRHYFK+CFIQGSIDF
Sbjct  197   KNTAPEATPGTVGGQAVAVRIAGDEAAFYGCGFYGAQDTLYDDKGRHYFKECFIQGSIDF  256

Query  1001  IFGKARSLYEECKINSIANEG-GGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLG  1177
             IFG ARSLY+ C+I SIA E  GGG+SG+ITA GR +  E++GF+F+ C + GSGKVWLG
Sbjct  257   IFGNARSLYDGCRIKSIAKEVLGGGVSGAITAHGRQTRSEETGFAFINCTISGSGKVWLG  316

Query  1178  RAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             RAWG+ ATVVFSKT M+ VV+ D WNDW D +RDQ+V FGEY+C G GA+   R  Y+KQ
Sbjct  317   RAWGACATVVFSKTYMTDVVAVDGWNDWRDPSRDQSVLFGEYECFGDGANYRLRVPYSKQ  376

Query  1358  LDESEAAPFLTTSYIDGEDWLI  1423
             L++ EA  +L  SY+DG  WLI
Sbjct  377   LNQVEAQHYLDVSYVDGNQWLI  398


 Score =   163 bits (413),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 112/155 (72%), Gaps = 7/155 (5%)
 Frame = +3

Query  276  SVVKQTGLDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITV  455
            S+VK +GLD+ LS+   V Q  SK  +     +     CD+ KWDS L+S+YNVS  +TV
Sbjct  52   SIVKGSGLDEILSL---VTQYLSKTQYQWRDEK----SCDEKKWDSKLISLYNVSLTLTV  104

Query  456  DLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAI  635
            DL GCANF+SVQ A+DAVPD+    TLI+IDSG YREKV ++ +K NLII+GQGYLNTAI
Sbjct  105  DLKGCANFSSVQTAVDAVPDYGSSRTLILIDSGIYREKVVIEANKTNLIIEGQGYLNTAI  164

Query  636  SWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
             WNDTANSTGGT+ S +   FA  FIAYNISF+ T
Sbjct  165  EWNDTANSTGGTTYSSSVTIFASNFIAYNISFKNT  199



>ref|XP_004494018.1| PREDICTED: probable pectinesterase 15-like [Cicer arietinum]
Length=404

 Score =   283 bits (725),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 156/201 (78%), Gaps = 0/201 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP  S G  G QA+A+ + GDQ+AFYGCGFYGAQD LND  GRHYFK CFIQGSIDF
Sbjct  200   KNNAPTASPGEVGAQAVALRVSGDQTAFYGCGFYGAQDTLNDDAGRHYFKDCFIQGSIDF  259

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSLYE+C I SIA +   G+ GSITAQGR S +E++GFSF+ C + GSGKVWLGR
Sbjct  260   IFGNARSLYEDCTIKSIAKQDTVGVDGSITAQGRQSLKEQTGFSFVNCNIVGSGKVWLGR  319

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG++ATVVFS T MS VV+ + WNDW D +RDQ+V+FGEY C GPGA+ ++R  YA+QL
Sbjct  320   AWGTFATVVFSTTNMSDVVAAEGWNDWRDPSRDQSVFFGEYHCIGPGANYTSRVFYARQL  379

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              + EA  ++  SYIDG DWL+
Sbjct  380   KDYEAISYMNVSYIDGNDWLL  400


 Score =   155 bits (393),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 110/152 (72%), Gaps = 5/152 (3%)
 Frame = +3

Query  279  VVKQTGLDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVD  458
            ++K +G+ DF+S++     +R  H      R+    KCD +KW S ++  YN S V TVD
Sbjct  54   IIKLSGVQDFVSLLITSIASRRHH-----HRKWHKEKCDKTKWASNIILYYNASLVFTVD  108

Query  459  LNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAIS  638
            L G ANF+SVQKA+DAVP+ S   T+I+I+SGTYREKV V+ +K NL++QGQGYLNT I 
Sbjct  109  LKGFANFSSVQKAVDAVPESSSDTTIILINSGTYREKVVVEANKTNLVLQGQGYLNTIIE  168

Query  639  WNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            WNDTANSTGGTS SY+FG FA KF AYNISF+
Sbjct  169  WNDTANSTGGTSYSYSFGVFASKFTAYNISFK  200



>ref|XP_008442748.1| PREDICTED: putative pectinesterase 14 isoform X1 [Cucumis melo]
Length=409

 Score =   280 bits (717),  Expect(2) = 4e-113, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 163/212 (77%), Gaps = 1/212 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP+ + G  GGQA+A+ I GD++AFYGCGFYGAQD L D +GRHYFK CFIQGSIDF
Sbjct  197   KNTAPEATPGIVGGQAVAVRIAGDKAAFYGCGFYGAQDTLYDDKGRHYFKTCFIQGSIDF  256

Query  1001  IFGKARSLYEECKINSIANEG-GGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLG  1177
             IFG ARSLY+ C+I SIA E  GGG+SG+ITAQGR +  E++GF+F+ C + GSGKVWLG
Sbjct  257   IFGNARSLYDGCRIKSIAKEVLGGGVSGAITAQGRQTRSEETGFAFINCTISGSGKVWLG  316

Query  1178  RAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             RAWG+ ATV+FSKT M+ VV  D WNDW D +RDQ+V FGEY+C G GA+ S R  Y+KQ
Sbjct  317   RAWGACATVIFSKTYMTDVVVDDGWNDWRDPSRDQSVLFGEYECFGDGANYSLRVPYSKQ  376

Query  1358  LDESEAAPFLTTSYIDGEDWLIPTPNTAYITT  1453
             L++ EA P+L  SYIDG  WL     T+ ++T
Sbjct  377   LNQIEAQPYLDVSYIDGNQWLTNQQITSTLST  408


 Score =   157 bits (398),  Expect(2) = 4e-113, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 113/155 (73%), Gaps = 7/155 (5%)
 Frame = +3

Query  276  SVVKQTGLDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITV  455
            S+VK++GLD+ LS+   V Q  SK  +    ++     CD+ KWDS L+S+YNVS  +TV
Sbjct  52   SLVKESGLDEILSL---VTQYLSKPQYQWRDKK----SCDEKKWDSKLISLYNVSLTLTV  104

Query  456  DLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAI  635
            DL GCANF+SVQ A+DAVPD+    TLI+I+SG YREKV ++ +K NLII+GQ YL+TAI
Sbjct  105  DLKGCANFSSVQTAVDAVPDYGSSRTLILINSGVYREKVVIEANKTNLIIEGQSYLDTAI  164

Query  636  SWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
             WNDTANSTGGT+ S +   FA  FIAYNISF+ T
Sbjct  165  EWNDTANSTGGTTYSSSVTIFASNFIAYNISFKNT  199



>ref|XP_004494095.1| PREDICTED: probable pectinesterase 15-like [Cicer arietinum]
Length=404

 Score =   288 bits (737),  Expect(2) = 6e-112, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 159/205 (78%), Gaps = 3/205 (1%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN+AP  S G  G QA+A+ + GDQ+AFYGCGFYGAQD LND  GRHYFK CFIQGSIDF
Sbjct  200   KNSAPTASPGEVGAQAVALRVSGDQTAFYGCGFYGAQDTLNDDTGRHYFKDCFIQGSIDF  259

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSLYE+C I SIA +   G+ GSITAQGR S +E++GFSF+ C + GSGKVWLGR
Sbjct  260   IFGNARSLYEDCTIKSIAKQDTIGVDGSITAQGRQSLKEQTGFSFVNCNIVGSGKVWLGR  319

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG++ATVVFS T MS VV+ + WNDW D +RDQ+V+FGEY C GPGAD ++R SYAKQL
Sbjct  320   AWGTFATVVFSTTSMSDVVAAEGWNDWKDPSRDQSVFFGEYRCIGPGADYTSRVSYAKQL  379

Query  1361  DESEAAPFLTTSYIDGEDWLIPTPN  1435
              + EA  ++  SYIDG DWL   PN
Sbjct  380   KDYEAISYMNVSYIDGNDWL---PN  401


 Score =   146 bits (368),  Expect(2) = 6e-112, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 108/152 (71%), Gaps = 5/152 (3%)
 Frame = +3

Query  279  VVKQTGLDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVD  458
            ++K + + DF+S++     +R  H      R+    KC+ +KW S ++  +N S V TVD
Sbjct  54   IIKLSEVQDFVSLLITSTASRRHHL-----RKWHKEKCEKTKWASNIILDHNASLVFTVD  108

Query  459  LNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAIS  638
            L G ANF+SVQKAIDAVP+ +   T+I+I+SGTYREKV V  +K NL++QG+GYLNT I 
Sbjct  109  LEGFANFSSVQKAIDAVPESNSHTTIILINSGTYREKVVVLANKTNLVLQGEGYLNTIIE  168

Query  639  WNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            WNDTANSTGGTS SY+FG FA KF AYNISF+
Sbjct  169  WNDTANSTGGTSYSYSFGVFASKFTAYNISFK  200



>ref|XP_011018831.1| PREDICTED: probable pectinesterase 15 isoform X1 [Populus euphratica]
Length=416

 Score =   290 bits (742),  Expect(2) = 7e-112, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 157/200 (79%), Gaps = 0/200 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP PS G  GGQA+A+ I GD++AFYGCGFYGAQD L+D  GRHYF+ CFIQGSIDF
Sbjct  196   KNTAPWPSPGEVGGQAVALRIAGDKAAFYGCGFYGAQDTLHDDSGRHYFRGCFIQGSIDF  255

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSLY+ C I+SIA +   G+SGSITAQ R S  E++GFSF+ C V GSGKVWLGR
Sbjct  256   IFGNARSLYQSCTISSIAEQPKAGVSGSITAQARQSVSEQTGFSFVNCTVIGSGKVWLGR  315

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVF KT MS  VS D WNDW D +RDQT +FGEY+C GPGA+ + R+SY KQL
Sbjct  316   AWGAYATVVFCKTYMSHAVSSDGWNDWRDPSRDQTAFFGEYECFGPGANFTFRASYGKQL  375

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EAAP++  SYIDG  WL
Sbjct  376   TQYEAAPYMDISYIDGNQWL  395


 Score =   144 bits (362),  Expect(2) = 7e-112, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 106/155 (68%), Gaps = 8/155 (5%)
 Frame = +3

Query  279  VVKQTGLDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKW-DSPLVSMYNVSHVITV  455
            V+K+T L+ F S++       +     HH RR    KCD +KW  S L+  Y VS V+TV
Sbjct  51   VIKKTRLEVFHSLV-------ASSFSRHHHRRKLKIKCDMNKWISSRLIYRYKVSLVLTV  103

Query  456  DLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAI  635
            DL GC NF+S+Q+A+D VP+ S   TLII+DSGTYREKV V  +K NLI+ GQGYLNTAI
Sbjct  104  DLKGCGNFSSIQEAVDVVPELSSSTTLIIMDSGTYREKVTVHATKKNLILLGQGYLNTAI  163

Query  636  SWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            +WNDTANSTGGT  S +   FA  FIAYNISF+ T
Sbjct  164  AWNDTANSTGGTVYSASVAIFASNFIAYNISFKNT  198



>ref|XP_009386766.1| PREDICTED: putative pectinesterase 14 [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   293 bits (749),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 167/208 (80%), Gaps = 4/208 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP  S G  G QA+A+ I GDQ+A YGCGFYGAQD L D+RGRHYF++CFI+GSIDF
Sbjct  209   QNTAPPASPGDVGAQAVALRIAGDQAALYGCGFYGAQDTLLDERGRHYFRECFIEGSIDF  268

Query  1001  IFGKARSLYEECKINSIANEGG---GGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVW  1171
             IFG ARSLYE C INSIA +     GG++G ITA GR S  EK+GFSF+ C +GG+GKVW
Sbjct  269   IFGNARSLYEACTINSIAKQATSDVGGVTGCITAHGRSSATEKTGFSFVNCSIGGTGKVW  328

Query  1172  LGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYA  1351
             LGRAW  YATVVFS+T M+ +++P+ WNDWND +RDQ+VYFGEY+C GPGA+ + R+SYA
Sbjct  329   LGRAWWPYATVVFSRTYMASIIAPEGWNDWNDPSRDQSVYFGEYECMGPGANYTLRTSYA  388

Query  1352  KQLDESEAAPFLTTSYIDGEDWLIPTPN  1435
             KQLD+ +AA F+  SY++G+DW++P PN
Sbjct  389   KQLDQCQAASFMDISYVEGKDWVLP-PN  415


 Score =   140 bits (354),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +3

Query  390  CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            CD+SKW SPL    N + ++TVD  GCANF+SVQ+AIDAVPD+SP  TLII+DSG YREK
Sbjct  95   CDNSKWVSPLALEQNATLILTVDQKGCANFSSVQRAIDAVPDYSPSRTLIILDSGVYREK  154

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            + V  +K N+ +QGQG+LNT+I+WNDTANSTGGT  S +   F+  FIAYNISFQ T
Sbjct  155  LFVWANKTNITMQGQGFLNTSIAWNDTANSTGGTIYSASVSIFSFNFIAYNISFQNT  211



>ref|XP_010098841.1| putative pectinesterase 15 [Morus notabilis]
 gb|EXB75929.1| putative pectinesterase 15 [Morus notabilis]
Length=432

 Score =   292 bits (747),  Expect(2) = 7e-110, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP P  G  G QALAI + GDQ+AFYGCGFYGAQD LND  GRHY+++CFIQGSIDF
Sbjct  208   QNTAPPPLPGEVGAQALAIRVSGDQAAFYGCGFYGAQDTLNDVLGRHYYRECFIQGSIDF  267

Query  1001  IFGKARSLYEECKINSIANEGGGG-ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLG  1177
             IFG ARSLYE C INSIA     G ISG+ITA GR S +E++GFSF+ C + G+GKVWLG
Sbjct  268   IFGNARSLYEGCTINSIAMPVTAGWISGAITAHGRQSLDEQTGFSFVNCSIEGTGKVWLG  327

Query  1178  RAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             RAWG YATVVFSKT MS VV+ D WNDW D +RDQ+V+FGEY+C GPGA+ + R+SY+KQ
Sbjct  328   RAWGPYATVVFSKTYMSDVVASDGWNDWKDPSRDQSVFFGEYECEGPGANYTYRASYSKQ  387

Query  1358  LDESEAAPFLTTSYIDGEDWLIPTPN  1435
             L +SEA  F+  SYI+G DWL+  PN
Sbjct  388   LQQSEAESFMDISYINGNDWLLDLPN  413


 Score =   135 bits (340),  Expect(2) = 7e-110, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 125/206 (61%), Gaps = 4/206 (2%)
 Frame = +3

Query  126  MNTRSTSILFWLIAFTIAFFSltfslysnllttttvltvn-tpttllpflRSVVKQTGLD  302
            M T+ T + FWL AF IA  S+  SL++    +    +V+      L     +++Q+G++
Sbjct  8    MKTKLT-LFFWLSAFVIALLSMIISLHNIPTFSKIGTSVSPHNVFELATFDRIIEQSGVE  66

Query  303  DFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFA  482
            D L+  H           HHH    +  +CD +KW S L+  YNV+ V+TV L  CANF+
Sbjct  67   DLLA--HLTNMVSRHRRRHHHHHHRRKIECDKNKWTSSLIHKYNVTLVLTVGLERCANFS  124

Query  483  SVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANst  662
            +VQKA+DAVP+ S   TLIIIDSGTY EKV V  +K N+I +G+GY  T ISWNDTANST
Sbjct  125  TVQKAVDAVPERSSSRTLIIIDSGTYMEKVIVDVNKTNMIFEGKGYQKTIISWNDTANST  184

Query  663  ggtsssYTFGAFAPKFIAYNISFQVT  740
            GGT  S +   FA  F AYNISFQ T
Sbjct  185  GGTIYSSSVAIFAHNFTAYNISFQNT  210



>gb|KHG12413.1| putative pectinesterase 15 -like protein [Gossypium arboreum]
Length=407

 Score =   287 bits (735),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 158/200 (79%), Gaps = 0/200 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP+P  G TG QA+A+ I GDQ+AFY CGFYGAQD L D RGRHYFK CFIQGSIDF
Sbjct  206   KNTAPEPIPGETGKQAVALRIAGDQAAFYNCGFYGAQDTLLDDRGRHYFKGCFIQGSIDF  265

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSLY+ C I+SIA EG  G+SGS+TA  R S  E++GFSF+ C V G+G VWLGR
Sbjct  266   IFGNARSLYQGCVIHSIAKEGTSGVSGSVTAHARQSLNEQTGFSFVNCIVRGTGSVWLGR  325

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFS++ MS VV+P  WNDW D +RDQTV+FGEY+C GPGA+ + R+SY KQL
Sbjct  326   AWGAYATVVFSRSYMSDVVAPVGWNDWRDPSRDQTVFFGEYECLGPGANYTFRASYGKQL  385

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              E EAA ++  SYIDG+ WL
Sbjct  386   MEYEAAHYMNISYIDGDQWL  405


 Score =   139 bits (350),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 89/126 (71%), Gaps = 5/126 (4%)
 Frame = +3

Query  378  KANKCDDSKWDSPL-----VSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLII  542
            + +KCD  KW S L     +  Y VS V+TVDL GC NF++ QKAIDAVPD SP  TLII
Sbjct  83   REHKCDHIKWRSSLSTSNLIYQYKVSLVLTVDLEGCGNFSNAQKAIDAVPDSSPSKTLII  142

Query  543  IDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYN  722
            I SGTYREKV V  SK NLIIQG+G+LNT I WNDTANSTGGT  S +   FA  F AYN
Sbjct  143  IYSGTYREKVVVHASKSNLIIQGEGFLNTVIEWNDTANSTGGTVYSSSVAIFASNFTAYN  202

Query  723  ISFQVT  740
            ISF+ T
Sbjct  203  ISFKNT  208



>ref|XP_003625727.1| Pectinesterase [Medicago truncatula]
 gb|AES81945.1| pectinesterase [Medicago truncatula]
Length=398

 Score =   283 bits (723),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 157/201 (78%), Gaps = 0/201 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT+P PS G  G QA+A+ + GDQ+AFYGCGFYGAQD LND  GRHYFK+CFIQGSIDF
Sbjct  194   KNTSPPPSPGEVGAQAVALRVTGDQAAFYGCGFYGAQDTLNDDSGRHYFKECFIQGSIDF  253

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARS YE+C IN IA +   GI GSITA GR S +E++GFSF+ C + GSGKVWLGR
Sbjct  254   IFGNARSFYEDCTINCIAKQDLDGIGGSITAHGRQSLKEETGFSFVNCNIVGSGKVWLGR  313

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG++ATVVFS T MS VV+ + WNDW D +RD++V+FGEY C G GA+ ++R SYA+QL
Sbjct  314   AWGAFATVVFSTTNMSDVVAAEGWNDWRDPSRDRSVFFGEYHCIGLGANYTSRVSYARQL  373

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              + EA  ++  SYIDG DWL+
Sbjct  374   RDFEATSYINVSYIDGNDWLL  394


 Score =   143 bits (361),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 127/197 (64%), Gaps = 7/197 (4%)
 Frame = +3

Query  150  LFWLIAFTIAFFSltfslysnllttttvltvntpttllpflRSVVKQTGLDDFLSVIHQV  329
            LFWL  F I  FS+    Y+   + T+    ++    L     ++K  G  DF+S++  +
Sbjct  7    LFWLSGFAILLFSIIIVHYTTPPSNTSNTATSSSLDSLLS--KIIKLRGAQDFVSLL--I  62

Query  330  KQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAV  509
                S  HHH  + + K   CD++K  S L+  YN +   TVDLNG ANF+SVQKAIDAV
Sbjct  63   TSIASTRHHHWMRHKEK---CDEAKRASQLILDYNATITFTVDLNGRANFSSVQKAIDAV  119

Query  510  PDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTF  689
            P+ S   TLIII+SGTYREKV V+ +K N+I+QGQGYL+T I WNDTANSTGGTS SY+F
Sbjct  120  PESSFNTTLIIINSGTYREKVVVQANKTNIILQGQGYLDTIIEWNDTANSTGGTSYSYSF  179

Query  690  GAFAPKFIAYNISFQVT  740
              FA KF AYNISF+ T
Sbjct  180  AVFASKFTAYNISFKNT  196



>ref|XP_010654006.1| PREDICTED: probable pectinesterase 15 isoform X2 [Vitis vinifera]
Length=362

 Score =   239 bits (610),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP  S G  GGQA+A+ +  DQ+AFYGCGFYGAQD L+D RGRHYF++CFIQGSIDF
Sbjct  200   QNTAPPASPGDVGGQAVALRVANDQAAFYGCGFYGAQDTLHDDRGRHYFRECFIQGSIDF  259

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSLYEEC INS A E   GISG+ITAQGR S +EK+GFSF+KC +GG+G+VWLGR
Sbjct  260   IFGNARSLYEECTINSTAKEVSSGISGAITAQGRQSVDEKTGFSFVKCVIGGTGRVWLGR  319

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTV  1288
             AWG+YATVVFS T M+ +V+ D WNDW D +RDQ+V
Sbjct  320   AWGAYATVVFSNTYMADLVASDGWNDWRDPSRDQSV  355


 Score =   182 bits (462),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 147/202 (73%), Gaps = 6/202 (3%)
 Frame = +3

Query  141  TSILFWLIAFTIAFFSltfslysnllttttvltvntpttllpflRSVVKQTGLDDFLSVI  320
            T++ FW  AF IA  S+T +L++   +T T+   +     L   R +VKQ+G++DFLS++
Sbjct  5    TTLFFWSSAFLIALLSITVALFTISSSTATITQGDLELAFL---RRIVKQSGVEDFLSLL  61

Query  321  HQV--KQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQK  494
            +Q   + ++  HHHHHH R+P+   CDD+KW S ++S YNVS ++TVDL GCANF+SVQK
Sbjct  62   NQATDRASQRHHHHHHHHRKPEV-ICDDAKWKSKIISSYNVSLILTVDLKGCANFSSVQK  120

Query  495  AIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggts  674
            A+DAVPD S   TLII+DSG YREKV V  SK NLI QGQGYLNTAI+WNDTANSTGGTS
Sbjct  121  AVDAVPDSSLSRTLIIMDSGIYREKVVVGASKTNLIFQGQGYLNTAIAWNDTANSTGGTS  180

Query  675  ssYTFGAFAPKFIAYNISFQVT  740
             SY+   FAP F AYNISFQ T
Sbjct  181  YSYSVAIFAPNFTAYNISFQNT  202



>ref|XP_006428522.1| hypothetical protein CICLE_v10013444mg, partial [Citrus clementina]
 gb|ESR41762.1| hypothetical protein CICLE_v10013444mg, partial [Citrus clementina]
Length=401

 Score =   284 bits (727),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 159/200 (80%), Gaps = 1/200 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             NTAP+PS G  GGQA+A+ I GDQ+AFY CGFYGAQD L D  GRHYFK CFIQGSIDFI
Sbjct  194   NTAPRPSPGDVGGQAVALRIGGDQAAFYNCGFYGAQDTLYDDHGRHYFKDCFIQGSIDFI  253

Query  1004  FGKARSLYEECKINSIANE-GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             FG ARSLYE+C INSIA +   G +SGSITAQGR S  E++GFSF+ C++ G+G+VWLGR
Sbjct  254   FGNARSLYEDCTINSIAEQVPDGMVSGSITAQGRQSMSEETGFSFVNCQIDGTGRVWLGR  313

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG  A VVFSKT M+ VVS D WNDW D +RD TV+FGEYDC GPGA+ S R+S+ KQL
Sbjct  314   AWGVCAAVVFSKTYMADVVSSDGWNDWQDPSRDLTVFFGEYDCLGPGANYSYRASFGKQL  373

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EAAP++  SYIDG++WL
Sbjct  374   MQYEAAPYMNISYIDGDEWL  393


 Score =   134 bits (336),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 88/125 (70%), Gaps = 7/125 (6%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMY-------NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIII  545
            KCD + W   ++S Y        VS ++TVDL+GCANF+SVQKA+DAVP FSP  TLIII
Sbjct  71   KCDKNNWRLRIISHYKWLVYHYRVSLILTVDLHGCANFSSVQKAVDAVPSFSPSKTLIII  130

Query  546  DSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNI  725
            DS TYREKV V  +K NLI  G+GYLNT I WNDTANSTGGT+ S +   FA  F AYNI
Sbjct  131  DSATYREKVVVNANKTNLIFLGRGYLNTIIEWNDTANSTGGTAYSSSVAVFASNFTAYNI  190

Query  726  SFQVT  740
            SF  T
Sbjct  191  SFMNT  195



>ref|XP_006491830.1| PREDICTED: probable pectinesterase 15-like [Citrus sinensis]
Length=369

 Score =   283 bits (724),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 159/200 (80%), Gaps = 1/200 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             NTAP+PS G  GGQA+A+ I GDQ+AFY CGFYGAQD L D  GRHYFK CFIQGSIDFI
Sbjct  148   NTAPRPSPGDVGGQAVALRIGGDQAAFYNCGFYGAQDTLYDDHGRHYFKDCFIQGSIDFI  207

Query  1004  FGKARSLYEECKINSIANE-GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             FG ARSLYE+C INSIA +   G +SGSITAQGR S  E++GFSF+ C++ G+G+VWLGR
Sbjct  208   FGNARSLYEDCTINSIAEQVPDGMVSGSITAQGRQSMSEETGFSFVNCQIDGTGRVWLGR  267

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG  A VVFSKT M+ VVS D WNDW D +RD TV+FGEYDC GPGA+ S R+S+ KQL
Sbjct  268   AWGVCAAVVFSKTYMADVVSSDGWNDWQDPSRDLTVFFGEYDCLGPGANYSYRASFGKQL  327

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EAAP++  SYIDG++WL
Sbjct  328   MQYEAAPYMNISYIDGDEWL  347


 Score =   135 bits (339),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 88/125 (70%), Gaps = 7/125 (6%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMY-------NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIII  545
            KCD + W   ++S Y        VS ++TVDL+GCANF+SVQKA+DAVP FSP  TLIII
Sbjct  25   KCDKTNWRLRIISHYKWLVYHYRVSLILTVDLHGCANFSSVQKAVDAVPSFSPSKTLIII  84

Query  546  DSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNI  725
            DS TYREKV V  +K NLI  G+GYLNT I WNDTANSTGGT+ S +   FA  F AYNI
Sbjct  85   DSATYREKVVVNANKTNLIFLGRGYLNTIIEWNDTANSTGGTAYSSSVAVFASNFTAYNI  144

Query  726  SFQVT  740
            SF  T
Sbjct  145  SFMNT  149



>gb|KDO54339.1| hypothetical protein CISIN_1g039329mg [Citrus sinensis]
Length=420

 Score =   282 bits (722),  Expect(2) = 8e-107, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 158/200 (79%), Gaps = 1/200 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             NTAP PS G  GGQA+A+ I GDQ+AFY CGFYGAQD L D  GRHYFK CFIQGSIDFI
Sbjct  199   NTAPWPSPGDVGGQAVALRIGGDQAAFYNCGFYGAQDTLYDDHGRHYFKDCFIQGSIDFI  258

Query  1004  FGKARSLYEECKINSIANE-GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             FG ARSLYE+C INSIA +   G +SGSITAQGR S  E++GFSF+ C++ G+G+VWLGR
Sbjct  259   FGNARSLYEDCTINSIAEQVPDGMVSGSITAQGRQSMSEETGFSFVNCQIDGTGRVWLGR  318

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG  A VVFSKT M+ VVS D WNDW D +RD TV+FGEYDC GPGA+ S R+S+ KQL
Sbjct  319   AWGVCAAVVFSKTYMADVVSSDGWNDWQDPSRDLTVFFGEYDCLGPGANYSYRASFGKQL  378

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EAAP++  SYIDG++WL
Sbjct  379   MQYEAAPYMNISYIDGDEWL  398


 Score =   134 bits (338),  Expect(2) = 8e-107, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 88/125 (70%), Gaps = 7/125 (6%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMY-------NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIII  545
            KCD + W   ++S Y        VS ++TVDL+GCANF+SVQKA+DAVP FSP  TLIII
Sbjct  76   KCDKTNWRLRIISHYKWLVYHYRVSLILTVDLHGCANFSSVQKAVDAVPSFSPSKTLIII  135

Query  546  DSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNI  725
            DS TYREKV V  +K NLI  G+GYLNT I WNDTANSTGGT+ S +   FA  F AYNI
Sbjct  136  DSATYREKVVVNANKTNLIFLGRGYLNTIIEWNDTANSTGGTAYSSSVAVFASNFTAYNI  195

Query  726  SFQVT  740
            SF  T
Sbjct  196  SFMNT  200



>ref|XP_004306176.1| PREDICTED: probable pectinesterase 15-like [Fragaria vesca subsp. 
vesca]
Length=401

 Score =   308 bits (788),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 171/210 (81%), Gaps = 6/210 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP PS+G  G QA+A+ + GDQ+AFYGCGFYGAQD LND RGRHYF++CFIQGSIDF
Sbjct  175   KNTAPPPSEGRIGAQAVALRVTGDQAAFYGCGFYGAQDTLNDDRGRHYFRECFIQGSIDF  234

Query  1001  IFGKARSLYEECKINSIANEGGGGI------SGSITAQGRDSEEEKSGFSFLKCEVGGSG  1162
             IFG ARSLYE C INSIAN    GI      SG+ITAQGR S +E+SG+SF+ C +GGSG
Sbjct  235   IFGSARSLYEGCTINSIANPVKDGILLKGRISGAITAQGRKSMQEQSGYSFVNCSIGGSG  294

Query  1163  KVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRS  1342
             KVWLGRAWG+YATVVFS+T MS VV+ D WNDW+DS+RD+ V++GEY+C GPGA+ +NR 
Sbjct  295   KVWLGRAWGAYATVVFSRTYMSDVVASDGWNDWSDSSRDEKVFYGEYECTGPGANNTNRV  354

Query  1343  SYAKQLDESEAAPFLTTSYIDGEDWLIPTP  1432
             SY+KQL+ESEAAPFL  SYIDG  WL  TP
Sbjct  355   SYSKQLNESEAAPFLDVSYIDGGIWLSYTP  384


 Score =   108 bits (270),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +3

Query  480  ASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANs  659
            +SVQKA+DA P+ S   TLIIID+GTYREKV V  SK NLI QGQGYLNTAI+WND+ANS
Sbjct  91   SSVQKAVDAAPELSTNRTLIIIDAGTYREKVTVNASKTNLIFQGQGYLNTAIAWNDSANS  150

Query  660  tggtsssYTFGAFAPKFIAYNISFQVT  740
            +GGT  S +   FAP F AYNISF+ T
Sbjct  151  SGGTGRSASVSIFAPSFTAYNISFKNT  177



>ref|XP_010241677.1| PREDICTED: probable pectinesterase 15 [Nelumbo nucifera]
Length=411

 Score =   272 bits (696),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 159/202 (79%), Gaps = 0/202 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP  S G  G QA+A+ I GDQ+AFY CGFYGAQD L+D +GRHYF+ CFIQGSIDF
Sbjct  202   QNTAPSASPGDVGAQAIAVRIAGDQAAFYRCGFYGAQDTLHDDKGRHYFQGCFIQGSIDF  261

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSLYE+C INSIA +    ISGSITA  R S  EK+GFSF+ C +GGSG+V LGR
Sbjct  262   IFGNARSLYEDCTINSIAKQVPMEISGSITAHQRRSTNEKTGFSFVNCSIGGSGRVLLGR  321

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YA+V+F++T MS +++P+ W+DWND +RD TV+FGEY+C G GA+ + R++Y+K+L
Sbjct  322   AWGAYASVIFARTFMSDIIAPEGWSDWNDPSRDGTVFFGEYECVGAGANYTLRTAYSKRL  381

Query  1361  DESEAAPFLTTSYIDGEDWLIP  1426
                E +P++  SYIDG+ WL+P
Sbjct  382   SAPEVSPYIDISYIDGDQWLLP  403


 Score =   144 bits (362),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 108/158 (68%), Gaps = 9/158 (6%)
 Frame = +3

Query  279  VVKQTGLDDFLSVIHQVKQARSKhhhhhhKRRPKAN---KCDDS-KWDSPLVSMYNVSHV  446
            +VKQ G+D FLS++ +    R      +H RRP       CD+  KW S +   YN S +
Sbjct  52   LVKQNGIDVFLSLMRRGFPGR-----VYHPRRPVRRWRINCDNHFKWASRVALDYNGSLI  106

Query  447  ITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLN  626
            +TVDLNGCANF+SVQKA+DA P++S   TLI+ID G YREKV V+ +K NLI QG+GYL 
Sbjct  107  LTVDLNGCANFSSVQKAVDAAPEYSSTRTLILIDPGVYREKVVVQSNKTNLIFQGKGYLK  166

Query  627  TAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            T+I+WNDTANSTGGT  S +   FAP FIA +ISFQ T
Sbjct  167  TSIAWNDTANSTGGTIYSASVAIFAPNFIACDISFQNT  204



>ref|XP_006401814.1| hypothetical protein EUTSA_v10015978mg [Eutrema salsugineum]
 gb|ESQ43267.1| hypothetical protein EUTSA_v10015978mg [Eutrema salsugineum]
Length=400

 Score =   271 bits (694),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 153/200 (77%), Gaps = 0/200 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP+P  G    QA+A+ I GDQ AFYGCGFYGAQD L D +GRH+FK CFIQGSIDF
Sbjct  179   KNNAPEPDPGEDDAQAVALRIEGDQCAFYGCGFYGAQDTLLDNKGRHFFKNCFIQGSIDF  238

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLY++C INSIA E   G+SGSITA  R +E+E++GFSF+ C++ GSGKVWLGR
Sbjct  239   IFGNGRSLYQDCTINSIAKENTTGVSGSITAHARQTEDEQTGFSFVNCKIDGSGKVWLGR  298

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YAT+VFS T MS +++P+ WN+W D +R++TV FGE++C G GA+   R SY KQL
Sbjct  299   AWGAYATIVFSNTYMSGIITPEGWNNWGDPSREKTVIFGEHNCYGEGANYKGRVSYGKQL  358

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              +SE + F   SYIDG+ WL
Sbjct  359   TDSEVSSFTDISYIDGDQWL  378


 Score =   135 bits (341),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYRE  566
            KC + KW+S L  MY  S V+TVDL+GC NF+SVQ AID+VPD SP  T II++SG YRE
Sbjct  65   KCCE-KWESRLTRMYRASLVLTVDLHGCGNFSSVQSAIDSVPDLSPSKTFIIVNSGVYRE  123

Query  567  KVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            K+ V ++K N+++QG+GY NT+I WNDTA STGGT+ S++F  FA  F AYNISF+
Sbjct  124  KITVNENKTNIVMQGRGYQNTSIEWNDTAKSTGGTAYSFSFVVFAANFTAYNISFK  179



>ref|XP_002519425.1| Pectinesterase PPE8B precursor, putative [Ricinus communis]
 gb|EEF42839.1| Pectinesterase PPE8B precursor, putative [Ricinus communis]
Length=394

 Score =   291 bits (745),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 156/200 (78%), Gaps = 0/200 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP PS G  GGQA+AI + GDQ+AFYGCGFYGAQD LND  GRHYFK+C+IQGSIDF
Sbjct  168   KNTAPNPSPGEVGGQAVAIRVGGDQAAFYGCGFYGAQDTLNDDHGRHYFKECYIQGSIDF  227

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG ARSL+E C INSIA    GG+SGSITAQ R S  E++GFSF+ C + G+GKVWLGR
Sbjct  228   IFGNARSLFEGCIINSIAKPTRGGVSGSITAQARQSMSEQTGFSFVSCSIRGTGKVWLGR  287

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFSKT MS  +S D WNDW D +RDQTV+FGEY C GPGA+   R  YAKQL
Sbjct  288   AWGAYATVVFSKTYMSNAISSDGWNDWRDPSRDQTVFFGEYGCYGPGANYIYRVPYAKQL  347

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EAA ++  SYIDG  WL
Sbjct  348   SQYEAATYMDISYIDGNHWL  367


 Score =   114 bits (286),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 89/156 (57%), Gaps = 34/156 (22%)
 Frame = +3

Query  273  RSVVKQTGLDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVIT  452
            + V+K++GL + L +I        +        RPK  KCD + W               
Sbjct  49   KRVIKKSGLQEVLQLILSRHHHHRR--------RPKV-KCDKNSW---------------  84

Query  453  VDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTA  632
                      S+QKAID VPDFSP  TLIIIDSGTYREKV V  SK N+I+QGQ Y+NTA
Sbjct  85   ----------SIQKAIDVVPDFSPSPTLIIIDSGTYREKVVVHTSKTNIILQGQSYMNTA  134

Query  633  ISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            I WNDTANSTGGT  S +   FAP F AYNISF+ T
Sbjct  135  IEWNDTANSTGGTVYSASVAIFAPNFTAYNISFKNT  170



>ref|NP_181209.1| putative pectinesterase 15 [Arabidopsis thaliana]
 sp|Q9ZQA3.1|PME15_ARATH RecName: Full=Probable pectinesterase 15; Short=PE 15; AltName: 
Full=Pectin methylesterase 15; Short=AtPME15; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD20147.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEC09289.1| putative pectinesterase 15 [Arabidopsis thaliana]
Length=407

 Score =   274 bits (700),  Expect(2) = 6e-103, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 159/203 (78%), Gaps = 0/203 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP+P  G    QA+A+ I GDQ+AFYGCGFYGAQD L D +GRH+FK+CFIQGSIDF
Sbjct  186   KNNAPEPDPGEADAQAVALRIEGDQAAFYGCGFYGAQDTLLDDKGRHFFKECFIQGSIDF  245

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLY++C INSIA     G++GSITAQGR SE+E+SGFSF+ C++ GSG++ LGR
Sbjct  246   IFGNGRSLYQDCTINSIAKGNTSGVTGSITAQGRQSEDEQSGFSFVNCKIDGSGEILLGR  305

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFS T MS +++P+ WN+W DST+++TV FGE+ C GPGAD   R  + KQL
Sbjct  306   AWGAYATVVFSNTYMSGIITPEGWNNWGDSTKEKTVTFGEHKCYGPGADYKERVLFGKQL  365

Query  1361  DESEAAPFLTTSYIDGEDWLIPT  1429
              +SEA+ F+  S+IDG++WL  T
Sbjct  366   TDSEASSFIDVSFIDGDEWLRHT  388


 Score =   130 bits (327),  Expect(2) = 6e-103, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYRE  566
            KC + KW S L   Y  S V+TVDL+GC NF++VQ AID VPD S   TLII++SG+YRE
Sbjct  72   KCCE-KWTSRLRHQYKTSLVLTVDLHGCGNFSNVQSAIDVVPDLSSSKTLIIVNSGSYRE  130

Query  567  KVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            KV V ++K NL+IQG+GY NT+I WNDTA S G T+ S++F  FA  F AYNISF+
Sbjct  131  KVTVNENKTNLVIQGRGYQNTSIEWNDTAKSAGNTADSFSFVVFAANFTAYNISFK  186



>ref|XP_002879623.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55882.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=404

 Score =   267 bits (682),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 155/200 (78%), Gaps = 0/200 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP+P  G    QA+++ I GDQ+AFYGCGFYGAQD L D +GRH+FK CFIQGSIDF
Sbjct  183   KNNAPEPDPGEADAQAVSLRIEGDQAAFYGCGFYGAQDTLLDDKGRHFFKDCFIQGSIDF  242

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLY++C INSIA     G++GSITAQGR SE+E++GFSF+ C++ GSG++ LGR
Sbjct  243   IFGNGRSLYKDCTINSIAKGNTSGVTGSITAQGRQSEDEQTGFSFVNCKIAGSGEILLGR  302

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFS T MS ++SP+ WN+W D  +++TV FGE+ C GPGAD   R  + KQL
Sbjct  303   AWGAYATVVFSDTYMSGIISPEGWNNWGDPDKEKTVTFGEHKCYGPGADYKERVLFGKQL  362

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              +SEA+ F+  S+IDG++WL
Sbjct  363   TDSEASSFIDISFIDGDEWL  382


 Score =   135 bits (340),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYRE  566
            KC + KW S L   Y  S V+TVDL+GC NF++VQ AIDAVPD SP  TLII++SG YRE
Sbjct  69   KCCE-KWTSRLTHQYKTSLVLTVDLHGCGNFSNVQSAIDAVPDLSPSKTLIIVNSGCYRE  127

Query  567  KVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            KV V ++K NL+IQG+GY NT+I WNDTA S G T+ S++F  FA  F AYNISF+
Sbjct  128  KVTVNENKTNLVIQGRGYQNTSIEWNDTAKSAGNTAESFSFVVFAANFTAYNISFK  183



>gb|AAO22722.1| putative pectinesterase family protein [Arabidopsis thaliana]
Length=407

 Score =   271 bits (692),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP+P  G    QA+A+ I GDQ+AFYGCGFYGAQD L D +GRH+FK+CFIQGSI F
Sbjct  186   KNNAPEPDPGEADAQAVALRIEGDQAAFYGCGFYGAQDTLLDDKGRHFFKECFIQGSIGF  245

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLY++C INSIA     G++GSITAQGR SE+E+SGFSF+ C++ GSG++ LGR
Sbjct  246   IFGNGRSLYQDCTINSIAKGNTSGVTGSITAQGRQSEDEQSGFSFVNCKIDGSGEILLGR  305

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+YATVVFS T MS +++P+ WN+W DST+++TV FGE+ C GPGAD   R  + KQL
Sbjct  306   AWGAYATVVFSNTYMSGIITPEGWNNWGDSTKEKTVTFGEHKCYGPGADYKERVLFGKQL  365

Query  1361  DESEAAPFLTTSYIDGEDWLIPT  1429
              +SEA+ F+  S+IDG++WL  T
Sbjct  366   TDSEASSFIDVSFIDGDEWLRHT  388


 Score =   130 bits (327),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYRE  566
            KC + KW S L   Y  S V+TVDL+GC NF++VQ AID VPD S   TLII++SG+YRE
Sbjct  72   KCCE-KWTSRLRHQYKTSLVLTVDLHGCGNFSNVQSAIDVVPDLSSSKTLIIVNSGSYRE  130

Query  567  KVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            KV V ++K NL+IQG+GY NT+I WNDTA S G T+ S++F  FA  F AYNISF+
Sbjct  131  KVTVNENKTNLVIQGRGYQNTSIEWNDTAKSAGNTADSFSFVVFAANFTAYNISFK  186



>ref|XP_010505218.1| PREDICTED: probable pectinesterase 15 [Camelina sativa]
Length=397

 Score =   268 bits (684),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 158/215 (73%), Gaps = 1/215 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP+P  G   GQA+A+ I GDQ+AFYGCGFYGAQD L D  GRH+FK CFIQGSIDF
Sbjct  174   KNIAPEPDPGEADGQAVALRIEGDQAAFYGCGFYGAQDTLLDDSGRHFFKDCFIQGSIDF  233

Query  1001  IFGKARSLYEECKINSIAN-EGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLG  1177
             IFG  RSLY++CKINSIA      G++GSITAQGR S++E+SGFSF+ C++ G G+V LG
Sbjct  234   IFGNGRSLYQDCKINSIAKGNASAGVTGSITAQGRQSKDEESGFSFVNCKIDGIGEVLLG  293

Query  1178  RAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             RAWG+YATVVFS T MS +++P+ WNDW D  + +TV FGE+ C GPGA+   R S+ KQ
Sbjct  294   RAWGAYATVVFSNTYMSGIITPEGWNDWGDPAKQKTVTFGEHKCYGPGANYKERVSFGKQ  353

Query  1358  LDESEAAPFLTTSYIDGEDWLIPTPNTAYITTSTD  1462
             L ESEA+ F+  S+I+G+ WL    N     TS D
Sbjct  354   LTESEASSFIDLSFINGDQWLNDHTNKLSDLTSKD  388


 Score =   132 bits (331),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 86/116 (74%), Gaps = 2/116 (2%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYRE  566
            +C+  KW S L   Y  S V+ VDL+GC NF++VQ AIDAVPD SP  TLII++SG+YRE
Sbjct  61   RCE--KWTSRLTHQYKTSLVLIVDLHGCGNFSNVQSAIDAVPDLSPSKTLIIVNSGSYRE  118

Query  567  KVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            KV V ++K N+++QG+GY NT+I WNDTA S G T+ S++F  FA  F AYNISF+
Sbjct  119  KVTVNENKTNIVLQGRGYQNTSIEWNDTAKSAGSTADSFSFVVFAANFTAYNISFK  174



>gb|EPS73183.1| pectinesterase, partial [Genlisea aurea]
Length=315

 Score =   267 bits (683),  Expect(2) = 9e-101, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 150/200 (75%), Gaps = 0/200 (0%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             NTAP P+ G    Q +A+ + GDQSAFYGCGFYG+QD LND +GRHY+ QC+IQGSIDFI
Sbjct  116   NTAPAPNPGDEDAQGVALRVSGDQSAFYGCGFYGSQDTLNDDQGRHYYNQCYIQGSIDFI  175

Query  1004  FGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGRA  1183
             FG ARSL+ +C +NS A      ++GSI A GR S EEK+GFSF+ C + GSGK+WLGRA
Sbjct  176   FGNARSLFLDCTLNSTAKHSSKMVTGSIAAHGRRSPEEKTGFSFVNCGILGSGKIWLGRA  235

Query  1184  WGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQLD  1363
             WG  ATVVF+   MS V++   WNDW+DSTRDQTV FGEY C GPG++ S R  Y+KQL 
Sbjct  236   WGRCATVVFAGCHMSDVITTGGWNDWDDSTRDQTVSFGEYMCDGPGSNSSERVPYSKQLT  295

Query  1364  ESEAAPFLTTSYIDGEDWLI  1423
              +E AP+L  S++DGEDWL+
Sbjct  296   AAEVAPYLDVSFVDGEDWLV  315


 Score =   130 bits (326),  Expect(2) = 9e-101, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = +3

Query  390  CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            CD     S LV +YNV+ V+TVD NGC +F +VQ+A+DAV +FS   TLI++ SG YREK
Sbjct  1    CDGGLRKSSLVGVYNVNVVLTVDANGCGDFTTVQRAVDAVAEFSDSWTLIVVGSGIYREK  60

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            VAV   K  +I++GQG+LNTA+ WNDTA S G T+SS TF AFA KFIAYNISF  T
Sbjct  61   VAVSSRKSMVILEGQGFLNTAVVWNDTAKSAGTTASSPTFSAFASKFIAYNISFMNT  117



>ref|XP_010509442.1| PREDICTED: probable pectinesterase 15 [Camelina sativa]
Length=397

 Score =   263 bits (671),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 157/215 (73%), Gaps = 1/215 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP+P  G   GQA+A+ I GDQ+AFYGCGFYGAQD L D  GRH+FK CFIQGSIDF
Sbjct  174   KNIAPEPDPGEADGQAVALRIEGDQAAFYGCGFYGAQDTLLDDSGRHFFKDCFIQGSIDF  233

Query  1001  IFGKARSLYEECKINSIAN-EGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLG  1177
             IFG  RSLY++C INSIA      G++GSITAQGR S++E+SGFSF+ C++ GSG+V LG
Sbjct  234   IFGNGRSLYQDCTINSIAKGNASAGVTGSITAQGRQSKDEESGFSFVNCKIDGSGEVLLG  293

Query  1178  RAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             RAWG+YATVVFS T MS +++ + WNDW D  + +TV FGE+ C GPGA+   R S+ KQ
Sbjct  294   RAWGAYATVVFSNTYMSGIITREGWNDWGDPAKQKTVTFGEHKCYGPGANYKERVSFGKQ  353

Query  1358  LDESEAAPFLTTSYIDGEDWLIPTPNTAYITTSTD  1462
             L +SEA+ F+  S+I+G+ WL    N     TS D
Sbjct  354   LTDSEASSFIDLSFINGDQWLNDHTNKLSDLTSKD  388


 Score =   134 bits (336),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 86/116 (74%), Gaps = 2/116 (2%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYRE  566
            +C+  KW S L   Y  S V+ VDL+GC NF++VQ AIDAVPD SP  TLII++SG+YRE
Sbjct  61   RCE--KWTSRLTHQYQTSLVLIVDLHGCGNFSNVQSAIDAVPDLSPSKTLIIVNSGSYRE  118

Query  567  KVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            KV V ++K NL++QG+GY NT+I WNDTA S G T+ S++F  FA  F AYNISF+
Sbjct  119  KVTVNENKTNLVLQGRGYQNTSIEWNDTAKSAGSTADSFSFVVFAANFTAYNISFK  174



>ref|XP_010516895.1| PREDICTED: probable pectinesterase 15 [Camelina sativa]
Length=406

 Score =   265 bits (677),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 157/215 (73%), Gaps = 1/215 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP+P  G   GQA+A+ I GDQ+AFYGCGFYGAQD L D +GRH+FK CFIQGSIDF
Sbjct  183   KNNAPEPDPGEADGQAVALRIEGDQAAFYGCGFYGAQDTLLDDKGRHFFKDCFIQGSIDF  242

Query  1001  IFGKARSLYEECKINSIAN-EGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLG  1177
             IFG  RSLY++C INSIA      G++GSITAQGR S++E+SGFSF+ C++ GSG+V LG
Sbjct  243   IFGNGRSLYQDCTINSIAKGNASAGVTGSITAQGRQSKDEESGFSFVNCKIDGSGEVLLG  302

Query  1178  RAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             RAWG+YATVVFS T MS +++P  WNDW D  + +T  FGE+ C GPGA+   R S+ KQ
Sbjct  303   RAWGAYATVVFSNTYMSGIITPQGWNDWGDPAKQKTATFGEHKCYGPGANYKERVSFGKQ  362

Query  1358  LDESEAAPFLTTSYIDGEDWLIPTPNTAYITTSTD  1462
             L +SEA+ F+  S+I+G+ WL    N     TS D
Sbjct  363   LTDSEASSFIDLSFINGDQWLNDHTNKLSDLTSKD  397


 Score =   131 bits (329),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +3

Query  402  KWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVK  581
            KW S L   Y  S V+ VDL+GC NF++VQ AIDAVPD SP  TLII++SG+YREKV V 
Sbjct  73   KWTSRLTHQYKTSLVLIVDLHGCGNFSNVQSAIDAVPDLSPSKTLIIVNSGSYREKVMVN  132

Query  582  KSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            ++K N+++QG+GY NT+I WNDTA S G T+ S++F  FA  F AYNISF+
Sbjct  133  ENKTNIVLQGRGYQNTSIEWNDTAKSAGSTADSFSFVVFAANFTAYNISFK  183



>ref|XP_010546523.1| PREDICTED: probable pectinesterase 15 isoform X4 [Tarenaya hassleriana]
Length=416

 Score =   279 bits (713),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 155/200 (78%), Gaps = 0/200 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP+   GA   QA+A+ I GDQ+AFYGCGFYG+QD L D  GRH+F  CFIQGSIDF
Sbjct  190   KNTAPEAEPGAKDEQAVAMRIEGDQAAFYGCGFYGSQDTLLDDNGRHFFHHCFIQGSIDF  249

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A+SLY +C INSIA E   GISG ITA GR+SE EK+GFSF+ C + G+GKV LGR
Sbjct  250   IFGSAKSLYLDCTINSIAKENTSGISGYITAHGRNSENEKTGFSFVNCRIDGTGKVLLGR  309

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
              WG YATV+FSKT MS++VS D W+DWND +RD+TV+FGEY+  GPG + S R SYAKQL
Sbjct  310   PWGPYATVIFSKTYMSEIVSSDGWDDWNDPSRDKTVFFGEYESYGPGGNYSERVSYAKQL  369

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              ESEAA F+  SYIDG+ WL
Sbjct  370   TESEAAFFMDISYIDGDQWL  389


 Score =   115 bits (289),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +3

Query  399  SKWDS-PLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVA  575
             KW S  L   Y  S V+TVDL+GC NF+++Q A+DAVP+ SP  +LII+DSG YREKV 
Sbjct  78   GKWKSKALKHRYTASLVLTVDLHGCGNFSNIQSAVDAVPELSPFTSLIIVDSGIYREKVI  137

Query  576  VKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            + K+K N++IQG+GY NT+I WNDT  S G  SSS++F  FA  F AYNISF+ T
Sbjct  138  IDKNKTNIVIQGRGYENTSIEWNDTTKSAGSMSSSFSFAVFATNFTAYNISFKNT  192



>ref|XP_010513018.1| PREDICTED: probable pectinesterase 15 [Camelina sativa]
Length=338

 Score =   281 bits (720),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 156/200 (78%), Gaps = 0/200 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP+P  G  G QA+A+ I GDQ+AFYGCGFYGAQ+ L D RGRH+FKQCFIQGS+DF
Sbjct  118   KNFAPEPEPGVEGAQAVAVRIEGDQAAFYGCGFYGAQETLYDNRGRHFFKQCFIQGSVDF  177

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLYEEC I SIA E   GISG ITA GR+S+++++GFSF+ C++ GSGKVWLGR
Sbjct  178   IFGNGLSLYEECVIRSIAKETTSGISGMITAHGRESKDQRTGFSFVNCKIDGSGKVWLGR  237

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AW +YATVVFSKT MS+V+SPD WND+ + TRD+TV FGEY C G GA    R SY KQL
Sbjct  238   AWKAYATVVFSKTSMSKVISPDGWNDFGNQTRDKTVTFGEYRCYGEGAYYKERVSYGKQL  297

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              +SEA+PF   SYIDG+ WL
Sbjct  298   TDSEASPFTDISYIDGDQWL  317


 Score =   111 bits (278),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = +3

Query  438  SHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQG  617
            S V  VDLNG  NF  VQKAIDAVPD S   TLIII+SG YREKV V K K N+++QG+G
Sbjct  19   SLVFIVDLNGLGNFTKVQKAIDAVPDSSLSRTLIIINSGVYREKVQVSKKKANILMQGRG  78

Query  618  YLNTAISWNDTAN-stggtsssYTFGAFAPKFIAYNISFQ  734
            Y  T I WNDTA  S+GGT++SYTF  FA  F+AYNISF+
Sbjct  79   YERTIIEWNDTAQYSSGGTANSYTFAIFADNFVAYNISFK  118



>ref|XP_002881462.1| hypothetical protein ARALYDRAFT_902790 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57721.1| hypothetical protein ARALYDRAFT_902790 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   279 bits (714),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 163/222 (73%), Gaps = 2/222 (1%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP+P  G  G QA+AI I GDQ+AFYGCGFY AQD + D  GRHYFKQC IQGSIDF
Sbjct  148   KNYAPEPEPGVEGAQAVAIRIDGDQAAFYGCGFYSAQDTVLDSNGRHYFKQCVIQGSIDF  207

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             I+GK RSLY+EC I SIA E   GISG ITAQGR+S +EKSGFSFLKC++ G+GKVWLGR
Sbjct  208   IYGKGRSLYDECLIRSIAKESTSGISGIITAQGRESIDEKSGFSFLKCKIEGTGKVWLGR  267

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
              W +YATVVFS+T MS+++SP+ WNDW + TRD+TV FGE+ C G G+D   R  YAKQL
Sbjct  268   PWRAYATVVFSQTYMSRIISPEGWNDWGNLTRDKTVTFGEHRCYGEGSDYKGRVPYAKQL  327

Query  1361  DESEAAPFLTTSYIDGEDWLIPT--PNTAYITTSTDPMTTLY  1480
              +SEA+ F   SYIDG+ WL  T  P+   I    D + + Y
Sbjct  328   TDSEASSFTDISYIDGDQWLNGTKIPSELNIEEHEDNLISSY  369


 Score =   112 bits (281),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = +3

Query  438  SHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQG  617
            S VITVD NG  NF  VQ AIDAVPD S   TLIII+SG YREKV V  +K N++++G+G
Sbjct  50   SLVITVDPNGHGNFTKVQNAIDAVPDLSSSKTLIIINSGVYREKVMVSVNKTNIMMKGRG  109

Query  618  YLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            Y  T I WNDT+ S+G T  SY+FG FA  F+AYNISF+
Sbjct  110  YQRTIIEWNDTSRSSGRTQDSYSFGIFAANFVAYNISFK  148



>ref|XP_010546522.1| PREDICTED: probable pectinesterase 15 isoform X3 [Tarenaya hassleriana]
Length=417

 Score =   279 bits (713),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 155/200 (78%), Gaps = 0/200 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP+   GA   QA+A+ I GDQ+AFYGCGFYG+QD L D  GRH+F  CFIQGSIDF
Sbjct  191   KNTAPEAEPGAKDEQAVAMRIEGDQAAFYGCGFYGSQDTLLDDNGRHFFHHCFIQGSIDF  250

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A+SLY +C INSIA E   GISG ITA GR+SE EK+GFSF+ C + G+GKV LGR
Sbjct  251   IFGSAKSLYLDCTINSIAKENTSGISGYITAHGRNSENEKTGFSFVNCRIDGTGKVLLGR  310

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
              WG YATV+FSKT MS++VS D W+DWND +RD+TV+FGEY+  GPG + S R SYAKQL
Sbjct  311   PWGPYATVIFSKTYMSEIVSSDGWDDWNDPSRDKTVFFGEYESYGPGGNYSERVSYAKQL  370

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              ESEAA F+  SYIDG+ WL
Sbjct  371   TESEAAFFMDISYIDGDQWL  390


 Score =   111 bits (277),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 83/116 (72%), Gaps = 2/116 (2%)
 Frame = +3

Query  399  SKWDS-PLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTY-REKV  572
             KW S  L   Y  S V+TVDL+GC NF+++Q A+DAVP+ SP  +LII+DSG Y REKV
Sbjct  78   GKWKSKALKHRYTASLVLTVDLHGCGNFSNIQSAVDAVPELSPFTSLIIVDSGIYSREKV  137

Query  573  AVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
             + K+K N++IQG+GY NT+I WNDT  S G  SSS++F  FA  F AYNISF+ T
Sbjct  138  IIDKNKTNIVIQGRGYENTSIEWNDTTKSAGSMSSSFSFAVFATNFTAYNISFKNT  193



>gb|KFK36544.1| hypothetical protein AALP_AA4G137600 [Arabis alpina]
Length=330

 Score =   279 bits (713),  Expect(2) = 6e-96, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 165/222 (74%), Gaps = 2/222 (1%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP+P+ G    QA+A+ I GDQ AFYGCGFYGAQD L D +GRH+FK CFIQGSIDF
Sbjct  109   KNNAPEPNPGEEDAQAVALKIEGDQGAFYGCGFYGAQDTLLDDKGRHFFKDCFIQGSIDF  168

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLY++C INSIA E   G+SGSITA  R SE+E +GFSF+ C++ GSGKVWLGR
Sbjct  169   IFGNGRSLYQDCTINSIAKENAPGVSGSITAHARQSEDEHTGFSFVNCKIDGSGKVWLGR  228

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+Y+TVVFS T MS +++P+ WNDW DSTR++TV FGE+ C G GA   +R SYAKQL
Sbjct  229   AWGAYSTVVFSNTYMSGIITPEGWNDWGDSTREKTVTFGEHKCYGSGAYYKDRVSYAKQL  288

Query  1361  DESEAAPFLTTSYIDGEDWLIPTPNTAYIT--TSTDPMTTLY  1480
              +SEA+ F+  S+IDG++WL  T   + +T   S D +   Y
Sbjct  289   TDSEASSFIDISFIDGDEWLHETNVLSELTFDDSIDELIRYY  330


 Score =   102 bits (253),  Expect(2) = 6e-96, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 78/107 (73%), Gaps = 8/107 (7%)
 Frame = +3

Query  417  LVSMYNVSHVI-TVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKI  593
            LVS++++  VI T+  N       VQ AIDAVPD SP  TLII++SG+YREKV V ++K 
Sbjct  10   LVSLFSIILVIYTILFN-------VQSAIDAVPDSSPSKTLIIVNSGSYREKVTVNENKT  62

Query  594  NLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            N+++QG+GY NT+I WNDTA STGGT  S++F  FA  F AYNISF+
Sbjct  63   NIVLQGRGYQNTSIEWNDTAKSTGGTVYSFSFAVFASNFSAYNISFK  109



>ref|XP_010546521.1| PREDICTED: probable pectinesterase 15 isoform X2 [Tarenaya hassleriana]
Length=444

 Score =   265 bits (676),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 155/228 (68%), Gaps = 28/228 (12%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP+   GA   QA+A+ I GDQ+AFYGCGFYG+QD L D  GRH+F  CFIQGSIDF
Sbjct  190   KNTAPEAEPGAKDEQAVAMRIEGDQAAFYGCGFYGSQDTLLDDNGRHFFHHCFIQGSIDF  249

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A+SLY +C INSIA E   GISG ITA GR+SE EK+GFSF+ C + G+GKV LGR
Sbjct  250   IFGSAKSLYLDCTINSIAKENTSGISGYITAHGRNSENEKTGFSFVNCRIDGTGKVLLGR  309

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQ--------------------------  1282
              WG YATV+FSKT MS++VS D W+DWND +RD+                          
Sbjct  310   PWGPYATVIFSKTYMSEIVSSDGWDDWNDPSRDKFVNERTFSTSSSKIFSTRNLIEISFF  369

Query  1283  --TVYFGEYDCRGPGADCSNRSSYAKQLDESEAAPFLTTSYIDGEDWL  1420
               TV+FGEY+  GPG + S R SYAKQL ESEAA F+  SYIDG+ WL
Sbjct  370   CRTVFFGEYESYGPGGNYSERVSYAKQLTESEAAFFMDISYIDGDQWL  417


 Score =   115 bits (289),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +3

Query  402  KWDS-PLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAV  578
            KW S  L   Y  S V+TVDL+GC NF+++Q A+DAVP+ SP  +LII+DSG YREKV +
Sbjct  79   KWKSKALKHRYTASLVLTVDLHGCGNFSNIQSAVDAVPELSPFTSLIIVDSGIYREKVII  138

Query  579  KKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
             K+K N++IQG+GY NT+I WNDT  S G  SSS++F  FA  F AYNISF+ T
Sbjct  139  DKNKTNIVIQGRGYENTSIEWNDTTKSAGSMSSSFSFAVFATNFTAYNISFKNT  192



>gb|AFI23413.1| pectin methylesterase [Coffea arabica]
Length=273

 Score =   306 bits (785),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP PS G  G QA+A+ I GD++AF+GCGFYGAQD LND RGRHYFK+CFIQGSIDF
Sbjct  54    QNTAPPPSPGVVGAQAVALRISGDKAAFFGCGFYGAQDTLNDDRGRHYFKECFIQGSIDF  113

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLYE+C INS+A E   GISG+ITAQGRDS  + SGFSF+ C V GSGKVWLGR
Sbjct  114   IFGNGRSLYEDCVINSVAKEVSSGISGAITAQGRDSTSDNSGFSFVNCNVEGSGKVWLGR  173

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWGSYATVVFSKT MS VVS D WNDW D +RDQTV+FGEY C GPGA+ + R SY KQL
Sbjct  174   AWGSYATVVFSKTYMSDVVSSDGWNDWRDPSRDQTVFFGEYGCFGPGANYTFRVSYGKQL  233

Query  1361  DESEAAPFLTTSYIDGEDWLIPTPN  1435
              +SEAA FL  +YIDG++WL+P  N
Sbjct  234   KQSEAAAFLDVTYIDGQEWLLPRIN  258


 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  576  VKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            V  +K NL+IQGQGYLNT I+WNDTANSTGGT+ S T    +  F+AYNISFQ T
Sbjct  2    VSANKTNLMIQGQGYLNTTIAWNDTANSTGGTALSSTIAISSTNFVAYNISFQNT  56



>ref|XP_010546520.1| PREDICTED: probable pectinesterase 15 isoform X1 [Tarenaya hassleriana]
Length=445

 Score =   264 bits (675),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 155/228 (68%), Gaps = 28/228 (12%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP+   GA   QA+A+ I GDQ+AFYGCGFYG+QD L D  GRH+F  CFIQGSIDF
Sbjct  191   KNTAPEAEPGAKDEQAVAMRIEGDQAAFYGCGFYGSQDTLLDDNGRHFFHHCFIQGSIDF  250

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A+SLY +C INSIA E   GISG ITA GR+SE EK+GFSF+ C + G+GKV LGR
Sbjct  251   IFGSAKSLYLDCTINSIAKENTSGISGYITAHGRNSENEKTGFSFVNCRIDGTGKVLLGR  310

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQ--------------------------  1282
              WG YATV+FSKT MS++VS D W+DWND +RD+                          
Sbjct  311   PWGPYATVIFSKTYMSEIVSSDGWDDWNDPSRDKFVNERTFSTSSSKIFSTRNLIEISFF  370

Query  1283  --TVYFGEYDCRGPGADCSNRSSYAKQLDESEAAPFLTTSYIDGEDWL  1420
               TV+FGEY+  GPG + S R SYAKQL ESEAA F+  SYIDG+ WL
Sbjct  371   CRTVFFGEYESYGPGGNYSERVSYAKQLTESEAAFFMDISYIDGDQWL  418


 Score =   111 bits (277),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 83/115 (72%), Gaps = 2/115 (2%)
 Frame = +3

Query  402  KWDS-PLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTY-REKVA  575
            KW S  L   Y  S V+TVDL+GC NF+++Q A+DAVP+ SP  +LII+DSG Y REKV 
Sbjct  79   KWKSKALKHRYTASLVLTVDLHGCGNFSNIQSAVDAVPELSPFTSLIIVDSGIYSREKVI  138

Query  576  VKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            + K+K N++IQG+GY NT+I WNDT  S G  SSS++F  FA  F AYNISF+ T
Sbjct  139  IDKNKTNIVIQGRGYENTSIEWNDTTKSAGSMSSSFSFAVFATNFTAYNISFKNT  193



>ref|XP_004956260.1| PREDICTED: probable pectinesterase 15-like [Setaria italica]
Length=410

 Score =   270 bits (690),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = +2

Query  812   LGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGS  991
             L  +NTA   + G  GGQA+A+ +  DQ+AFY CGFYG+QD L D+RGRH F++C+++GS
Sbjct  182   LSVQNTARPAAPGDAGGQAVALRVAADQAAFYWCGFYGSQDTLLDERGRHLFRECYVEGS  241

Query  992   IDFIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVW  1171
             IDFIFG ARSLY  C I+S+A+ G GG++GS+TAQGR S +E++GF+F+ C V G+G+VW
Sbjct  242   IDFIFGNARSLYLGCTISSVADAGAGGVTGSVTAQGRASPDERTGFAFVLCSVVGTGRVW  301

Query  1172  LGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYA  1351
             LGR WG+YATVVF++T ++ VV+P  W+DWND  R Q+V+FGEYDC GPGA  + R +YA
Sbjct  302   LGRPWGAYATVVFARTYLADVVAPGGWDDWNDPARRQSVFFGEYDCTGPGA-AAQRVAYA  360

Query  1352  KQLDESEAAPFLTTSYIDGEDWLIP  1426
             +QLDE +AAPF+  SYIDG  W +P
Sbjct  361   RQLDERQAAPFMDASYIDGGQWAVP  385


 Score =   102 bits (255),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 85/126 (67%), Gaps = 5/126 (4%)
 Frame = +3

Query  378  KANKCDD-SKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVA---TLIII  545
            +   C++ ++W + + S++N S V+TVD  GCANF SVQ+A+DAVPD +  A   TLI +
Sbjct  62   RRRACEEHARWVARMASLHNASLVLTVDRRGCANFTSVQQAVDAVPDHAAAAAARTLIAV  121

Query  546  DSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTAN-stggtsssYTFGAFAPKFIAYN  722
            D+G Y EKV V  +K  + +QG+G L TA++WN TAN S G TS+S TF   A  F+AYN
Sbjct  122  DAGVYAEKVVVWGNKTGVTLQGRGNLETAVAWNATANSSGGSTSASATFAVLAAGFVAYN  181

Query  723  ISFQVT  740
            +S Q T
Sbjct  182  LSVQNT  187



>ref|XP_010543016.1| PREDICTED: probable pectinesterase 8 [Tarenaya hassleriana]
Length=407

 Score =   269 bits (687),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GDQS F GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  201   NVAPIPKPGDIGAQAVAIRIAGDQSVFLGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  260

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  RSLY+EC++ S+AN    G   + G++TA GR S++E SGFSF+ C +GG+G+VWL
Sbjct  261   FGNGRSLYQECRLISMANPVAPGSKAVDGAVTAHGRASKDENSGFSFVNCSIGGTGRVWL  320

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF+ T M+ V+SPD WND ND +RDQT+++GEY+C GPGAD + R++Y +
Sbjct  321   GRAWRPYSRVVFASTFMTDVISPDGWNDLNDPSRDQTIFYGEYNCSGPGADMTKRAAYVQ  380

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++ A F+ TSYIDG+ WL
Sbjct  381   KLNDTQIASFINTSYIDGDQWL  402


 Score =   100 bits (250),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 75/122 (61%), Gaps = 1/122 (1%)
 Frame = +3

Query  366  KRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIII  545
            K R + + CD+   D P     N +  + VD NGC NF +VQ A+DAV +FS   T+I I
Sbjct  79   KTRKRVSVCDEFPKDIPPPDT-NTTSTLCVDKNGCCNFTTVQSAVDAVGNFSQKRTVIWI  137

Query  546  DSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNI  725
            +SG Y EKV + K+K N+  QGQGY  TAI+WNDTA S  GT  S T   FA  F+A NI
Sbjct  138  NSGVYYEKVLIPKTKPNITFQGQGYETTAIAWNDTAYSANGTFYSGTVQVFASNFVAKNI  197

Query  726  SF  731
            SF
Sbjct  198  SF  199



>ref|XP_009144121.1| PREDICTED: probable pectinesterase 15 [Brassica rapa]
Length=338

 Score =   261 bits (668),  Expect(2) = 3e-92, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 152/199 (76%), Gaps = 0/199 (0%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             NTAP+P     G QA+A+ +  D+SAFYGCGFY AQD L D  GRH+FK+C+IQGSIDFI
Sbjct  129   NTAPEPRPEVKGAQAVAMRLQADKSAFYGCGFYSAQDTLLDSEGRHFFKECYIQGSIDFI  188

Query  1004  FGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGRA  1183
             FG  RS+Y++C I SIA E   GISG ITAQ RDSE +++GFSF+ C + G+GK+WLGRA
Sbjct  189   FGNGRSIYQDCTIRSIAKETSSGISGIITAQARDSESDQTGFSFVNCTISGTGKIWLGRA  248

Query  1184  WGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQLD  1363
             W +++TVVFS T MS+V+SPD WN++ ++TRD+TV FGE+ C G GA+ + R +Y KQL 
Sbjct  249   WRTFSTVVFSNTYMSEVISPDGWNNFGNTTRDRTVTFGEHKCFGEGANYTKRVAYGKQLT  308

Query  1364  ESEAAPFLTTSYIDGEDWL  1420
             ++EAA F   S+IDG+ WL
Sbjct  309   DAEAAKFTDISFIDGQQWL  327


 Score =   107 bits (266),  Expect(2) = 3e-92, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  426  MYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLII  605
             +  S V+ VDLNG  NF +VQ AIDAVPD S   TLI+I+ G YREKV V K K N+++
Sbjct  26   FHQASLVLVVDLNGGGNFTTVQSAIDAVPDSSSFRTLIVINPGIYREKVTVHKKKTNVVL  85

Query  606  QGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            QG+GY  T I WNDTA S+GGT  S++F  +A  F+A+N+SF
Sbjct  86   QGKGYQKTIIEWNDTALSSGGTFYSFSFAVYADNFVAHNVSF  127



>emb|CDY33185.1| BnaC04g08540D [Brassica napus]
Length=338

 Score =   261 bits (666),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 153/199 (77%), Gaps = 0/199 (0%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             NTAP+P     G QA+A+ +  D++AFYGCGFY AQD L D  GRH+FK+C+IQGSIDFI
Sbjct  129   NTAPEPRPEVKGAQAVAMRLQADKAAFYGCGFYSAQDTLLDSEGRHFFKECYIQGSIDFI  188

Query  1004  FGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGRA  1183
             FG  RS+Y++C+I SIA E   GISG ITAQ RDSE +++GFSF+ C + G+GK+WLGRA
Sbjct  189   FGNGRSIYQDCRIRSIAKETRSGISGIITAQARDSESDQTGFSFVNCTISGTGKIWLGRA  248

Query  1184  WGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQLD  1363
             W +++TVVFS T MS+V+SPD WN++ ++TRD+TV FGE+ C G GA+ + R +Y KQL 
Sbjct  249   WRAFSTVVFSNTYMSEVISPDGWNNFGNTTRDRTVTFGEHKCFGEGANYTKRVAYGKQLT  308

Query  1364  ESEAAPFLTTSYIDGEDWL  1420
             ++EAA F   S+IDG+ WL
Sbjct  309   DAEAAKFTDISFIDGQQWL  327


 Score =   107 bits (266),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  426  MYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLII  605
             +  S V+ VDLNG  NF +VQ AIDAVPD S   TLI+I+ G YREKV V K K N+++
Sbjct  26   FHQASLVLVVDLNGGGNFTTVQSAIDAVPDSSSFRTLIVINPGIYREKVTVHKKKTNVVL  85

Query  606  QGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            QG+GY  T I WNDTA S+GGT  S++F  +A  F+A+N+SF
Sbjct  86   QGKGYQKTIIEWNDTALSSGGTFYSFSFAVYADNFVAHNVSF  127



>ref|XP_006296290.1| hypothetical protein CARUB_v10025460mg [Capsella rubella]
 gb|EOA29188.1| hypothetical protein CARUB_v10025460mg [Capsella rubella]
Length=371

 Score =   256 bits (653),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 147/200 (74%), Gaps = 0/200 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN+AP+P  GA G QA+A+ I GDQ AFY CGFYG QD L D  GRHYFK CFIQGSIDF
Sbjct  149   KNSAPEPEPGAEGAQAVAVRIDGDQVAFYSCGFYGFQDTLLDNTGRHYFKNCFIQGSIDF  208

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFGK  SLY++C I SIA +    I+G ITAQGR+SE E+SGFSFL C + GSGKV LGR
Sbjct  209   IFGKGLSLYQDCVIRSIAKQSKADITGFITAQGRESEGERSGFSFLDCNIDGSGKVLLGR  268

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AW  +ATVVFS++ MS V+S + W DW + TRD+TV FGE+ C G GA+   R +Y KQL
Sbjct  269   AWRGFATVVFSQSYMSSVISSEGWGDWENVTRDKTVTFGEHRCYGEGANYKERVAYGKQL  328

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              +SEA+ +   SYIDG+ WL
Sbjct  329   TDSEASSYTDISYIDGDQWL  348


 Score =   111 bits (278),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +3

Query  438  SHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQG  617
            S V  VDLNG  NF +VQKAIDAVPDFS    LIII++G YREKV V + K N+++QG+G
Sbjct  51   SLVFIVDLNGNGNFTTVQKAIDAVPDFSLSRALIIINAGIYREKVIVSEKKTNILMQGRG  110

Query  618  YLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            Y  T I WNDTA+S+GG  +SYTF  FA  F+A NISF+
Sbjct  111  YQRTIIEWNDTAHSSGGNPNSYTFAIFAANFVASNISFK  149



>ref|XP_006285001.1| hypothetical protein CARUB_v10006308mg [Capsella rubella]
 gb|EOA17899.1| hypothetical protein CARUB_v10006308mg [Capsella rubella]
Length=327

 Score =   270 bits (690),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 149/200 (75%), Gaps = 0/200 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP+P  G  G QA+A+ I GDQ+AFYGCGFYGAQD L D RGRH+FK CFIQGSI  
Sbjct  128   KNYAPEPDPGMIGAQAVALRIDGDQAAFYGCGFYGAQDTLLDNRGRHFFKHCFIQGSIYI  187

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RS+Y++C I+SIA E   G+SG ITA G++ E+EK+GFSF+ C + G+GKVWLGR
Sbjct  188   IFGNGRSIYQDCIIHSIAKESASGMSGCITAHGKELEDEKTGFSFVNCRIDGTGKVWLGR  247

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AW  YA VVFSKT MSQVVS + WND  D    +TVYFGE+ C GPGA+ S R  Y KQL
Sbjct  248   AWRPYARVVFSKTYMSQVVSNEGWNDMKDHKTQKTVYFGEHRCYGPGANHSGRVPYGKQL  307

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EAAPF   S+IDGE+WL
Sbjct  308   TDVEAAPFTNISFIDGEEWL  327


 Score = 96.3 bits (238),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 78/115 (68%), Gaps = 7/115 (6%)
 Frame = +3

Query  411  SPLVSMYNVSHV-------ITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            S + S+Y +S V       + VD+ G  +F +VQ+A+++VPD S    LI + +G YREK
Sbjct  14   SSITSLYEISTVSAGFSLVLVVDVKGSGSFITVQEAVNSVPDLSKSKILIHVKAGVYREK  73

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            V + + + N+++QG G+ +T I WNDTANS+G T++SY+F  F+  F+AYNISF+
Sbjct  74   VIISERERNIVLQGTGFESTIIEWNDTANSSGSTANSYSFAIFSTNFVAYNISFK  128



>dbj|BAJ99366.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score =   263 bits (672),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 155/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP    GA+GGQA+A+ + GDQ+AF+ CG YGAQD L D++GRH F  C+++GSIDF
Sbjct  179   QNTAPPADPGASGGQAVALRVAGDQAAFHWCGVYGAQDTLLDEQGRHLFHGCYVEGSIDF  238

Query  1001  IFGKARSLYEECKINSI--ANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             IFG ARSLY  C I+S+  A   GGG++GSITAQGR S  EK+GF+F+ C V G+GKVWL
Sbjct  239   IFGNARSLYLNCTISSVAAATSNGGGVTGSITAQGRGSASEKTGFAFVGCSVVGTGKVWL  298

Query  1175  GRAWGSYATVVFSKTQMSQ-VVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYA  1351
             GRAWG YATVVF++T ++  VV+P+ WNDWND  R QTV+FGEY+  GPGA    R  YA
Sbjct  299   GRAWGPYATVVFARTYLAAGVVAPEGWNDWNDPARRQTVFFGEYESTGPGAGRDGRVPYA  358

Query  1352  KQLDESEAAPFLTTSYIDGEDWLIP  1426
             +QLD  +AAPF+  SYIDG+ W +P
Sbjct  359   RQLDSRQAAPFMDVSYIDGDQWAVP  383


 Score =   102 bits (254),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 85/129 (66%), Gaps = 4/129 (3%)
 Frame = +3

Query  366  KRRPKANKCDD-SKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVA--TL  536
            + R +  +CD+ ++W + + S  N + V+TVD  GC NF+SVQKA+DAVPD       TL
Sbjct  53   QGRRRRRQCDEQARWVAGIASQLNATLVLTVDHLGCGNFSSVQKAVDAVPDHGAAGGRTL  112

Query  537  IIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssY-TFGAFAPKFI  713
            + + +G +REKV +  +K  + + G+G LN+ ++WNDTA S+GG++ S  TF   A  F+
Sbjct  113  LAVGAGIFREKVVLWGNKTGVTLHGRGNLNSTVAWNDTAGSSGGSTPSSATFTVLAAGFV  172

Query  714  AYNISFQVT  740
            AYNISFQ T
Sbjct  173  AYNISFQNT  181



>ref|XP_010093131.1| putative pectinesterase 8 [Morus notabilis]
 gb|EXB53583.1| putative pectinesterase 8 [Morus notabilis]
Length=405

 Score =   262 bits (670),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 156/204 (76%), Gaps = 3/204 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G Q +A+ + GDQ+AF+GCGF+GAQD L+D +GRHYFK C+IQGSIDFI
Sbjct  199   NVAPIPKPGDVGAQGVAMRVSGDQAAFWGCGFFGAQDTLHDDKGRHYFKDCYIQGSIDFI  258

Query  1004  FGKARSLYEECKINSIAN---EGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE+C + S+AN   EG   I G +TA GR S++E +GF+F+ C +GG+G+VWL
Sbjct  259   FGNARSLYEDCVLISMANPVAEGSKFIDGCVTAHGRTSKDENTGFAFVNCTIGGTGRVWL  318

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF+ T MS +++P+ WND+ND TRDQT+++GEYDC GPGA+ S R+ Y +
Sbjct  319   GRAWRPFSRVVFAHTTMSDIIAPEGWNDFNDPTRDQTIFYGEYDCSGPGANMSMRAPYIQ  378

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L+++EA+ F+  S+ID   WL+P
Sbjct  379   RLNDTEASVFINASFIDANQWLLP  402


 Score =   102 bits (253),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 79/128 (62%), Gaps = 7/128 (5%)
 Frame = +3

Query  366  KRRPKANK----CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVA-  530
            K+RP   K    CDD +   P V   N + ++ VD NGC NF +VQ AIDAVP   P   
Sbjct  71   KKRPDKGKDSSICDDFQPQFPSVDA-NTTSILCVDRNGCCNFTTVQGAIDAVPTTPPSQK  129

Query  531  -TLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPK  707
             T+I I+SG Y EKV + ++K N+  QGQGY +TAI WNDTANS+ GT  S +   F+  
Sbjct  130  RTIIWINSGLYYEKVTIPRTKPNITFQGQGYTSTAIVWNDTANSSRGTFFSGSVQVFSDN  189

Query  708  FIAYNISF  731
            FIA NISF
Sbjct  190  FIAQNISF  197



>ref|XP_010534682.1| PREDICTED: probable pectinesterase 15 [Tarenaya hassleriana]
Length=330

 Score =   259 bits (663),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 146/200 (73%), Gaps = 0/200 (0%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP+P  G  GGQA+A+ I G+ +AFYGCGFYG QD L D  G H+FK CFIQGS+DF
Sbjct  127   KNTAPEPKPGGEGGQAVAVRIDGNHAAFYGCGFYGYQDTLLDNLGTHFFKDCFIQGSVDF  186

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  +SLY +C INS+A E   GISG ITA    +  E +GFSF+ C + G+GK+ LGR
Sbjct  187   IFGNGKSLYADCTINSVAKEVTSGISGYITAHASIARNESTGFSFVNCRIDGTGKILLGR  246

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AW  YATVVFSKT MS V+S D WNDW+D +RD+TV+FGEY   GPGAD S R  Y+KQL
Sbjct  247   AWRPYATVVFSKTYMSSVISSDGWNDWDDPSRDRTVFFGEYANYGPGADRSGRVPYSKQL  306

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              E EA+ ++  SYIDG+ WL
Sbjct  307   TEVEASLYMNLSYIDGDQWL  326


 Score =   104 bits (259),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N + V TVD  G  NF SVQ+A+DAVP  S   TLII+ SG YREKV V + K N++IQG
Sbjct  27   NAALVFTVDTRGMGNFTSVQRAVDAVPKMSLYRTLIIVTSGIYREKVTVGEDKPNIVIQG  86

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
             GY +T+I WNDTA ST GT ++++F  +A  F AYNISF+ T
Sbjct  87   NGYQSTSIEWNDTAASTNGTFNTFSFVVYADNFTAYNISFKNT  129



>ref|XP_009612401.1| PREDICTED: probable pectinesterase 8 [Nicotiana tomentosiformis]
Length=382

 Score =   270 bits (691),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 160/199 (80%), Gaps = 0/199 (0%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  GA G QA+AI I GDQ+AF+GCGF+GAQD L+D RGRHYFK+C+IQGSIDF+
Sbjct  179   NVAPIPGPGAVGAQAVAIRIGGDQAAFWGCGFFGAQDTLHDDRGRHYFKECYIQGSIDFV  238

Query  1004  FGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGRA  1183
             FG  +S YE+C++ SIA+ G   I+G++TA GR S+EE SGF+F+ C VGGSG++WLGRA
Sbjct  239   FGNGKSFYEDCQLTSIASPGSRSINGAVTAHGRASKEEDSGFAFVNCNVGGSGRIWLGRA  298

Query  1184  WGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQLD  1363
             W S++TVVF+ T M+ ++SPD WND ND +RDQT+++GEY+C G G++ S R+ Y ++L+
Sbjct  299   WRSFSTVVFANTFMTDIISPDGWNDLNDPSRDQTIFYGEYNCTGAGSNMSQRAPYVQKLN  358

Query  1364  ESEAAPFLTTSYIDGEDWL  1420
             +++A PFL++S+ID + WL
Sbjct  359   DTQALPFLSSSFIDADQWL  377


 Score = 92.8 bits (229),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 75/118 (64%), Gaps = 1/118 (1%)
 Frame = +3

Query  378  KANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGT  557
            K + CD+   + P +     S ++ VD NGC NF +VQ A+D+V +FS   TLI I+SG 
Sbjct  61   KQSICDNFSPNFPTIDPTTTS-ILCVDHNGCCNFTTVQAAVDSVGNFSATRTLIWINSGI  119

Query  558  YREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            Y EKV + K+K N+  QGQGY +TAI +ND ANS+ GT  S +   F+  FIA NISF
Sbjct  120  YFEKVIIPKTKPNITFQGQGYTSTAIVYNDNANSSRGTFYSGSVQVFSTNFIAKNISF  177



>ref|XP_006429777.1| hypothetical protein CICLE_v10011953mg [Citrus clementina]
 gb|ESR43017.1| hypothetical protein CICLE_v10011953mg [Citrus clementina]
Length=383

 Score =   262 bits (669),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 156/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP PS G  G QA+AI I GDQSAF+GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  177   NVAPIPSPGDVGAQAVAIRISGDQSAFFGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  236

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARS YE C++ S+AN    G   I+G++TA GR S++E SGF+F+ C +GG+G++WL
Sbjct  237   FGNARSFYENCQLISMANPVAPGSKAINGAVTAHGRASKDENSGFAFVNCTIGGTGRIWL  296

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF    M+ +++P+ WND+ND TRDQTV++GEY+C G G+D + R+ Y +
Sbjct  297   GRAWRPFSRVVFLFASMTDIIAPEGWNDFNDPTRDQTVFYGEYNCTGAGSDMTMRAPYVQ  356

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A+ FL TS+IDG+ WL
Sbjct  357   RLNDTQASLFLNTSFIDGDQWL  378


 Score = 99.0 bits (245),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 76/122 (62%), Gaps = 3/122 (2%)
 Frame = +3

Query  369  RRPKANKCDDSKWD-SPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIII  545
             R K + CDD   D +P  +  N +    VD NGC NF SVQ A+DAVP+ S    +++I
Sbjct  56   HRKKVSICDDFPKDFAPPDT--NTTSYFCVDRNGCCNFTSVQSAVDAVPNLSLKRNIVLI  113

Query  546  DSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNI  725
            +SG Y EKV V K+K N+  QGQGY +TAI+WNDTA S  GT  S +   FA  F+A NI
Sbjct  114  NSGIYYEKVTVPKTKPNITFQGQGYTSTAIAWNDTAKSANGTFYSGSVQVFASNFMAKNI  173

Query  726  SF  731
            SF
Sbjct  174  SF  175



>ref|XP_006659931.1| PREDICTED: probable pectinesterase 8-like [Oryza brachyantha]
Length=394

 Score =   274 bits (701),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 161/204 (79%), Gaps = 3/204 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+A+ I GDQ+AF+GCGF+GAQD L+D RGRHYFK+CFIQGSIDFI
Sbjct  183   NVAPIPRPGDVGAQAVALRIGGDQAAFWGCGFFGAQDTLHDDRGRHYFKECFIQGSIDFI  242

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ S+A+    G   I+GS+TA GR+SEEEK+G+SF+ C +GG+G++WL
Sbjct  243   FGDARSLYENCRVISMADAVPAGVRTITGSVTAHGRESEEEKTGYSFVNCSIGGTGRIWL  302

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+TVVF+ T MS +++ + WNDWNDS+RDQTV++GEY C G GA+ S+R  YA+
Sbjct  303   GRAWRPYSTVVFAYTSMSDIIASEGWNDWNDSSRDQTVFYGEYRCTGDGANLSDRVPYAQ  362

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L + +  P+L TSYIDG+ WL+P
Sbjct  363   KLSDGQVLPYLNTSYIDGDRWLMP  386


 Score = 86.3 bits (212),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +3

Query  444  VITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYL  623
            +  VD NGC +F +VQ A++AVP FS    ++ I+ G Y EKV V  +K N+  QGQG+ 
Sbjct  86   IFCVDPNGCCSFTTVQAAVNAVPSFSRKRNVVWINKGIYYEKVTVPATKPNITFQGQGFD  145

Query  624  NTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
             TAI+WNDTANS+ GT  S +   FA  F+A NISF
Sbjct  146  LTAIAWNDTANSSHGTFYSASVSVFATGFVAKNISF  181



>gb|KFK42874.1| hypothetical protein AALP_AA1G050100 [Arabis alpina]
Length=365

 Score =   263 bits (673),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 158/202 (78%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GDQSAF GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  159   NVAPIPKPGDVGAQAVAIRITGDQSAFVGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  218

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG A+SLY++C+I S+AN+   G   ++G++TA GR+S++E SGFSF+ C +GG+G VWL
Sbjct  219   FGNAKSLYQDCQIISMANQVSPGSKLVNGAVTANGRNSKDENSGFSFVNCTIGGTGHVWL  278

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ V+F  T M+ V++P+ WN++ND +RD T+++GEY+C GPGA+ S R+SY +
Sbjct  279   GRAWRPYSRVIFVSTTMTDVITPEGWNNFNDPSRDATIFYGEYNCSGPGAEMSKRASYVQ  338

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+E+  A F++TS+IDG+ WL
Sbjct  339   KLNETLVAEFISTSFIDGDQWL  360


 Score = 96.7 bits (239),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +3

Query  372  RPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDS  551
            + K + CDD   + P     N +  + VD NGC NF +VQ AIDA+ +FS +  +I I+S
Sbjct  39   KKKVSICDDFPKNIPPPDT-NTTAYLCVDKNGCCNFTTVQSAIDAIGNFSQIRNVIWINS  97

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            G Y EKV + K+K N+ +QGQG+  TAI+WNDTA S  GT    T   F  +F+A NISF
Sbjct  98   GMYYEKVVIPKTKPNITLQGQGFETTAIAWNDTAYSANGTFYCATVQVFGSQFVAKNISF  157



>ref|XP_011001039.1| PREDICTED: probable pectinesterase 8 [Populus euphratica]
Length=398

 Score =   266 bits (681),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 158/202 (78%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP PS G  G QA+AI I GDQ+ F GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  191   NVAPIPSPGDVGAQAVAIRISGDQAFFLGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  250

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ S+AN    G  GI+G++TA GR S++E +GF+F+ C +GG+G++WL
Sbjct  251   FGDARSLYENCQLISMANPVAPGAKGINGAVTAHGRISKDENTGFAFVNCTLGGTGRIWL  310

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+TV+FS T M+ +V+P+ WND+ND TRDQT+++ EY+C G GA+ + R+ Y +
Sbjct  311   GRAWRPYSTVIFSYTSMTDIVAPEGWNDFNDPTRDQTIFYAEYNCLGAGANMTMRAPYVQ  370

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A+PFL  S+IDG+ WL
Sbjct  371   KLNDTQASPFLNVSFIDGDQWL  392


 Score = 92.8 bits (229),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 66/100 (66%), Gaps = 0/100 (0%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N +  I VD NGC NF +VQ A+D+V +FS   T+I I+SG Y EKV V K K N+  QG
Sbjct  90   NTTSTICVDRNGCCNFTTVQSAVDSVMNFSQKRTIIWINSGIYYEKVTVLKYKQNITFQG  149

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            QGY +TAI WNDTA S+ GT  S +   F+  FIA NISF
Sbjct  150  QGYTSTAIVWNDTAKSSNGTFYSGSVQVFSNNFIAKNISF  189



>ref|XP_009772188.1| PREDICTED: probable pectinesterase 8 [Nicotiana sylvestris]
Length=382

 Score =   268 bits (684),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  GA G QA+AI I GDQ+AF+GCGF+GAQD L+D RGRHYFK+C+IQGSIDF+
Sbjct  179   NVAPIPGPGAVGAQAVAIRIGGDQAAFWGCGFFGAQDTLHDDRGRHYFKECYIQGSIDFV  238

Query  1004  FGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGRA  1183
             FG  +SLYE C++ S+A+ G   I+G++TA GR S+EE SGF+F+ C VGGSG++WLGRA
Sbjct  239   FGNGKSLYENCELISMASPGSRSINGAVTAHGRASKEEDSGFAFVNCNVGGSGRIWLGRA  298

Query  1184  WGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQLD  1363
             W  ++TVVF+ T M+ ++SPD WND ND +RDQT+++GEY+C G G++ S R+ Y ++L+
Sbjct  299   WRPFSTVVFANTFMTDIISPDGWNDLNDPSRDQTIFYGEYNCSGAGSNMSQRAPYVQKLN  358

Query  1364  ESEAAPFLTTSYIDGEDWL  1420
             +++A PFL++S+ID + WL
Sbjct  359   DTQALPFLSSSFIDADQWL  377


 Score = 91.3 bits (225),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 75/118 (64%), Gaps = 1/118 (1%)
 Frame = +3

Query  378  KANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGT  557
            K + CD+   + P +     S ++ VD NGC NF +VQ A+D+V +FS   +LI I+SG 
Sbjct  61   KQSICDNFSPNFPTIDPTTTS-ILCVDHNGCCNFTTVQAAVDSVGNFSATRSLIWINSGI  119

Query  558  YREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            Y EKV + K+K N+  QGQGY +TAI +ND ANS+ GT  S +   F+  FIA NISF
Sbjct  120  YFEKVIIPKTKPNITFQGQGYTSTAIVYNDNANSSRGTFYSGSVQVFSTNFIAKNISF  177



>ref|XP_006481444.1| PREDICTED: probable pectinesterase 8-like [Citrus sinensis]
Length=383

 Score =   259 bits (662),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP PS G  G QA+AI I GDQSAF+GCGF+GAQD L+D RGRHYFK C IQGSIDFI
Sbjct  177   NVAPIPSPGDVGAQAVAIRISGDQSAFFGCGFFGAQDTLHDDRGRHYFKDCHIQGSIDFI  236

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARS YE C++ S+AN    G   I+G++TA GR S++E SGF+F+ C VGG+G++WL
Sbjct  237   FGNARSFYENCQLISMANPVAPGSKAINGAVTAHGRASKDENSGFAFVNCTVGGTGRIWL  296

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF    M+ +++P+ WND+ND TRDQTV++GEY+C G G+D + R+ Y +
Sbjct  297   GRAWRPFSRVVFLFASMTDIIAPEGWNDFNDPTRDQTVFYGEYNCTGAGSDMTMRAPYVQ  356

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A+ FL  S+IDG+ WL
Sbjct  357   RLNDTQASLFLNISFIDGDQWL  378


 Score = 99.4 bits (246),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 76/122 (62%), Gaps = 3/122 (2%)
 Frame = +3

Query  369  RRPKANKCDDSKWD-SPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIII  545
             R K + CDD   D +P  +  N +    VD NGC NF SVQ A+DAVP+ S    +++I
Sbjct  56   HRKKVSICDDFPKDFAPPDT--NTTSYFCVDRNGCCNFTSVQSAVDAVPNLSLKRNIVLI  113

Query  546  DSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNI  725
            +SG Y EKV V K+K N+  QGQGY +TAI+WNDTA S  GT  S +   FA  F+A NI
Sbjct  114  NSGIYYEKVTVPKTKPNITFQGQGYTSTAIAWNDTAKSANGTFYSGSVQVFASNFMAKNI  173

Query  726  SF  731
            SF
Sbjct  174  SF  175



>ref|XP_007162301.1| hypothetical protein PHAVU_001G140600g [Phaseolus vulgaris]
 gb|ESW34295.1| hypothetical protein PHAVU_001G140600g [Phaseolus vulgaris]
Length=394

 Score =   262 bits (670),  Expect(2) = 5e-89, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 157/202 (78%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP PS GA G QA+AI + GDQS F GCGF+GAQD L+D +GRHYFK C+IQGSIDFI
Sbjct  189   NLAPMPSPGAVGAQAVAIRVSGDQSEFRGCGFFGAQDTLHDDKGRHYFKDCYIQGSIDFI  248

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C+I SIAN    G   I+G++TA GR S +E +GF+F+ C +GG+G++WL
Sbjct  249   FGNARSLYENCQIVSIANPVPVGQRSINGAVTAHGRVSGDENTGFAFVNCTIGGNGRIWL  308

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF+ T MS +++P+ WND+ND +RDQT+++GEY+C G GA+ + R+SY +
Sbjct  309   GRAWRPYSRVVFASTLMSDIIAPEGWNDFNDPSRDQTIFYGEYNCSGSGANTNLRASYVQ  368

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+E+EA+ F  T++IDG+ WL
Sbjct  369   KLNETEASAFFNTTFIDGDQWL  390


 Score = 95.9 bits (237),  Expect(2) = 5e-89, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 74/126 (59%), Gaps = 5/126 (4%)
 Frame = +3

Query  366  KRRPKANK----CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVAT  533
            K+ P        CDD     P  +  N +  + VD  GC NF +VQ A++AVPDFS   T
Sbjct  63   KKHPSGGNTDSICDDFPSGIPPPNT-NTTSYLCVDRRGCCNFTTVQAAVNAVPDFSVKRT  121

Query  534  LIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFI  713
            +I I+ G Y EKV V K+K N+  QGQGY +TAI+WNDTA S  GT  S +   FA  FI
Sbjct  122  IIWINIGMYYEKVMVPKTKPNITFQGQGYTSTAIAWNDTALSANGTFYSGSVQVFASNFI  181

Query  714  AYNISF  731
            A NISF
Sbjct  182  AKNISF  187



>ref|XP_002323171.2| hypothetical protein POPTR_0016s01920g [Populus trichocarpa]
 gb|EEF04932.2| hypothetical protein POPTR_0016s01920g [Populus trichocarpa]
Length=380

 Score =   265 bits (678),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 158/202 (78%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP PS G  G QA+AI I GDQ+ F GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  174   NVAPIPSPGDIGAQAVAIRISGDQAFFLGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  233

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ S+AN    G  GI+G++TA GR S++E +GF+F+ C +GG+G++WL
Sbjct  234   FGNARSLYENCQLISMANPVAPGAKGINGAVTAHGRISKDENTGFAFVNCSLGGTGRIWL  293

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y++V+FS T M+ +V P+ WND+ND TRDQT+++GEY+C G GA+ + R+ Y +
Sbjct  294   GRAWRPYSSVIFSYTSMTDIVVPEGWNDFNDPTRDQTIFYGEYNCLGAGANMTMRAPYVQ  353

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A+PFL  S+IDG+ WL
Sbjct  354   KLNDTQASPFLNVSFIDGDQWL  375


 Score = 92.8 bits (229),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 66/100 (66%), Gaps = 0/100 (0%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N +  I VD NGC NF +VQ A+D+V +FS   T+I I+SG Y EKV V K K N+  QG
Sbjct  73   NTTSTICVDRNGCCNFTTVQSAVDSVMNFSQKRTIIWINSGIYYEKVTVLKYKQNITFQG  132

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            QGY +TAI WNDTA S+ GT  S +   F+  FIA NISF
Sbjct  133  QGYTSTAIVWNDTAKSSNGTFYSGSVQVFSNNFIAKNISF  172



>ref|XP_002892282.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68541.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=403

 Score =   264 bits (674),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 156/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GD+SAF GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  197   NVAPIPKPGDVGAQAVAIRIAGDESAFVGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  256

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG A+SLY++C+I S+AN+   G   ++G++TA GR S++E SGFSF+ C +GG+G VWL
Sbjct  257   FGNAKSLYQDCRIISMANQVSPGSKAVNGAVTANGRSSKDENSGFSFVNCTIGGTGHVWL  316

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF  T M+ V++P+ WN++ND +RD T+++GEY+C GPGAD S R++Y +
Sbjct  317   GRAWRPYSRVVFVSTTMTDVIAPEGWNNFNDPSRDATIFYGEYNCSGPGADMSKRAAYVQ  376

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+E++ A  + TSYIDG+ WL
Sbjct  377   KLNETQVALLINTSYIDGDQWL  398


 Score = 93.6 bits (231),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +3

Query  372  RPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDS  551
            + K + CDD   + P +     S+ + VD NGC NF +VQ A+DAV +FS    +I I+S
Sbjct  77   KKKVSICDDFPKNIPPLDTDTTSY-LCVDKNGCCNFTTVQSAVDAVGNFSQRRNVIWINS  135

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            G Y EKV + K+K N+ +QGQG+  TAI+WNDTA S  GT    +   F  +F+A NISF
Sbjct  136  GMYYEKVVIPKTKPNITLQGQGFETTAIAWNDTAYSANGTFYCASVQVFGSQFVAKNISF  195



>ref|XP_011073122.1| PREDICTED: probable pectinesterase 8 [Sesamum indicum]
Length=402

 Score =   257 bits (657),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+A+ I GDQ+AF+GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  196   NVAPIPGPGVVGAQAVALRIAGDQAAFWGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  255

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG A+S YE C I SIA+    G   I+G++TA GR S++E SGF+F+ C +GG+G++WL
Sbjct  256   FGNAKSFYEGCHITSIASPVAPGARVINGAVTAHGRASKDENSGFAFVNCSIGGTGRIWL  315

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++TVVFS T M+ +++P+ WND+ND TRD ++++GEY+C G GA+ + R  YA+
Sbjct  316   GRAWRPFSTVVFSYTSMTDIIAPEGWNDFNDPTRDLSIFYGEYNCTGDGANTTLRVPYAQ  375

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A+PFL  S++D + WL
Sbjct  376   RLNDTQASPFLNVSFVDADQWL  397


 Score = 99.4 bits (246),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 68/101 (67%), Gaps = 0/101 (0%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N + +  VD NGC NF +VQ A+DAV   SP  T+I I++G Y EKV + K+K N+  QG
Sbjct  95   NTTSIFCVDSNGCCNFTTVQAAVDAVGVMSPKRTVIWINTGIYFEKVIIPKTKPNITFQG  154

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            QGY +TAI WNDTANS+ GT  S +   FAP FIA NISF 
Sbjct  155  QGYTSTAIVWNDTANSSHGTFYSGSVQVFAPNFIAKNISFM  195



>ref|XP_006418040.1| hypothetical protein EUTSA_v10009800mg [Eutrema salsugineum]
 gb|ESQ36393.1| hypothetical protein EUTSA_v10009800mg [Eutrema salsugineum]
Length=399

 Score =   262 bits (669),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 158/202 (78%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GD+SAF GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  193   NVAPIPKPGDVGAQAVAIRIAGDESAFVGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  252

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG A+SLY++C+I S+AN+   G   ++G++TA GR+S++E SGFSF+ C +GG+G VWL
Sbjct  253   FGNAKSLYQDCQIISMANQLSPGSKAVNGAVTANGRNSKDENSGFSFVNCSIGGTGHVWL  312

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF  T M+ V++P+ WN++ND +RD T+++GEY+C GPGA+ S R++Y +
Sbjct  313   GRAWRPYSRVVFVSTSMTDVIAPEGWNNFNDPSRDATIFYGEYNCSGPGAEISKRAAYVQ  372

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+E++   F++TS+IDG+ WL
Sbjct  373   KLNETQVFQFISTSFIDGDQWL  394


 Score = 95.1 bits (235),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +3

Query  372  RPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDS  551
            + K + CDD   + P     NV+  + VD NGC NF +VQ A+DA+ +FS    +I I+S
Sbjct  73   KKKVSICDDFPKNIPPPDT-NVTSYLCVDKNGCCNFTTVQSAVDAIGNFSQRRNVIWINS  131

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            G Y EKV + K+K N+ +QGQG+  TAI+WNDTA S  GT    +   F  +FIA NISF
Sbjct  132  GMYYEKVVIPKTKPNITLQGQGFETTAIAWNDTAYSANGTFYCASVQVFGSQFIAKNISF  191



>ref|XP_011014966.1| PREDICTED: probable pectinesterase 8 [Populus euphratica]
Length=398

 Score =   264 bits (674),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 158/202 (78%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP PS G  G QA+AI I GDQ+ F GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  191   NVAPIPSPGDFGAQAVAIRISGDQAFFLGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  250

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ S+AN    G  GI+G++TA GR S++E +GF+F+ C +GG+G++WL
Sbjct  251   FGDARSLYENCQLISMANPVAPGAKGINGAVTAHGRISKDENTGFAFVNCTLGGTGRIWL  310

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+TV+FS T M+ +V+P+ WND+ND TR+QT+++ EY+C G GA+ + R+ Y +
Sbjct  311   GRAWRPYSTVIFSYTSMTDIVAPEGWNDFNDPTREQTIFYAEYNCLGAGANMTMRAPYVQ  370

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A+PFL  S+IDG+ WL
Sbjct  371   KLNDTQASPFLNVSFIDGDQWL  392


 Score = 92.8 bits (229),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 66/100 (66%), Gaps = 0/100 (0%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N +  I VD NGC NF +VQ A+D+V +FS   T+I I+SG Y EKV V K K N+  QG
Sbjct  90   NTTSTICVDRNGCCNFTTVQSAVDSVMNFSQKRTIIWINSGIYYEKVTVLKYKQNITFQG  149

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            QGY +TAI WNDTA S+ GT  S +   F+  FIA NISF
Sbjct  150  QGYTSTAIVWNDTAKSSNGTFYSGSVQVFSNNFIAKNISF  189



>gb|EEC85099.1| hypothetical protein OsI_32473 [Oryza sativa Indica Group]
Length=506

 Score =   241 bits (616),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 151/211 (72%), Gaps = 6/211 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NT+P P  G  GGQA+A+ + GD++AF+ CG Y AQD L D+ GRH F+ C+I+GSIDF
Sbjct  286   QNTSPPPEPGDAGGQAVALRVAGDEAAFHWCGVYSAQDTLLDESGRHLFRGCYIEGSIDF  345

Query  1001  IFGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVW  1171
             IFG ARSLY  C I+S+A     G   ++GS+TAQGR S  E++GF+F++C V G+G+VW
Sbjct  346   IFGNARSLYVGCTISSVAMASATGNKEVTGSVTAQGRASAAERTGFAFVRCSVVGTGQVW  405

Query  1172  LGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGA--DCSNRSS  1345
             LGRAWG YATVVF++T +  VV+ + WNDW D  R Q V+F EY C GPG+    + R S
Sbjct  406   LGRAWGPYATVVFAETYLGDVVAAEGWNDWGDPGRRQQVWFAEYACWGPGSATAATGRVS  465

Query  1346  YAKQLDESEAAPFLTTSYIDGEDWLIPTPNT  1438
             YA+QLD+ +AAPF+  SYID   W +P P+T
Sbjct  466   YARQLDQRQAAPFMDVSYIDANQWALP-PST  495


 Score =   115 bits (287),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 88/129 (68%), Gaps = 5/129 (4%)
 Frame = +3

Query  369  RRPKANKCDDS-KWDSPLVSMYNVSHVITVDLN---GCANFASVQKAIDAVPDFSPVATL  536
             R +  +C +  +W + L S +N + ++TVD N   GCANF ++QKA+DAVPD++   TL
Sbjct  160  HRRRTKRCAEHLRWAASLASQHNATLLLTVDRNQAAGCANFTTIQKAVDAVPDYAATRTL  219

Query  537  IIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtss-sYTFGAFAPKFI  713
            I +D+G YREKV V  +K  L + G+G LNT ++WN T+NSTGG++  S TF   AP F+
Sbjct  220  IAVDAGIYREKVVVWSNKTALTLHGRGNLNTTVAWNATSNSTGGSTVYSATFTVLAPAFV  279

Query  714  AYNISFQVT  740
            AYNI+FQ T
Sbjct  280  AYNITFQNT  288



>ref|XP_004305897.1| PREDICTED: probable pectinesterase 8-like [Fragaria vesca subsp. 
vesca]
Length=414

 Score =   260 bits (664),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 157/204 (77%), Gaps = 4/204 (2%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI + GDQSAF+GCGF+GAQD L+D +GRHYF+ C+IQGSIDFI
Sbjct  208   NVAPIPKPGDVGAQAVAIRVSGDQSAFWGCGFFGAQDTLHDDKGRHYFRDCYIQGSIDFI  267

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ S+AN    G   I+G++TA GR S E  +G+SF+ C VGGSG+VWL
Sbjct  268   FGNARSLYENCQLVSMANPVAPGAKIINGALTAHGRASNEN-TGYSFVNCIVGGSGRVWL  326

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF  T M+ +++P+ WND+ND TRDQT+++GEY+C G GA+ + R+SY +
Sbjct  327   GRAWRPFSRVVFINTTMTDIIAPEGWNDFNDPTRDQTIFYGEYNCSGAGANLTMRASYVQ  386

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L++++A+PFL  S+IDG DWL P
Sbjct  387   KLNDTQASPFLNVSFIDGNDWLQP  410


 Score = 95.9 bits (237),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 69/115 (60%), Gaps = 1/115 (1%)
 Frame = +3

Query  390  CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            CDD     P     N +  + VD NGC NF  VQ A+DAVP  S   T+I I++G Y EK
Sbjct  94   CDDFPPGIPPPDT-NTTSYLCVDRNGCCNFTLVQSAVDAVPALSQKRTVIWINNGIYYEK  152

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            V V  +K N+  QGQGY +TAISWNDTANS+ GT  S +   F   FIA NISF 
Sbjct  153  VTVPSAKPNITFQGQGYFSTAISWNDTANSSHGTFYSGSVQVFGANFIAKNISFM  207



>ref|NP_001063991.1| Os09g0571100 [Oryza sativa Japonica Group]
 dbj|BAD46605.1| putative pectin methylesterase [Oryza sativa Japonica Group]
 dbj|BAF25905.1| Os09g0571100 [Oryza sativa Japonica Group]
 gb|EAZ45745.1| hypothetical protein OsJ_30426 [Oryza sativa Japonica Group]
 dbj|BAG97861.1| unnamed protein product [Oryza sativa Japonica Group]
Length=408

 Score =   241 bits (615),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 151/211 (72%), Gaps = 6/211 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NT+P P  G  GGQA+A+ + GD++AF+ CG Y AQD L D+ GRH F+ C+I+GSIDF
Sbjct  188   QNTSPPPEPGDAGGQAVALRVAGDEAAFHWCGVYSAQDTLLDESGRHLFRGCYIEGSIDF  247

Query  1001  IFGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVW  1171
             IFG ARSLY  C I+S+A     G   ++GS+TAQGR S  E++GF+F++C V G+G+VW
Sbjct  248   IFGNARSLYVGCTISSVAMASATGNKEVTGSVTAQGRASAAERTGFAFVRCSVVGTGQVW  307

Query  1172  LGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGA--DCSNRSS  1345
             LGRAWG YATVVF++T +  VV+ + WNDW D  R Q V+F EY C GPG+    + R S
Sbjct  308   LGRAWGPYATVVFAETYLGDVVAAEGWNDWGDPGRRQQVWFAEYACWGPGSATAATGRVS  367

Query  1346  YAKQLDESEAAPFLTTSYIDGEDWLIPTPNT  1438
             YA+QLD+ +AAPF+  SYID   W +P P+T
Sbjct  368   YARQLDQRQAAPFMDVSYIDANQWALP-PST  397


 Score =   115 bits (287),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 90/130 (69%), Gaps = 7/130 (5%)
 Frame = +3

Query  366  KRRPKANKCDDS-KWDSPLVSMYNVSHVITVDLN---GCANFASVQKAIDAVPDFSPVAT  533
            +RR K  +C +  +W + L S +N + ++TVD N   GCANF ++QKA+DAVPD++   T
Sbjct  63   RRRTK--RCAEHLRWAASLASQHNATLLLTVDRNQAAGCANFTTIQKAVDAVPDYAATRT  120

Query  534  LIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtss-sYTFGAFAPKF  710
            LI +D+G YREKV V  +K  L + G+G LNT ++WN T+NSTGG++  S TF   AP F
Sbjct  121  LIAVDAGIYREKVVVWSNKTALTLHGRGNLNTTVAWNATSNSTGGSTVYSATFTVLAPAF  180

Query  711  IAYNISFQVT  740
            +AYNI+FQ T
Sbjct  181  VAYNITFQNT  190



>ref|XP_008809346.1| PREDICTED: probable pectinesterase 8 [Phoenix dactylifera]
Length=391

 Score =   263 bits (672),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 156/204 (76%), Gaps = 3/204 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP PS G  G QA+AI + GDQSAF+GCGF+GAQD L+D RGRHYFK+C+IQGSIDFI
Sbjct  186   NVAPIPSPGDVGAQAVAIRVGGDQSAFWGCGFFGAQDTLHDDRGRHYFKECYIQGSIDFI  245

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ SIA+    G   I+G++TA GR S +E +GFSF+ C +GG+G++WL
Sbjct  246   FGDARSLYESCEMISIASPVPAGLKVINGAVTAHGRASGDENTGFSFVNCTIGGTGRIWL  305

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF  T M+ ++SP+ WND+ND  RDQT+++GEY C GPGA+ S R+ Y +
Sbjct  306   GRAWRPYSRVVFINTFMTDIISPEGWNDFNDPARDQTLFYGEYKCSGPGANQSMRAPYVQ  365

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L +++A PFL  SYIDG+ WL P
Sbjct  366   KLSDAQALPFLNASYIDGDQWLQP  389


 Score = 92.8 bits (229),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N + ++ VD NGC NF +VQ A+DAV +FS   T+I I+ G Y EKV + ++K ++  QG
Sbjct  85   NTTSILCVDRNGCCNFTTVQSAVDAVGNFSQKRTVIWINKGIYYEKVTIPRTKSSITFQG  144

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            QG  +TAI+WNDTANS  GT +S +   F   FIA NISF
Sbjct  145  QGLYSTAIAWNDTANSAHGTFNSASVSTFGTNFIAKNISF  184



>gb|KHG03314.1| putative pectinesterase 8 -like protein [Gossypium arboreum]
Length=347

 Score =   259 bits (663),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 158/202 (78%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GDQ+AF+GCGFYGAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  141   NVAPLPRPGDVGAQAVAIRIAGDQAAFWGCGFYGAQDTLHDDRGRHYFKDCYIQGSIDFI  200

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  +SLYE+C++ S+AN+   G   I+G++TA GR S +E SGF+F+ C +GG+G++WL
Sbjct  201   FGNGKSLYEDCQLISMANQVAPGSKSINGAVTAHGRASADEDSGFAFVNCSIGGTGRIWL  260

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF+ T M+ +++P+ WND+ND +RDQT+++GEY+C G GA+ S R+ Y +
Sbjct  261   GRAWRPYSRVVFALTSMTDIIAPEGWNDFNDPSRDQTIFYGEYNCTGAGANMSGRAPYVQ  320

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A+ FLTTS+ID + WL
Sbjct  321   KLNDTQASLFLTTSFIDADQWL  342


 Score = 96.3 bits (238),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N +  + VD NGC NF +VQ A+DAVP+ S   ++I I++G Y EKV + K+K N+  QG
Sbjct  40   NTTLTLCVDRNGCCNFTTVQAAVDAVPNLSMKRSVIWINTGIYYEKVIIPKTKPNITFQG  99

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            QGY +TAI+WNDTANS  GT  S +   F+  FIA NISF
Sbjct  100  QGYTSTAIAWNDTANSANGTFYSGSVQVFSTNFIAKNISF  139



>ref|XP_004493561.1| PREDICTED: probable pectinesterase 8-like [Cicer arietinum]
Length=399

 Score =   258 bits (658),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 156/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P+ GA G QA+A+ I GDQ+ F GCGF+GAQD L+D +GRHYFK C+IQGSIDFI
Sbjct  196   NLAPIPTPGAEGAQAVAMRISGDQAEFRGCGFFGAQDTLHDDKGRHYFKDCYIQGSIDFI  255

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C+I SIAN    G   I+G++TA GR S +E +G++F+   +GG+G++WL
Sbjct  256   FGNARSLYENCQIVSIANPVPPGQKNINGAVTAHGRVSMDENTGYAFVNSTIGGNGRIWL  315

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF+ T MS +++P+ WND+ND TRDQT+++GEY+C GPGA+ + R+ Y +
Sbjct  316   GRAWRPYSRVVFAFTIMSDIIAPEGWNDFNDPTRDQTIFYGEYNCSGPGANVNTRAPYVQ  375

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A PFL  S+IDG+ WL
Sbjct  376   RLNDTQAFPFLNASFIDGDLWL  397


 Score = 97.1 bits (240),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 72/115 (63%), Gaps = 1/115 (1%)
 Frame = +3

Query  390  CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            CDD     P  +   +S+   VD  GC NF +VQ+A++AVPDFS    +I I+SG Y EK
Sbjct  82   CDDFPPGIPPPNTDTISY-FCVDRKGCCNFTTVQQAVNAVPDFSLKRNIIWINSGIYYEK  140

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            V V K+K N+  QGQ Y +TAI+WNDTA S  GT  S +   FAP FIA NISF 
Sbjct  141  VMVPKTKPNITFQGQSYTSTAIAWNDTAKSANGTFYSGSVQVFAPNFIAKNISFM  195



>ref|NP_172023.1| putative pectinesterase 8 [Arabidopsis thaliana]
 sp|O23038.2|PME8_ARATH RecName: Full=Probable pectinesterase 8; Short=PE 8; AltName: 
Full=Pectin methylesterase 2; Short=AtPME2; AltName: Full=Pectin 
methylesterase 8; Short=AtPME8; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE27822.1| putative pectinesterase 8 [Arabidopsis thaliana]
Length=393

 Score =   262 bits (669),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GD+SAF GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  187   NVAPIPKPGDVGAQAVAIRIAGDESAFVGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  246

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG A+SLY++C+I S+AN+   G   ++G++TA GR S++E SGFSF+ C +GG+G VWL
Sbjct  247   FGNAKSLYQDCRIISMANQLSPGSKAVNGAVTANGRSSKDENSGFSFVNCTIGGTGHVWL  306

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF  T M+ V++P+ WN++ND +RD T+++GEY+C GPGAD S R+ Y +
Sbjct  307   GRAWRPYSRVVFVSTTMTDVIAPEGWNNFNDPSRDATIFYGEYNCSGPGADMSKRAPYVQ  366

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+E++ A  + TS+IDG+ WL
Sbjct  367   KLNETQVALLINTSFIDGDQWL  388


 Score = 92.8 bits (229),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 73/118 (62%), Gaps = 1/118 (1%)
 Frame = +3

Query  378  KANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGT  557
            K + CDD   + P +     S+ + VD NGC NF +VQ A+DAV +FS    +I I+SG 
Sbjct  69   KVSICDDFPKNIPPLDTDTTSY-LCVDKNGCCNFTTVQSAVDAVGNFSQRRNVIWINSGM  127

Query  558  YREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            Y EKV + K+K N+ +QGQG+  TAI+WNDTA S  GT    T   F  +F+A NISF
Sbjct  128  YYEKVVIPKTKPNITLQGQGFDITAIAWNDTAYSANGTFYCATVQVFGSQFVAKNISF  185



>gb|KHN26371.1| Putative pectinesterase 8 [Glycine soja]
Length=395

 Score =   258 bits (659),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 156/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP PS GA G QA+AI + GDQS F GCGF+GAQD L+D +GRHYFK C+IQGSIDFI
Sbjct  190   NLAPMPSPGAVGAQAVAIRVSGDQSEFRGCGFFGAQDTLHDDKGRHYFKDCYIQGSIDFI  249

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C+I SIAN    G   I+G++TA GR S +E +GF+F+   +GG+G++WL
Sbjct  250   FGNARSLYENCEIVSIANPVPAGQKSINGAVTAHGRVSGDENTGFAFVNSTIGGNGRIWL  309

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF+ + MS +++P+ WND+ND +RDQT+++GEY+C GPGA+ + R+ Y +
Sbjct  310   GRAWRPYSRVVFAFSIMSDIIAPEGWNDFNDPSRDQTIFYGEYNCSGPGANTNFRAPYVQ  369

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+E++A  FL TS+IDG+ WL
Sbjct  370   KLNETQALAFLNTSFIDGDQWL  391


 Score = 96.3 bits (238),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +3

Query  390  CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            CDD     P  +  N +  + VD  GC NF +VQ A++AVPDFS   T+I I+SG Y EK
Sbjct  76   CDDFPPGIPPPNT-NTTSYLCVDRKGCCNFTTVQAAVNAVPDFSVKRTIIWINSGMYYEK  134

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            V V K+K N+  QGQGY +TAI+WNDTA S  GT  S +   F   FIA NISF
Sbjct  135  VLVPKTKPNITFQGQGYTSTAIAWNDTALSANGTFYSGSVQVFGSNFIAKNISF  188



>ref|XP_003553427.1| PREDICTED: probable pectinesterase 8-like [Glycine max]
Length=395

 Score =   258 bits (660),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 156/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP PS GA G QA+AI + GDQS F GCGF+GAQD L+D +GRHYFK C+IQGSIDFI
Sbjct  190   NLAPMPSPGAVGAQAVAIRVSGDQSEFSGCGFFGAQDTLHDDKGRHYFKDCYIQGSIDFI  249

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C+I SIAN    G   I+G++TA GR S +E +GF+F+   +GG+G++WL
Sbjct  250   FGNARSLYENCEIVSIANPVPAGQKSINGAVTAHGRVSGDENTGFAFVNSTIGGNGRIWL  309

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF+ + MS +++P+ WND+ND +RDQT+++GEY+C GPGA+ + R+ Y +
Sbjct  310   GRAWRPYSRVVFAFSIMSDIIAPEGWNDFNDPSRDQTIFYGEYNCSGPGANTNFRAPYVQ  369

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+E++A  FL TS+IDG+ WL
Sbjct  370   KLNETQALAFLNTSFIDGDQWL  391


 Score = 96.3 bits (238),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 75/126 (60%), Gaps = 5/126 (4%)
 Frame = +3

Query  366  KRRPKANK----CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVAT  533
            K+ P +      CDD     P  +  N +  + VD  GC NF +VQ A++AVPDFS   T
Sbjct  64   KKHPDSGNTDSICDDFPPGIPPPNT-NTTSYLCVDRKGCCNFTTVQAAVNAVPDFSVKRT  122

Query  534  LIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFI  713
            +I I+SG Y EKV V K+K N+  QGQGY +TAI+WNDTA S  GT  S +   F   FI
Sbjct  123  IIWINSGMYYEKVLVPKTKPNITFQGQGYTSTAIAWNDTALSANGTFYSGSVQVFGSNFI  182

Query  714  AYNISF  731
            A NISF
Sbjct  183  AKNISF  188



>ref|XP_010260644.1| PREDICTED: probable pectinesterase 8 [Nelumbo nucifera]
Length=394

 Score =   263 bits (673),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 158/204 (77%), Gaps = 3/204 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP PS G  G QA+AI I GDQ+AF+GCGF+GAQD L+D RGRHYF+ CFIQGSIDFI
Sbjct  189   NVAPMPSPGDVGAQAVAIRIAGDQAAFWGCGFFGAQDTLHDDRGRHYFRDCFIQGSIDFI  248

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  RSLYE C++ SIA+    G   I G++TA GR S++E +GFSF+ C +GG+G++WL
Sbjct  249   FGDGRSLYENCQLISIASPVPVGQKSIDGAVTAHGRASKDENTGFSFVNCSIGGTGRIWL  308

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF+ T M+ +++P+ WND+ND TRDQT+++GEY C G GA+ + R+ Y +
Sbjct  309   GRAWRPFSRVVFAYTTMTDIITPEGWNDFNDVTRDQTIFYGEYMCSGAGANMTLRAPYVQ  368

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L++S+A+PFL +SYIDG+ WL P
Sbjct  369   RLNDSQASPFLNSSYIDGDQWLQP  392


 Score = 90.9 bits (224),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N + +  VD +GC NF +VQ A+DAV +FS   T+I I+SG Y EKV V ++K N+  QG
Sbjct  88   NTTSIFCVDQSGCCNFTTVQSAVDAVGNFSQKRTIIWINSGIYFEKVMVPRTKPNITFQG  147

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            QG  +TAI WNDTANS+ GT  S +   F+  FIA NISF
Sbjct  148  QGLGSTAIVWNDTANSSHGTFYSGSVQVFSNNFIAKNISF  187



>gb|KDP42780.1| hypothetical protein JCGZ_00479 [Jatropha curcas]
Length=388

 Score =   259 bits (663),  Expect(2) = 7e-88, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GDQ+AF GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  185   NVAPIPGPGYMGAQAVAIRIAGDQAAFLGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  244

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ S+AN    G   I+G++TA GR S++E +GF F+ C +GGSG++WL
Sbjct  245   FGNARSLYENCQLISMANPVAPGQRVINGAVTAHGRTSKDENTGFVFVNCSLGGSGRIWL  304

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ V+F+ T M+ +++P+ WND+ND TRDQT+++GEY+C GPGA+ + R+ Y +
Sbjct  305   GRAWRPFSRVIFAYTSMTDIIAPEGWNDFNDPTRDQTIFYGEYNCYGPGANMTMRAPYVQ  364

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+++EA+ FL  S+ID + WL
Sbjct  365   RLNDTEASTFLNASFIDRDQWL  386


 Score = 94.7 bits (234),  Expect(2) = 7e-88, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N +  I VD NGC NF +VQ A+D+V +F+   T+I I+SG Y EKV + ++K N+  QG
Sbjct  84   NTTSTICVDPNGCCNFTTVQSAVDSVANFTQKRTIIWINSGIYYEKVIIPRTKPNITFQG  143

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            QGY +TAI WNDTANS+GGT  S +   F+  FIA NISF
Sbjct  144  QGYTSTAIVWNDTANSSGGTFYSGSVQVFSDSFIAKNISF  183



>gb|KDP29213.1| hypothetical protein JCGZ_16602 [Jatropha curcas]
Length=397

 Score =   293 bits (749),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 165/216 (76%), Gaps = 5/216 (2%)
 Frame = +2

Query  779   NVRAYD*VNGFLGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGR  958
             N  AY+     +  KN AP PS G  GGQA+A+ +  DQ+AFY CGFYGAQD L+D  GR
Sbjct  171   NFTAYN-----ISFKNAAPNPSPGVVGGQAVALRVAADQAAFYWCGFYGAQDTLHDDHGR  225

Query  959   HYFKQCFIQGSIDFIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFL  1138
             HYFK+CFIQGSIDFIFG ARSL+E C I+S A     G+SG+ITAQ R+S  E++GFSF+
Sbjct  226   HYFKECFIQGSIDFIFGNARSLFEGCTISSTAKPPKAGVSGAITAQARESIIEETGFSFV  285

Query  1139  KCEVGGSGKVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGP  1318
              C + GSGKVWLGRAWG+YATVVFSKT MS VVSPDAWNDW+D +RDQTV+FGEY+C GP
Sbjct  286   GCRIDGSGKVWLGRAWGAYATVVFSKTYMSNVVSPDAWNDWSDPSRDQTVFFGEYECYGP  345

Query  1319  GADCSNRSSYAKQLDESEAAPFLTTSYIDGEDWLIP  1426
             GA+ ++R SY KQL   EAAP++  S+IDG  WL P
Sbjct  346   GANYTHRVSYGKQLTHYEAAPYMDISFIDGYTWLHP  381


 Score = 95.9 bits (237),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 104/207 (50%), Gaps = 35/207 (17%)
 Frame = +3

Query  135  RSTSILFWLIAFTIAFFSltfslysn--llttttvltvntpttllpflRSVVKQTGLDDF  308
            R  S  FWL AF IA FS+T S Y+      + +V      +  L  L+ V ++TGL+D 
Sbjct  2    RIKSFSFWLFAFGIALFSITISFYAIPPSPFSASVPLTIQNSFQLHILKRVFERTGLEDT  61

Query  309  LSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWD---SPLVSMYNVS--HVITVDLNGCA  473
            L+ I                      KCD  +       L+  + VS   ++TVDL GC 
Sbjct  62   LARILSRHHHHHHRRKV---------KCDQKRLIYRFRKLICQHKVSTSSILTVDLKGCG  112

Query  474  NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTA  653
            NF+SVQKAIDAVP+F    TLIIIDS                   GQGYLNTAI WNDTA
Sbjct  113  NFSSVQKAIDAVPEFKSSPTLIIIDS-------------------GQGYLNTAIEWNDTA  153

Query  654  NstggtsssYTFGAFAPKFIAYNISFQ  734
            NSTG T  S +   FA  F AYNISF+
Sbjct  154  NSTGRTVYSASVAIFALNFTAYNISFK  180



>ref|XP_008787556.1| PREDICTED: putative pectinesterase 14 [Phoenix dactylifera]
Length=444

 Score =   294 bits (752),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 171/219 (78%), Gaps = 8/219 (4%)
 Frame = +2

Query  779   NVRAYD*VNGFLGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGR  958
             N RAY+     +  +NTAP  S G  GGQA+A+ I GDQ+AFYGCGFYGAQD L D RGR
Sbjct  192   NFRAYN-----ISFQNTAPPASPGDVGGQAVALRISGDQAAFYGCGFYGAQDTLLDDRGR  246

Query  959   HYFKQCFIQGSIDFIFGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGF  1129
             HYF++CFI+GSIDFIFG ARS+YE+C INS+A +   G G ISG ITA GR S  EK+GF
Sbjct  247   HYFRECFIEGSIDFIFGNARSIYEDCTINSVAKQVPDGMGSISGCITAHGRQSANEKTGF  306

Query  1130  SFLKCEVGGSGKVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDC  1309
             SF+ C + G+G+VWLGRAWG YATVVFS+T +S +V+P+ WNDWND +RDQ VYFGEY+C
Sbjct  307   SFVNCSISGTGRVWLGRAWGPYATVVFSRTYISGIVAPEGWNDWNDPSRDQLVYFGEYEC  366

Query  1310  RGPGADCSNRSSYAKQLDESEAAPFLTTSYIDGEDWLIP  1426
              GPGA+ + R++YAKQLD+ EAA F+  SYIDG +W++P
Sbjct  367   MGPGANSTLRTAYAKQLDQCEAAQFMDISYIDGCEWVLP  405


 Score =   144 bits (363),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYRE  566
            +CD SKW SP+ S  NV+ V+TVDL GCANF+ VQKA+DAVPD+SP  TLIIIDSG YRE
Sbjct  86   ECDKSKWVSPIASDQNVALVLTVDLKGCANFSKVQKAVDAVPDYSPSRTLIIIDSGVYRE  145

Query  567  KVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            KV V  +K N+ +QGQGYLNTAI+WN TANS+GGTS S +   FA  F AYNISFQ T
Sbjct  146  KVVVWANKTNITMQGQGYLNTAIAWNATANSSGGTSYSASTSIFAFNFRAYNISFQNT  203



>ref|XP_009803530.1| PREDICTED: probable pectinesterase 8 isoform X1 [Nicotiana sylvestris]
Length=373

 Score =   257 bits (657),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 156/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  GA G QA+AI I GD++AF+GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  167   NVAPMPGPGAVGAQAVAIRIAGDEAAFWGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  226

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  +SLYE C++ SIA+    G   I+G++TA GR +++E SGF+F+ C +GG+G++WL
Sbjct  227   FGNGKSLYENCQLISIASPVAAGVKSINGAVTAHGRATKDENSGFAFVNCTLGGTGRIWL  286

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+TVVF+ T M+ +V+P+ WND+ND +RDQT+++GEY+C G G+  + R+ Y +
Sbjct  287   GRAWRPYSTVVFANTYMTDIVAPEGWNDFNDPSRDQTIFYGEYNCSGAGSSMTLRAPYVQ  346

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A PFL +S+ID   WL
Sbjct  347   RLNDTQALPFLNSSFIDASLWL  368


 Score = 96.3 bits (238),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 75/121 (62%), Gaps = 1/121 (1%)
 Frame = +3

Query  372  RPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDS  551
            + K + CD    + P +   N + ++ VD NGC NF +VQ A+DAV +FS   +LI I++
Sbjct  47   KAKISICDKFSPNFPTIDT-NTTSILCVDHNGCCNFTTVQAAVDAVGNFSAKRSLIWINN  105

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            G Y EKV + K+K N+  QGQGY  TAI WNDTANS  GT  S +   F+  FIA NISF
Sbjct  106  GIYFEKVIIPKTKPNITFQGQGYTTTAIVWNDTANSANGTFYSGSVQIFSTNFIAKNISF  165

Query  732  Q  734
             
Sbjct  166  M  166



>emb|CDP08865.1| unnamed protein product [Coffea canephora]
Length=395

 Score =   261 bits (667),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 158/204 (77%), Gaps = 3/204 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  GA G QA+A+ I GDQ+AF+GCGF+GAQD L+D RGRHYFK+C+IQGSIDF+
Sbjct  190   NVAPIPGPGAMGAQAVAMRIAGDQAAFWGCGFFGAQDTLHDDRGRHYFKECYIQGSIDFV  249

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  +S YE C++ SIAN    G   I+G++TA GR S++E SG++F+ C +GG+G++WL
Sbjct  250   FGNGKSFYENCQLTSIANPVAVGARAITGAVTAHGRASKDENSGYAFVNCSIGGTGRIWL  309

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++TVVF+ T MS +++ + WND+ND +RDQTV++GEY+C G GA+ + R  YA+
Sbjct  310   GRAWRPFSTVVFAYTSMSDIIASEGWNDFNDPSRDQTVFYGEYNCSGNGANTTLRVPYAQ  369

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L++++A PFL  S+IDG+ WL P
Sbjct  370   KLNDTQATPFLNISFIDGDQWLQP  393


 Score = 92.0 bits (227),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 66/101 (65%), Gaps = 0/101 (0%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N +  I VD NGC NF +VQ A+DAV   S   T+I I++G Y EKV + K+K N+  QG
Sbjct  89   NTTSTICVDHNGCCNFTTVQAAVDAVEVLSSKRTIIWINNGIYFEKVIIPKTKPNITFQG  148

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            QG+ +TAI WNDTANS+ GT  S +   FA  FIA NISF 
Sbjct  149  QGFTSTAIVWNDTANSSHGTFYSGSVQVFAANFIAKNISFM  189



>ref|XP_004243648.1| PREDICTED: probable pectinesterase 8 [Solanum lycopersicum]
Length=389

 Score =   257 bits (657),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 158/204 (77%), Gaps = 3/204 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  GA G QA+AI I GD++AF+GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  183   NVAPMPVPGAVGAQAVAIRIGGDEAAFWGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  242

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  +S+YE C++ SIA+    G   I+G++TA GR +++E SGF F+ C +GG+G++WL
Sbjct  243   FGNGKSIYENCQLISIASPVAPGVKSINGAVTAHGRATKDENSGFVFVNCTLGGTGRIWL  302

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW SY+TVVF+ T M+ +V+P+ WND ND TRDQT+++GEY+C G G++ + R+ Y +
Sbjct  303   GRAWRSYSTVVFANTFMTDIVAPEGWNDLNDPTRDQTIFYGEYNCSGAGSNMALRAPYVQ  362

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L++++A PFL +S+ID + WL P
Sbjct  363   RLNDTQALPFLNSSFIDADLWLQP  386


 Score = 95.9 bits (237),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 74/121 (61%), Gaps = 1/121 (1%)
 Frame = +3

Query  372  RPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDS  551
            + + + CD    + P +   N S +I VD NGC NF +VQ A+D+V +FS   +LI I +
Sbjct  63   KTRQSPCDQFAPNFPTIDPSNTS-IICVDHNGCCNFTTVQAAVDSVGNFSAKRSLIWISN  121

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            G Y EKV + K+K N+  QGQGY  TAI WNDTANS  GT  S +   F+  FIA NISF
Sbjct  122  GIYFEKVIIPKTKPNITFQGQGYTTTAIVWNDTANSANGTFYSGSVQVFSTNFIAKNISF  181

Query  732  Q  734
             
Sbjct  182  M  182



>ref|XP_009349568.1| PREDICTED: probable pectinesterase 8 [Pyrus x bretschneideri]
Length=399

 Score =   253 bits (646),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GDQ+AF GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  192   NVAPIPKPGDVGAQAVAIRISGDQAAFLGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  251

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  RSLYE C++ S++N    G   I+G++TA GR S+++ +G++F+ C +GG+G+VWL
Sbjct  252   FGNGRSLYENCQLISMSNPVPLGTKSINGAVTAHGRASKDDNTGYAFVNCFIGGTGRVWL  311

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF+ T M+ +++P+ WND+ND TRDQT+++GEY+C G GA+ S R+ Y +
Sbjct  312   GRAWRPFSRVVFASTTMTDIIAPEGWNDFNDPTRDQTIFYGEYNCSGAGANMSLRAPYVQ  371

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A+ FL  S+IDG DWL
Sbjct  372   KLNDTQASLFLNASFIDGGDWL  393


 Score = 99.8 bits (247),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 70/115 (61%), Gaps = 1/115 (1%)
 Frame = +3

Query  390  CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            CDD     P     N +  + VD NGC NF  VQ A+DAVP  SP  T+I I+ G Y EK
Sbjct  78   CDDFPRGFPPPDT-NTTSYLCVDRNGCCNFTLVQAAVDAVPTPSPKRTIIWINKGIYYEK  136

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            V V K+K N+  QGQGY  TAISWNDTANS+ GT  S +   FA  F+A NISF 
Sbjct  137  VTVPKTKPNITFQGQGYETTAISWNDTANSSHGTFYSGSVQVFADNFVAKNISFM  191



>ref|XP_010935867.1| PREDICTED: putative pectinesterase 14 [Elaeis guineensis]
Length=440

 Score =   292 bits (748),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/222 (62%), Positives = 171/222 (77%), Gaps = 8/222 (4%)
 Frame = +2

Query  770   LICNVRAYD*VNGFLGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQ  949
             L  N +AY+     +  +NTAP  S G  GGQA+A+ I GDQ+AFYGCGFYGAQD L D 
Sbjct  185   LAFNFKAYN-----ISFQNTAPPASPGDVGGQAVALRISGDQAAFYGCGFYGAQDTLLDD  239

Query  950   RGRHYFKQCFIQGSIDFIFGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEK  1120
              GRHYF+QCFI+GSIDFIFG ARS+YE+C INSIA +   G G ISG ITA GR S  EK
Sbjct  240   HGRHYFRQCFIEGSIDFIFGNARSIYEDCTINSIAKQVPDGVGSISGCITAHGRQSANEK  299

Query  1121  SGFSFLKCEVGGSGKVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGE  1300
             +GFSF+ C + G+G VWLGRAWG YATVVFS+T +S +V+P+ WNDWND +RDQ+VYFGE
Sbjct  300   TGFSFVDCSISGTGTVWLGRAWGPYATVVFSRTYISSIVAPEGWNDWNDPSRDQSVYFGE  359

Query  1301  YDCRGPGADCSNRSSYAKQLDESEAAPFLTTSYIDGEDWLIP  1426
             Y+C GPGA+ + R++YA+QLD+ EAA F+  SYIDG +W++P
Sbjct  360   YECMGPGANYTLRTAYARQLDQCEAAQFMDISYIDGSEWVLP  401


 Score =   139 bits (350),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +3

Query  390  CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            CD SKW SP+ S  NV+ ++TVDL  CANF+SVQKA+DAVPD+SP  TLIIIDSG YREK
Sbjct  83   CDKSKWVSPIASDPNVALILTVDLKSCANFSSVQKAVDAVPDYSPSRTLIIIDSGVYREK  142

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            V V  +K N+ +QGQGYLNTAI+WN TANS+GGT  S +    A  F AYNISFQ T
Sbjct  143  VVVWANKTNITMQGQGYLNTAIAWNATANSSGGTVYSASTSILAFNFKAYNISFQNT  199



>ref|XP_007049055.1| Pectinesterase [Theobroma cacao]
 gb|EOX93212.1| Pectinesterase [Theobroma cacao]
Length=396

 Score =   254 bits (650),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP    G  G QA+AI I GDQ+AF+GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  190   NVAPIARPGDVGAQAVAIRIAGDQAAFWGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  249

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  RSLYE C++ S+AN    G  GI+G++TA GR S +E +GF+F+ C VGG+G++WL
Sbjct  250   FGNGRSLYENCQLVSMANPVAPGSKGINGAVTAHGRASGDENTGFAFVNCSVGGTGRIWL  309

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF+ T M+ +++P+ WND+ND  RDQT+ +GEY+C G GA+ + R+ Y +
Sbjct  310   GRAWRPFSRVVFALTSMTDIIAPEGWNDFNDPARDQTISYGEYNCTGDGANTTLRAPYVQ  369

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +LD+++A+ FL TSYIDG+ WL
Sbjct  370   KLDDTQASIFLNTSYIDGDQWL  391


 Score = 97.4 bits (241),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 69/108 (64%), Gaps = 0/108 (0%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N +  + VD NGC NF +VQ A+DAV +FS   T+I I+SG Y EKV + K+K N+  QG
Sbjct  89   NTTLTLCVDRNGCCNFTTVQSAVDAVANFSMRRTVIWINSGIYYEKVTIPKTKPNITFQG  148

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVTHHILR  755
            QGY +TA+ WNDTANS  GT  S +   F+  FIA NISF     I R
Sbjct  149  QGYTSTAVVWNDTANSANGTFYSGSVQVFSANFIAKNISFMNVAPIAR  196



>gb|EEE68230.1| hypothetical protein OsJ_26414 [Oryza sativa Japonica Group]
Length=519

 Score =   262 bits (669),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 156/204 (76%), Gaps = 3/204 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+A+ I GDQ+AF+GCGF+GAQD L+D RGRHYFK+CFIQGSIDFI
Sbjct  308   NVAPIPRPGDVGAQAVALRIGGDQAAFWGCGFFGAQDTLHDDRGRHYFKECFIQGSIDFI  367

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ SIA+    G   I+GS+TA  R+S ++ +G+SF+ C +GG+G++WL
Sbjct  368   FGDARSLYENCRVISIADPVPAGVRTITGSVTAHARESVDDNTGYSFVNCSIGGTGRIWL  427

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+TVVF+ T MS +++ + WNDWND +RDQTV++GEY C G GA+ S+R  YA+
Sbjct  428   GRAWRPYSTVVFAYTSMSDIIASEGWNDWNDPSRDQTVFYGEYRCTGDGANLSDRVPYAQ  487

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L + +  P+L TS+IDG+ WL P
Sbjct  488   KLSDVQVLPYLNTSFIDGDRWLKP  511


 Score = 90.1 bits (222),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +3

Query  444  VITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYL  623
            +  VD NGC NF +VQ A++AVP FS    ++ I+ G Y EKV V  +K N+  QGQG+ 
Sbjct  211  IFCVDPNGCCNFTTVQAAVNAVPSFSKKRNVVWINKGIYYEKVTVPATKPNITFQGQGFD  270

Query  624  NTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
             TAISWNDTANS+ GT  S +   FA  F+A NISF
Sbjct  271  LTAISWNDTANSSHGTFYSGSVSVFATGFVAKNISF  306



>ref|XP_010457617.1| PREDICTED: probable pectinesterase 8 [Camelina sativa]
Length=394

 Score =   259 bits (662),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GD+SAF GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  188   NVAPIPKPGDVGAQAVAIRIAGDESAFVGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  247

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG A+SLY++C+I S+AN+   G   ++G++TA GR+S++E SGFSF+ C +GG+G VWL
Sbjct  248   FGNAKSLYQDCRIISMANQVSPGSKAVNGAVTANGRNSKDENSGFSFVNCSIGGTGHVWL  307

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF  T M+ V++ + WN++ND +RD T+++GEY+C G GAD S R+ Y +
Sbjct  308   GRAWRPYSRVVFVSTTMTDVIASEGWNNFNDPSRDATIFYGEYNCSGTGADMSKRAPYVQ  367

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+E++ A F+ TSYIDG+ WL
Sbjct  368   KLNETQVALFINTSYIDGDQWL  389


 Score = 92.4 bits (228),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +3

Query  372  RPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDS  551
            + K + C+D   + P +     S+ + VD NGC NF +VQ A+DAV +FS    +I I+S
Sbjct  68   KKKVSICEDFPKNIPPMDTDTTSY-LCVDKNGCCNFTTVQSAVDAVGNFSQRRNVIWINS  126

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            G Y EKV + K+K N+ +QGQG+  TAI+WNDTA S  GT    +   F  +F+A NISF
Sbjct  127  GMYYEKVMIPKTKPNITLQGQGFETTAIAWNDTAYSANGTFYCASVQVFGSQFVAKNISF  186



>ref|XP_010475224.1| PREDICTED: probable pectinesterase 8 [Camelina sativa]
Length=395

 Score =   259 bits (662),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GD+SAF GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  189   NVAPIPKPGDVGAQAVAIRIAGDESAFVGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  248

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG A+SLY++C+I S+AN+   G   ++G++TA GR+S++E SGFSF+ C +GG+G VWL
Sbjct  249   FGNAKSLYQDCRIISMANQVSPGSKAVNGAVTANGRNSKDENSGFSFVNCSIGGTGHVWL  308

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF  T M+ V++ + WN++ND +RD T+++GEY+C G GAD S R+ Y +
Sbjct  309   GRAWRPYSRVVFVSTTMTDVIASEGWNNFNDPSRDATIFYGEYNCSGTGADMSKRAPYVQ  368

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+E++ A F+ TSYIDG+ WL
Sbjct  369   KLNETQVALFINTSYIDGDQWL  390


 Score = 92.4 bits (228),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +3

Query  372  RPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDS  551
            + K + C+D   + P +     S+ + VD NGC NF +VQ A+DAV +FS    +I I+S
Sbjct  69   KKKVSICEDFPKNIPPLDTDTTSY-LCVDKNGCCNFTTVQSAVDAVGNFSQRRNVIWINS  127

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            G Y EKV + K+K N+ +QGQG+  TAI+WNDTA S  GT    +   F  +F+A NISF
Sbjct  128  GMYYEKVMIPKTKPNITLQGQGFETTAIAWNDTAYSANGTFYCASVQVFGSQFVAKNISF  187



>gb|EEC83093.1| hypothetical protein OsI_28228 [Oryza sativa Indica Group]
Length=394

 Score =   262 bits (669),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 156/204 (76%), Gaps = 3/204 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+A+ I GDQ+AF+GCGF+GAQD L+D RGRHYFK+CFIQGSIDFI
Sbjct  183   NVAPIPRPGDVGAQAVALRIGGDQAAFWGCGFFGAQDTLHDDRGRHYFKECFIQGSIDFI  242

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ SIA+    G   I+GS+TA  R+S ++ +G+SF+ C +GG+G++WL
Sbjct  243   FGDARSLYENCRVISIADPVPAGVRTITGSVTAHARESVDDNTGYSFVNCSIGGTGRIWL  302

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+TVVF+ T MS +++ + WNDWND +RDQTV++GEY C G GA+ S+R  YA+
Sbjct  303   GRAWRPYSTVVFAYTSMSDIIASEGWNDWNDPSRDQTVFYGEYRCTGDGANLSDRVPYAQ  362

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L + +  P+L TS+IDG+ WL P
Sbjct  363   KLSDVQVLPYLNTSFIDGDRWLKP  386


 Score = 89.7 bits (221),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +3

Query  444  VITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYL  623
            +  VD NGC NF +VQ A++AVP FS    ++ I+ G Y EKV V  +K N+  QGQG+ 
Sbjct  86   IFCVDPNGCCNFTTVQAAVNAVPSFSKKRNVVWINKGIYYEKVTVPATKPNITFQGQGFD  145

Query  624  NTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
             TAISWNDTANS+ GT  S +   FA  F+A NISF
Sbjct  146  LTAISWNDTANSSHGTFYSGSVSVFATGFVAKNISF  181



>ref|XP_009610336.1| PREDICTED: probable pectinesterase 8 isoform X1 [Nicotiana tomentosiformis]
Length=373

 Score =   256 bits (654),  Expect(2) = 6e-87, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 156/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  GA G QA+AI I GD++AF+GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  167   NVAPMPGPGAIGAQAVAIRIAGDEAAFWGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  226

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  +SLYE C++ SIA+    G   I+G++TA GR +++E SGF+F+ C +GG+G++WL
Sbjct  227   FGNGKSLYENCQLISIASPVAAGVKSINGAVTAHGRATKDENSGFAFVNCTLGGTGRIWL  286

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+T+VF+ T M+ +++P+ WND+ND +RDQT+++GEY+C G G+  + R+ Y +
Sbjct  287   GRAWRPYSTIVFANTYMTDIIAPEGWNDFNDPSRDQTIFYGEYNCSGAGSSMTLRAPYVQ  346

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A PFL +S++D   WL
Sbjct  347   RLNDTQALPFLNSSFVDANQWL  368


 Score = 95.1 bits (235),  Expect(2) = 6e-87, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 74/121 (61%), Gaps = 1/121 (1%)
 Frame = +3

Query  372  RPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDS  551
            + K + CD    + P +   N + ++ VD NGC NF +VQ A+DAV +FS   +LI I +
Sbjct  47   KAKISICDKFSPNFPTIDT-NTTSILCVDHNGCCNFTTVQAAVDAVGNFSVKRSLIWISN  105

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            G Y EKV + K+K N+  QGQGY  TAI WNDTANS  GT  S +   F+  FIA NISF
Sbjct  106  GIYFEKVIIPKTKPNITFQGQGYTTTAIVWNDTANSANGTFYSGSVQIFSTNFIAKNISF  165

Query  732  Q  734
             
Sbjct  166  M  166



>ref|XP_003625222.1| hypothetical protein MTR_7g092780 [Medicago truncatula]
 gb|ABN08648.1| Pectinesterase [Medicago truncatula]
 gb|AES81440.1| pectinesterase [Medicago truncatula]
Length=389

 Score =   256 bits (655),  Expect(2) = 6e-87, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P+ GA G QA+A+ I GDQ+ F GCGF+GAQD L+D +GRHYFK C+IQGSIDFI
Sbjct  186   NLAPIPTPGAEGAQAVAMRISGDQAEFRGCGFFGAQDTLHDDKGRHYFKDCYIQGSIDFI  245

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ SIAN    G   I+G++TA GR S +E +G+ FL   +GG+G++WL
Sbjct  246   FGNARSLYENCQLVSIANPVPPGQKNINGAVTAHGRVSMDENTGYVFLNSTIGGNGRIWL  305

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ V+F+ + MS +++P+ WND+ND TRDQT+++GEY+C GPGA+ + R  Y +
Sbjct  306   GRAWRPYSRVIFAFSIMSDIIAPEGWNDFNDPTRDQTIFYGEYNCSGPGANVNMRVPYVQ  365

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A PFL TS+IDG+ WL
Sbjct  366   RLNDTQAFPFLNTSFIDGDQWL  387


 Score = 94.4 bits (233),  Expect(2) = 6e-87, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +3

Query  390  CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            CDD     P  +  N +  + VD  GC NF +VQ+A++AVPDFS    +I I+SG Y EK
Sbjct  72   CDDFPPGIPPPNT-NTTSYLCVDRKGCCNFTTVQQAVNAVPDFSLKRNIIWINSGFYYEK  130

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            V V K+K N+  QGQ Y +TAI+WNDTA S  GT  S +   FA  FIA NISF
Sbjct  131  VTVPKTKPNITFQGQSYTSTAIAWNDTAKSANGTFYSGSVQVFASNFIAKNISF  184



>ref|XP_008378333.1| PREDICTED: probable pectinesterase 8 [Malus domestica]
Length=399

 Score =   251 bits (640),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GDQ+AF GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  192   NVAPIPKPGDVGAQAVAIRISGDQAAFLGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  251

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  RSLYE C++ S++N    G   I+G++TA GR S+++ +G++F+ C +GG+G+VWL
Sbjct  252   FGNGRSLYENCQLISMSNPVPLGTKXINGAVTAHGRASKDDNTGYAFVNCFIGGTGRVWL  311

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ V F+ T M+ +++P+ WND+ND TRDQT+++GEY+C G GA+ S R+ Y +
Sbjct  312   GRAWRPFSRVXFASTTMTDIIAPEGWNDFNDPTRDQTIFYGEYNCSGAGANMSLRAPYVQ  371

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A+ FL  S+IDG DWL
Sbjct  372   KLNDTQASLFLNVSFIDGGDWL  393


 Score = 99.8 bits (247),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 69/115 (60%), Gaps = 1/115 (1%)
 Frame = +3

Query  390  CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            CDD     P     N +  + VD NGC NF  VQ A+DAVP  SP  T+I I+ G Y EK
Sbjct  78   CDDFPRGFPPPDT-NTTSYLCVDRNGCCNFTLVQAAVDAVPTPSPKRTIIWINKGIYYEK  136

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            V V K+K N+  QGQGY  TAISWNDTANS  GT  S +   FA  F+A NISF 
Sbjct  137  VTVPKTKPNITFQGQGYETTAISWNDTANSAHGTFYSGSVQVFADNFVAKNISFM  191



>ref|XP_006357894.1| PREDICTED: probable pectinesterase 8-like [Solanum tuberosum]
Length=388

 Score =   255 bits (652),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 156/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  GA G QA+AI I GD++AF+GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  182   NVAPMPVPGAVGAQAVAIRIAGDEAAFWGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  241

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  +S+YE C++ SIA+    G   I+G++TA GR +++E SGF+F+ C +GG+G++WL
Sbjct  242   FGNGKSIYENCQLISIASPVAPGVKSINGAVTAHGRATKDENSGFAFVNCTLGGTGRIWL  301

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+TVVF+ T M+ +V+P+ WND ND  RDQT+++GEY+C G G++ + R+ Y +
Sbjct  302   GRAWRPYSTVVFANTYMTDIVAPEGWNDLNDPMRDQTIFYGEYNCSGAGSNMALRAPYVQ  361

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A PFL +S+ID + WL
Sbjct  362   RLNDTQALPFLNSSFIDADLWL  383


 Score = 94.7 bits (234),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 75/121 (62%), Gaps = 1/121 (1%)
 Frame = +3

Query  372  RPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDS  551
            + + + CD    + P +   N S +I VD NGC NF +VQ A+D+V +FS   +LI I +
Sbjct  62   KARQSPCDKFTPNFPTIDPSNTS-IICVDHNGCCNFTTVQAAVDSVGNFSVKRSLIWISN  120

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            G Y EKV + K+K N+  QGQGY  TAI WNDTANS+ GT  S +   F+  FIA NISF
Sbjct  121  GIYFEKVIIPKTKPNITFQGQGYTTTAIVWNDTANSSNGTFYSGSVQVFSTNFIAKNISF  180

Query  732  Q  734
             
Sbjct  181  M  181



>ref|XP_010267309.1| PREDICTED: putative pectinesterase 14 isoform X2 [Nelumbo nucifera]
Length=424

 Score =   290 bits (742),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 168/219 (77%), Gaps = 5/219 (2%)
 Frame = +2

Query  779   NVRAYD*VNGFLGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGR  958
             N  AYD     +  +NTAP  S G  GGQA+A+ I GDQ+AFY CGFYGAQD L D RGR
Sbjct  209   NFIAYD-----ISFQNTAPSASPGDVGGQAIALRIAGDQAAFYRCGFYGAQDTLLDDRGR  263

Query  959   HYFKQCFIQGSIDFIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFL  1138
             HYFK+CFIQGSIDFIFG ARSLYE+C I+ IA +   GISG+ITA GR S   ++GFSF+
Sbjct  264   HYFKECFIQGSIDFIFGNARSLYEDCTIDLIAKKVSVGISGAITAHGRQSMNARTGFSFV  323

Query  1139  KCEVGGSGKVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGP  1318
              C +GG+G+VWLGRAWG +A+VVF++T M+ +++P+ WNDWND +RDQ V+FGEY+C GP
Sbjct  324   NCSIGGTGRVWLGRAWGGFASVVFARTFMADIIAPEGWNDWNDPSRDQNVFFGEYECVGP  383

Query  1319  GADCSNRSSYAKQLDESEAAPFLTTSYIDGEDWLIPTPN  1435
             GA+ + R+SY++QL  SEAAPF+  SYIDG  WL+P  N
Sbjct  384   GANYTLRTSYSRQLSHSEAAPFIDISYIDGNLWLLPQGN  422


 Score =   156 bits (394),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 135/208 (65%), Gaps = 7/208 (3%)
 Frame = +3

Query  132  TRSTSILFWLIAFTIAFFSltfslysnllttttvltvntpttllpflRSVV-----KQTG  296
            TR T + FW  AF++A  S+  +  +  + +++  +    +    F    +      Q+G
Sbjct  15   TRKTKLFFWFSAFSVALLSILLATTTTTIPSSSSPSSLISSAYYSFELGAIFKRGLNQSG  74

Query  297  LDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCAN  476
            +D F S++ ++ + R  HHH   +   + + CD++KW S LVS YN+S V TVDLNGCAN
Sbjct  75   VDVFSSLLRRIIRRRGHHHHRRGRG--RGDVCDEAKWFSWLVSGYNISLVFTVDLNGCAN  132

Query  477  FASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTAN  656
            F+SVQKA+DA PD SP  TLI+IDSG YREKV V  +K NLI QGQGYLNT+I+WNDTAN
Sbjct  133  FSSVQKAVDAAPDRSPTRTLILIDSGVYREKVVVGTNKTNLIFQGQGYLNTSIAWNDTAN  192

Query  657  stggtsssYTFGAFAPKFIAYNISFQVT  740
            STGGT  S +   FA  FIAY+ISFQ T
Sbjct  193  STGGTVYSSSVAIFASNFIAYDISFQNT  220



>ref|XP_009803531.1| PREDICTED: probable pectinesterase 8 isoform X2 [Nicotiana sylvestris]
Length=370

 Score =   253 bits (646),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 151/199 (76%), Gaps = 0/199 (0%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  GA G QA+AI I GD++AF+GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  167   NVAPMPGPGAVGAQAVAIRIAGDEAAFWGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  226

Query  1004  FGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGRA  1183
             FG  +SLYE   I S    G   I+G++TA GR +++E SGF+F+ C +GG+G++WLGRA
Sbjct  227   FGNGKSLYELISIASPVAAGVKSINGAVTAHGRATKDENSGFAFVNCTLGGTGRIWLGRA  286

Query  1184  WGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQLD  1363
             W  Y+TVVF+ T M+ +V+P+ WND+ND +RDQT+++GEY+C G G+  + R+ Y ++L+
Sbjct  287   WRPYSTVVFANTYMTDIVAPEGWNDFNDPSRDQTIFYGEYNCSGAGSSMTLRAPYVQRLN  346

Query  1364  ESEAAPFLTTSYIDGEDWL  1420
             +++A PFL +S+ID   WL
Sbjct  347   DTQALPFLNSSFIDASLWL  365


 Score = 96.3 bits (238),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 75/121 (62%), Gaps = 1/121 (1%)
 Frame = +3

Query  372  RPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDS  551
            + K + CD    + P +   N + ++ VD NGC NF +VQ A+DAV +FS   +LI I++
Sbjct  47   KAKISICDKFSPNFPTIDT-NTTSILCVDHNGCCNFTTVQAAVDAVGNFSAKRSLIWINN  105

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            G Y EKV + K+K N+  QGQGY  TAI WNDTANS  GT  S +   F+  FIA NISF
Sbjct  106  GIYFEKVIIPKTKPNITFQGQGYTTTAIVWNDTANSANGTFYSGSVQIFSTNFIAKNISF  165

Query  732  Q  734
             
Sbjct  166  M  166



>ref|XP_002521065.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF41349.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=396

 Score =   254 bits (649),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 158/202 (78%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+A+ I GDQ+AF+GCGF+GAQD L+D +GRHYFK C+IQGSIDFI
Sbjct  190   NVAPIPGPGDMGAQAVAMRISGDQAAFWGCGFFGAQDTLHDDKGRHYFKDCYIQGSIDFI  249

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ S+AN    G   I+G++TA GR S++E +GF+F+ C +GG+G++WL
Sbjct  250   FGDARSLYESCELISMANPVAPGQRSINGAVTAHGRTSKDENTGFAFVNCTLGGTGRIWL  309

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF+ T M+ +++ + WND+ND TRDQT+++GEY+C GPGA+ + R++Y +
Sbjct  310   GRAWRPFSRVVFAFTSMTDIIAAEGWNDFNDPTRDQTIFYGEYNCSGPGANMTMRAAYVQ  369

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A+ FL  S+IDG+ WL
Sbjct  370   RLNDTQASAFLDASFIDGDQWL  391


 Score = 94.4 bits (233),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 72/116 (62%), Gaps = 1/116 (1%)
 Frame = +3

Query  384  NKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYR  563
            N CDD   D P     N +    VD NGC NF +VQ A+DAV +FS   T+I I+SG Y 
Sbjct  74   NICDDFPIDIPPPDT-NTTSTFCVDPNGCCNFTTVQSAVDAVANFSQKRTIIWINSGIYY  132

Query  564  EKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            E+V V  +K N+  QGQGY +TAI WN+TANS+ GT  S +   F+  FIA NISF
Sbjct  133  ERVIVPITKQNVTFQGQGYTSTAIVWNNTANSSHGTFYSGSVQVFSNNFIAKNISF  188



>ref|XP_006661576.1| PREDICTED: probable pectinesterase 15-like [Oryza brachyantha]
Length=356

 Score =   238 bits (608),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 145/201 (72%), Gaps = 2/201 (1%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +N AP P  G  GGQA+A+ ++ D++AF+ CG Y AQD L D+ GRH F+ C+I+GSIDF
Sbjct  138   QNAAPPPQPGDAGGQAVALRVVADEAAFHWCGVYSAQDTLLDESGRHLFRGCYIEGSIDF  197

Query  1001  IFGKARSLYEECKINSIANE--GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             IFG ARSLY  C I+S+A      G ++GS+TAQGR S  E++GF+F++C V G+G+VWL
Sbjct  198   IFGNARSLYVGCTISSVATATFSAGTVTGSVTAQGRASATERTGFAFVRCSVVGTGQVWL  257

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAWG YA V+F++T +  VV+ + WNDW D  R Q V+F EY C GPG+  + R +YA+
Sbjct  258   GRAWGPYAAVLFAETYLGDVVAAEGWNDWGDPGRRQQVWFAEYACWGPGSGTTGRVAYAR  317

Query  1355  QLDESEAAPFLTTSYIDGEDW  1417
             QL+E +AAPF+  SYIDG  W
Sbjct  318   QLEERQAAPFMDVSYIDGNQW  338


 Score =   110 bits (274),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 85/125 (68%), Gaps = 5/125 (4%)
 Frame = +3

Query  375  PKANKCDDS-KWDSPLVSMYNVSHVITVDLN---GCANFASVQKAIDAVPDFSPVATLII  542
            P   +C D  +W + L S +N + ++TVD N   GCANF ++QKAIDA P++S   TLI 
Sbjct  14   PPPKRCADHLRWAAALASQHNATLLLTVDHNQATGCANFTTLQKAIDAAPNYSLARTLIA  73

Query  543  IDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggts-ssYTFGAFAPKFIAY  719
            +D+G YREKV +  +K  + + G+G LNT ++WN T+NSTGG++  S TF   AP F+AY
Sbjct  74   VDTGLYREKVVLWPNKTAVTLHGRGNLNTTVAWNATSNSTGGSTIYSATFTVLAPGFVAY  133

Query  720  NISFQ  734
            NI+FQ
Sbjct  134  NITFQ  138



>ref|XP_008451885.1| PREDICTED: probable pectinesterase 8 [Cucumis melo]
Length=394

 Score =   253 bits (647),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 154/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI + GDQ+AF+ CGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  187   NVAPIPGPGDVGAQAVAIRVGGDQAAFWSCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  246

Query  1004  FGKARSLYEECKINSIAN---EGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  RS YE C++ S+AN   +G   ++G++TA GR S EE SGFSF+ C +GG+G+VWL
Sbjct  247   FGNGRSFYESCQLVSMANPVPQGSKFVNGAVTAHGRASAEENSGFSFVNCSIGGTGRVWL  306

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF+ T M+ +++P+ WND+ND TRDQT+++GEY+C G GA+ S+R+ Y +
Sbjct  307   GRAWRPFSRVVFANTVMTDIIAPEGWNDFNDPTRDQTIFYGEYNCSGAGANMSSRAPYVQ  366

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L++++ + FL  S+ID + WL P
Sbjct  367   RLNDTQVSSFLNLSFIDADQWLQP  390


 Score = 94.7 bits (234),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = +3

Query  438  SHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQG  617
            + V  VD NGC NF +VQ A+DAVP+ S    +I I++G Y EKV V KSK N+  QGQG
Sbjct  88   TSVFCVDQNGCCNFTTVQAAVDAVPNLSIKRNIIWINAGIYYEKVMVPKSKPNVTFQGQG  147

Query  618  YLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            Y  TAI WNDTANS+ GT  S +   F+  FIA NISF
Sbjct  148  YTTTAIVWNDTANSSHGTFYSGSVQVFSSNFIAKNISF  185



>ref|NP_181208.1| putative pectinesterase 14 [Arabidopsis thaliana]
 sp|Q9ZQA4.1|PME14_ARATH RecName: Full=Putative pectinesterase 14; Short=PE 14; AltName: 
Full=Pectin methylesterase 14; Short=AtPME14; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD20146.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEC09288.1| putative pectinesterase 14 [Arabidopsis thaliana]
Length=333

 Score =   255 bits (651),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 149/200 (75%), Gaps = 3/200 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P+ GA   QA+A+ ++GD++AFYGCGFYG QD L DQ GRH+FK CFI+GSIDF
Sbjct  137   KNTAPAPNPGAVDAQAVALKVVGDKAAFYGCGFYGNQDTLLDQEGRHFFKGCFIEGSIDF  196

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLYE+C ++SIA E      G ITA G+D+ ++++GF F+ C++ GS +VWLGR
Sbjct  197   IFGNGRSLYEDCTLHSIAKEN---TIGCITANGKDTLKDRTGFVFVNCKITGSARVWLGR  253

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AW  YA V+FSKT MS+VVS D WND  D    +TVY+GE+ C GPGA+ S R +YAK L
Sbjct  254   AWRPYARVIFSKTYMSRVVSLDGWNDMGDPKTQRTVYYGEHRCYGPGANHSKRVTYAKLL  313

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EAAPF   S+IDGE+WL
Sbjct  314   SDVEAAPFTNISFIDGEEWL  333


 Score = 93.2 bits (230),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 83/146 (57%), Gaps = 14/146 (10%)
 Frame = +3

Query  306  FLSVIHQVKQARSKhhhhhhKRRPKANKCDD-SKWDSPLVSMYNVSHVITVDLNGCANFA  482
            FLS+I  ++           +R    +KCD  SK+ +   +M     V+ V LNGC  F 
Sbjct  7    FLSIISPIESV--------DQRIHHPSKCDHLSKFPTKGFTM-----VLKVSLNGCGRFK  53

Query  483  SVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANst  662
             VQ AIDA    S   TLI+ID G YRE+  V ++K NL++QG GY  T+I WN+T  S+
Sbjct  54   RVQDAIDASIGSSQSKTLILIDFGIYRERFIVHENKNNLVVQGMGYSRTSIEWNNTTASS  113

Query  663  ggtsssYTFGAFAPKFIAYNISFQVT  740
             GT SS++   F  KF AYNISF+ T
Sbjct  114  NGTFSSFSVAVFGEKFTAYNISFKNT  139



>ref|XP_010484902.1| PREDICTED: probable pectinesterase 8 [Camelina sativa]
Length=398

 Score =   256 bits (653),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI   GD+SAF GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  192   NVAPIPKPGDVGAQAVAIRSAGDESAFVGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  251

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG A+SLY++C+I S+AN+   G   ++G++TA GR+S++E SGFSF+ C +GG+G VWL
Sbjct  252   FGNAKSLYQDCRIISMANQVSPGSKAVNGAVTANGRNSKDENSGFSFVNCSIGGTGHVWL  311

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF  T M+ V++ + WN++ND +RD T+++GEY+C G GAD S R+ Y +
Sbjct  312   GRAWRPYSRVVFVSTTMTDVIASEGWNNFNDPSRDATIFYGEYNCSGTGADMSKRAPYVQ  371

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+E++ A F+ TSYIDG+ WL
Sbjct  372   KLNEAQVALFINTSYIDGDQWL  393


 Score = 92.0 bits (227),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +3

Query  372  RPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDS  551
            + K + C+D   + P +     S+ + VD NGC NF +VQ A+DAV +FS    +I I+S
Sbjct  72   KKKVSICEDFPKNIPPLDTDTTSY-LCVDKNGCCNFTTVQSAVDAVGNFSQRRNVIWINS  130

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            G Y EKV + K+K N+ +QGQG+  TAI+WNDTA S  GT    +   F  +F+A NISF
Sbjct  131  GMYYEKVMIPKTKPNITLQGQGFETTAIAWNDTAYSANGTFYCASVQVFGSQFVAKNISF  190



>gb|AAB71446.1| Similar to Prunus pectinesterase (gb|X95991) [Arabidopsis thaliana]
Length=391

 Score =   262 bits (669),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GD+SAF GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  185   NVAPIPKPGDVGAQAVAIRIAGDESAFVGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  244

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG A+SLY++C+I S+AN+   G   ++G++TA GR S++E SGFSF+ C +GG+G VWL
Sbjct  245   FGNAKSLYQDCRIISMANQLSPGSKAVNGAVTANGRSSKDENSGFSFVNCTIGGTGHVWL  304

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF  T M+ V++P+ WN++ND +RD T+++GEY+C GPGAD S R+ Y +
Sbjct  305   GRAWRPYSRVVFVSTTMTDVIAPEGWNNFNDPSRDATIFYGEYNCSGPGADMSKRAPYVQ  364

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+E++ A  + TS+IDG+ WL
Sbjct  365   KLNETQVALLINTSFIDGDQWL  386


 Score = 85.5 bits (210),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 72/118 (61%), Gaps = 3/118 (3%)
 Frame = +3

Query  378  KANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGT  557
            K + CDD   + P +     S+ + VD NGC NF +VQ A+DAV +FS    +I I+SG 
Sbjct  69   KVSICDDFPKNIPPLDTDTTSY-LCVDKNGCCNFTTVQSAVDAVGNFSQRRNVIWINSGI  127

Query  558  YREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
              EKV + K+K N+ +QGQG+  TAI+WNDTA S  GT    T   F  +F+A NISF
Sbjct  128  --EKVVIPKTKPNITLQGQGFDITAIAWNDTAYSANGTFYCATVQVFGSQFVAKNISF  183



>ref|XP_004972590.1| PREDICTED: probable pectinesterase 8-like [Setaria italica]
Length=398

 Score =   262 bits (669),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 155/204 (76%), Gaps = 3/204 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  GA   QALAI I GDQ+AF+GCGF+GAQD L+D RGRHYFK+CFIQGSIDFI
Sbjct  187   NVAPIPRPGAVDAQALAIRINGDQAAFWGCGFFGAQDTLHDDRGRHYFKECFIQGSIDFI  246

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ SIA+    G   I+GS+TA  R SE++ +G+SF+ C +GG+G +WL
Sbjct  247   FGDARSLYENCRLISIADPVPSGQRSITGSVTAHARVSEDDNTGYSFVHCSIGGTGWIWL  306

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF+ T MS +++ + WNDWND +RDQTV++GEY C G GA+ ++R  YA+
Sbjct  307   GRAWRPYSRVVFAYTSMSDIIASEGWNDWNDPSRDQTVFYGEYKCTGDGANLADRVPYAQ  366

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L + +  PFL+TS+IDG+ WL P
Sbjct  367   KLSDVQVLPFLSTSFIDGDQWLKP  390


 Score = 85.1 bits (209),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = +3

Query  444  VITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYL  623
            V  VD NGC +F +VQ A+DA+P+ S    ++ I+ G Y EKV V  SK N+  QGQG+ 
Sbjct  90   VFCVDPNGCCDFTTVQAAVDAIPNHSRKRNVVWINKGIYFEKVTVPSSKPNITFQGQGFD  149

Query  624  NTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVTHHILR  755
             TAI+WNDTA S  GT  S +   FA  F+A NISF     I R
Sbjct  150  MTAIAWNDTAKSANGTFYSASVSIFASGFVAKNISFMNVAPIPR  193



>ref|XP_009610337.1| PREDICTED: probable pectinesterase 8 isoform X2 [Nicotiana tomentosiformis]
Length=370

 Score =   252 bits (644),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 151/199 (76%), Gaps = 0/199 (0%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  GA G QA+AI I GD++AF+GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  167   NVAPMPGPGAIGAQAVAIRIAGDEAAFWGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  226

Query  1004  FGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGRA  1183
             FG  +SLYE   I S    G   I+G++TA GR +++E SGF+F+ C +GG+G++WLGRA
Sbjct  227   FGNGKSLYELISIASPVAAGVKSINGAVTAHGRATKDENSGFAFVNCTLGGTGRIWLGRA  286

Query  1184  WGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQLD  1363
             W  Y+T+VF+ T M+ +++P+ WND+ND +RDQT+++GEY+C G G+  + R+ Y ++L+
Sbjct  287   WRPYSTIVFANTYMTDIIAPEGWNDFNDPSRDQTIFYGEYNCSGAGSSMTLRAPYVQRLN  346

Query  1364  ESEAAPFLTTSYIDGEDWL  1420
             +++A PFL +S++D   WL
Sbjct  347   DTQALPFLNSSFVDANQWL  365


 Score = 95.1 bits (235),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 74/121 (61%), Gaps = 1/121 (1%)
 Frame = +3

Query  372  RPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDS  551
            + K + CD    + P +   N + ++ VD NGC NF +VQ A+DAV +FS   +LI I +
Sbjct  47   KAKISICDKFSPNFPTIDT-NTTSILCVDHNGCCNFTTVQAAVDAVGNFSVKRSLIWISN  105

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            G Y EKV + K+K N+  QGQGY  TAI WNDTANS  GT  S +   F+  FIA NISF
Sbjct  106  GIYFEKVIIPKTKPNITFQGQGYTTTAIVWNDTANSANGTFYSGSVQIFSTNFIAKNISF  165

Query  732  Q  734
             
Sbjct  166  M  166



>ref|XP_009118594.1| PREDICTED: probable pectinesterase 8 [Brassica rapa]
 emb|CDY59792.1| BnaAnng16250D [Brassica napus]
Length=400

 Score =   256 bits (653),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GDQSAF GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  194   NVAPIPKPGDVGAQAVAIRIGGDQSAFLGCGFFGAQDTLHDDRGRHYFKNCYIQGSIDFI  253

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG A+SLY++C+I S+AN+   G   ++G++TA GR+S++E SGF+F+ C +GG+G VWL
Sbjct  254   FGNAKSLYQDCQIISMANQVSPGSKSVNGAVTANGRNSKDENSGFAFVNCTIGGTGHVWL  313

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ V+F  T M+ V++ + WN++ND +RD T+++GEY+C GPGAD S R+ Y +
Sbjct  314   GRAWRPYSRVIFVSTYMTDVIASEGWNNFNDPSRDATIFYGEYNCSGPGADVSKRAPYVQ  373

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++ A F+  ++IDG+ WL
Sbjct  374   KLNDTQVAEFVNVTFIDGDQWL  395


 Score = 90.9 bits (224),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 72/120 (60%), Gaps = 1/120 (1%)
 Frame = +3

Query  372  RPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDS  551
            + K + CDD   + P       S+ + VD  GC NF +VQ A+DA+ +FS    +I I+S
Sbjct  74   KKKVSICDDFPKNIPPPDTDTTSY-LCVDKKGCCNFTTVQSAVDAIGNFSQKRNVIWINS  132

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            G Y EKV + K+K N+ +QGQG+  TAI+WNDTA S  GT    T   F  +F+A NISF
Sbjct  133  GMYYEKVVIPKTKPNITLQGQGFETTAIAWNDTAYSANGTFYCATVQVFGSQFVAKNISF  192



>ref|XP_002267842.1| PREDICTED: probable pectinesterase 8 [Vitis vinifera]
 emb|CBI34119.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   253 bits (647),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 155/204 (76%), Gaps = 3/204 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI + GDQ+AF+GCGF+G+QD L+D RGRHYF+ C+IQGSIDFI
Sbjct  192   NVAPIPKPGDVGAQAVAIRVAGDQAAFWGCGFFGSQDTLHDDRGRHYFRDCYIQGSIDFI  251

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARS YE C++ S+AN    G   I+G+ITA GR S +E +G++F+ C VGG+G+VWL
Sbjct  252   FGDARSFYENCQLISMANPVPVGSKVINGAITAHGRTSMDENTGYAFVACTVGGTGRVWL  311

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF+ T +S +++ + WND+ND TRDQ++++GEY C+GPGA+ S R  YA+
Sbjct  312   GRAWRPFSRVVFAYTSLSDIIASEGWNDFNDPTRDQSIFYGEYMCKGPGANTSTRVPYAQ  371

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L++++A+ FL  S+ID + WL P
Sbjct  372   KLNDTQASIFLNVSFIDADQWLQP  395


 Score = 93.2 bits (230),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 66/100 (66%), Gaps = 0/100 (0%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N + ++ VD NGC NF  VQ A+DAV   S   T+I I+SG Y EKV + K+K N+  QG
Sbjct  91   NTTSILCVDRNGCCNFTMVQSAVDAVSVLSQKRTIIWINSGVYYEKVIIPKNKPNITFQG  150

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            QG+ +TAI WNDTANS+ GT  S +   FA  FIA NISF
Sbjct  151  QGFASTAIVWNDTANSSHGTFYSGSVQVFAANFIAKNISF  190



>ref|XP_008229648.1| PREDICTED: probable pectinesterase 8 [Prunus mume]
Length=394

 Score =   253 bits (645),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GDQ+AF GCGF+GAQD L+D +GRHYFK C++QGSIDFI
Sbjct  188   NVAPIPKPGDIGAQAVAIRISGDQAAFLGCGFFGAQDTLHDDKGRHYFKDCYVQGSIDFI  247

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  RS YE C++ SIAN    G   ++G+ITA GR S+++ +GF+F+ C +GG+G+VWL
Sbjct  248   FGNGRSFYENCQLISIANPLPPGSRNVNGAITAHGRASKDDNTGFAFVNCFIGGTGRVWL  307

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF KT M+ +++P+ WND+ND TRDQT+++GEY+C G GA+ + R+ + +
Sbjct  308   GRAWRPFSRVVFVKTTMADIIAPEGWNDFNDPTRDQTIFYGEYNCSGAGANVTMRAPFVQ  367

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A+ FL  S+IDG DWL
Sbjct  368   KLNDTQASTFLNVSWIDGGDWL  389


 Score = 93.2 bits (230),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +3

Query  390  CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            CDD     P       S+ + VD NGC NF  VQ A+DA P  S   T+I I++G Y EK
Sbjct  74   CDDFPRGFPPPDTNKTSY-LCVDRNGCCNFTLVQAAVDAAPALSQKRTIIWINNGIYYEK  132

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            +++ K+K N+  QGQGY +TAI+WNDTANS+ GT  S +   FA  F+A NISF
Sbjct  133  ISIPKNKPNITFQGQGYESTAIAWNDTANSSHGTFYSGSVQVFADNFVAKNISF  186



>ref|XP_009119166.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase 8 [Brassica 
rapa]
Length=402

 Score =   254 bits (650),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GD+SAF GCGF+ AQD L+D RGRHYFK C+IQGSIDFI
Sbjct  196   NVAPIPKPGDVGAQAVAIRISGDESAFVGCGFFXAQDTLHDDRGRHYFKDCYIQGSIDFI  255

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG A+SLY++C+I S+AN+   G   I+G++TA GR+S++E SGFSF+ C +GG+G VWL
Sbjct  256   FGNAKSLYQDCQIISMANQVSPGSKSINGAVTANGRNSKDENSGFSFVNCSIGGTGHVWL  315

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ V+F  T M+ V++P+ WN++ND +RD T+++GEY+C GPGA+ S R+ Y +
Sbjct  316   GRAWRPYSRVIFVSTFMTDVIAPEGWNNFNDPSRDATIFYGEYNCSGPGANISKRAQYVQ  375

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+E++ A F+  + IDG+ WL
Sbjct  376   KLNETQVAQFINMTIIDGDQWL  397


 Score = 91.3 bits (225),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 76/127 (60%), Gaps = 6/127 (5%)
 Frame = +3

Query  366  KRRPKANK-----CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVA  530
            +R+P  +K     C D   + P       S+ + VD NGC NF +VQ A+DA+ +FS   
Sbjct  69   RRKPSHSKKKISICGDFPKNIPPPDTDTTSY-LCVDKNGCCNFTTVQSAVDAIGNFSERR  127

Query  531  TLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKF  710
             +I I+SG Y EKVA+ K+K N+ +QGQG+  T+I+WNDTA S  GT    +   F  +F
Sbjct  128  NVIWINSGMYYEKVAIPKTKPNITLQGQGFETTSIAWNDTAYSANGTFYCASVQVFGSQF  187

Query  711  IAYNISF  731
            +A NISF
Sbjct  188  LAKNISF  194



>ref|XP_010025544.1| PREDICTED: probable pectinesterase 8 [Eucalyptus grandis]
 gb|KCW62245.1| hypothetical protein EUGRSUZ_H04905 [Eucalyptus grandis]
Length=394

 Score =   254 bits (650),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 158/202 (78%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P+ G  GGQA+AI I GDQ++F+GCGF+GAQD L+D RGRHYF+ C+IQGSIDFI
Sbjct  193   NIAPIPNPGDVGGQAVAIRISGDQASFWGCGFFGAQDTLHDDRGRHYFRDCYIQGSIDFI  252

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ SIA     G   I+G++TA GR S++E +GF+F+   +GG+G++WL
Sbjct  253   FGDARSLYENCQLISIAAPVPPGQKVINGAVTAHGRASKDENTGFAFMNASIGGTGRIWL  312

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF+ T M+ +++P+ WND+ND+TRDQT+++GEY+C G GA+ S R+ Y +
Sbjct  313   GRAWRPFSRVVFAFTTMTDIIAPEGWNDFNDATRDQTIFYGEYNCSGAGANMSLRAPYVQ  372

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A PFL  S+IDG+ WL
Sbjct  373   RLNDTQALPFLNISFIDGDQWL  394


 Score = 90.9 bits (224),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 74/114 (65%), Gaps = 1/114 (1%)
 Frame = +3

Query  390  CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            CD+   D P     N +  + VD NGC NF +VQ A+DA  +FS   T+I I+SG Y EK
Sbjct  79   CDNFPPDIPPPET-NTTVTLCVDRNGCCNFTTVQAAVDAAGNFSQKRTVIWINSGIYYEK  137

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            V + +++ N+  QGQGYL+TAI+WN TA+S+GGT  S +   F+  F+A NISF
Sbjct  138  VTILRTRPNITFQGQGYLSTAIAWNGTASSSGGTFYSGSVQVFSNNFMARNISF  191



>ref|XP_011018832.1| PREDICTED: probable pectinesterase 15 isoform X2 [Populus euphratica]
Length=390

 Score =   285 bits (730),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 156/201 (78%), Gaps = 0/201 (0%)
 Frame = +2

Query  818   GKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSID  997
               +TAP PS G  GGQA+A+ I GD++AFYGCGFYGAQD L+D  GRHYF+ CFIQGSID
Sbjct  169   ANSTAPWPSPGEVGGQAVALRIAGDKAAFYGCGFYGAQDTLHDDSGRHYFRGCFIQGSID  228

Query  998   FIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLG  1177
             FIFG ARSLY+ C I+SIA +   G+SGSITAQ R S  E++GFSF+ C V GSGKVWLG
Sbjct  229   FIFGNARSLYQSCTISSIAEQPKAGVSGSITAQARQSVSEQTGFSFVNCTVIGSGKVWLG  288

Query  1178  RAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             RAWG+YATVVF KT MS  VS D WNDW D +RDQT +FGEY+C GPGA+ + R+SY KQ
Sbjct  289   RAWGAYATVVFCKTYMSHAVSSDGWNDWRDPSRDQTAFFGEYECFGPGANFTFRASYGKQ  348

Query  1358  LDESEAAPFLTTSYIDGEDWL  1420
             L + EAAP++  SYIDG  WL
Sbjct  349   LTQYEAAPYMDISYIDGNQWL  369


 Score =   127 bits (320),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 87/127 (69%), Gaps = 8/127 (6%)
 Frame = +3

Query  279  VVKQTGLDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKW-DSPLVSMYNVSHVITV  455
            V+K+T L+ F S++       +     HH RR    KCD +KW  S L+  Y VS V+TV
Sbjct  51   VIKKTRLEVFHSLV-------ASSFSRHHHRRKLKIKCDMNKWISSRLIYRYKVSLVLTV  103

Query  456  DLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAI  635
            DL GC NF+S+Q+A+D VP+ S   TLII+DSGTYREKV V  +K NLI+ GQGYLNTAI
Sbjct  104  DLKGCGNFSSIQEAVDVVPELSSSTTLIIMDSGTYREKVTVHATKKNLILLGQGYLNTAI  163

Query  636  SWNDTAN  656
            +WNDTAN
Sbjct  164  AWNDTAN  170



>ref|XP_009405469.1| PREDICTED: probable pectinesterase 8 [Musa acuminata subsp. malaccensis]
Length=404

 Score =   253 bits (647),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 154/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P+ G  G QA+AI +  DQ+AF+GCGF+GAQD ++D RGRHYFK+C IQGSIDFI
Sbjct  194   NVAPIPNPGDVGAQAVAIRVGADQAAFWGCGFFGAQDTIHDDRGRHYFKECHIQGSIDFI  253

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  RSLYE C++ SIA+    G   I G++TA GR S +E +GFSF+ C +GG+G++WL
Sbjct  254   FGDGRSLYESCQMISIASPVAAGLKTIDGTVTAHGRASGDENTGFSFVNCSIGGTGRIWL  313

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF+ T MS++++P+ WND+ D  RDQTV++GEY+C G GA  + R  YA+
Sbjct  314   GRAWRPFSRVVFANTFMSEIIAPEGWNDFGDPGRDQTVFYGEYNCSGAGASLTMRVPYAQ  373

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L+ ++AAPFL TS+IDG+ WL P
Sbjct  374   KLNNTQAAPFLNTSFIDGDQWLQP  397


 Score = 92.0 bits (227),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 77/146 (53%), Gaps = 4/146 (3%)
 Frame = +3

Query  303  DFLSVIHQVKQARSKhhhhhhKRRPKANK---CDDSKWDSPLVSMYNVSHVITVDLNGCA  473
            DFLS    +        HH   R PK N    CDD     P     + + +  VD NGC 
Sbjct  48   DFLSFTSSISPNSYGSGHHRRHRAPKTNDTDICDDLPPGFPPADT-DTTSIFCVDRNGCC  106

Query  474  NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTA  653
            +F +VQ A+DAV   S   +++ I+ G Y EKV + K+K N+  QGQG   T I+WNDTA
Sbjct  107  SFTTVQSAVDAVAVLSQKRSIVWINKGIYYEKVTIPKTKPNITFQGQGLYTTGIAWNDTA  166

Query  654  NstggtsssYTFGAFAPKFIAYNISF  731
            NS+ GT  S +   F   FIA NISF
Sbjct  167  NSSHGTFYSASVAVFGANFIAKNISF  192



>ref|XP_003576885.2| PREDICTED: probable pectinesterase 15 [Brachypodium distachyon]
Length=415

 Score =   241 bits (614),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 151/203 (74%), Gaps = 4/203 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +N AP    GA+GGQA+A+ + GDQ+AF+ CGFY AQD L D++GRH+F+ C+++GSIDF
Sbjct  184   RNAAPPAGPGASGGQAVALRVAGDQAAFHWCGFYSAQDTLLDEQGRHFFRGCYVEGSIDF  243

Query  1001  IFGKARSLYEECKINSIANEGGGG----ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKV  1168
             IFG  RSLY  C I+S+A    G     I+GS+TAQGR +E EK+GF+F++C V G+G V
Sbjct  244   IFGNGRSLYLGCTISSVAAAASGSNAGGITGSVTAQGRRTEAEKTGFAFVRCSVVGTGSV  303

Query  1169  WLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSY  1348
             WLGRAWG+YATVVF++T ++ +V+P+ WNDWND  R  +V FGEY+  GPGA+   R +Y
Sbjct  304   WLGRAWGAYATVVFAETYLAGIVAPEGWNDWNDPARQGSVMFGEYESSGPGANKDGRVAY  363

Query  1349  AKQLDESEAAPFLTTSYIDGEDW  1417
             A+QLD  +AAPF+   YIDG  W
Sbjct  364   ARQLDRRQAAPFMDVDYIDGGQW  386


 Score =   104 bits (260),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 83/124 (67%), Gaps = 5/124 (4%)
 Frame = +3

Query  378  KANKCDD-SKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFS---PVATLIII  545
            +   CD+ +KW S + S  N++ ++TVD +GC NF+S+QKAIDAVPD +      TLI +
Sbjct  61   RRRHCDEEAKWASSIASRLNITQILTVDRHGCGNFSSIQKAIDAVPDNNNHIGTRTLITV  120

Query  546  DSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggts-ssYTFGAFAPKFIAYN  722
             +GT+ EKV V  +K  L I G+G LN+ ++W+DTA +TGG +  S TF   A  F+AYN
Sbjct  121  GAGTFHEKVTVWSNKTGLTIHGRGNLNSVVAWDDTAGTTGGCTPCSATFTVLAAGFVAYN  180

Query  723  ISFQ  734
            ++F+
Sbjct  181  VTFR  184



>ref|XP_002445213.1| hypothetical protein SORBIDRAFT_07g006050 [Sorghum bicolor]
 gb|EES14708.1| hypothetical protein SORBIDRAFT_07g006050 [Sorghum bicolor]
Length=399

 Score =   260 bits (664),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 154/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  GA   QA+AI I GDQ+AF+GCGF+GAQD L+D RGRHYFK+CFIQGSIDFI
Sbjct  188   NVAPIPRPGAVDAQAVAIRINGDQAAFWGCGFFGAQDTLHDDRGRHYFKECFIQGSIDFI  247

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ SIA+    G   I+GS+TA  R SE++ +G+SF+ C +GG+G +WL
Sbjct  248   FGDARSLYENCRLISIADPVPSGQRSITGSVTAHARVSEDDNTGYSFVNCSIGGTGWIWL  307

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ V+F+ T MS +++ + WNDWND TRDQTV++GEY C G GA+ ++R  YA+
Sbjct  308   GRAWRPYSRVIFAYTSMSDIIASEGWNDWNDHTRDQTVFYGEYKCTGDGANLADRVPYAQ  367

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L + +  P+L TS+IDG+ WL P
Sbjct  368   KLSDVQVLPYLNTSFIDGDQWLKP  391


 Score = 84.7 bits (208),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = +3

Query  444  VITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYL  623
            +  VD NGC  F +VQ A+DAVP+ S    ++ I+ G Y EKV V  SK N+  QGQG+ 
Sbjct  91   IFCVDPNGCCEFTTVQAAVDAVPNHSSKRNVVWINKGIYFEKVTVPASKPNITFQGQGFD  150

Query  624  NTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
             TAI+WNDTA S  GT  S +   FA  FIA NISF
Sbjct  151  LTAIAWNDTAKSANGTFYSASVSVFASGFIAKNISF  186



>ref|XP_010686768.1| PREDICTED: probable pectinesterase 8 [Beta vulgaris subsp. vulgaris]
Length=420

 Score =   256 bits (654),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 151/202 (75%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP PS GA G QA+AI I GDQ+AF+GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  201   NVAPMPSPGAVGAQAVAIRIGGDQAAFWGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  260

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  RS YE C + SIA+    G   I+G++TA GR +++E SGF F  C +GG+G++WL
Sbjct  261   FGNGRSFYENCMMISIASPVPPGQRYINGAVTASGRATQDENSGFVFYNCSIGGTGRIWL  320

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW S++ V+F+ T MS +++P+ WND+N+   DQTV++GEY C GPGAD S R +Y +
Sbjct  321   GRAWRSFSRVIFAYTTMSDIIAPEGWNDFNNPNNDQTVFYGEYMCSGPGADLSTRVAYEQ  380

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+++  APFL  SYI+ + WL
Sbjct  381   KLNDTIVAPFLNVSYIEADQWL  402


 Score = 88.6 bits (218),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 0/100 (0%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N + ++ VD  GC NF +VQ A+DA P  S    +I I+SG Y EKV + ++K N+  QG
Sbjct  100  NTTSILCVDSKGCCNFTTVQSAVDASPVLSQKRIIIWINSGLYYEKVMIPRNKPNITFQG  159

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            QGY  T+I WNDTANS  GT SS +   F+  FIA NISF
Sbjct  160  QGYATTSIVWNDTANSAHGTFSSGSVQVFSSNFIAKNISF  199



>ref|XP_010422119.1| PREDICTED: putative pectinesterase 14 [Camelina sativa]
Length=312

 Score =   258 bits (659),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 147/200 (74%), Gaps = 3/200 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT+P P+ GA   QA+A+ I+GD+ AFYGCGFYG QD L DQ GRHYFK+CFI+GSIDF
Sbjct  116   KNTSPAPNPGAVDAQAVALRIVGDKVAFYGCGFYGNQDTLLDQEGRHYFKECFIEGSIDF  175

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLYE+C I+S+A E      G ITA G+D+   ++GF F+ C++ GSGKVWLGR
Sbjct  176   IFGNGRSLYEDCIIHSVAKEN---TIGCITANGKDTLRGRTGFVFVNCQIKGSGKVWLGR  232

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AW  YA VVFSKT MS+VVS D WND  D    +TVY+GE+ C GPGA+ S R  YAKQL
Sbjct  233   AWRPYARVVFSKTYMSKVVSLDGWNDMGDHKTQKTVYYGEHRCYGPGANHSERVPYAKQL  292

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EAAPF   S+IDGE WL
Sbjct  293   TDVEAAPFTNISFIDGEKWL  312


 Score = 85.1 bits (209),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 63/99 (64%), Gaps = 0/99 (0%)
 Frame = +3

Query  444  VITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYL  623
            V  V L GC  F  +  AIDA    S   TLI+ID G YRE+V V K+K NL++QG G+L
Sbjct  20   VFKVSLQGCGRFTKIHDAIDASIGSSVTKTLILIDFGIYRERVFVPKNKNNLVMQGMGFL  79

Query  624  NTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
             T+I WN+TA+S+ GT  S++   +  +F A NISF+ T
Sbjct  80   RTSIEWNNTASSSHGTFESFSVALYGDQFTAKNISFKNT  118



>ref|XP_007215489.1| hypothetical protein PRUPE_ppa006779mg [Prunus persica]
 gb|EMJ16688.1| hypothetical protein PRUPE_ppa006779mg [Prunus persica]
Length=395

 Score =   249 bits (636),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 153/202 (76%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GDQ+AF GCGF+GAQD L+D +GRHYFK C++QGSIDFI
Sbjct  189   NLAPIPKPGDFGAQAVAIRISGDQAAFLGCGFFGAQDTLHDDKGRHYFKDCYVQGSIDFI  248

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG  RSLYE C++ SIAN        ++G+ITA GR S+++ +GF+F+ C +GG+G+VWL
Sbjct  249   FGNGRSLYENCQLISIANPLPPESRNVNGAITAHGRTSKDDNTGFAFVNCFIGGTGRVWL  308

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF  T M+ +++P+ WND+ND TRDQT+++GEY+C G GA+ + R+ + +
Sbjct  309   GRAWRPFSRVVFVNTIMADIIAPEGWNDFNDPTRDQTIFYGEYNCSGAGANMTMRAPFVQ  368

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+++EA+ FL  S+IDG DWL
Sbjct  369   KLNDTEASTFLNVSWIDGGDWL  390


 Score = 92.8 bits (229),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 70/115 (61%), Gaps = 1/115 (1%)
 Frame = +3

Query  390  CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            CDD     P       S+ + VD NGC NF  VQ A+DA P  S   T+I I++G Y EK
Sbjct  75   CDDFPRGVPPPDTNKTSY-LCVDRNGCCNFTLVQAAVDAAPALSQKRTIIWINNGIYYEK  133

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            + + K+K N+  QGQGY +TAI+WNDTANS+ GT  S +   FA  F+A NISF 
Sbjct  134  ILIPKNKPNITFQGQGYESTAIAWNDTANSSHGTFYSGSVQVFADNFVAKNISFM  188



>ref|XP_004168775.1| PREDICTED: probable pectinesterase 8-like [Cucumis sativus]
Length=394

 Score =   251 bits (640),  Expect(2) = 6e-84, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 154/208 (74%), Gaps = 3/208 (1%)
 Frame = +2

Query  812   LGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGS  991
             L   N AP P+ G  G Q +AI I GDQ+AF+ CGF+GAQD L+D RGRHYFK C+IQGS
Sbjct  183   LSFMNVAPIPAPGDVGAQGVAIRIGGDQAAFWSCGFFGAQDTLHDDRGRHYFKDCYIQGS  242

Query  992   IDFIFGKARSLYEECKINSIAN---EGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSG  1162
             IDFIFG  RS YE C++ S+AN   +G   ++G++TA GR S +E SGFSF+ C +GG+G
Sbjct  243   IDFIFGNGRSFYESCQLVSMANPVPQGSKFVNGAVTAHGRASADENSGFSFVNCSIGGTG  302

Query  1163  KVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRS  1342
             +VWLGRAW  ++ VVF+ T M+ +++P+ WND+ND  RDQT+++GEY+C G GA+ S+R+
Sbjct  303   RVWLGRAWRPFSRVVFANTVMTDIIAPEGWNDFNDPARDQTIFYGEYNCSGAGANMSSRA  362

Query  1343  SYAKQLDESEAAPFLTTSYIDGEDWLIP  1426
              Y ++L++++ + FL  S+ID + WL P
Sbjct  363   PYVQRLNDTQVSSFLNLSFIDADQWLQP  390


 Score = 90.1 bits (222),  Expect(2) = 6e-84, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 64/98 (65%), Gaps = 0/98 (0%)
 Frame = +3

Query  438  SHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQG  617
            + V  VD N C NF ++Q A+DAVP+ S    +I I++G Y EKV V K+K N+  QGQG
Sbjct  88   TSVFCVDQNSCCNFTTIQAAVDAVPNLSIKRNIIWINAGIYYEKVMVPKTKANVTFQGQG  147

Query  618  YLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            Y  TAI WNDTANS+ GT  S +   F+  FIA N+SF
Sbjct  148  YTTTAIVWNDTANSSHGTFYSASVQVFSSNFIAKNLSF  185



>ref|XP_010267308.1| PREDICTED: putative pectinesterase 14 isoform X1 [Nelumbo nucifera]
Length=431

 Score =   283 bits (724),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 169/226 (75%), Gaps = 12/226 (5%)
 Frame = +2

Query  779   NVRAYD*VNGFLGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGR  958
             N  AYD     +  +NTAP  S G  GGQA+A+ I GDQ+AFY CGFYGAQD L D RGR
Sbjct  209   NFIAYD-----ISFQNTAPSASPGDVGGQAIALRIAGDQAAFYRCGFYGAQDTLLDDRGR  263

Query  959   HYFKQCFIQGSIDFIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFL  1138
             HYFK+CFIQGSIDFIFG ARSLYE+C I+ IA +   GISG+ITA GR S   ++GFSF+
Sbjct  264   HYFKECFIQGSIDFIFGNARSLYEDCTIDLIAKKVSVGISGAITAHGRQSMNARTGFSFV  323

Query  1139  KCEVGGSGKVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQT-------VYFG  1297
              C +GG+G+VWLGRAWG +A+VVF++T M+ +++P+ WNDWND +RDQ+       V+FG
Sbjct  324   NCSIGGTGRVWLGRAWGGFASVVFARTFMADIIAPEGWNDWNDPSRDQSVCMCDRNVFFG  383

Query  1298  EYDCRGPGADCSNRSSYAKQLDESEAAPFLTTSYIDGEDWLIPTPN  1435
             EY+C GPGA+ + R+SY++QL  SEAAPF+  SYIDG  WL+P  N
Sbjct  384   EYECVGPGANYTLRTSYSRQLSHSEAAPFIDISYIDGNLWLLPQGN  429


 Score =   156 bits (394),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 135/208 (65%), Gaps = 7/208 (3%)
 Frame = +3

Query  132  TRSTSILFWLIAFTIAFFSltfslysnllttttvltvntpttllpflRSVV-----KQTG  296
            TR T + FW  AF++A  S+  +  +  + +++  +    +    F    +      Q+G
Sbjct  15   TRKTKLFFWFSAFSVALLSILLATTTTTIPSSSSPSSLISSAYYSFELGAIFKRGLNQSG  74

Query  297  LDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITVDLNGCAN  476
            +D F S++ ++ + R  HHH   +   + + CD++KW S LVS YN+S V TVDLNGCAN
Sbjct  75   VDVFSSLLRRIIRRRGHHHHRRGRG--RGDVCDEAKWFSWLVSGYNISLVFTVDLNGCAN  132

Query  477  FASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTAN  656
            F+SVQKA+DA PD SP  TLI+IDSG YREKV V  +K NLI QGQGYLNT+I+WNDTAN
Sbjct  133  FSSVQKAVDAAPDRSPTRTLILIDSGVYREKVVVGTNKTNLIFQGQGYLNTSIAWNDTAN  192

Query  657  stggtsssYTFGAFAPKFIAYNISFQVT  740
            STGGT  S +   FA  FIAY+ISFQ T
Sbjct  193  STGGTVYSSSVAIFASNFIAYDISFQNT  220



>ref|XP_004147773.1| PREDICTED: probable pectinesterase 8-like [Cucumis sativus]
 gb|KGN53483.1| hypothetical protein Csa_4G056710 [Cucumis sativus]
Length=394

 Score =   251 bits (640),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 154/208 (74%), Gaps = 3/208 (1%)
 Frame = +2

Query  812   LGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGS  991
             L   N AP P+ G  G Q +AI I GDQ+AF+ CGF+GAQD L+D RGRHYFK C+IQGS
Sbjct  183   LSFMNVAPIPAPGDVGAQGVAIRIGGDQAAFWSCGFFGAQDTLHDDRGRHYFKDCYIQGS  242

Query  992   IDFIFGKARSLYEECKINSIAN---EGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSG  1162
             IDFIFG  RS YE C++ S+AN   +G   ++G++TA GR S +E SGFSF+ C +GG+G
Sbjct  243   IDFIFGNGRSFYESCQLVSMANPVPQGSKFVNGAVTAHGRASADENSGFSFVNCSIGGTG  302

Query  1163  KVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRS  1342
             +VWLGRAW  ++ VVF+ T M+ +++P+ WND+ND  RDQT+++GEY+C G GA+ S+R+
Sbjct  303   RVWLGRAWRPFSRVVFANTVMTDIIAPEGWNDFNDPARDQTIFYGEYNCSGAGANMSSRA  362

Query  1343  SYAKQLDESEAAPFLTTSYIDGEDWLIP  1426
              Y ++L++++ + FL  S+ID + WL P
Sbjct  363   PYVQRLNDTQVSSFLNLSFIDADQWLQP  390


 Score = 89.7 bits (221),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 64/98 (65%), Gaps = 0/98 (0%)
 Frame = +3

Query  438  SHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQG  617
            + +  VD N C NF ++Q A+DAVP+ S    +I I++G Y EKV V K+K N+  QGQG
Sbjct  88   TSIFCVDQNSCCNFTTIQAAVDAVPNLSIKRNIIWINAGIYYEKVMVPKTKANVTFQGQG  147

Query  618  YLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            Y  TAI WNDTANS+ GT  S +   F+  FIA N+SF
Sbjct  148  YTTTAIVWNDTANSSHGTFYSASVQVFSSNFIAKNLSF  185



>ref|XP_006279166.1| hypothetical protein CARUB_v10007965mg [Capsella rubella]
 gb|EOA12064.1| hypothetical protein CARUB_v10007965mg [Capsella rubella]
Length=330

 Score =   261 bits (668),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 150/200 (75%), Gaps = 3/200 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT+P P+ GA   QA+A+ ++GD++AFYGCGF+G QD L DQ GRHYFK CFI+GSIDF
Sbjct  134   KNTSPAPNPGAVREQAVALKVVGDKTAFYGCGFFGNQDTLLDQEGRHYFKDCFIEGSIDF  193

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLYE+C I+S+A E      G ITA G+D+  E++GFSF+ C++GGS KVWLGR
Sbjct  194   IFGNGRSLYEDCIIHSVAKEN---TVGCITANGKDTLRERTGFSFVNCKIGGSAKVWLGR  250

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AW  YA VVFSKT MSQVVS + WND  D    +TVYFGE+ C GPGA+ S R  YA+QL
Sbjct  251   AWRPYARVVFSKTYMSQVVSYEGWNDMKDHKTQKTVYFGEHRCYGPGANHSGRVPYAQQL  310

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EAAPF   S+IDGE+WL
Sbjct  311   TDVEAAPFTNISFIDGEEWL  330


 Score = 78.6 bits (192),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 70/121 (58%), Gaps = 2/121 (2%)
 Frame = +3

Query  378  KANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGT  557
            +  KCD    + P    Y + + ++  L+GC  F  +Q AIDA    +    LI+ID G 
Sbjct  18   RTPKCDAEFLNFP-TKGYTLVYKVS-SLHGCGRFTRIQNAIDASLGSTLTKQLILIDHGI  75

Query  558  YREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQV  737
            YRE+V V K+K NL++QG G   T+I WN+TA+S+ GT  S++   +   F A NISF+ 
Sbjct  76   YRERVIVPKNKKNLVMQGMGLSRTSIEWNNTASSSNGTYESFSVALYGDLFTAKNISFKN  135

Query  738  T  740
            T
Sbjct  136  T  136



>ref|XP_003571529.1| PREDICTED: probable pectinesterase 8 [Brachypodium distachyon]
Length=390

 Score =   256 bits (653),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 154/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  GA   QA+A+ I GDQ+AF+GCGF+GAQD L+D RGRHYFK+CFIQGSIDFI
Sbjct  179   NVAPIPRPGAVDAQAVALRIGGDQAAFWGCGFFGAQDTLHDDRGRHYFKECFIQGSIDFI  238

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ SIA+    G   I+G+ITA  R+S+ + +G+SF+ C +GG+G++WL
Sbjct  239   FGDARSLYENCRLISIADPVPAGVRTITGAITAHARESDGDNTGYSFVNCSIGGTGRIWL  298

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF+ T MS +++ + WNDWND +RDQ+V++GEY C G GA+ + R  Y+ 
Sbjct  299   GRAWRPYSRVVFAYTLMSDIIASEGWNDWNDPSRDQSVFYGEYKCTGDGANLAGRVPYSL  358

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L + +A P+L TSYIDG+ WL P
Sbjct  359   KLSDEQALPYLNTSYIDGDRWLKP  382


 Score = 83.2 bits (204),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = +3

Query  444  VITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYL  623
            +  VD NGC +F  VQ A+DAVP  S    ++ I+ G Y EKV V  +K N+  QGQG+ 
Sbjct  82   IFCVDPNGCCDFTKVQDAVDAVPRSSHKRNVVWINKGIYFEKVTVPATKPNITFQGQGFD  141

Query  624  NTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
             TAI+WNDTANS+ GT  S +   FA  F+A NISF
Sbjct  142  LTAIAWNDTANSSHGTFYSASVTVFAAGFVAKNISF  177



>emb|CDY33182.1| BnaC04g08570D [Brassica napus]
Length=412

 Score =   278 bits (710),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 159/217 (73%), Gaps = 5/217 (2%)
 Frame = +2

Query  770   LICNVRAYD*VNGFLGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQ  949
             L  N  AY+     +  KN AP+P  G    QA+A+ I GDQ AFYGCGFYGAQD L D 
Sbjct  179   LAANFTAYN-----ISFKNNAPEPDPGEDDAQAVALKIEGDQCAFYGCGFYGAQDTLLDD  233

Query  950   RGRHYFKQCFIQGSIDFIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGF  1129
             RGRH+FK CFIQGSIDFIFG  RSLY++C INSIA E   G+SGSITA GR SE+E++GF
Sbjct  234   RGRHFFKNCFIQGSIDFIFGNGRSLYQDCTINSIAKENTSGVSGSITAHGRQSEDEQTGF  293

Query  1130  SFLKCEVGGSGKVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDC  1309
             SF+ C++ GSG +WLGRAWG+YATVVFS T MS +++P+ WNDW D TR++TV FGE+ C
Sbjct  294   SFVNCKIDGSGNMWLGRAWGAYATVVFSNTYMSGIITPEGWNDWGDPTREKTVTFGEHKC  353

Query  1310  RGPGADCSNRSSYAKQLDESEAAPFLTTSYIDGEDWL  1420
              G GA+   R SY KQL +SEA+ F   SYIDG+ WL
Sbjct  354   YGEGANYKRRVSYGKQLTDSEASSFTDISYIDGDQWL  390


 Score =   130 bits (326),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 87/117 (74%), Gaps = 2/117 (2%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTY-R  563
            KC + KW S L  +Y  S V+TVDLNGC NF++VQ AID+VPD SP  TLII++SG Y R
Sbjct  76   KCCE-KWTSKLTHLYKTSLVLTVDLNGCGNFSNVQSAIDSVPDLSPSKTLIIVNSGVYSR  134

Query  564  EKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            EKV V ++K N+++QG+GY NT+I WNDTA S GGT+ S++F   A  F AYNISF+
Sbjct  135  EKVTVNENKTNVVMQGRGYQNTSIEWNDTAKSAGGTAYSFSFAVLAANFTAYNISFK  191



>ref|XP_009143563.1| PREDICTED: probable pectinesterase 15 [Brassica rapa]
Length=406

 Score =   277 bits (708),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 158/217 (73%), Gaps = 5/217 (2%)
 Frame = +2

Query  770   LICNVRAYD*VNGFLGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQ  949
             L  N  AY+     +  KN AP+P  G    QA+A+ I GDQ AFYGCGFYGAQD L D 
Sbjct  173   LAANFTAYN-----ISFKNNAPEPDPGEDDAQAVALKIEGDQCAFYGCGFYGAQDTLLDD  227

Query  950   RGRHYFKQCFIQGSIDFIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGF  1129
             RGRH+FK CFIQGSIDFIFG  RSLY++C INSIA E   G+SGSITA GR SE+E++GF
Sbjct  228   RGRHFFKNCFIQGSIDFIFGNGRSLYQDCTINSIAKENTSGVSGSITAHGRQSEDEQTGF  287

Query  1130  SFLKCEVGGSGKVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDC  1309
             SF+ C++ GSG +WLGRAWG+YATVVFS T MS +++P+ WNDW D TR++TV FGE+ C
Sbjct  288   SFVNCKIDGSGNMWLGRAWGAYATVVFSNTYMSGIITPEGWNDWGDPTREKTVTFGEHKC  347

Query  1310  RGPGADCSNRSSYAKQLDESEAAPFLTTSYIDGEDWL  1420
              G GA+   R SY KQL  SEA+ F   SYIDG+ WL
Sbjct  348   YGEGANYKRRVSYGKQLTNSEASSFTDISYIDGDQWL  384


 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 87/116 (75%), Gaps = 1/116 (1%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYRE  566
            KC + KW S L  +Y  S V+TVDLNGC NF++VQ AID+VPD SP  TLII++SG YRE
Sbjct  71   KCCE-KWTSKLTHLYKTSLVLTVDLNGCGNFSNVQSAIDSVPDLSPSKTLIIVNSGVYRE  129

Query  567  KVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            KV V ++K N+++QG+GY NT+I WNDTA S GGT+ S++F   A  F AYNISF+
Sbjct  130  KVTVNENKTNIVMQGRGYQNTSIEWNDTAKSAGGTAYSFSFAVLAANFTAYNISFK  185



>ref|XP_006294321.1| hypothetical protein CARUB_v10023328mg [Capsella rubella]
 gb|EOA27219.1| hypothetical protein CARUB_v10023328mg [Capsella rubella]
Length=408

 Score =   276 bits (707),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 170/237 (72%), Gaps = 6/237 (3%)
 Frame = +2

Query  770   LICNVRAYD*VNGFLGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQ  949
             L  N  AYD     +  KN AP+P  G T  QA+A+ I GDQ+AFYGCGFYGAQD L D 
Sbjct  175   LAANFTAYD-----ISFKNNAPEPDPGETDAQAVALRIEGDQAAFYGCGFYGAQDTLLDD  229

Query  950   RGRHYFKQCFIQGSIDFIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGF  1129
             +GRH+FK CFIQGSIDFIFG  RSLY++C INSIA     G++GSITAQGR+S++E+SGF
Sbjct  230   KGRHFFKDCFIQGSIDFIFGNGRSLYQDCTINSIAKGNTSGVTGSITAQGRESKDEESGF  289

Query  1130  SFLKCEVGGSGKVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDC  1309
             SF+ C++ GSG+V LGRAWG+YATVVFS T MS +++P+ W+DW D  + +TV FGE+ C
Sbjct  290   SFVNCKIDGSGQVLLGRAWGAYATVVFSNTYMSGIITPEGWDDWGDQAKQKTVTFGEHKC  349

Query  1310  RGPGADCSNRSSYAKQLDESEAAPFLTTSYIDGEDWLIPTPNTAYITTSTDPMTTLY  1480
              GPGA+   R S+ KQL +SEA+ F+  S+IDG+ WL  T NT    TS D    LY
Sbjct  350   YGPGANYKERVSFGKQLTDSEASSFIDVSFIDGDQWLRHT-NTLANLTSKDTRDGLY  405


 Score =   129 bits (325),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 87/116 (75%), Gaps = 1/116 (1%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYRE  566
            KC + +W S L + Y  S V+TVDL+GC NF++VQ AIDAVPD SP  TLI+++SG+YRE
Sbjct  73   KCCE-RWTSRLTNQYKSSLVLTVDLHGCGNFSNVQSAIDAVPDLSPSKTLILVNSGSYRE  131

Query  567  KVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            KV V ++K N++IQG+GY NT+I WNDTA S G T+ S++F   A  F AY+ISF+
Sbjct  132  KVTVNENKTNIVIQGRGYQNTSIEWNDTAKSAGNTADSFSFVVLAANFTAYDISFK  187



>emb|CDX75019.1| BnaA05g07650D [Brassica napus]
Length=404

 Score =   276 bits (706),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 164/228 (72%), Gaps = 5/228 (2%)
 Frame = +2

Query  770   LICNVRAYD*VNGFLGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQ  949
             L  N  AY+     +  KN AP+P  G    QA+A+ I GDQ AFYGCGFYGAQD L D 
Sbjct  170   LAANFTAYN-----ISFKNNAPEPDPGEDDAQAVALKIEGDQCAFYGCGFYGAQDTLLDD  224

Query  950   RGRHYFKQCFIQGSIDFIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGF  1129
             RGRH+FK CFIQGSIDFIFG  RS+Y++C INSIA E   G+SGSITA GR SE+E++GF
Sbjct  225   RGRHFFKNCFIQGSIDFIFGNGRSIYQDCTINSIAKENTSGVSGSITAHGRQSEDEQTGF  284

Query  1130  SFLKCEVGGSGKVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDC  1309
             SF+ C++ GSG +WLGRAWG+YATVVFS T MS +++P+ WNDW D TR++TV FGE+ C
Sbjct  285   SFVNCKIDGSGNMWLGRAWGAYATVVFSNTYMSGIITPEGWNDWGDPTREKTVTFGEHKC  344

Query  1310  RGPGADCSNRSSYAKQLDESEAAPFLTTSYIDGEDWLIPTPNTAYITT  1453
              G GA+   R SY KQL +SEA+ F   SYIDG+ WL  T   + +T+
Sbjct  345   YGEGANYKRRVSYGKQLTDSEASLFTDISYIDGDQWLSQTNILSELTS  392


 Score =   127 bits (320),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 87/117 (74%), Gaps = 2/117 (2%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTY-R  563
            KC + KW S L  +Y  S V+TVDLNGC NF++VQ AID+VPD SP  TLII++SG Y R
Sbjct  67   KCCE-KWTSRLTHLYKPSLVLTVDLNGCGNFSNVQSAIDSVPDLSPSKTLIIVNSGVYSR  125

Query  564  EKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            EKV V ++K N+++QG+GY NT+I WNDT+ S GGT+ S++F   A  F AYNISF+
Sbjct  126  EKVTVNENKTNIVMQGRGYQNTSIEWNDTSKSAGGTAYSFSFAVLAANFTAYNISFK  182



>gb|EMS46468.1| putative pectinesterase 8 [Triticum urartu]
Length=420

 Score =   243 bits (620),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 152/233 (65%), Gaps = 32/233 (14%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+A+ I GDQ+AF+GCGF+GAQD L+D RGRHYFK+CFIQGSIDFI
Sbjct  180   NVAPIPRPGDVGAQAVALRIGGDQAAFWGCGFFGAQDTLHDDRGRHYFKECFIQGSIDFI  239

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ SIA+    G   I+GS+TA  R+S +E SG+SF+ C +GG+G +WL
Sbjct  240   FGDARSLYENCRLISIADPVPAGVRSITGSVTAHARESNKENSGYSFVNCSIGGTGWIWL  299

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQ------------------------  1282
             GRAW  Y+ VVF+ T MS +++ D WNDWND +RDQ                        
Sbjct  300   GRAWRPYSRVVFAYTTMSNIIASDGWNDWNDPSRDQYASPELLVFSGINSECTLTSVCSM  359

Query  1283  -----TVYFGEYDCRGPGADCSNRSSYAKQLDESEAAPFLTTSYIDGEDWLIP  1426
                  +V++GEY C G GA  + R  YA +L + +A P+L TS+IDG+ WL P
Sbjct  360   ISIARSVFYGEYKCTGDGAHLAGRVPYALELSDVQALPYLNTSFIDGDLWLKP  412


 Score = 89.7 bits (221),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 70/122 (57%), Gaps = 1/122 (1%)
 Frame = +3

Query  390  CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            CDD   D PL      S +  VD NGC +F +VQ A+DAVP  S    ++ I+ G Y EK
Sbjct  66   CDDFPPDFPLPDTAATS-IFCVDPNGCCDFTTVQSAVDAVPRSSQKRNVLWINKGIYLEK  124

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVTHHI  749
            V V  +K N+  QGQG+  TAI WNDTANS+ GT  S +   FA  F+A NISF     I
Sbjct  125  VTVPATKANITFQGQGFDLTAIMWNDTANSSHGTFYSASVSVFATGFVAKNISFMNVAPI  184

Query  750  LR  755
             R
Sbjct  185  PR  186



>ref|XP_008442749.1| PREDICTED: probable pectinesterase 15 isoform X2 [Cucumis melo]
Length=319

 Score =   166 bits (421),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 96/121 (79%), Gaps = 4/121 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP+ + G  GGQA+A+ I GD++AFYGCGFYGAQD L D +GRHYFK CFIQGSIDF
Sbjct  197   KNTAPEATPGIVGGQAVAVRIAGDKAAFYGCGFYGAQDTLYDDKGRHYFKTCFIQGSIDF  256

Query  1001  IFGKARSLYEECKINSIANEG-GGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGK---V  1168
             IFG ARSLY+ C+I SIA E  GGG+SG+ITAQGR +  E++GF+F+ C + GSGK   V
Sbjct  257   IFGNARSLYDGCRIKSIAKEVLGGGVSGAITAQGRQTRSEETGFAFINCTISGSGKECVV  316

Query  1169  W  1171
             W
Sbjct  317   W  317


 Score =   158 bits (400),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 113/155 (73%), Gaps = 7/155 (5%)
 Frame = +3

Query  276  SVVKQTGLDDFLSVIHQVKQARSKhhhhhhKRRPKANKCDDSKWDSPLVSMYNVSHVITV  455
            S+VK++GLD+ LS+   V Q  SK  +    ++     CD+ KWDS L+S+YNVS  +TV
Sbjct  52   SLVKESGLDEILSL---VTQYLSKPQYQWRDKK----SCDEKKWDSKLISLYNVSLTLTV  104

Query  456  DLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAI  635
            DL GCANF+SVQ A+DAVPD+    TLI+I+SG YREKV ++ +K NLII+GQ YL+TAI
Sbjct  105  DLKGCANFSSVQTAVDAVPDYGSSRTLILINSGVYREKVVIEANKTNLIIEGQSYLDTAI  164

Query  636  SWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
             WNDTANSTGGT+ S +   FA  FIAYNISF+ T
Sbjct  165  EWNDTANSTGGTTYSSSVTIFASNFIAYNISFKNT  199



>gb|KDO64378.1| hypothetical protein CISIN_1g0167571mg, partial [Citrus sinensis]
Length=207

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP PS G  G QA+AI I GDQSAF+GCGF+GAQD L+D RGRHYFK C IQGSIDFI
Sbjct  1     NVAPIPSPGDVGAQAVAIRISGDQSAFFGCGFFGAQDTLHDDRGRHYFKDCHIQGSIDFI  60

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARS YE C++ S+AN    G   ISG++TA GR S++E SGF+F+ C VGG+G++WL
Sbjct  61    FGNARSFYENCQLISMANPVAPGSKAISGAVTAHGRASKDENSGFAFVNCTVGGTGRIWL  120

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  ++ VVF    M+ +++P+ WND+ND TRDQTV++GEY+C G G+D + R+ Y +
Sbjct  121   GRAWRPFSRVVFLFASMTDIIAPEGWNDFNDPTRDQTVFYGEYNCTGAGSDMTMRAPYVQ  180

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L++++A+ FL TS+IDG+ WL
Sbjct  181   RLNDTQASLFLNTSFIDGDQWL  202



>ref|XP_002459865.1| hypothetical protein SORBIDRAFT_02g012560 [Sorghum bicolor]
 gb|EER96386.1| hypothetical protein SORBIDRAFT_02g012560 [Sorghum bicolor]
Length=428

 Score =   265 bits (676),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 161/222 (73%), Gaps = 8/222 (4%)
 Frame = +2

Query  770   LICNVRAYD*VNGFLGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQ  949
             L  N  AY+     +  +NTA     G +GGQA+A+ + GDQ+AFY CGFY +QD L D+
Sbjct  184   LAANFVAYN-----VSVQNTAAPADPGGSGGQAVALRVAGDQAAFYWCGFYSSQDTLLDE  238

Query  950   RGRHYFKQCFIQGSIDFIFGKARSLYEECKINSIANEGGGG-ISGSITAQGRDSEEEKSG  1126
             +GRH F+ C+++GSIDFIFG ARSLY  C I+S+AN   GG ++GS+TA GR S  EK+G
Sbjct  239   QGRHLFRGCYVEGSIDFIFGNARSLYLGCTISSVANAAAGGTVTGSVTAHGRASPAEKTG  298

Query  1127  FSFLKCEVGGSGKVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYD  1306
             F+F+ C V G+G+VWLGRAWG YATVVF++T +S VV+P AWNDWND  R Q+V+FGEYD
Sbjct  299   FAFVGCTVVGTGQVWLGRAWGPYATVVFARTYLSAVVAPGAWNDWNDPARQQSVFFGEYD  358

Query  1307  CRGPGAD--CSNRSSYAKQLDESEAAPFLTTSYIDGEDWLIP  1426
             C GPGA      R +YA+QLD+ +AAPF+  SYIDG  W +P
Sbjct  359   CTGPGASGGTVQRVAYARQLDQRQAAPFMDVSYIDGNQWAVP  400


 Score =   114 bits (284),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = +3

Query  390  CDD-SKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYRE  566
            CDD ++W + + S++N + V+TVD  GC N+  +QKA+DAVPD++   TLI +D+G Y E
Sbjct  81   CDDQARWVAKMASLHNATLVLTVDHKGCGNYTRLQKAVDAVPDYAAARTLIAVDAGVYAE  140

Query  567  KVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            KV V  +K  + +QG+G LNT I WNDTANS+GGT  S T    A  F+AYN+S Q T
Sbjct  141  KVVVWSNKTGVTLQGRGNLNTTIVWNDTANSSGGTFYSATVAVLAANFVAYNVSVQNT  198



>ref|XP_008662740.1| PREDICTED: probable pectinesterase 8 [Zea mays]
 gb|AFW56986.1| hypothetical protein ZEAMMB73_471457 [Zea mays]
Length=426

 Score =   264 bits (674),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 160/215 (74%), Gaps = 7/215 (3%)
 Frame = +2

Query  803   NGFLGGK----NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFK  970
             +GF+G      N AP P  GA   QA+AI I GDQ+AF+GCGF+GAQD L+D RGRHYFK
Sbjct  204   SGFIGKNISFINVAPIPRPGAVDAQAVAIRINGDQAAFWGCGFFGAQDTLHDDRGRHYFK  263

Query  971   QCFIQGSIDFIFGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLK  1141
             +CFIQGSIDFIFG ARSLYE C++ SIA+    G   I+GS+TA  R+SE++ +G+SF+ 
Sbjct  264   ECFIQGSIDFIFGDARSLYENCRLISIADPVPSGQRSITGSVTAHARESEDDNTGYSFVN  323

Query  1142  CEVGGSGKVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPG  1321
             C +GG+G +WLGRAW  Y+ V+F+ T MS +++ + WNDWND TRDQTV++GEY C G G
Sbjct  324   CSIGGTGSIWLGRAWRPYSRVIFAYTSMSDIIASEGWNDWNDQTRDQTVFYGEYKCTGDG  383

Query  1322  ADCSNRSSYAKQLDESEAAPFLTTSYIDGEDWLIP  1426
             A+ ++R  YA++L + +  P+L TS+IDG+ WL P
Sbjct  384   ANLADRVPYAQKLSDVQVLPYLNTSFIDGDQWLKP  418


 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 67/114 (59%), Gaps = 1/114 (1%)
 Frame = +3

Query  390  CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREK  569
            CDD   D P      +S +  VD NGC +F +VQ A++AVP+ S    ++ I+ G Y EK
Sbjct  101  CDDFPPDFPPADTPALS-IFCVDPNGCCDFTTVQAAVNAVPNHSSKRNVVWINRGIYFEK  159

Query  570  VAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            V V  SK N+  QGQG+  TAI+WNDTA S  GT  S +   FA  FI  NISF
Sbjct  160  VTVPASKPNITFQGQGFHLTAIAWNDTAKSANGTFYSASVSVFASGFIGKNISF  213



>ref|XP_006358730.1| PREDICTED: probable pectinesterase 8-like [Solanum tuberosum]
Length=200

 Score =   254 bits (649),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 152/191 (80%), Gaps = 0/191 (0%)
 Frame = +2

Query  848   GATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFIFGKARSLY  1027
             GA G QA+AI I GDQ+AF+GCGF+G+QD L+D RGRHYFK+C+IQGSIDF+FG  +S Y
Sbjct  5     GAVGAQAVAIRIGGDQAAFWGCGFFGSQDTLHDDRGRHYFKECYIQGSIDFVFGNGKSFY  64

Query  1028  EECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGRAWGSYATVV  1207
             E C++ SIA+ G   I+G++TA GR S++E SGF+F+ C +GG+G++WLGRAW S++TVV
Sbjct  65    ENCELTSIASPGSRSINGAVTAHGRASKDEDSGFAFVNCSIGGTGRIWLGRAWRSFSTVV  124

Query  1208  FSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQLDESEAAPFL  1387
             FS T M+ ++SPD WND ND +RDQT+++GEY C G G++ S R+SY ++L++++A PFL
Sbjct  125   FSNTFMTDIISPDGWNDLNDPSRDQTIFYGEYKCSGAGSNMSQRASYVQKLNDTQALPFL  184

Query  1388  TTSYIDGEDWL  1420
               S+ID   WL
Sbjct  185   NLSFIDAHLWL  195



>ref|XP_006303572.1| hypothetical protein CARUB_v10011085mg, partial [Capsella rubella]
 gb|EOA36470.1| hypothetical protein CARUB_v10011085mg, partial [Capsella rubella]
Length=342

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 155/203 (76%), Gaps = 3/203 (1%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GD+SAF GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  134   NVAPIPKPGDVGAQAVAIRIAGDESAFVGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  193

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG A+SLY++C+I S+AN+   G   ++G++TA GR+S++E SGFSF+ C +GG+G VWL
Sbjct  194   FGNAKSLYQDCRIISMANQVSPGSKAVNGAVTANGRNSKDENSGFSFVNCSIGGTGHVWL  253

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW  Y+ VVF  T M+ V++ + WN++ND +RD T+++GEY+C G GAD S R+ Y +
Sbjct  254   GRAWRPYSRVVFVSTTMTDVIASEGWNNFNDPSRDATIFYGEYNCTGAGADMSKRAPYVQ  313

Query  1355  QLDESEAAPFLTTSYIDGEDWLI  1423
             +L+E++ A F+  SYIDG+ WL+
Sbjct  314   KLNETQVALFVNASYIDGDQWLL  336



>ref|XP_004955158.1| PREDICTED: probable pectinesterase 8-like [Setaria italica]
Length=346

 Score =   230 bits (587),  Expect(2) = 7e-74, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 145/205 (71%), Gaps = 3/205 (1%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  G  G QA+AI I GD++AF GCGF+GAQD L D++ RHYFK+CFI+GS+DF
Sbjct  135   KNAAPAPKPGTEGAQAVAIRISGDKAAFSGCGFFGAQDTLLDEQHRHYFKECFIEGSVDF  194

Query  1001  IFGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVW  1171
             IFG  RSLYE   +NS+A E   G   I+G+ITAQ R   E  +GFSF+ C + G+G + 
Sbjct  195   IFGDGRSLYENSTLNSVAEELPQGQHSINGAITAQARQFPENNTGFSFIGCTIQGTGWIL  254

Query  1172  LGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYA  1351
             LGRAW +Y+ VVF+ T M  +V+   W++W D  R++TV++GE+ C G GA+ + R +YA
Sbjct  255   LGRAWQAYSRVVFAYTYMPGIVASAGWDNWGDERRNRTVFYGEHGCLGDGANVAGRVAYA  314

Query  1352  KQLDESEAAPFLTTSYIDGEDWLIP  1426
             + +D+S+  PFL  SYIDGE+WL P
Sbjct  315   RSVDDSQVRPFLDASYIDGEEWLKP  339


 Score = 77.0 bits (188),  Expect(2) = 7e-74, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = +3

Query  444  VITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYL  623
            V  VD +GC N+ +VQ A+DAVPD S   T++ I++G Y EKV +KK   N+  Q QG  
Sbjct  41   VFCVDKSGCCNYTTVQAAVDAVPDNSQKRTIVWINAGIYVEKVTLKKP--NVTFQVQGMK  98

Query  624  NTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
             T I WNDTAN   GT +S +    AP F+A NISF+
Sbjct  99   ATTIVWNDTANFAKGTRNSASVHIDAPGFVAKNISFK  135



>emb|CDY63984.1| BnaA04g21070D [Brassica napus]
Length=284

 Score =   249 bits (637),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 144/200 (72%), Gaps = 3/200 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP P  GA G QA+A+ I GDQ+AFYGCGFY AQD L D  GRH+FK CFIQGSIDF
Sbjct  87    RNTAPAPEPGAEGAQAVALRIEGDQAAFYGCGFYSAQDTLLDNAGRHFFKDCFIQGSIDF  146

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLY++C I SIA E   GISG ITAQ R SE E +GFSF+ C++ G+GKVWLGR
Sbjct  147   IFGMGRSLYQDCTIRSIAKESTSGISGCITAQDRTSEAENTGFSFVNCKIYGTGKVWLGR  206

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AW  YA+VVFS T MS ++S + WND  D   D+ VYFGE+ C G GA+   R  Y+KQL
Sbjct  207   AWRPYASVVFSNTYMSNIISSEGWNDMRDPNNDKKVYFGEHRCFGDGANQKGRVPYSKQL  266

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              +S    F + SYIDG++WL
Sbjct  267   TDSH---FTSISYIDGDEWL  283


 Score = 57.0 bits (136),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +3

Query  534  LIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFI  713
             ++I+S   REKV V + KIN+I+ G GY  T I WNDT  S+GGT +SY+F   A +F 
Sbjct  23   FLVIESN--REKVTVDEKKINVILHGTGYQRTFIEWNDTGKSSGGTVNSYSFAVSAARFT  80

Query  714  AYNISFQVT  740
            A N+SF+ T
Sbjct  81   AQNVSFRNT  89



>ref|XP_009142108.1| PREDICTED: probable pectinesterase 15 [Brassica rapa]
Length=290

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 144/200 (72%), Gaps = 3/200 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP P  GA G QA+A+ I GDQ+AFYGCGFY AQD L D  GRH+FK CFIQGSIDF
Sbjct  93    RNTAPAPEPGAEGAQAVALRIEGDQAAFYGCGFYSAQDTLLDNAGRHFFKHCFIQGSIDF  152

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLY++C I SIA E   GISG ITAQ R SE E +GFSF+ C++ G+GKVWLGR
Sbjct  153   IFGMGRSLYQDCTIRSIAKESTSGISGCITAQDRTSEAENTGFSFVNCKIYGTGKVWLGR  212

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AW  YA+VVFS T MS ++S + WND  D   D+ VYFGE+ C G GA+   R  Y+KQL
Sbjct  213   AWRPYASVVFSNTYMSNIISAEGWNDMRDPNNDKKVYFGEHRCFGDGANQKGRVPYSKQL  272

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              +S    F + SYIDG++WL
Sbjct  273   TDSH---FTSISYIDGDEWL  289


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +3

Query  564  EKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQVT  740
            EKV V + KIN+I+ G GY  T I WNDT  S+GGT +SY+F   A +F A N+SF+ T
Sbjct  37   EKVTVDEKKINVILHGTGYQRTFIEWNDTGKSSGGTVNSYSFAVSAARFTAQNVSFRNT  95



>ref|XP_008653773.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase 15, partial 
[Zea mays]
Length=437

 Score =   255 bits (652),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 159/222 (72%), Gaps = 8/222 (4%)
 Frame = +2

Query  770   LICNVRAYD*VNGFLGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQ  949
             L  N  AY+     +  +NTA     G  GGQA+A+ + GDQ+AFY CGFY +QD L D+
Sbjct  193   LAANFVAYN-----VSVQNTARPADPGDAGGQAVALRVRGDQAAFYWCGFYSSQDTLLDE  247

Query  950   RGRHYFKQCFIQGSIDFIFGKARSLYEECKINSIANEGGGG-ISGSITAQGRDSEEEKSG  1126
             +GRH+F+ C+++GSIDFIFG ARSLY  C I+S+AN    G ++GS+TA GR S  E++G
Sbjct  248   QGRHFFRGCYVEGSIDFIFGNARSLYLGCTISSVANAAANGTVTGSVTAHGRASLAERTG  307

Query  1127  FSFLKCEVGGSGKVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYD  1306
              +F+ C V G+G+VWLGRAWG YATVVF++T +S VV+P  WNDWND  R Q+V+FGEYD
Sbjct  308   LAFVDCNVVGTGQVWLGRAWGPYATVVFARTYLSAVVAPAGWNDWNDPARQQSVFFGEYD  367

Query  1307  CRGPGAD--CSNRSSYAKQLDESEAAPFLTTSYIDGEDWLIP  1426
             C GPGA    + R +YA+QLD+ +AAPF+  SYI+G  W +P
Sbjct  368   CTGPGASGGTAQRVAYARQLDQRQAAPFMDLSYINGNQWALP  409


 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 93/138 (67%), Gaps = 5/138 (4%)
 Frame = +3

Query  330  KQARSKhhhhhhKRRPKANKCDD-SKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDA  506
            ++A ++   HHH+RR     CDD ++W + + S++N S V+TVD  GCANF S+QKA+DA
Sbjct  74   EEAEAEVGRHHHRRR----ACDDQARWVAKMASLHNASLVLTVDRTGCANFTSLQKAVDA  129

Query  507  VPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYT  686
            VPD++   TLI +D+G Y EKV V  +   + +QG+G LNT I WNDTANSTGGT  S T
Sbjct  130  VPDYAAARTLIAVDAGVYAEKVVVWSNXTGVTLQGRGNLNTTIVWNDTANSTGGTFYSAT  189

Query  687  FGAFAPKFIAYNISFQVT  740
                A  F+AYN+S Q T
Sbjct  190  VAVLAANFVAYNVSVQNT  207



>ref|XP_008353660.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase 8 [Malus 
domestica]
Length=228

 Score =   248 bits (632),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 153/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  818   GKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSID  997
             G N AP P  G  G Q LAI I GDQ+A  GCGF+GAQD L+D RGRHYFK C+IQGSID
Sbjct  20    GDNVAPIPKPGDVGAQXLAIRISGDQAAILGCGFFGAQDTLHDDRGRHYFKDCYIQGSID  79

Query  998   FIFGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKV  1168
             FIFG  RSLYE C++ S++N    G   I+G++TA GR S++E +G++F+ C +GG+G+V
Sbjct  80    FIFGNGRSLYENCQLISMSNPVPLGTKSINGAVTAHGRASKDENTGYAFVNCFIGGTGRV  139

Query  1169  WLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSY  1348
             WLGRAW  ++ VVF+ T M+ +++P+ WND+ND TRDQT+++GEY+  G GA+ S R+ Y
Sbjct  140   WLGRAWRPFSRVVFASTTMTDIIAPEGWNDFNDPTRDQTIFYGEYNNSGAGANMSLRAPY  199

Query  1349  AKQLDESEAAPFLTTSYIDGEDWL  1420
              ++L++++A+ FL  S+IDG DWL
Sbjct  200   VQKLNDTQASLFLNVSFIDGGDWL  223



>emb|CDY68894.1| BnaCnng60960D [Brassica napus]
Length=313

 Score =   209 bits (531),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 137/202 (68%), Gaps = 32/202 (16%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI I GD++AF GCGF+GAQD L+D RGRHYFK C+IQGSIDFI
Sbjct  136   NVAPIPKPGDVGAQAVAIRIPGDEAAFVGCGFFGAQDTLHDDRGRHYFKDCYIQGSIDFI  195

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG A+SLY++C+I S+AN+   G   I+G++TA+GR+S++E SGFSF+ C +GG+G    
Sbjct  196   FGNAKSLYQDCQIISMANQVSAGSKSINGAVTAKGRNSKDENSGFSFVNCSIGGTG----  251

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
                                      WN++ND +RD T+++GEY+C GPGA+ S R+ Y +
Sbjct  252   -------------------------WNNFNDPSRDATIFYGEYNCSGPGANISKRAQYVQ  286

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L+E++ A F+  ++IDG+ WL
Sbjct  287   KLNETQVAQFINMTFIDGDQWL  308


 Score = 90.5 bits (223),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 75/127 (59%), Gaps = 6/127 (5%)
 Frame = +3

Query  366  KRRPKANK-----CDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVA  530
            +R+P  +K     CDD   + P       S+ + VD NGC NF +VQ A+DAV +FS   
Sbjct  9    RRKPSHSKKKISICDDFPKNLPPPDTDTTSY-LCVDKNGCCNFTTVQSAVDAVGNFSQRR  67

Query  531  TLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKF  710
             +I I+SG Y EKV + K+K N+ +Q QG+  TAI+WNDTA S  GT    +   F  +F
Sbjct  68   NVIWINSGMYYEKVVIPKTKPNITLQRQGFETTAIAWNDTAYSANGTFYRASVQVFGSQF  127

Query  711  IAYNISF  731
            +A NISF
Sbjct  128  LAKNISF  134



>tpg|DAA60680.1| TPA: hypothetical protein ZEAMMB73_943201 [Zea mays]
Length=309

 Score =   244 bits (624),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 145/191 (76%), Gaps = 3/191 (2%)
 Frame = +2

Query  863   QALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFIFGKARSLYEECKI  1042
              A+A+ + GDQ+AFY CGFY +QD L D++GRH+F+ C+++GSIDFIFG ARSLY  C I
Sbjct  91    NAVALRVRGDQAAFYWCGFYSSQDTLLDEQGRHFFRGCYVEGSIDFIFGNARSLYLGCTI  150

Query  1043  NSIANEGGGG-ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGRAWGSYATVVFSKT  1219
             +S+AN    G ++GS+TA GR S  E++G +F+ C V G+G+VWLGRAWG YATVVF++T
Sbjct  151   SSVANAAANGTVTGSVTAHGRASLAERTGLAFVDCNVVGTGQVWLGRAWGPYATVVFART  210

Query  1220  QMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGAD--CSNRSSYAKQLDESEAAPFLTT  1393
              +S VV+P  WNDWND  R Q+V+FGEYDC GPGA    + R +YA+QLD+ +AAPF+  
Sbjct  211   YLSAVVAPAGWNDWNDPARQQSVFFGEYDCTGPGASGGTAQRVAYARQLDQRQAAPFMDL  270

Query  1394  SYIDGEDWLIP  1426
             SYI+G  W +P
Sbjct  271   SYINGNQWALP  281


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 66/102 (65%), Gaps = 11/102 (11%)
 Frame = +3

Query  417  LVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKIN  596
            + S++N S V+TVD  GCANF S+QKA+DAVPD++   TLI +D+G Y EKV        
Sbjct  1    MASLHNASLVLTVDRTGCANFTSLQKAVDAVPDYAAARTLIAVDAGVYAEKVV-------  53

Query  597  LIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYN  722
                G+G LNT I WNDTANSTGGT  S T    A  F+AYN
Sbjct  54   ----GRGNLNTTIVWNDTANSTGGTFYSATVAVLAANFVAYN  91



>emb|CAN73254.1| hypothetical protein VITISV_006029 [Vitis vinifera]
Length=397

 Score =   202 bits (514),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 120/162 (74%), Gaps = 3/162 (2%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+AI + GDQ+AF+GCGF+G+QD L+D RGRHYF+ C+IQGSIDFI
Sbjct  192   NVAPIPKPGDVGAQAVAIRVAGDQAAFWGCGFFGSQDTLHDDRGRHYFRDCYIQGSIDFI  251

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARS YE C++ S+AN    G   I+G+ITA GR S +E +G++F+ C VGG+G+VWL
Sbjct  252   FGDARSFYENCQLISMANPVPVGSKVINGAITAHGRTSMDENTGYAFVACTVGGTGRVWL  311

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGE  1300
             GRAW  ++ VVF+ T +S +++ + WND+ND TRDQ  + G 
Sbjct  312   GRAWRPFSRVVFAYTSLSDIIASEGWNDFNDPTRDQVFFMGS  353


 Score = 93.6 bits (231),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 66/101 (65%), Gaps = 0/101 (0%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N + ++ VD NGC NF  VQ A+DAV   S   T+I I+SG Y EKV + K+K N+  QG
Sbjct  91   NTTSILCVDRNGCCNFTMVQSAVDAVSVLSQKRTIIWINSGVYYEKVIIPKNKPNITFQG  150

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            QG+ +TAI WNDTANS+ GT  S +   FA  FIA NISF 
Sbjct  151  QGFASTAIVWNDTANSSHGTFYSGSVQVFAANFIAKNISFM  191



>gb|EMT18708.1| Putative pectinesterase 8 [Aegilops tauschii]
Length=349

 Score =   242 bits (617),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 152/233 (65%), Gaps = 32/233 (14%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N AP P  G  G QA+A+ I GDQ+AF+GCGF+GAQD L+D RGRHYFK+CFIQGSIDFI
Sbjct  109   NVAPIPRPGDVGAQAVALRIGGDQAAFWGCGFFGAQDTLHDDRGRHYFKECFIQGSIDFI  168

Query  1004  FGKARSLYEECKINSIANEGGGG---ISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSLYE C++ SIA+    G   I+GS+TA  R+S +E +G+SF+ C +GG+G +WL
Sbjct  169   FGDARSLYENCRLISIADPVPAGVRSITGSVTAHARESNQENTGYSFVNCSIGGTGWIWL  228

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQ------------------------  1282
             GRAW  Y+ VVF+ T MS +++ D WNDWND +RDQ                        
Sbjct  229   GRAWRPYSRVVFAYTSMSNIIASDGWNDWNDPSRDQYASPVLLVFSGINSECTLTSVCSM  288

Query  1283  -----TVYFGEYDCRGPGADCSNRSSYAKQLDESEAAPFLTTSYIDGEDWLIP  1426
                  +V++GEY C G GA  + R  YA +L + +A P+L TS+IDG+ WL P
Sbjct  289   ISIARSVFYGEYKCTGDGAHLAGRVPYALELSDVQALPYLNTSFIDGDLWLKP  341


 Score = 52.4 bits (124),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  552  GTYREKVAVKKSKINLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
            G   EKV V  +K N+  QGQG+  TAI WNDTANS+ GT  S +   FA  F+A NISF
Sbjct  48   GQCSEKVTVPATKPNITFQGQGFDLTAIMWNDTANSSHGTFYSASVSVFAAGFVAKNISF  107



>ref|XP_011093645.1| PREDICTED: probable pectinesterase 53 isoform X2 [Sesamum indicum]
Length=386

 Score =   228 bits (580),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 142/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  G TG QA+A  I GD +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  190   KNTTPVPRAGETGTQAVAFRISGDTAAFVGCKFLGAQDTLYDHSGRHYYKDCYIEGSVDF  249

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SL+EEC+++++A      ++G++TAQGR S  + +GFSF+ C+V GSG ++LGR
Sbjct  250   IFGNGLSLFEECEVHAVA-----AVTGAVTAQGRSSMLDDTGFSFVNCKVTGSGALYLGR  304

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W+DW D +R  TV++G+Y CRG GA  + R S++++L
Sbjct  305   AWGPFSRVVFAYTYMDNIIIPKGWHDWGDPSRQLTVFYGQYKCRGAGASFAGRVSWSREL  364

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  365   SDEEAKPFISLSFIDGSEWI  384


 Score = 63.5 bits (153),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 67/114 (59%), Gaps = 7/114 (6%)
 Frame = +3

Query  438  SHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ +TVD N    +F S+Q+A+D++P  + +  +I + +G Y EKV + K K  + I+G 
Sbjct  85   SYTLTVDKNPALGDFTSIQQALDSLPPLNLLRVVINVHAGVYTEKVRIPKLKSFITIEGG  144

Query  615  GYLNTAISWNDTANstg------gtsssYTFGAFAPKFIAYNISFQVTHHILRS  758
            G  +T + W DTA + G      GT +S TF   AP FIA NI+F+ T  + R+
Sbjct  145  GAESTIVEWGDTAQTPGPKGRPLGTFASATFAVDAPYFIAKNITFKNTTPVPRA  198



>ref|XP_002974192.1| hypothetical protein SELMODRAFT_101090 [Selaginella moellendorffii]
 gb|EFJ24414.1| hypothetical protein SELMODRAFT_101090 [Selaginella moellendorffii]
Length=318

 Score =   223 bits (569),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 137/203 (67%), Gaps = 5/203 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +N A     G TG QA+A+ I  D +AFY C F+G QD L D +GRHYFK+CF+QGS+DF
Sbjct  121   QNEAIAHIHGETGKQAVALRISADMAAFYDCNFHGGQDTLYDHKGRHYFKRCFVQGSVDF  180

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLY++C + SIAN+     +G+ITAQ R      SGFSF+ C + GSG+++LGR
Sbjct  181   IFGYGRSLYKDCHLYSIANK-----TGAITAQKRTIRNMNSGFSFVNCSITGSGRIYLGR  235

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG  + VV+S T M  +++P  W +WN   R++TV+F +Y+C GPGA  S R ++A+ L
Sbjct  236   AWGDRSRVVYSYTYMDALIAPQGWQNWNHPERNRTVFFAQYECSGPGAKTSQRVAWARTL  295

Query  1361  DESEAAPFLTTSYIDGEDWLIPT  1429
                EA PFL T +I GE WL+ T
Sbjct  296   TFEEAQPFLDTDFIHGETWLLST  318


 Score = 66.2 bits (160),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 63/111 (57%), Gaps = 5/111 (5%)
 Frame = +3

Query  417  LVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKIN  596
            LV       VI V  +G  NF+S+ +AID++P+ +    ++ I +G YREK+A+ KSK  
Sbjct  11   LVEAERNQSVIVVARDGLGNFSSIAEAIDSIPEQNQQRVIVWIKAGVYREKIAIPKSKPF  70

Query  597  LIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPK-----FIAYNISFQ  734
            + +QG G   T I+WN TA+   GT+   T+ +         FIA NI+FQ
Sbjct  71   VTLQGDGSSLTIITWNSTASDRNGTNLLKTYNSATISINSRFFIAKNITFQ  121



>gb|KDP46694.1| hypothetical protein JCGZ_06482 [Jatropha curcas]
Length=374

 Score =   228 bits (582),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 139/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GA G QA+A+ I  D +AF GC F GAQD L D  GRHYFK C+I+GS+DF
Sbjct  178   KNKAPSPPSGALGKQAVALRISADTAAFIGCNFIGAQDTLYDHIGRHYFKDCYIEGSVDF  237

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLYE C +++I N       G++TAQ RDS  +++GFSF+ C+V GSG ++LGR
Sbjct  238   IFGNGLSLYENCHLHAITNS-----FGALTAQKRDSMLQETGFSFVNCKVTGSGALYLGR  292

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWGS++ VVF+ T M ++++P  W +W D  R+ TV++G+Y C GPGAD   R S++++L
Sbjct  293   AWGSFSRVVFAYTYMDKIITPRGWYNWGDKNREMTVFYGQYKCSGPGADFGGRVSWSREL  352

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              E EA PF++  +IDG  WL
Sbjct  353   TEEEAKPFISIGFIDGHQWL  372


 Score = 60.8 bits (146),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 6/94 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
              F +VQKAID++P  +    +I I +GTYREKV +  S   + ++G G   T I W+DT
Sbjct  85   GGFVTVQKAIDSIPIVNNCRVVISISAGTYREKVEIPASMAYITLEGDGTGKTIIEWDDT  144

Query  651  ANstggtsssY------TFGAFAPKFIAYNISFQ  734
            A+  G            TF   +P FIA NI+F+
Sbjct  145  ADKMGQGGHRLGTYGSATFAINSPYFIAKNITFK  178



>ref|XP_010271483.1| PREDICTED: probable pectinesterase 53 [Nelumbo nucifera]
Length=395

 Score =   231 bits (589),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 142/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  GA G QA+A+ I GD +AF+ C F GAQD L D  GRHYFK C+IQGS+DF
Sbjct  200   KNTAPLPPSGALGKQAVALRISGDTAAFFSCNFIGAQDTLYDHIGRHYFKDCYIQGSVDF  259

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLYE C +++I N       G++TAQ RD+  E++GFSF+ C V GSG ++LGR
Sbjct  260   IFGDGLSLYEGCHLHAITNS-----YGALTAQKRDNMLEETGFSFVNCRVTGSGALYLGR  314

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWGS++ VVF+ T M ++++P  W +W D  R+ TV++G+Y C GPGAD   R S++++L
Sbjct  315   AWGSFSRVVFAYTYMDKIITPKGWYNWGDKNRELTVFYGQYKCSGPGADFGGRVSWSREL  374

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +WL
Sbjct  375   TQQEAKPFISLSFIDGYEWL  394


 Score = 57.8 bits (138),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 6/96 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F +VQKA+D++P  +    LI I +G YREKV +  +K  + ++G G   T + W DT
Sbjct  107  GDFVTVQKAVDSLPIVNQCRVLIKIHAGIYREKVDIPATKAFVTLEGAGADRTILQWGDT  166

Query  651  ANstgg------tsssYTFGAFAPKFIAYNISFQVT  740
            A+  G       T +S TF   +P F+A NI+F+ T
Sbjct  167  ADRMGSDRRPLGTFASATFAINSPYFVAKNITFKNT  202



>ref|XP_002975044.1| hypothetical protein SELMODRAFT_102829 [Selaginella moellendorffii]
 gb|EFJ23829.1| hypothetical protein SELMODRAFT_102829 [Selaginella moellendorffii]
Length=318

 Score =   223 bits (568),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 137/203 (67%), Gaps = 5/203 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +N A     G TG QA+A+ I  D +AFY C F+G QD L D +GRHYFK+CF+QGS+DF
Sbjct  121   QNEAIAHIHGETGKQAVALRISADMAAFYDCNFHGGQDTLYDHKGRHYFKRCFVQGSVDF  180

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLY++C + SIAN+     +G+ITAQ R      SGFSF+ C + GSG+++LGR
Sbjct  181   IFGYGRSLYKDCHLYSIANK-----TGAITAQKRTIRNMNSGFSFVNCSITGSGRIYLGR  235

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG  + VV+S T M  +++P  W +WN   R++TV+F +Y+C GPGA  S R ++A+ L
Sbjct  236   AWGDRSRVVYSYTYMDALIAPQGWQNWNHPERNRTVFFAQYECSGPGAKTSQRVAWARTL  295

Query  1361  DESEAAPFLTTSYIDGEDWLIPT  1429
                EA PFL T +I GE WL+ T
Sbjct  296   TFEEAQPFLGTDFIHGETWLLST  318


 Score = 65.5 bits (158),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 63/111 (57%), Gaps = 5/111 (5%)
 Frame = +3

Query  417  LVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKIN  596
            LV       VI V  +G  NF+S+ +AID++P+ +    ++ I +G YREK+A+ KSK  
Sbjct  11   LVEAERNQSVIVVARDGFGNFSSIAEAIDSIPEQNQQRVIVRIKAGVYREKIAIPKSKPF  70

Query  597  LIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPK-----FIAYNISFQ  734
            + +QG G   T I+WN TA+   GT+   T+ +         FIA NI+FQ
Sbjct  71   VTLQGDGSSLTIITWNSTASDRNGTNLLKTYNSATISINSRFFIAKNITFQ  121



>ref|XP_009406172.1| PREDICTED: probable pectinesterase 53 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=404

 Score =   223 bits (568),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 141/205 (69%), Gaps = 5/205 (2%)
 Frame = +2

Query  806   GFLGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQ  985
               LG +NT P P  GA G QA+++ I GD +AF GC F GAQD L D  GRHY+K C+I+
Sbjct  203   ALLGFQNTTPVPPPGAMGKQAVSLRISGDTAAFVGCKFLGAQDTLYDHVGRHYYKDCYIE  262

Query  986   GSIDFIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGK  1165
             GS+DFIFG A SLYE C +++IA        G++TAQ R S  E +GFSF+ C+V GSG 
Sbjct  263   GSVDFIFGNALSLYEGCHVHAIAQN-----YGALTAQNRMSLLEDTGFSFVNCKVTGSGA  317

Query  1166  VWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSS  1345
             ++LGRAWG+++ V+F+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  + R S
Sbjct  318   LYLGRAWGTFSRVIFAYTYMDDIILPRGWYNWGDPNREMTVFYGQYKCTGPGASYAGRVS  377

Query  1346  YAKQLDESEAAPFLTTSYIDGEDWL  1420
             ++++L + EA PF++ S+IDG +W+
Sbjct  378   WSRELTDEEAKPFISMSFIDGSEWI  402


 Score = 64.3 bits (155),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 64/107 (60%), Gaps = 7/107 (7%)
 Frame = +3

Query  438  SHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ +TVD N    +F ++Q+A+D++P  + V  +I +++GTY EKV V   +  + IQG 
Sbjct  76   SYTLTVDKNPSVGDFTTIQEAVDSLPLINLVRVVIKVNAGTYTEKVNVSPMRAFITIQGA  135

Query  615  GYLNTAISWNDTANstg------gtsssYTFGAFAPKFIAYNISFQV  737
            G   T + W DTA + G      GT +S TF   AP FIA NI+F+V
Sbjct  136  GADKTVVQWGDTAETLGPKKQPIGTFNSATFAVNAPYFIARNITFKV  182



>ref|XP_010915080.1| PREDICTED: probable pectinesterase 53 isoform X2 [Elaeis guineensis]
Length=380

 Score =   219 bits (559),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 139/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A+ I GD +AF GC F G QD L D  GRHY+K C+I+GS+DF
Sbjct  184   KNTTPIPPPGAMGKQAVALRISGDTAAFLGCKFLGGQDTLYDHIGRHYYKDCYIEGSVDF  243

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA        G++TAQ R S  E +GFSF+ C+V GSG ++LGR
Sbjct  244   IFGNALSLFEGCHVHAIAQN-----YGAVTAQNRMSLLEDTGFSFVNCKVTGSGALYLGR  298

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C GPGA+   R S++++L
Sbjct  299   AWGTFSRVVFAYTYMDDIIIPRGWYNWGDPSREMTVFYGQYKCSGPGANYVGRVSWSREL  358

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  359   TDEEAKPFISLSFIDGTEWV  378


 Score = 67.0 bits (162),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 64/111 (58%), Gaps = 7/111 (6%)
 Frame = +3

Query  438  SHVITVDLNGC-ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ +TVD N    +F S+Q AID++P  + V  +I +++GTY+EKV +   K  + I+G 
Sbjct  79   SYTLTVDKNPSKGDFTSIQDAIDSLPFVNLVRVVIKVNAGTYKEKVNISPGKAFITIEGA  138

Query  615  GYLNTAISWNDTANstggtss------sYTFGAFAPKFIAYNISFQVTHHI  749
            G   T + W DTA++ G          S TFG  AP FIA NI+F+ T  I
Sbjct  139  GADKTVVQWGDTADTPGPRGQPIGTFNSATFGVNAPYFIAKNITFKNTTPI  189



>ref|XP_002454459.1| hypothetical protein SORBIDRAFT_04g031450 [Sorghum bicolor]
 gb|EES07435.1| hypothetical protein SORBIDRAFT_04g031450 [Sorghum bicolor]
Length=349

 Score =   218 bits (556),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 144/204 (71%), Gaps = 13/204 (6%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N+AP P  GA G QA+A+ + GD++AF+GCGF+GAQD L+D + RHYFK+C IQGSIDFI
Sbjct  150   NSAPAPKPGAEGAQAVAMRVSGDRAAFWGCGFFGAQDTLHDDQNRHYFKECLIQGSIDFI  209

Query  1004  FGKARSLYEECKINSIANE---GGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             FG ARSL+E C ++S+A E   G   I+G+ITAQGR   +  +GFSF+ C +GGSG + L
Sbjct  210   FGDARSLHENCTLHSVAQELPQGQRSINGAITAQGRRFADNNTGFSFVGCTIGGSGWILL  269

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAW +Y+ V+F+ T M   +   A           TV++GE+DC G GA+ + R SYA+
Sbjct  270   GRAWQAYSRVIFAYTYMPAAIVATA----------GTVFYGEFDCTGDGANMAGRVSYAR  319

Query  1355  QLDESEAAPFLTTSYIDGEDWLIP  1426
             +L++ +A PFLTT++IDG +WL P
Sbjct  320   KLNKMQAQPFLTTAFIDGPEWLKP  343


 Score = 68.2 bits (165),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 58/96 (60%), Gaps = 3/96 (3%)
 Frame = +3

Query  444  VITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYL  623
            +  VD NGC NF +VQ A+DAVPD     +++ I  G + EKV V+K   N+  QGQG  
Sbjct  56   IFCVDKNGCCNFTTVQAAVDAVPDNGQKRSIVWI-IGIFVEKVVVRKP--NITFQGQGLK  112

Query  624  NTAISWNDTANstggtsssYTFGAFAPKFIAYNISF  731
             + I WNDTA + G T +S +    AP F+A N+SF
Sbjct  113  VSMIVWNDTATTAGNTPNSASVHIDAPGFVAKNMSF  148



>ref|XP_003631899.2| PREDICTED: probable pectinesterase 53 [Vitis vinifera]
 emb|CBI17409.3| unnamed protein product [Vitis vinifera]
Length=364

 Score =   220 bits (561),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 139/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +N AP P  GA G QA+A+ I  D +AF GC F GAQD L D  GRHYF+ C+IQGS+DF
Sbjct  167   QNKAPPPPSGALGKQAVALRISADTAAFIGCKFIGAQDTLYDHMGRHYFRDCYIQGSVDF  226

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLYE C +++I N       G++TAQ RD   E++GFSF+ C+V GSG ++LGR
Sbjct  227   IFGNGLSLYEGCHLHAITNS-----VGALTAQKRDGLLEETGFSFVHCKVTGSGALYLGR  281

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M ++++P  W  W + +R+ TV++G+Y C GPGAD   R S++++L
Sbjct  282   AWGTFSRVVFAFTFMDKIINPSGWYAWGNKSREMTVFYGQYQCSGPGADFGRRVSWSREL  341

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++  ++DG +WL
Sbjct  342   TQQEAKPFISIGFVDGYEWL  361


 Score = 65.9 bits (159),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +FASVQKA+D++P  +P   +I I +G YREKV +   K  + ++G G   T I WNDT
Sbjct  74   GHFASVQKAVDSLPVNNPCRVVISIGAGIYREKVVIPAIKAYVSLEGAGADKTIIEWNDT  133

Query  651  ANstggtsssY------TFGAFAPKFIAYNISFQ  734
            A+  G T          TF   +P FIA NI+FQ
Sbjct  134  ADLVGQTGRPLGTFGSATFAVNSPYFIAKNITFQ  167



>ref|XP_003530551.1| PREDICTED: probable pectinesterase 53-like isoform X1 [Glycine 
max]
 ref|XP_006584808.1| PREDICTED: probable pectinesterase 53-like isoform X2 [Glycine 
max]
 gb|KHN16649.1| Putative pectinesterase 53 [Glycine soja]
Length=375

 Score =   226 bits (577),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P+ GA G Q +A+ I  D + F GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  177   KNTAPIPAPGAVGKQGVALRISADTAVFLGCKFLGAQDTLYDHIGRHYYKDCYIEGSVDF  236

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA      ++G++TAQGR+S  E +GFSF+ C+V GSG ++LGR
Sbjct  237   IFGNALSLFEGCHVHAIAQ-----LTGALTAQGRNSLLEDTGFSFVHCKVTGSGALYLGR  291

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  + R S++++L
Sbjct  292   AWGPFSRVVFAYTYMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGPGASYAGRVSWSREL  351

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ SYIDG +W+
Sbjct  352   SDEEAKPFISLSYIDGSEWI  371


 Score = 59.7 bits (143),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = +3

Query  438  SHVITVDL-NGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            SH + V   +G   F+S+Q AID++P  + V  +I + +G Y EKV +   K  + IQG+
Sbjct  77   SHTLHVSKKHGKGGFSSIQAAIDSLPFINVVRVVIKVHAGVYTEKVNISPFKSFVTIQGE  136

Query  615  GYLNTAISWNDTANst-ggtsssYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA S   GT  S TF   +P FIA NI+F+ T
Sbjct  137  GADKTIVQWGDTAQSQPLGTYGSATFAVNSPYFIAKNITFKNT  179



>ref|XP_010049610.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase 53 [Eucalyptus 
grandis]
Length=383

 Score =   225 bits (574),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A  I  D +AF+GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  187   KNTTPVPKPGAVGKQAVAFRISADTAAFWGCSFLGAQDTLYDHFGRHYYKDCYIEGSVDF  246

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SL+E C++++IA+       G++TAQGR S  E +GFSFLKC+V GSG ++LGR
Sbjct  247   IFGNGLSLFESCQVHAIASX-----VGALTAQGRSSMLEDTGFSFLKCKVTGSGALYLGR  301

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W++W D  R+ TV++G+Y C GPGA  + R S++++L
Sbjct  302   AWGPFSRVVFAYTWMDDIIIPKGWSNWGDPGREMTVFYGQYKCIGPGASFAGRVSWSREL  361

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PFL+ S+IDG +W+
Sbjct  362   TDEEAKPFLSLSFIDGSEWI  381


 Score = 60.8 bits (146),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 62/108 (57%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGC-ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ +TVD N    +F S+Q AID++P  + V  +I + +G Y EKV++ + K  + I+G 
Sbjct  82   SYTLTVDKNPAYGDFTSIQDAIDSLPFINLVRVVIKVHAGVYTEKVSIPQLKSFITIEGA  141

Query  615  GYLNTAISWNDTANs------tggtsssYTFGAFAPKFIAYNISFQVT  740
            G   T + W D A++        GT  S TFG  +P FIA NI+F+ T
Sbjct  142  GAAKTIVQWGDRADTPGPKGQHMGTYGSATFGVNSPFFIAKNITFKNT  189



>ref|XP_011093643.1| PREDICTED: probable pectinesterase 53 isoform X1 [Sesamum indicum]
Length=388

 Score =   222 bits (566),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 142/202 (70%), Gaps = 7/202 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  G TG QA+A  I GD +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  190   KNTTPVPRAGETGTQAVAFRISGDTAAFVGCKFLGAQDTLYDHSGRHYYKDCYIEGSVDF  249

Query  1001  IFGKARSLYE--ECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             IFG   SL+E  EC+++++A      ++G++TAQGR S  + +GFSF+ C+V GSG ++L
Sbjct  250   IFGNGLSLFELQECEVHAVA-----AVTGAVTAQGRSSMLDDTGFSFVNCKVTGSGALYL  304

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAWG ++ VVF+ T M  ++ P  W+DW D +R  TV++G+Y CRG GA  + R S+++
Sbjct  305   GRAWGPFSRVVFAYTYMDNIIIPKGWHDWGDPSRQLTVFYGQYKCRGAGASFAGRVSWSR  364

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L + EA PF++ S+IDG +W+
Sbjct  365   ELSDEEAKPFISLSFIDGSEWI  386


 Score = 63.5 bits (153),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 67/114 (59%), Gaps = 7/114 (6%)
 Frame = +3

Query  438  SHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ +TVD N    +F S+Q+A+D++P  + +  +I + +G Y EKV + K K  + I+G 
Sbjct  85   SYTLTVDKNPALGDFTSIQQALDSLPPLNLLRVVINVHAGVYTEKVRIPKLKSFITIEGG  144

Query  615  GYLNTAISWNDTANstg------gtsssYTFGAFAPKFIAYNISFQVTHHILRS  758
            G  +T + W DTA + G      GT +S TF   AP FIA NI+F+ T  + R+
Sbjct  145  GAESTIVEWGDTAQTPGPKGRPLGTFASATFAVDAPYFIAKNITFKNTTPVPRA  198



>ref|XP_002531506.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF30860.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=367

 Score =   229 bits (585),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 143/201 (71%), Gaps = 5/201 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GA G QA+A+ I  D +AF GC F GAQD L D  GRHYFK+C+I+GS+DF
Sbjct  170   KNKAPSPPSGALGKQAVALRISADTAAFIGCKFIGAQDTLYDHIGRHYFKECYIEGSVDF  229

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLY++C +++I N       G++TAQ R+S  E++GFSF+ C+V GSG ++LGR
Sbjct  230   IFGNGLSLYDDCHLHAITNS-----FGALTAQKRESMLEETGFSFVNCKVTGSGALYLGR  284

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M ++++P  W DW D  R+ TV++G+Y C GPGA    R S++++L
Sbjct  285   AWGTFSRVVFAYTYMDKIITPTGWYDWGDKNREMTVFYGQYKCSGPGAQFGGRVSWSREL  344

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              E EA PF++  +IDG+DWL+
Sbjct  345   TEQEAKPFVSIDFIDGQDWLL  365


 Score = 55.8 bits (133),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 52/94 (55%), Gaps = 6/94 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F +++KA++++P  +    +I I +GTYREK+ +  S   + ++G G   T I W+DT
Sbjct  77   GDFVTLKKALNSIPVINNCRVIISIGAGTYREKIEIPGSMSYITLEGAGAGKTTIEWDDT  136

Query  651  ANstggtsssY------TFGAFAPKFIAYNISFQ  734
            A+  G            TF   +P FIA NI+F+
Sbjct  137  ADKQGQGGHLLGTYGSATFAINSPYFIAKNITFK  170



>ref|XP_009406173.1| PREDICTED: probable pectinesterase 53 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=377

 Score =   222 bits (565),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 139/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+++ I GD +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  181   KNTTPVPPPGAMGKQAVSLRISGDTAAFVGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDF  240

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++IA        G++TAQ R S  E +GFSF+ C+V GSG ++LGR
Sbjct  241   IFGNALSLYEGCHVHAIAQN-----YGALTAQNRMSLLEDTGFSFVNCKVTGSGALYLGR  295

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ V+F+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  + R S++++L
Sbjct  296   AWGTFSRVIFAYTYMDDIILPRGWYNWGDPNREMTVFYGQYKCTGPGASYAGRVSWSREL  355

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  356   TDEEAKPFISMSFIDGSEWI  375


 Score = 63.2 bits (152),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 64/108 (59%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ +TVD N    +F ++Q+A+D++P  + V  +I +++GTY EKV V   +  + IQG 
Sbjct  76   SYTLTVDKNPSVGDFTTIQEAVDSLPLINLVRVVIKVNAGTYTEKVNVSPMRAFITIQGA  135

Query  615  GYLNTAISWNDTANstg------gtsssYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G      GT +S TF   AP FIA NI+F+ T
Sbjct  136  GADKTVVQWGDTAETLGPKKQPIGTFNSATFAVNAPYFIARNITFKNT  183



>ref|XP_010258939.1| PREDICTED: probable pectinesterase 68 isoform X1 [Nelumbo nucifera]
Length=347

 Score =   221 bits (562),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 142/203 (70%), Gaps = 6/203 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  G  G QA A  I GD+S F GCGFYGAQD L D  GRHYFK+C+I+GSIDF
Sbjct  147   KNTAPAPMPGMEGWQAAAFRISGDKSYFSGCGFYGAQDTLCDDAGRHYFKECYIEGSIDF  206

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RS+Y++C+++SIA        GSI AQ R S EE++GF+FL C+V GSG +++GR
Sbjct  207   IFGNGRSMYKDCELHSIATR-----FGSIAAQDRKSAEERTGFAFLNCKVTGSGPLYVGR  261

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWND-STRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             A G Y+ +VFS T  + VV+P  W+DW+  S +++TV+FG Y C GPGA+     S+A++
Sbjct  262   AMGQYSRIVFSYTYFADVVAPGGWDDWDHTSNKNKTVFFGVYKCWGPGAEAVRGVSWARE  321

Query  1358  LDESEAAPFLTTSYIDGEDWLIP  1426
             LD + A PFL  S+++G  W+ P
Sbjct  322   LDYNTAHPFLAKSFVNGRHWIPP  344


 Score = 63.9 bits (154),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 60/119 (50%), Gaps = 11/119 (9%)
 Frame = +3

Query  402  KWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVK  581
            KW  P         VITVD  GC +F SVQ A+++VP+ +    +I I +G Y EKV V 
Sbjct  36   KWVGP-----TGRRVITVDSRGCGDFLSVQAAVESVPENNKEKVIIQIKAGIYIEKVVVP  90

Query  582  KSKINLIIQGQGYLNTAISWNDTA------NstggtsssYTFGAFAPKFIAYNISFQVT  740
             +K+ +  QG+G   T I W+D A           T  + +   FA  F A NISF+ T
Sbjct  91   ATKLFITFQGEGREVTVIEWHDRAADRGPNGQQLRTYKTASVTVFANYFSAKNISFKNT  149



>ref|XP_011025911.1| PREDICTED: probable pectinesterase 53 [Populus euphratica]
Length=360

 Score =   223 bits (568),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 141/201 (70%), Gaps = 5/201 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GA G QA+A+ I  D +AF  C F GAQD L D  GRHYFK+C+I+GS+DF
Sbjct  163   KNKAPLPPSGALGKQAVALRISADTAAFISCKFIGAQDTLYDHIGRHYFKKCYIEGSVDF  222

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLYE+C ++++ N       G++TAQ R S  E++GFSF+ C+V GSG ++LGR
Sbjct  223   IFGNGLSLYEDCHLHAVTNS-----FGALTAQKRQSFLEETGFSFVSCKVTGSGALFLGR  277

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M ++++P  W DW D +R  TV+FG+Y C GPGAD   R +++++L
Sbjct  278   AWGNFSRVVFAYTFMDKIITPRGWYDWGDKSRQMTVFFGQYKCSGPGADFGRRVAWSREL  337

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              + +A PF++  +IDG +WL+
Sbjct  338   TDQQAKPFISIGFIDGHEWLL  358


 Score = 61.2 bits (147),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = +3

Query  477  FASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTAN  656
            F +VQKAI+++P  +    +I I +GTYREKV +  +   + +QG G   T I W+DTA+
Sbjct  73   FPTVQKAINSLPVINNCRVVITIGAGTYREKVEIPATMAYITLQGAGADRTIIEWDDTAD  132

Query  657  stggtsssYTFGA--FA---PKFIAYNISFQ  734
                     TFG+  FA   P FIA +I+F+
Sbjct  133  RMENGRPLGTFGSATFAVNSPYFIAKDITFK  163



>gb|EPS63895.1| pectinesterase, partial [Genlisea aurea]
Length=301

 Score =   224 bits (572),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GA G QA+A+ I  D +AF  C F GAQD L D +GRHYF  C IQGS+DF
Sbjct  107   KNKAPPPPAGAIGKQAVALRISADMAAFLNCKFIGAQDTLYDHKGRHYFNNCHIQGSVDF  166

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLY+ C++++  N       G++TAQ R+S  E++GFSF+ C+V GSG ++LGR
Sbjct  167   IFGDGLSLYDGCRLHAKTNT-----YGALTAQKRESMLEETGFSFVNCQVTGSGALYLGR  221

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWGS++ VVF+ T M ++++P  W DW D  R  TV++G++ C GPGAD   R S+A++L
Sbjct  222   AWGSFSRVVFAYTYMQKIITPRGWYDWGDKQRQMTVFYGQFKCSGPGADYGGRVSWAREL  281

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              E EA PF++ S+IDG DWL
Sbjct  282   TEEEAQPFISLSFIDGHDWL  301


 Score = 59.7 bits (143),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F ++ KAID++P F+P   +I +  G YREK+ +  +   + IQG G   T + W+DT
Sbjct  14   GDFTTLNKAIDSIPLFNPCRAVISVAPGIYREKIEIPATMAYVTIQGSGANKTIVRWDDT  73

Query  651  ANstg------gtsssYTFGAFAPKFIAYNISFQ  734
            A+  G      GT  S TF   AP FIA +I+F+
Sbjct  74   ADKLGPNGQPLGTYGSATFAVNAPYFIAKDITFK  107



>ref|XP_007046753.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046754.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX90910.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX90911.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=362

 Score =   224 bits (571),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GA G QA+A+ I  D +AF GC F GAQD L D  GRHYFK C+I+GS+DF
Sbjct  165   KNKAPSPPSGALGKQAVALRISADTAAFIGCKFIGAQDTLYDHIGRHYFKDCYIEGSVDF  224

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLY +C ++++ N       G++TAQ R+S  E++GFSF+ C+V GSG ++LGR
Sbjct  225   IFGNGLSLYRDCHLHAVTNS-----YGALTAQKRESFLEETGFSFVNCKVTGSGALFLGR  279

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF  T M ++++P  W DW D  R+ TV++G+Y C GPGA+   R S+A++L
Sbjct  280   AWGTFSRVVFVYTYMDKIITPRGWYDWGDKNREMTVFYGQYKCSGPGANFGGRVSWAREL  339

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++  +IDG  WL
Sbjct  340   TQQEAKPFISVDFIDGRSWL  359


 Score = 60.1 bits (144),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 6/94 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
              FA+VQKAI ++P  +    +I I +GTYREKV +  +   + ++G G   T I W+DT
Sbjct  72   GQFATVQKAISSLPVVNNCRVVIYIGAGTYREKVEIPATMAYITLEGAGAGKTVIEWDDT  131

Query  651  ANstggtsssY------TFGAFAPKFIAYNISFQ  734
            A+  G +          TF   +P FIA NI+F+
Sbjct  132  ADRMGQSGRPLGTYGSATFAVNSPYFIAKNITFK  165



>gb|KDP33787.1| hypothetical protein JCGZ_07358 [Jatropha curcas]
Length=383

 Score =   223 bits (569),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A  I  D +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  187   KNTTPVPPPGAIGKQAVAFRISADTAAFLGCRFLGAQDTLYDHLGRHYYKDCYIEGSVDF  246

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SL+E C +++IA       +G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  247   IFGNGLSLFEGCHVHAIAQ-----YTGALTAQGRSSLLEDTGFSFVNCKVTGSGALYLGR  301

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D TR+ TV++G+Y C GPGA  + R S++++L
Sbjct  302   AWGPFSRVVFAYTYMDNIIIPKGWYNWGDPTREMTVFYGQYKCTGPGARFAGRVSWSREL  361

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ SYIDG +W+
Sbjct  362   TDEEAKPFISLSYIDGSEWI  381


 Score = 60.1 bits (144),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGCA-NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ +TVD N  A +F S+Q AID++P  + V  +I + +G Y+EKV +   K  + I+G 
Sbjct  82   SYTLTVDKNPAAGDFTSIQDAIDSLPFINLVRVVIKVHAGVYKEKVNIPPLKSFITIEGA  141

Query  615  GYLNTAISWNDTANstggtsssY------TFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G            TF   +P FIA NI+F+ T
Sbjct  142  GADKTIVEWGDTAQTPGAKGQPMGTYSSATFAVNSPYFIAKNITFKNT  189



>ref|XP_010915072.1| PREDICTED: probable pectinesterase 53 isoform X1 [Elaeis guineensis]
Length=381

 Score =   216 bits (551),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 140/201 (70%), Gaps = 6/201 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A+ I GD +AF GC F G QD L D  GRHY+K C+I+GS+DF
Sbjct  184   KNTTPIPPPGAMGKQAVALRISGDTAAFLGCKFLGGQDTLYDHIGRHYYKDCYIEGSVDF  243

Query  1001  IFGKARSLYEE-CKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLG  1177
             IFG A SL+E+ C +++IA        G++TAQ R S  E +GFSF+ C+V GSG ++LG
Sbjct  244   IFGNALSLFEQGCHVHAIAQN-----YGAVTAQNRMSLLEDTGFSFVNCKVTGSGALYLG  298

Query  1178  RAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             RAWG+++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C GPGA+   R S++++
Sbjct  299   RAWGTFSRVVFAYTYMDDIIIPRGWYNWGDPSREMTVFYGQYKCSGPGANYVGRVSWSRE  358

Query  1358  LDESEAAPFLTTSYIDGEDWL  1420
             L + EA PF++ S+IDG +W+
Sbjct  359   LTDEEAKPFISLSFIDGTEWV  379


 Score = 67.0 bits (162),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 64/111 (58%), Gaps = 7/111 (6%)
 Frame = +3

Query  438  SHVITVDLNGC-ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ +TVD N    +F S+Q AID++P  + V  +I +++GTY+EKV +   K  + I+G 
Sbjct  79   SYTLTVDKNPSKGDFTSIQDAIDSLPFVNLVRVVIKVNAGTYKEKVNISPGKAFITIEGA  138

Query  615  GYLNTAISWNDTANstggtss------sYTFGAFAPKFIAYNISFQVTHHI  749
            G   T + W DTA++ G          S TFG  AP FIA NI+F+ T  I
Sbjct  139  GADKTVVQWGDTADTPGPRGQPIGTFNSATFGVNAPYFIAKNITFKNTTPI  189



>ref|XP_010316821.1| PREDICTED: probable pectinesterase 53 [Solanum lycopersicum]
Length=362

 Score =   225 bits (573),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 136/201 (68%), Gaps = 5/201 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GA G QA+A+ I  D +AF  C F GAQD L D RGRHYFK C+IQGS+DF
Sbjct  165   KNVAPPPPSGALGKQAVALRISADTAAFINCKFIGAQDTLYDHRGRHYFKNCYIQGSVDF  224

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLYE C + +          G++TAQ R+S  E++GFSFL C+V GSG ++LGR
Sbjct  225   IFGDGLSLYENCHLRAKTKS-----YGALTAQKRESLLEETGFSFLNCKVTGSGALYLGR  279

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M ++++   W DW D  R  TV+FG++ C GPGAD   R  ++++L
Sbjct  280   AWGTFSRVVFAYTYMDKIITSKGWYDWGDKNRHMTVFFGQFKCSGPGADHGERVKWSREL  339

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              E EA PF++ S+IDG +WL+
Sbjct  340   TEQEAKPFISLSFIDGHEWLL  360


 Score = 58.2 bits (139),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 6/94 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F +VQKAID++P  +    +I +  GTYREK+ +  +   + ++G     T I W+DT
Sbjct  72   GDFTTVQKAIDSIPIVNSCRVVISVSPGTYREKIEIPATMAYITLEGAASHKTTIKWDDT  131

Query  651  ANstggtsssY------TFGAFAPKFIAYNISFQ  734
            A+ TG +          TF   +P FIA NI+F+
Sbjct  132  ADRTGKSGQPMGTYGSATFAVNSPYFIAKNITFK  165



>ref|XP_008804057.1| PREDICTED: probable pectinesterase 53 [Phoenix dactylifera]
Length=380

 Score =   219 bits (558),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A+ I GD +A  GC F G QD L D  GRHY+K C+I+GS+DF
Sbjct  184   KNTTPIPPPGAMGKQAVALRISGDTAAILGCKFLGGQDTLYDHVGRHYYKDCYIEGSVDF  243

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA        G++TAQ R S  E +GFSF+ C+V GSG ++LGR
Sbjct  244   IFGNALSLFEGCHVHAIAQN-----YGAVTAQNRMSLLEDTGFSFVNCKVTGSGALYLGR  298

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C GPGA+   R S++++L
Sbjct  299   AWGTFSRVVFAYTYMDDIIIPRGWYNWGDPSREMTVFYGQYKCSGPGANYVGRVSWSREL  358

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              E EA PF++ S+IDG +W+
Sbjct  359   TEEEAKPFISLSFIDGTEWI  378


 Score = 63.9 bits (154),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 62/111 (56%), Gaps = 7/111 (6%)
 Frame = +3

Query  438  SHVITVDLNGC-ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ +TVD N    +F+S+Q AID++P  + V  +I + +G Y+EKV +  ++  + I+G 
Sbjct  79   SYTLTVDKNPSKGDFSSIQNAIDSLPSVNLVRVMIKVHAGIYKEKVNISPARAFITIEGA  138

Query  615  GYLNTAISWNDTANstggtsssY------TFGAFAPKFIAYNISFQVTHHI  749
            G   T + W DTA++ G            TF   AP FIA NI+F+ T  I
Sbjct  139  GADETVVQWGDTADTPGPKGQPMGTFNSATFAVNAPYFIAKNITFKNTTPI  189



>ref|XP_011100946.1| PREDICTED: probable pectinesterase 53 [Sesamum indicum]
Length=369

 Score =   223 bits (567),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GATG QA+A+ I  D +AF  C F GAQD L D +GRHYFK C IQGS+DF
Sbjct  172   KNKAPPPPAGATGKQAVALRISADMAAFINCKFIGAQDTLYDHKGRHYFKNCHIQGSVDF  231

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLY++C +++          G++TAQ R+S  E++GFSF+ C+V GSG ++LGR
Sbjct  232   IFGDGLSLYQDCHLHAKTKS-----YGALTAQKRESMLEETGFSFVNCKVTGSGALYLGR  286

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M ++++P  W DW D  R  TV++G++ C GPGAD   R S+A++L
Sbjct  287   AWGTFSRVVFAYTYMDKIITPRGWYDWGDKQRQMTVFYGQFKCSGPGADYGGRVSWAREL  346

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG  WL
Sbjct  347   TKQEAEPFISLSFIDGHQWL  366


 Score = 60.1 bits (144),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
            A+F ++  AI ++P F+P   LI +  GTYREK+ +  +   + ++G G   T I W+DT
Sbjct  79   AHFTTLDAAISSIPLFNPCRLLISVGPGTYREKIEIPMTMAYVTLEGAGAGKTIIRWDDT  138

Query  651  ANstg------gtsssYTFGAFAPKFIAYNISFQ  734
            A+  G      GT  S TF   AP F+A NI+F+
Sbjct  139  ADRVGPNGQPLGTYGSATFAVNAPYFVAKNITFK  172



>ref|XP_007160279.1| hypothetical protein PHAVU_002G308000g [Phaseolus vulgaris]
 gb|ESW32273.1| hypothetical protein PHAVU_002G308000g [Phaseolus vulgaris]
Length=376

 Score =   224 bits (572),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P+ GA G QA+A+ I  D + F GC F GAQD L DQ GRHY+K C+I+GS+DF
Sbjct  178   KNTAPIPAPGAVGKQAVALRISADNAIFLGCKFLGAQDTLYDQLGRHYYKDCYIEGSVDF  237

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA      ++G++TAQGR S  + +GFSF+ C+V GSG ++LGR
Sbjct  238   IFGNALSLFEGCHVHAIAQ-----VTGALTAQGRSSLLQDTGFSFVHCKVTGSGALYLGR  292

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C G GA  + R S++++L
Sbjct  293   AWGPFSRVVFAYTYMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGAGASYAGRVSWSREL  352

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ SYIDG +W+
Sbjct  353   TDEEAKPFISLSYIDGSEWI  372


 Score = 58.2 bits (139),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
              F+S+Q AID++P  + V  +I + +G Y EKV +   K  + IQG G  NT + W DT
Sbjct  90   GGFSSIQAAIDSLPFINVVRVVIKVHAGVYTEKVNIPPLKSFITIQGAGADNTIVQWGDT  149

Query  651  ANst-ggtsssYTFGAFAPKFIAYNISFQVT  740
            A S   GT  S TF   +P FIA NI+F+ T
Sbjct  150  AQSQPLGTYGSATFAVNSPFFIAKNITFKNT  180



>gb|KHG28220.1| putative pectinesterase 53 -like protein [Gossypium arboreum]
Length=361

 Score =   228 bits (580),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 136/200 (68%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GA G QA+A+ I  D SAF GC F GAQD L D  GRHYF+ C+IQGS+DF
Sbjct  164   KNKAPLPPSGALGKQAVALRISADASAFIGCKFIGAQDTLYDHIGRHYFRHCYIQGSVDF  223

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLY+ C ++ + N       G++TAQ R+S  E++GFSF+KC+V GSG ++LGR
Sbjct  224   IFGNGLSLYKHCHLHVVTNS-----YGALTAQKRESMLEETGFSFVKCKVTGSGALYLGR  278

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF  T M ++++P  W DW D  R+ TV++G+Y C GPGA+   R S+A++L
Sbjct  279   AWGVFSRVVFVYTYMDKIITPRGWYDWGDKNREMTVFYGQYKCSGPGAEFGGRVSWAREL  338

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
                EA PF++  +IDG  WL
Sbjct  339   TRQEAKPFISIDFIDGHSWL  358


 Score = 54.7 bits (130),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 51/93 (55%), Gaps = 6/93 (6%)
 Frame = +3

Query  474  NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTA  653
             FA+V+KAI ++P  +    +I I +G YREK+ +  +   + I G G   T I W+DTA
Sbjct  72   EFATVKKAISSIPVVNHCRVVISIGAGIYREKIEIPATMAYITIVGAGADKTVIEWDDTA  131

Query  654  NstggtsssY------TFGAFAPKFIAYNISFQ  734
            +  G +  S       TF   +P FIA NI+F+
Sbjct  132  DKMGQSGHSLGTYGSATFAINSPYFIAENITFK  164



>ref|XP_006425546.1| hypothetical protein CICLE_v10027321mg [Citrus clementina]
 ref|XP_006467156.1| PREDICTED: probable pectinesterase 53-like [Citrus sinensis]
 gb|ESR38786.1| hypothetical protein CICLE_v10027321mg [Citrus clementina]
Length=366

 Score =   221 bits (563),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 137/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GA G QA+A  I  D +AF GC F G+QD L D  GRHYFK C+I+GS+DF
Sbjct  167   KNKAPLPPSGALGKQAVAFRISADTAAFTGCKFIGSQDTLYDHIGRHYFKNCYIEGSVDF  226

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   S YE+C +++I N       G++TAQ R S  E++GFSF+KC+V GSG ++LGR
Sbjct  227   IFGNGLSFYEDCHLHAITNS-----YGALTAQKRGSLLEETGFSFVKCKVTGSGALYLGR  281

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M ++++P  W DW D  R+ TV++G+Y C GPGA    R S++++L
Sbjct  282   AWGTFSRVVFAYTYMDKIITPRGWYDWGDKNREMTVFYGQYKCSGPGAYYGGRVSWSREL  341

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++  +IDG  WL
Sbjct  342   TQEEAEPFISVEFIDGHQWL  361


 Score = 61.2 bits (147),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 6/94 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             NF +VQKAI+++P  +    +I I +GTYREKV +  +   + + G G  NT I W+DT
Sbjct  74   GNFVTVQKAINSLPVINLCRVVIFISAGTYREKVEIPTTMAYITMIGAGADNTVIEWDDT  133

Query  651  ANstg------gtsssYTFGAFAPKFIAYNISFQ  734
            A+  G      GT +S TF   +P FIA NI+F+
Sbjct  134  ADRMGRSGRPLGTYASATFAVNSPYFIAKNITFK  167



>ref|XP_008657240.1| PREDICTED: probable pectinesterase 53 [Zea mays]
 gb|AFW85118.1| hypothetical protein ZEAMMB73_006796 [Zea mays]
Length=395

 Score =   224 bits (571),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 142/201 (71%), Gaps = 5/201 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT+P P  GATG QA+A+ +  D +AF GC F GAQD L D  GRHY+K+C+IQGS+DF
Sbjct  199   KNTSPVPRPGATGKQAVALRVSADNAAFVGCSFLGAQDTLYDHSGRHYYKECYIQGSVDF  258

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE+C +++IA +      G++TAQ R S  E +GFSF+ C V GSG ++LGR
Sbjct  259   IFGNALSLYEDCHVHAIALD-----YGALTAQNRQSMLEDTGFSFVNCRVTGSGALYLGR  313

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  + R +++ +L
Sbjct  314   AWGTFSRVVFAYTYMDDIIIPKGWYNWGDPNRELTVFYGQYKCTGPGATYAGRVAWSHEL  373

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              + EA PF++ ++IDG +W++
Sbjct  374   TDDEARPFVSLNFIDGNEWIM  394


 Score = 57.8 bits (138),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +3

Query  438  SHVITVDLNGC-ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ + VD N    +F ++Q A+D++PD + V  +I ++ GTY EKV++   +  + ++G 
Sbjct  93   SYSLVVDANPAFGDFTTIQAAVDSLPDMNLVRVVIRVNPGTYTEKVSISAMRAFITLEGA  152

Query  615  GYLNTAISWNDTANstggtss-------sYTFGAFAPKFIAYNISFQVTHHILR  755
            G  +T + W DTA+S  G          S +F   A  F+A NI+F+ T  + R
Sbjct  153  GADSTIVQWGDTADSPTGAKGRPLGTFNSASFAVNAQYFLARNITFKNTSPVPR  206



>ref|XP_006340937.1| PREDICTED: probable pectinesterase 53-like [Solanum tuberosum]
Length=355

 Score =   221 bits (563),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 135/201 (67%), Gaps = 5/201 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GA   QA+A+ I  D +AF  C F GAQD L D RGRHYFK C+IQGS+DF
Sbjct  158   KNVAPPPPSGALRKQAVALRISADTAAFINCKFIGAQDTLYDHRGRHYFKNCYIQGSVDF  217

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLYE C + +          G++TAQ R+S  E++GFSFL C+V GSG ++LGR
Sbjct  218   IFGDGLSLYENCHLRAKTKS-----YGALTAQKRESLLEETGFSFLNCKVTGSGALYLGR  272

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M ++++   W DW D  R  TV++G++ C GPGAD   R  ++++L
Sbjct  273   AWGTFSRVVFAYTYMDKIITSKGWYDWGDKNRHMTVFYGQFKCSGPGADHGERVKWSREL  332

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              E EA PF++ S+IDG +WL+
Sbjct  333   TEQEAKPFISLSFIDGHEWLL  353


 Score = 60.8 bits (146),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F +VQKAID++P  +    +I +  GTYREK+ +  +   + ++G G   T I W+DT
Sbjct  65   GDFTTVQKAIDSIPIVNSCRVVISVSPGTYREKIEIPATMAYITLEGAGSHKTTIKWDDT  124

Query  651  ANstggtsssY------TFGAFAPKFIAYNISFQ  734
            A+ TG +          TF   +P FIA NI+F+
Sbjct  125  ADRTGKSGQPMGTYGSATFAVNSPYFIAKNITFK  158



>ref|XP_002458469.1| hypothetical protein SORBIDRAFT_03g034250 [Sorghum bicolor]
 gb|EES03589.1| hypothetical protein SORBIDRAFT_03g034250 [Sorghum bicolor]
Length=402

 Score =   226 bits (575),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 143/202 (71%), Gaps = 5/202 (2%)
 Frame = +2

Query  815   GGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSI  994
              G+NT+P P  GATG QA+A+ +  D +AF GC F GAQD L D  GRHY+K+C+I+GS+
Sbjct  204   AGQNTSPVPKPGATGKQAVALRVSADNAAFVGCKFLGAQDTLYDHSGRHYYKECYIEGSV  263

Query  995   DFIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             DFIFG A SLYE+C +++IA +      G++TAQ R S  E +GFSF+ C V GSG ++L
Sbjct  264   DFIFGNALSLYEDCHVHAIARD-----YGALTAQNRQSMLEDTGFSFVNCRVTGSGALYL  318

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAWG+++ VVF+ T M  ++ P+ W +W D  R+ TV++G+Y C GPGA  + R +++ 
Sbjct  319   GRAWGTFSRVVFAYTYMDNIIIPNGWYNWGDPNRELTVFYGQYKCTGPGASYAGRVAWSH  378

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L + EA PF++ S+IDG +W+
Sbjct  379   ELTDDEAKPFISLSFIDGTEWI  400


 Score = 56.2 bits (134),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 62/110 (56%), Gaps = 8/110 (7%)
 Frame = +3

Query  438  SHVITVDLNGC-ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ + VD N    +F ++Q AID++P  + V  +I +++GTY EKV++   +  + ++G 
Sbjct  92   SYSLVVDKNPAFGDFTTIQAAIDSLPVINLVRVVIRVNAGTYTEKVSISAMRAFITLEGA  151

Query  615  GYLNTAISWNDTANstggtss-------sYTFGAFAPKFIAYNISFQVTH  743
            G  +T + W DTA+S  G          S TF   A  F+A NI+F++ H
Sbjct  152  GADSTIVQWGDTADSPTGPKGRPLGTFNSATFAVNAQYFLARNITFKLWH  201



>gb|EYU24077.1| hypothetical protein MIMGU_mgv1a008262mg [Erythranthe guttata]
Length=379

 Score =   218 bits (556),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN +P P  GA G QA+A+ I  D +AF  C F GAQD L D +GRHYFK C IQGS+DF
Sbjct  182   KNKSPAPLAGAIGKQAVALRISADMAAFINCKFVGAQDTLYDHKGRHYFKNCHIQGSVDF  241

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLY+ C +++  N       G++TAQ R+S  +++GFSF+ C+V G+G ++LGR
Sbjct  242   IFGDGLSLYDSCHLHAKTNN-----YGALTAQKRESMLDETGFSFVNCKVTGNGALYLGR  296

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWGS++ VVF+ T M ++++P  W DW D  R  TV++G++ C GPGA+   R S+A++L
Sbjct  297   AWGSFSRVVFAFTYMDKIITPRGWYDWGDKQRHMTVFYGQFKCSGPGANYGGRVSWAREL  356

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +WL
Sbjct  357   TKQEAQPFVSLSFIDGHEWL  376


 Score = 63.5 bits (153),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (60%), Gaps = 6/94 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F +V+KAI+++P F+P   +I +  GTYREK+ +  S   + ++G G   T I W+DT
Sbjct  89   GDFTTVKKAINSIPLFNPCRVVISVSPGTYREKIEIPASMAYVTLEGSGAAKTIIRWDDT  148

Query  651  AN------stggtsssYTFGAFAPKFIAYNISFQ  734
            A+      +  GT  S TF   AP F+A NI+F+
Sbjct  149  ADRIGPNGAALGTYGSATFAVNAPFFLARNITFK  182



>ref|XP_010679844.1| PREDICTED: probable pectinesterase 53 [Beta vulgaris subsp. vulgaris]
Length=385

 Score =   225 bits (573),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P+ GA G QA+A+ I  D++AF GC F G QD L D  GRHYF++C+I+GS+DF
Sbjct  187   KNTAPSPASGAQGKQAVALRISADKAAFIGCKFIGEQDTLYDHIGRHYFRECYIEGSVDF  246

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             +FG   SLY+ C +++++N       G++TAQ R+S  E++GFSFL C + GSG ++LGR
Sbjct  247   VFGNGLSLYDNCHLHAVSNN-----YGALTAQKRESFLEETGFSFLNCTITGSGALYLGR  301

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M ++++P  W DW D  RD TV++G+Y C GPGAD   R S++++L
Sbjct  302   AWGTFSRVVFAYTYMDKIIAPGGWYDWGDKNRDTTVFYGQYKCSGPGADHGVRVSWSREL  361

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
                EA PF++  +IDG++WL
Sbjct  362   TTQEAQPFISYDFIDGDEWL  381


 Score = 56.2 bits (134),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 54/95 (57%), Gaps = 6/95 (6%)
 Frame = +3

Query  474  NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTA  653
            ++ASVQ+AI+++P  +    +I I  GTYREKV V  +   + ++G G   T I W+DTA
Sbjct  95   HYASVQEAINSLPISNLCRVVISIGPGTYREKVEVPVTMAYIKLKGAGAEKTIIEWDDTA  154

Query  654  NstggtsssY------TFGAFAPKFIAYNISFQVT  740
            +  G +          TF   +P FIA NI+F+ T
Sbjct  155  DRLGQSGQPLGTKNSATFAVNSPYFIAKNITFKNT  189



>ref|XP_004503496.1| PREDICTED: probable pectinesterase 53-like [Cicer arietinum]
Length=385

 Score =   226 bits (575),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 140/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P+ GA G QA+A+ I  D + F GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  187   KNTAPVPAPGAVGKQAVALRISADTAIFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDF  246

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA       +G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  247   IFGNALSLFEGCHVHAIAIN-----TGALTAQGRSSLLEDTGFSFVHCKVTGSGALYLGR  301

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  + R S++++L
Sbjct  302   AWGPFSRVVFAYTYMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGPGASYAGRVSWSREL  361

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ SYIDG +W+
Sbjct  362   TDEEAKPFISLSYIDGSEWI  381


 Score = 55.5 bits (132),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 8/101 (8%)
 Frame = +3

Query  462  NGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISW  641
            +G   F+S+Q AID++P  + V  +I + +G Y EKV +   K  + I+G G   T + W
Sbjct  89   SGKGGFSSIQAAIDSLPFINLVRVVIKVHAGVYTEKVNIPALKAFITIEGAGADKTIVQW  148

Query  642  NDTANstggtsssYTFGAFA--------PKFIAYNISFQVT  740
             DTA +    +   T G +         P FIA N++F+ T
Sbjct  149  GDTAQTPNPAAKGQTLGTYGSATFAVNSPYFIAKNMTFKNT  189



>ref|XP_003524409.1| PREDICTED: probable pectinesterase 53-like [Glycine max]
Length=375

 Score =   225 bits (573),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 140/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P+ GA G Q +A+ I  D + F GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  177   KNTAPIPAPGAVGKQGVALRISADTAVFQGCKFLGAQDTLYDHIGRHYYKDCYIEGSVDF  236

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA      ++G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  237   IFGNALSLFEGCHVHAIAQ-----LTGALTAQGRSSLLEDTGFSFVHCKVTGSGALYLGR  291

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  + R S++++L
Sbjct  292   AWGPFSRVVFAYTYMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGPGASYAGRVSWSREL  351

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ SYIDG +W+
Sbjct  352   TDEEAKPFISLSYIDGSEWI  371


 Score = 56.2 bits (134),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 2/103 (2%)
 Frame = +3

Query  438  SHVITVDL-NGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            SH + V   +G   F+S+Q AID++P  + V  +I + +G Y EKV +   K  + IQG+
Sbjct  77   SHTLHVSKKHGKGGFSSIQAAIDSLPFINVVRVVIKVHAGVYTEKVNISPFKSFITIQGE  136

Query  615  GYLNTAISWNDTANst-ggtsssYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA S   GT  S TF   +  FIA NI+F+ T
Sbjct  137  GADKTIVQWGDTAQSQPLGTYGSATFAVNSAYFIAKNITFKNT  179



>ref|XP_010656255.1| PREDICTED: probable pectinesterase 53 [Vitis vinifera]
Length=379

 Score =   226 bits (577),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P+ GA G QA+A  I GD +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  183   KNTTPVPAPGAVGKQAVAFRISGDTAAFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDF  242

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA       +G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  243   IFGNALSLFEGCHVHAIAQN-----TGALTAQGRSSLLEDTGFSFVNCKVTGSGALFLGR  297

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C GPGA  + R S++++L
Sbjct  298   AWGPFSRVVFAYTYMDDIIIPKGWYNWGDPSREMTVFYGQYKCTGPGAAFAGRVSWSREL  357

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ SYIDG +W+
Sbjct  358   TDQEAKPFISLSYIDGSEWI  377


 Score = 54.7 bits (130),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGCA-NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ ITV+ N  A +F S+Q AID++P  + V  +I + +G Y EKV +   K  + I+G 
Sbjct  78   SYAITVNKNSAAGDFRSIQDAIDSLPSINLVRVVIKVHAGVYTEKVNIPAFKSFITIEGA  137

Query  615  GYLNTAISWNDTANstggtss------sYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G          S TF   +  FIA NI+F+ T
Sbjct  138  GADKTVVQWGDTARTIGEKGQPIGTFNSATFAVNSLYFIAKNITFKNT  185



>emb|CAN63186.1| hypothetical protein VITISV_037092 [Vitis vinifera]
Length=379

 Score =   226 bits (577),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P+ GA G QA+A  I GD +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  183   KNTTPVPAPGAVGKQAVAFRISGDTAAFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDF  242

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA       +G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  243   IFGNALSLFEGCHVHAIAQN-----TGALTAQGRSSLLEDTGFSFVNCKVTGSGALFLGR  297

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C GPGA  + R S++++L
Sbjct  298   AWGPFSRVVFAYTYMDDIIIPKGWYNWGDPSREMTVFYGQYKCTGPGAAFAGRVSWSREL  357

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ SYIDG +W+
Sbjct  358   TDQEAKPFISLSYIDGSEWI  377


 Score = 54.7 bits (130),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGCA-NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ ITV+ N  A +F S+Q AID++P  + V  +I + +G Y EKV +   K  + I+G 
Sbjct  78   SYAITVNKNSAAGDFRSIQDAIDSLPSINLVRVVIKVHAGVYTEKVNIPXFKSFITIEGA  137

Query  615  GYLNTAISWNDTANstggtss------sYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G          S TF   +  FIA NI+F+ T
Sbjct  138  GADKTVVQWGDTARTIGEKGQPIGTFNSATFAVNSLYFIAKNITFKNT  185



>emb|CBI27989.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   227 bits (578),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P+ GA G QA+A  I GD +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  117   KNTTPVPAPGAVGKQAVAFRISGDTAAFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDF  176

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA       +G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  177   IFGNALSLFEGCHVHAIAQN-----TGALTAQGRSSLLEDTGFSFVNCKVTGSGALFLGR  231

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C GPGA  + R S++++L
Sbjct  232   AWGPFSRVVFAYTYMDDIIIPKGWYNWGDPSREMTVFYGQYKCTGPGAAFAGRVSWSREL  291

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ SYIDG +W+
Sbjct  292   TDQEAKPFISLSYIDGSEWI  311


 Score = 53.9 bits (128),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGCA-NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ ITV+ N  A +F S+Q AID++P  + V  +I + +G Y EKV +   K  + I+G 
Sbjct  12   SYAITVNKNSAAGDFRSIQDAIDSLPSINLVRVVIKVHAGVYTEKVNIPAFKSFITIEGA  71

Query  615  GYLNTAISWNDTANstggtss------sYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G          S TF   +  FIA NI+F+ T
Sbjct  72   GADKTVVQWGDTARTIGEKGQPIGTFNSATFAVNSLYFIAKNITFKNT  119



>ref|XP_009399936.1| PREDICTED: probable pectinesterase 68 [Musa acuminata subsp. 
malaccensis]
Length=344

 Score =   219 bits (557),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 141/204 (69%), Gaps = 6/204 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  G  G QA A  I GD++ F+GCGFYGAQD L D  GRHYFK C+I+GSIDF
Sbjct  144   KNTAPAPMPGMEGWQAAAFRISGDKAYFFGCGFYGAQDTLCDDAGRHYFKDCYIEGSIDF  203

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RS+Y++C+++SIAN       GS+ AQ R+S  E++GF+F+ C V GSGK+++GR
Sbjct  204   IFGNGRSMYKDCQLHSIANR-----FGSVAAQDRNSPCERTGFAFVNCRVTGSGKLYVGR  258

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWN-DSTRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             A G Y+ +VF+ T    VV+P  W+DWN +S +++T +FG Y C GPGA      S+A++
Sbjct  259   AMGQYSRIVFAYTYFDDVVAPGGWDDWNHNSNKNKTAFFGVYRCYGPGAAAVRGVSWARE  318

Query  1358  LDESEAAPFLTTSYIDGEDWLIPT  1429
             LD   A PFL  S+++G  WL P+
Sbjct  319   LDFETARPFLVKSFVNGRHWLGPS  342


 Score = 62.0 bits (149),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 59/119 (50%), Gaps = 11/119 (9%)
 Frame = +3

Query  402  KWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVK  581
            KW  P        H I VD NG  +F SVQ+A+D+VP+ +    +I I +G Y EKV V 
Sbjct  33   KWFEP-----TSQHTIVVDANGSGDFLSVQEAVDSVPENNTKRVIIHIHAGCYIEKVVVP  87

Query  582  KSKINLIIQGQGYLNTAISWNDTA------NstggtsssYTFGAFAPKFIAYNISFQVT  740
             +K  +  QG G   T I W+D A           T ++ +   FA  F A NISF+ T
Sbjct  88   ATKPYVTFQGAGRNVTVIEWHDRASDRGPNGQQLRTYNTASVTVFANHFSAKNISFKNT  146



>ref|XP_010264302.1| PREDICTED: probable pectinesterase 68 [Nelumbo nucifera]
Length=362

 Score =   216 bits (549),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 140/203 (69%), Gaps = 6/203 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  G  G QA A  I GD++ F GCGFYGAQD L D  GRHYFK+C+I+GSIDF
Sbjct  162   KNTAPAPMPGMEGWQAAAFRISGDKAYFSGCGFYGAQDTLCDDAGRHYFKECYIEGSIDF  221

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RS+Y+EC+++SIA        GSI AQ R S +E++GF+F++C V G+G +++GR
Sbjct  222   IFGNGRSMYKECELHSIATR-----FGSIAAQDRKSPQERTGFAFVRCRVTGTGPLYVGR  276

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWND-STRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             A G Y+ ++FS T  + VV+P  W+DW+  S +++TV+FG Y C GPGA      ++A++
Sbjct  277   AMGQYSRIIFSYTYFADVVAPGGWDDWDHTSNKNKTVFFGVYKCWGPGAYAVRGVTWARE  336

Query  1358  LDESEAAPFLTTSYIDGEDWLIP  1426
             LD   A PFL  S+++G  W+ P
Sbjct  337   LDYKTAHPFLAKSFVNGRHWIAP  359


 Score = 64.7 bits (156),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 60/119 (50%), Gaps = 11/119 (9%)
 Frame = +3

Query  402  KWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVK  581
            KW  P         VITVD  GC +F SVQ A+++VP+ +    +I I +G Y EKV V 
Sbjct  51   KWVGP-----TGRRVITVDARGCGDFLSVQAAVESVPENNRENVIIQIKAGVYIEKVVVP  105

Query  582  KSKINLIIQGQGYLNTAISWNDTA------NstggtsssYTFGAFAPKFIAYNISFQVT  740
             +K  +  QG+G   T I W+D A           T ++ +   FA  F A NISF+ T
Sbjct  106  ATKPFITFQGEGREETVIEWHDRAGDRGPNGQQLRTYNTASVTVFANYFTARNISFKNT  164



>ref|XP_002961718.1| hypothetical protein SELMODRAFT_76693 [Selaginella moellendorffii]
 gb|EFJ36978.1| hypothetical protein SELMODRAFT_76693 [Selaginella moellendorffii]
Length=329

 Score =   216 bits (551),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 140/207 (68%), Gaps = 5/207 (2%)
 Frame = +2

Query  800   VNGFLGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCF  979
             +  ++  +N AP+P  GA   QA+A+ + GD +AFY CGFYGAQD L D  GRHYF+ C+
Sbjct  125   IAKYISFRNNAPRPPPGAFNRQAVAVLVAGDMAAFYSCGFYGAQDTLFDYEGRHYFRDCY  184

Query  980   IQGSIDFIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGS  1159
             I+GSIDFIFG A+S+++ C++++IA+       GS+TAQ R    E SGF F+ C V GS
Sbjct  185   IEGSIDFIFGHAKSVFKACELHAIADS-----FGSVTAQNRGDPRENSGFIFIACTVTGS  239

Query  1160  GKVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNR  1339
             G ++LGRAWG+Y+ VV+  T M   V  + WNDW  ++R +TVY+G+Y C GPGA+   R
Sbjct  240   GTIFLGRAWGAYSRVVYLFTYMDSNVVSEGWNDWGVASRQETVYYGQYKCFGPGANELGR  299

Query  1340  SSYAKQLDESEAAPFLTTSYIDGEDWL  1420
               ++ +L + EA PFL  ++IDG  WL
Sbjct  300   VRWSHELTDEEARPFLQVNFIDGVQWL  326


 Score = 63.9 bits (154),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query  477  FASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTAN  656
            F S+Q AIDAVP  +    +I + +G Y+EK+ +   K  +++QG G   T ISW+DTA+
Sbjct  48   FRSIQAAIDAVPVGNQHWVIIQVGAGVYQEKITIPYMKPYILLQGAGRDFTTISWSDTAS  107

Query  657  stggtsssYTFGAFAPKFIAYNISFQ  734
            + G  +S+ TF AFAP FIA  ISF+
Sbjct  108  TFGTANSA-TFSAFAPNFIAKYISFR  132



>ref|XP_009402793.1| PREDICTED: probable pectinesterase 53 [Musa acuminata subsp. 
malaccensis]
Length=379

 Score =   219 bits (557),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A+ +  D + F GC   GAQD L D  GRHY+K C+I+GS+DF
Sbjct  183   KNTTPVPPPGAMGKQAVALRVSADAATFVGCNILGAQDTLYDHFGRHYYKDCYIEGSVDF  242

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C+++++A        G++TAQ R +  E +GFSF++C+V GSG ++LGR
Sbjct  243   IFGNALSLYEGCRVHAVARN-----YGAVTAQNRMNLLEDTGFSFVRCKVTGSGALYLGR  297

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ V+F+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  + R S++++L
Sbjct  298   AWGTFSRVIFAYTYMDAIIVPRGWYNWGDPNREMTVFYGQYKCSGPGASYAGRVSWSREL  357

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF+T S+IDG +W+
Sbjct  358   TDEEAKPFITLSFIDGSEWV  377


 Score = 61.2 bits (147),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 61/108 (56%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGCA-NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S  +TVD N  A +F ++Q A+D++P  + V  +I +++GTY EKV +   +  + IQG 
Sbjct  78   SRALTVDKNPSAGDFTTIQAAVDSLPLINLVRVVIKVNAGTYTEKVRISPMRAFVTIQGA  137

Query  615  GYLNTAISWNDTANstggtss------sYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G T        S TF   AP F+A NI+F+ T
Sbjct  138  GAGKTVVQWGDTAETLGPTGQPIGTFNSATFAVNAPYFMAKNITFKNT  185



>ref|XP_002964788.1| hypothetical protein SELMODRAFT_83442 [Selaginella moellendorffii]
 gb|EFJ33626.1| hypothetical protein SELMODRAFT_83442 [Selaginella moellendorffii]
Length=329

 Score =   218 bits (554),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 140/207 (68%), Gaps = 5/207 (2%)
 Frame = +2

Query  800   VNGFLGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCF  979
             +  ++  +N AP+P  GA   QA+A+ + GD +AFY CGFYGAQD L D  GRHYF+ C+
Sbjct  125   IAKYISFRNNAPRPPPGAFNRQAVAVLVAGDMAAFYSCGFYGAQDTLFDYEGRHYFRDCY  184

Query  980   IQGSIDFIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGS  1159
             I+GSIDFIFG A+S+++ C++++IA+       GS+TAQ R    E SGF F+ C V GS
Sbjct  185   IEGSIDFIFGHAKSVFKACELHAIADS-----FGSVTAQNRGDPRENSGFIFIACTVTGS  239

Query  1160  GKVWLGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNR  1339
             G ++LGRAWG+Y+ VV+  T M   V  + WNDW  ++R QTVY+G+Y C GPGA+   R
Sbjct  240   GTIFLGRAWGAYSRVVYLFTYMDSNVVSEGWNDWGVASRQQTVYYGQYKCFGPGANELGR  299

Query  1340  SSYAKQLDESEAAPFLTTSYIDGEDWL  1420
               ++ +L + EA PFL  ++IDG  WL
Sbjct  300   VRWSHELTDEEARPFLQVNFIDGVQWL  326


 Score = 62.4 bits (150),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query  477  FASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTAN  656
            F S+Q AIDAVP  +    +I + +G Y+EK+ +   K  +++QG G   T ISW+D+A+
Sbjct  48   FRSIQAAIDAVPVGNQHWVIIQVGAGVYQEKITIPYMKPYILLQGAGRDFTTISWSDSAS  107

Query  657  stggtsssYTFGAFAPKFIAYNISFQ  734
            + G  +S+ TF AFAP FIA  ISF+
Sbjct  108  TFGTANSA-TFSAFAPNFIAKYISFR  132



>ref|XP_009599854.1| PREDICTED: probable pectinesterase 53 [Nicotiana tomentosiformis]
Length=372

 Score =   221 bits (563),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 137/201 (68%), Gaps = 5/201 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GA G QA+A+ I  D +AF  C F GAQD L D RGRHYFK C+IQGS+DF
Sbjct  175   KNVAPPPPSGALGKQAVALRISADTAAFINCKFIGAQDTLYDHRGRHYFKNCYIQGSVDF  234

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLYE C +++          G++TAQ R+S  E++GFSF+ C+V GSG ++LGR
Sbjct  235   IFGDGLSLYENCHLHAKTKS-----YGALTAQKRESMLEETGFSFVNCKVTGSGALYLGR  289

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M ++++   W DW D  R  TV++G++ C GPGA+   R  ++++L
Sbjct  290   AWGTFSRVVFAYTYMDKIITSKGWYDWGDKNRHMTVFYGQFKCSGPGANHGGRVKWSREL  349

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              E EA PF++ S+IDG +WL+
Sbjct  350   TEQEAKPFVSLSFIDGHEWLL  370


 Score = 58.5 bits (140),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 6/94 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F +VQKAID++P  +    +I +  G YREK+ +  +   + ++G G   T I W+DT
Sbjct  82   GDFTTVQKAIDSIPIVNSCRVVISVSPGIYREKIEIPATMAYITLEGAGSRKTTIKWDDT  141

Query  651  ANst------ggtsssYTFGAFAPKFIAYNISFQ  734
            A+         GT  S TF   +P FIA NI+F+
Sbjct  142  ADRLGKDGQPMGTYGSATFAVNSPYFIAKNITFK  175



>ref|XP_004969916.1| PREDICTED: probable pectinesterase 53-like [Setaria italica]
Length=403

 Score =   225 bits (574),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 142/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT+P P  GATG QA+A+ +  D +AF GC F GAQD L D  GRHY+K+C+I+GS+DF
Sbjct  207   KNTSPVPKPGATGKQAVALRVSADNAAFVGCKFLGAQDTLYDHSGRHYYKECYIEGSVDF  266

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE+C +++IA +      G++TAQ R S  E +GFSF+ C V GSG ++LGR
Sbjct  267   IFGNALSLYEDCHVHAIARD-----YGALTAQNRQSMLEDTGFSFVNCRVTGSGALYLGR  321

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  + R +++++L
Sbjct  322   AWGTFSRVVFAYTYMDNIIIPRGWYNWGDPNRELTVFYGQYKCTGPGASYAGRVAWSREL  381

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  382   TDDEAKPFISLSFIDGTEWV  401


 Score = 53.9 bits (128),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 60/109 (55%), Gaps = 8/109 (7%)
 Frame = +3

Query  438  SHVITVDLNGC-ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ + VD N    +F ++Q AID++P  + V  +I +++GTY EKV +   +  + ++G 
Sbjct  101  SYSLVVDKNPAFGDFTTIQAAIDSLPAINLVRVVIRVNAGTYTEKVTISAMRAFITLEGA  160

Query  615  GYLNTAISWNDTANstggtss-------sYTFGAFAPKFIAYNISFQVT  740
            G  +T + W DTA+S  G          S TF   A  F+A NI+F+ T
Sbjct  161  GADSTIVQWGDTADSPTGPKGRPLGTFNSATFAVNAQYFLARNITFKNT  209



>ref|XP_006475589.1| PREDICTED: probable pectinesterase 53-like isoform X1 [Citrus 
sinensis]
Length=379

 Score =   224 bits (572),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 140/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P+ GA G QA+A  I  D + F+GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  183   KNTTPVPAPGAVGKQAVAFRISADTATFWGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDF  242

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA       +G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  243   IFGNALSLFEGCHVHAIAQ-----YTGALTAQGRSSLLEDTGFSFVNCKVTGSGALYLGR  297

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C+GPGA  + R S+A++L
Sbjct  298   AWGPFSRVVFAYTYMDNIIIPKGWYNWGDPNREMTVFYGQYKCKGPGASFAGRVSWAREL  357

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  358   TDEEAKPFISLSFIDGSEWI  377


 Score = 55.1 bits (131),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 61/108 (56%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGCA-NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            ++ +TV  N  A +F  +Q AID++P  + V  +I + +G Y+EKV +   K  + I+G 
Sbjct  78   AYTLTVAKNPAAGDFTKIQDAIDSLPFINLVRVVIKVHAGVYKEKVNIPPFKSFITIEGA  137

Query  615  GYLNTAISWNDTANstg------gtsssYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G      GT +S TF   AP FIA NI+F+ T
Sbjct  138  GADKTIVQWGDTAQTRGPRGQPIGTWASATFAVNAPYFIAKNITFKNT  185



>ref|XP_002514210.1| Pectinesterase PPE8B precursor, putative [Ricinus communis]
 gb|EEF48164.1| Pectinesterase PPE8B precursor, putative [Ricinus communis]
Length=383

 Score =   220 bits (560),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 137/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A  I  D + F GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  187   KNTTPVPPPGAIGKQAVAFRISADTAVFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDF  246

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SL+E C +++IA       +G++TAQGR S  + +GFSF+ C+V GSG ++LGR
Sbjct  247   IFGNGLSLFEGCHVHAIAQY-----TGALTAQGRSSILDDTGFSFVNCKVTGSGALYLGR  301

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D TR+ TV++G+Y C GPGA  + R S++++L
Sbjct  302   AWGPFSRVVFAYTYMDNIIIPKGWYNWGDPTREMTVFYGQYKCTGPGASFAGRVSWSREL  361

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  362   TDEEAKPFISLSFIDGSEWI  381


 Score = 59.7 bits (143),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ +TVD N    +F S+Q AID++P  + V  +I + +G Y+EKV++   K  + ++G 
Sbjct  82   SYTLTVDKNPAYGDFTSIQDAIDSLPFINLVRVVIRVHAGVYKEKVSIPPLKSFITVEGA  141

Query  615  GYLNTAISWNDTANstggtsssY------TFGAFAPKFIAYNISFQVT  740
            G   T I W DTA + G            TF   +P FIA NI+F+ T
Sbjct  142  GADKTIIQWGDTAQTPGAKGQPMGTYNSATFAVNSPYFIAKNITFKNT  189



>ref|XP_001769271.1| predicted protein [Physcomitrella patens]
 gb|EDQ65983.1| predicted protein [Physcomitrella patens]
Length=370

 Score =   209 bits (532),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 141/202 (70%), Gaps = 8/202 (4%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +N++P P  GA   QA+A+   GD +AFYGC FYG QD L D RGRH+FK   I G++DF
Sbjct  171   ENSSPPPDGGAQQ-QAVALRTTGDMNAFYGCAFYGHQDTLYDHRGRHFFKDTLIVGTVDF  229

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSG--KVWL  1174
             IFG  +SLY+ C++  + + GG     S+TAQ R S  E +G+SF+ C+V GSG  +V+L
Sbjct  230   IFGDGKSLYKNCELRVLPSSGG-----SLTAQKRLSGSEDTGYSFVNCKVTGSGPPQVYL  284

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAWG Y+ V+F+ T+ + ++ P+ W +W D +R++TV++G Y C GPGA   +R+ Y+K
Sbjct  285   GRAWGPYSRVIFAFTEFANIIKPEGWYNWGDPSREKTVFYGMYKCFGPGASSPSRAYYSK  344

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L ++EAAPFL+ +YIDG  W+
Sbjct  345   ELTDAEAAPFLSLNYIDGGLWV  366


 Score = 70.5 bits (171),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +3

Query  444  VITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYL  623
            VI VD +G  NF +V +A++++P+ S     I +++GTY E+V + KSK  + +QG G  
Sbjct  75   VIVVDQSGAGNFKTVNEALNSIPEHSKSPVTIKVNAGTYNERVVIPKSKEFITLQGAGRD  134

Query  624  NTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
             T I+ ++ A ++G T +S TFG  AP F A NISF+
Sbjct  135  VTKITASNAAGNSGTTYTSATFGVSAPHFTARNISFE  171



>ref|XP_004287482.1| PREDICTED: probable pectinesterase 53-like [Fragaria vesca subsp. 
vesca]
Length=381

 Score =   223 bits (568),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 139/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P+ GA G QA+A  I  D +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  185   KNTTPVPAPGAIGKQAVAFRISADTAAFLGCRFLGAQDTLYDHVGRHYYKDCYIEGSVDF  244

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SL+E C +++IA       +G++TAQGR S  E++GFSF+ C+V GSG ++LGR
Sbjct  245   IFGNGLSLFEGCHVHAIATN-----TGALTAQGRSSLLEETGFSFVNCKVTGSGALYLGR  299

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  + R S++++L
Sbjct  300   AWGPFSRVVFAYTYMDNIIMPKGWYNWGDPNREMTVFYGQYKCTGPGAQYAGRVSWSREL  359

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ ++IDG +WL
Sbjct  360   TDEEAKPFISLTFIDGSEWL  379


 Score = 56.6 bits (135),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 60/109 (55%), Gaps = 8/109 (7%)
 Frame = +3

Query  438  SHVITVDLNGC-ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ + VD N    +F S+Q AID++P  + V  +I + +G Y+EKV +   K  + I+G 
Sbjct  79   SYTLNVDKNPSRGDFTSIQDAIDSLPFINLVRVVIKVHAGVYKEKVNIPPLKSFITIEGA  138

Query  615  GYLNTAISWNDTANs-------tggtsssYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA +         GT +S TF   +P FIA NI+F+ T
Sbjct  139  GAEKTIVQWGDTAQTPSGPKKQPMGTFNSATFAVNSPYFIARNITFKNT  187



>emb|CDP09966.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   214 bits (544),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 138/203 (68%), Gaps = 6/203 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  G  G QA+A  I GD++ F GCGFYGAQD L D  GRHYFK C+I+GSIDF
Sbjct  171   KNTAPAPMPGMQGWQAVAFRISGDKAYFSGCGFYGAQDTLCDDAGRHYFKDCYIEGSIDF  230

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RS+Y++C+++SIA        GSI AQGR S +EK+GF+F++C V GSG  ++GR
Sbjct  231   IFGNGRSMYKDCELHSIATR-----FGSIAAQGRKSPDEKTGFAFVRCRVTGSGPTYVGR  285

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWND-STRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             A G Y+ +V+S T    VV+   W+DW+  S +++TV+FG Y C GPGA      S+A++
Sbjct  286   AMGQYSRIVYSYTFFDDVVAHGGWDDWDHVSNKNRTVFFGVYKCWGPGAAAVRGVSWARE  345

Query  1358  LDESEAAPFLTTSYIDGEDWLIP  1426
             LD   A PFL  S+++G  W+ P
Sbjct  346   LDFEAAHPFLVKSFVNGRHWIAP  368


 Score = 65.5 bits (158),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 63/126 (50%), Gaps = 11/126 (9%)
 Frame = +3

Query  381  ANKCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTY  560
            +N     +W  P     + + +ITVDL G  NF SVQ A+D+VP+ +    LI I  G+Y
Sbjct  53   SNHHHRHRWIGP-----SGNRLITVDLEGFGNFRSVQAAVDSVPESNRENVLIRISPGSY  107

Query  561  REKVAVKKSKINLIIQGQGYLNTAISWNDTAN------stggtsssYTFGAFAPKFIAYN  722
             EKV V  SK  +  +G G   T I W+D A+          T  + +   FA  F A N
Sbjct  108  IEKVVVPASKPYITFEGAGRGATVIEWHDRASDRGPDGQQLRTYHTASVSVFASYFSARN  167

Query  723  ISFQVT  740
            ISF+ T
Sbjct  168  ISFKNT  173



>ref|XP_006451320.1| hypothetical protein CICLE_v10010616mg, partial [Citrus clementina]
 gb|ESR64560.1| hypothetical protein CICLE_v10010616mg, partial [Citrus clementina]
Length=359

 Score =   224 bits (571),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 140/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P+ GA G QA+A  I  D + F+GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  163   KNTTPVPAPGAVGKQAVAFRISADTATFWGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDF  222

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA       +G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  223   IFGNALSLFEGCHVHAIAQ-----YTGALTAQGRSSLLEDTGFSFVNCKVTGSGALYLGR  277

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C+GPGA  + R S+A++L
Sbjct  278   AWGPFSRVVFAYTDMDNIIIPKGWYNWGDPNREMTVFYGQYKCKGPGASFAGRVSWAREL  337

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  338   TDEEAKPFISLSFIDGSEWI  357


 Score = 55.1 bits (131),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 61/108 (56%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGCA-NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            ++ +TV  N  A +F  +Q AID++P  + V  +I + +G Y+EKV +   K  + I+G 
Sbjct  58   AYTLTVAKNPAAGDFTKIQDAIDSLPFINLVRVVIKVHAGVYKEKVNIPPFKSFITIEGA  117

Query  615  GYLNTAISWNDTANstg------gtsssYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G      GT +S TF   AP FIA NI+F+ T
Sbjct  118  GADKTIVQWGDTAQTRGPRGQPIGTWASATFAVNAPYFIAKNITFKNT  165



>ref|XP_001769270.1| predicted protein [Physcomitrella patens]
 gb|EDQ65982.1| predicted protein [Physcomitrella patens]
Length=382

 Score =   219 bits (559),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 136/206 (66%), Gaps = 5/206 (2%)
 Frame = +2

Query  812   LGGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGS  991
             +G KN AP P  G  G QA+A+ I GD++AFY CGFYGAQD L D  GRHYFK CFI+GS
Sbjct  173   MGFKNLAPMPEPGELGKQAVALVICGDKAAFYDCGFYGAQDTLFDYAGRHYFKNCFIEGS  232

Query  992   IDFIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVW  1171
             IDFIFG  RSLYE C+I+ IA       +GSITAQ R   E++SGF F+ C + G G VW
Sbjct  233   IDFIFGDGRSLYEGCEIHVIAET-----TGSITAQARSKPEDRSGFVFMDCTIMGHGLVW  287

Query  1172  LGRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYA  1351
             LGRAWG+ + VVF ++ M  ++ P  W D+ DST   T ++ +Y C GPGA+ + R  ++
Sbjct  288   LGRAWGTSSRVVFVRSYMDDIIIPAGWTDFGDSTVHNTSFYAQYKCSGPGAESAVRVPWS  347

Query  1352  KQLDESEAAPFLTTSYIDGEDWLIPT  1429
              +L++ +A  FL   +IDG  W+  T
Sbjct  348   YELNDDDAKQFLDLDFIDGASWIHAT  373


 Score = 59.7 bits (143),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  432  NVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG  611
            N S+   VD +G  +F SVQ A++AVP+ S   T+I I +G Y E+V +  +K ++ +QG
Sbjct  77   NTSYFFRVDQSGRGDFVSVQAAVNAVPENSEQRTIIEIKAGVYEERVVIPSNKPHITMQG  136

Query  612  QGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
            +G   T I+ ND A +  G   S T   +A  F A ++ F+
Sbjct  137  EGMNVTIITGNDNA-AKRGNEGSVTVAIYADHFTAVDMGFK  176



>ref|XP_002310842.1| hypothetical protein POPTR_0007s13780g [Populus trichocarpa]
 gb|EEE91292.1| hypothetical protein POPTR_0007s13780g [Populus trichocarpa]
Length=339

 Score =   220 bits (561),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 140/201 (70%), Gaps = 5/201 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GA G QA+A+ I  D +AF  C F GAQD L D  GRHYFK+C+I+GS+DF
Sbjct  142   KNKAPLPPSGALGKQAVALRISADTAAFISCKFIGAQDTLYDHIGRHYFKKCYIEGSVDF  201

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLYE+C ++++         G++TAQ R S  E++GFSF+ C+V GSG ++LGR
Sbjct  202   IFGNGLSLYEDCHLHAVTTS-----FGALTAQKRQSFLEETGFSFVSCKVTGSGALFLGR  256

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M ++++P  W DW D +R  TV+FG+Y C GPGAD   R +++++L
Sbjct  257   AWGNFSRVVFAYTFMDKIITPRGWYDWGDKSRQMTVFFGQYKCSGPGADFGGRVAWSREL  316

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              + +A PF++  +IDG +WL+
Sbjct  317   TDQQAKPFISIGFIDGHEWLL  337


 Score = 58.5 bits (140),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = +3

Query  477  FASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTAN  656
            F +VQKAI+++P  +    +I I +GTYREKV +  +   + ++G G   T I W+DTA+
Sbjct  52   FPTVQKAINSLPVINNCRVVISISAGTYREKVEIPATMAYITLRGAGADRTIIEWDDTAD  111

Query  657  stggtsssYTFGA--FA---PKFIAYNISFQ  734
                     TFG+  FA   P FIA +I+F+
Sbjct  112  RMENGRPLGTFGSATFAVNSPYFIAKDITFK  142



>ref|XP_006475590.1| PREDICTED: probable pectinesterase 53-like isoform X2 [Citrus 
sinensis]
 gb|KDO66597.1| hypothetical protein CISIN_1g019696mg [Citrus sinensis]
Length=337

 Score =   224 bits (571),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 140/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P+ GA G QA+A  I  D + F+GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  141   KNTTPVPAPGAVGKQAVAFRISADTATFWGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDF  200

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA       +G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  201   IFGNALSLFEGCHVHAIAQ-----YTGALTAQGRSSLLEDTGFSFVNCKVTGSGALYLGR  255

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C+GPGA  + R S+A++L
Sbjct  256   AWGPFSRVVFAYTYMDNIIIPKGWYNWGDPNREMTVFYGQYKCKGPGASFAGRVSWAREL  315

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  316   TDEEAKPFISLSFIDGSEWI  335


 Score = 54.7 bits (130),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 61/108 (56%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGCA-NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            ++ +TV  N  A +F  +Q AID++P  + V  +I + +G Y+EKV +   K  + I+G 
Sbjct  36   AYTLTVAKNPAAGDFTKIQDAIDSLPFINLVRVVIKVHAGVYKEKVNIPPFKSFITIEGA  95

Query  615  GYLNTAISWNDTANstg------gtsssYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G      GT +S TF   AP FIA NI+F+ T
Sbjct  96   GADKTIVQWGDTAQTRGPRGQPIGTWASATFAVNAPYFIAKNITFKNT  143



>ref|XP_006380792.1| hypothetical protein POPTR_0007s13780g [Populus trichocarpa]
 gb|ERP58589.1| hypothetical protein POPTR_0007s13780g [Populus trichocarpa]
Length=341

 Score =   220 bits (561),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 140/201 (70%), Gaps = 5/201 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GA G QA+A+ I  D +AF  C F GAQD L D  GRHYFK+C+I+GS+DF
Sbjct  144   KNKAPLPPSGALGKQAVALRISADTAAFISCKFIGAQDTLYDHIGRHYFKKCYIEGSVDF  203

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLYE+C ++++         G++TAQ R S  E++GFSF+ C+V GSG ++LGR
Sbjct  204   IFGNGLSLYEDCHLHAVTTS-----FGALTAQKRQSFLEETGFSFVSCKVTGSGALFLGR  258

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M ++++P  W DW D +R  TV+FG+Y C GPGAD   R +++++L
Sbjct  259   AWGNFSRVVFAYTFMDKIITPRGWYDWGDKSRQMTVFFGQYKCSGPGADFGGRVAWSREL  318

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              + +A PF++  +IDG +WL+
Sbjct  319   TDQQAKPFISIGFIDGHEWLL  339


 Score = 58.5 bits (140),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = +3

Query  477  FASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDTAN  656
            F +VQKAI+++P  +    +I I +GTYREKV +  +   + ++G G   T I W+DTA+
Sbjct  54   FPTVQKAINSLPVINNCRVVISISAGTYREKVEIPATMAYITLRGAGADRTIIEWDDTAD  113

Query  657  stggtsssYTFGA--FA---PKFIAYNISFQ  734
                     TFG+  FA   P FIA +I+F+
Sbjct  114  RMENGRPLGTFGSATFAVNSPYFIAKDITFK  144



>ref|XP_006371972.1| hypothetical protein POPTR_0018s06820g [Populus trichocarpa]
 gb|ERP49769.1| hypothetical protein POPTR_0018s06820g [Populus trichocarpa]
Length=422

 Score =   224 bits (570),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 140/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P+ GA G QA+A+ I  D +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  226   KNTAPLPAPGAMGQQAVALRISADTAAFLGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDF  285

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SL+E C +++IA       +G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  286   IFGNGLSLFEGCHVHAIAQ-----FTGALTAQGRSSLLEDTGFSFVNCKVTGSGALYLGR  340

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  + R S++++L
Sbjct  341   AWGPFSRVVFAYTYMDNIIIPKGWYNWGDPNRELTVFYGQYKCTGPGASFAGRVSWSREL  400

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              +SEA PF + ++IDG +W+
Sbjct  401   TDSEAKPFTSLTFIDGSEWI  420


 Score = 55.1 bits (131),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 56/96 (58%), Gaps = 6/96 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F ++Q+AID++P  + V  +I I +G Y+EKV +   K  + ++G G  NT + W DT
Sbjct  133  GDFTTIQEAIDSLPFINLVRVIIKIRAGVYKEKVNIPPLKSFITMEGAGADNTIVQWGDT  192

Query  651  ANs------tggtsssYTFGAFAPKFIAYNISFQVT  740
            A +        GT SS TF   +P F+A NI+F+ T
Sbjct  193  AQTPGARGQPMGTYSSATFAVNSPFFVAKNITFKNT  228



>ref|XP_006853729.1| hypothetical protein AMTR_s00056p00166920 [Amborella trichopoda]
 gb|ERN15196.1| hypothetical protein AMTR_s00056p00166920 [Amborella trichopoda]
Length=379

 Score =   221 bits (563),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA+G QA+A  I  D +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  182   KNTTPVPKPGASGKQAVAFRISADTAAFLGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDF  241

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLYE C +++IAN       G++TAQ R S  E +GFSF+ C+V GSG ++LGR
Sbjct  242   IFGNGLSLYEGCHVHAIANN-----YGALTAQNRMSLLEDTGFSFVNCKVTGSGALYLGR  296

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  + R S++++L
Sbjct  297   AWGAFSRVVFAYTYMDNIIIPRGWYNWGDPNREMTVFYGQYKCAGPGASFAGRVSWSREL  356

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  357   TDEEAKPFISLSFIDGSEWI  376


 Score = 57.8 bits (138),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGC-ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S  +TVD N    +F ++Q AID++P  + V  +I ++ GTY EKV +   K  + I+G 
Sbjct  77   SFYLTVDKNPAKGDFTTIQSAIDSLPFINLVRVVIKVNPGTYTEKVIIPAMKAFITIEGA  136

Query  615  GYLNTAISWNDTANstggtss------sYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G T        S TF   +P FIA NI+F+ T
Sbjct  137  GADRTEVQWGDTAQTVGPTGQPIGTFNSATFAVNSPYFIAKNITFKNT  184



>gb|EEC79546.1| hypothetical protein OsI_20666 [Oryza sativa Indica Group]
Length=398

 Score =   221 bits (562),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 139/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  GA G Q +A+ I  D +AF GC F GAQD L D  GRHY++ C+I+GS+DF
Sbjct  202   KNTAPVPRPGALGKQGVALRISADNAAFLGCNFLGAQDTLYDHLGRHYYRDCYIEGSVDF  261

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++IA        G++TAQ R S  E +GFSF+ C V GSG ++LGR
Sbjct  262   IFGNALSLYEGCHVHAIARN-----YGALTAQNRMSILEDTGFSFVNCRVTGSGALYLGR  316

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D TR+ TV++G+Y C GPG++ + R +++++L
Sbjct  317   AWGTFSRVVFAYTYMDNIIIPRGWYNWGDPTREMTVFYGQYKCTGPGSNYAGRVAWSREL  376

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  377   TDQEAKPFISLSFIDGLEWV  396


 Score = 57.8 bits (138),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 60/113 (53%), Gaps = 7/113 (6%)
 Frame = +3

Query  438  SHVITVDLNGCA-NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            +  + VD N  A NF S+Q A+D++P  +    +I +++GTY EKV +   +  + I+G 
Sbjct  97   TRTLVVDKNPAAGNFTSIQAAVDSIPLINLARVVIKVNAGTYTEKVTISPLRAFVTIEGA  156

Query  615  GYLNTAISWNDTANstggtsssY------TFGAFAPKFIAYNISFQVTHHILR  755
            G   T + W DTA++ G     +      TF   A  F+A NI+F+ T  + R
Sbjct  157  GADKTVVQWGDTADTVGPLGRPFGTFASATFAVNAQFFVAKNITFKNTAPVPR  209



>ref|NP_001056077.1| Os05g0521600 [Oryza sativa Japonica Group]
 gb|AAV59317.1| putative pectin methylesterase [Oryza sativa Japonica Group]
 dbj|BAF17991.1| Os05g0521600 [Oryza sativa Japonica Group]
 dbj|BAG88606.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64406.1| hypothetical protein OsJ_19250 [Oryza sativa Japonica Group]
Length=398

 Score =   221 bits (562),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 139/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  GA G Q +A+ I  D +AF GC F GAQD L D  GRHY++ C+I+GS+DF
Sbjct  202   KNTAPVPRPGALGKQGVALRISADNAAFLGCNFLGAQDTLYDHLGRHYYRDCYIEGSVDF  261

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++IA        G++TAQ R S  E +GFSF+ C V GSG ++LGR
Sbjct  262   IFGNALSLYEGCHVHAIARN-----YGALTAQNRMSILEDTGFSFVNCRVTGSGALYLGR  316

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D TR+ TV++G+Y C GPG++ + R +++++L
Sbjct  317   AWGTFSRVVFAYTYMDNIIIPRGWYNWGDPTREMTVFYGQYKCTGPGSNYAGRVAWSREL  376

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  377   TDQEAKPFISLSFIDGLEWV  396


 Score = 57.8 bits (138),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 60/113 (53%), Gaps = 7/113 (6%)
 Frame = +3

Query  438  SHVITVDLNGCA-NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            +  + VD N  A NF S+Q A+D++P  +    +I +++GTY EKV +   +  + I+G 
Sbjct  97   TRTLVVDKNPAAGNFTSIQAAVDSIPLINLARVVIKVNAGTYTEKVTISPLRAFVTIEGA  156

Query  615  GYLNTAISWNDTANstggtsssY------TFGAFAPKFIAYNISFQVTHHILR  755
            G   T + W DTA++ G     +      TF   A  F+A NI+F+ T  + R
Sbjct  157  GADKTVVQWGDTADTVGPLGRPFGTFASATFAVNAQFFVAKNITFKNTAPVPR  209



>ref|XP_003567104.1| PREDICTED: probable pectinesterase 53 isoform X2 [Brachypodium 
distachyon]
Length=389

 Score =   224 bits (570),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT+P P  GA+G QA+A+ +  D +AF GC F GAQD L D  GRHY+K C+I+GSIDF
Sbjct  193   KNTSPVPKAGASGKQAVALRVSADNAAFVGCKFLGAQDTLYDHTGRHYYKDCYIEGSIDF  252

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++IA +      G++TAQ R S  E +GFSF+ C V GSG ++LGR
Sbjct  253   IFGNALSLYEGCHVHAIARD-----YGALTAQNRQSMLEDTGFSFVNCRVTGSGALYLGR  307

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C GPGA  S R S++++L
Sbjct  308   AWGTFSRVVFAYTYMDDIIIPRGWYNWGDPSRELTVFYGQYKCTGPGASYSGRVSWSREL  367

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  368   TDEEAKPFISLSFIDGTEWV  387


 Score = 54.7 bits (130),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 68/124 (55%), Gaps = 9/124 (7%)
 Frame = +3

Query  411  SPLVSMYNVSHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKS  587
            +PL  ++  S+ + VD N    +F S+Q A+D++P  + V  +I +++GTY EKV +   
Sbjct  79   APLARVFP-SYSLVVDKNPSSGDFTSIQAAVDSLPPINLVRVVIKVNAGTYTEKVNISPM  137

Query  588  KINLIIQGQGYLNTAISWNDTANstg-------gtsssYTFGAFAPKFIAYNISFQVTHH  746
            +  + ++G G   T + W DTA++         GT  S +F   A  F+A NI+F+ T  
Sbjct  138  RAFITLEGAGADRTVVQWGDTADTPAGPRGRPLGTYGSASFAVNAQYFLARNITFKNTSP  197

Query  747  ILRS  758
            + ++
Sbjct  198  VPKA  201



>ref|XP_011009863.1| PREDICTED: probable pectinesterase 53 [Populus euphratica]
Length=381

 Score =   222 bits (565),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 140/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P+ GA G QA+A+ I  D +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  185   KNTAPLPAPGAMGKQAVALRISADTAAFLGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDF  244

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SL+E C +++IA       +G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  245   IFGNGLSLFEGCHVHAIAQ-----FTGALTAQGRSSLLEDTGFSFVNCKVTGSGALYLGR  299

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  + R S++++L
Sbjct  300   AWGPFSRVVFAYTYMDGIIIPKGWYNWGDPNRELTVFYGQYKCTGPGARFAGRVSWSREL  359

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              +SEA PF + ++IDG +W+
Sbjct  360   TDSEAKPFTSLTFIDGSEWI  379


 Score = 56.2 bits (134),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 6/96 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F ++Q+AID++P  + V  +I I +G Y+EKV +   K  + I+G G  NT + W DT
Sbjct  92   GDFTTIQEAIDSLPFINLVRVIIKIRAGVYKEKVNIPPLKSFITIEGAGADNTIVQWGDT  151

Query  651  A------NstggtsssYTFGAFAPKFIAYNISFQVT  740
            A          GT SS TF   +P F+A NI+F+ T
Sbjct  152  AQTPGARGQPMGTYSSATFAVNSPFFVAKNITFKNT  187



>ref|XP_003516527.2| PREDICTED: probable pectinesterase 53-like [Glycine max]
Length=379

 Score =   220 bits (560),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 139/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NT P P+ GA G QA+A+ I  D +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  183   QNTTPVPAPGAVGKQAVALRISADTAAFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDF  242

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG + SL+E C +++IA       +G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  243   IFGNSLSLFEGCHVHAIAQN-----TGAVTAQGRSSMLEDTGFSFVNCKVTGSGALYLGR  297

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C G GA  + R  ++++L
Sbjct  298   AWGPFSRVVFAYTFMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGLGASFAGRVPWSREL  357

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EAAPFL+ S+IDG +W+
Sbjct  358   TDEEAAPFLSLSFIDGTEWI  377


 Score = 58.2 bits (139),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 61/108 (56%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ + VD + G  +F S+Q+AID++P  + V  +I + +G Y EKV +   K  + I+G 
Sbjct  78   SYTLHVDKDPGAGDFTSIQEAIDSLPFINLVRVVIKVHAGVYTEKVNIPPLKSYITIEGA  137

Query  615  GYLNTAISWNDTANstg------gtsssYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G      GT  S TF   +P F+A NI+FQ T
Sbjct  138  GTDKTIVKWGDTAQTPGPNGRPLGTYGSATFAVNSPYFLAKNITFQNT  185



>ref|XP_006287923.1| hypothetical protein CARUB_v10001159mg [Capsella rubella]
 gb|EOA20821.1| hypothetical protein CARUB_v10001159mg [Capsella rubella]
Length=386

 Score =   221 bits (563),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 142/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A+ +  D +AF+GC   GAQD L D  GRHY+K C+I+GS+DF
Sbjct  190   KNTTPVPLPGAVGKQAVALRVSADNAAFFGCKMLGAQDTLYDHLGRHYYKDCYIEGSVDF  249

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++IA++      G++TAQGR S  E +GFSF+KC+V G+G ++LGR
Sbjct  250   IFGNALSLYEGCHVHAIADK-----LGAVTAQGRSSVLEDTGFSFVKCKVTGTGVLYLGR  304

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C G GA+ + R ++A++L
Sbjct  305   AWGPFSRVVFAYTYMDNIILPRGWYNWGDPSREMTVFYGQYKCTGAGANYAGRVAWAREL  364

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ ++IDG +W+
Sbjct  365   TDEEAKPFISLNFIDGSEWI  384


 Score = 57.0 bits (136),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 6/96 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F  +Q AID++P  + V  +I + +G Y+EKV +   K  + IQG+G  NT + W DT
Sbjct  97   GDFTKIQDAIDSLPLINLVRVVIKVHAGVYKEKVNIPPMKAFITIQGEGAENTIVEWGDT  156

Query  651  ANstggtsssY------TFGAFAPKFIAYNISFQVT  740
            A +     +        +F   +P F+A NI+F+ T
Sbjct  157  AQTPDSKGNPMGTFNSASFAVNSPFFVAKNITFKNT  192



>ref|XP_002303355.2| hypothetical protein POPTR_0003s07460g [Populus trichocarpa]
 gb|EEE78334.2| hypothetical protein POPTR_0003s07460g [Populus trichocarpa]
Length=367

 Score =   211 bits (536),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 138/204 (68%), Gaps = 6/204 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  G  G QA A  I GD++ F GCGFYGAQD L D  GRHYFK+C+I+GSIDF
Sbjct  167   KNTAPAPMPGMKGWQAAAFRISGDKAYFAGCGFYGAQDTLCDDAGRHYFKECYIEGSIDF  226

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RS+Y++C+++SIA        GSI AQ R+S +EK+GF+FL C V G+G +++GR
Sbjct  227   IFGNGRSMYKDCELHSIATR-----FGSIAAQDRNSPDEKTGFAFLNCRVTGTGPLYVGR  281

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWND-STRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             A G Y+ +V+S T    VV+   W+DW+  S +++TV+FG Y C GPGA      S+A++
Sbjct  282   AMGQYSRIVYSYTYFDNVVAHGGWDDWDHASNKNKTVFFGVYKCWGPGAAAVQGVSWARE  341

Query  1358  LDESEAAPFLTTSYIDGEDWLIPT  1429
             LD   A  FL  S+++G  W+ P+
Sbjct  342   LDYESAHKFLAKSFVNGRHWIAPS  365


 Score = 67.0 bits (162),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 61/119 (51%), Gaps = 11/119 (9%)
 Frame = +3

Query  402  KWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVK  581
            KW  P+        VITVD+NG   F SVQ A+DAVP+ +    +I+I +G Y EKV V 
Sbjct  56   KWVGPVGY-----RVITVDVNGAGEFLSVQAAVDAVPENNGENVMILISAGYYIEKVTVP  110

Query  582  KSKINLIIQGQGYLNTAISWNDTANstggtsssY------TFGAFAPKFIAYNISFQVT  740
             SK  +  QG+G   T I W+D A+  G            +   FA  F A NISF+ T
Sbjct  111  ASKPYITFQGEGRDVTIIEWHDRASDRGANGQQLRTYRTASVSVFANYFSARNISFKNT  169



>ref|XP_008649911.1| PREDICTED: probable pectinesterase 53 [Zea mays]
 gb|AFW78823.1| hypothetical protein ZEAMMB73_511959 [Zea mays]
Length=410

 Score =   220 bits (560),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 137/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  GA G Q +A+ I  D +AF GC F GAQD L D  GRHY++ C+I+GS+DF
Sbjct  214   KNTAPVPRPGALGKQGVALRISADSAAFVGCNFLGAQDTLYDHLGRHYYRDCYIEGSVDF  273

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++IA        G++TAQ R S  E +GFSF+ C V GSG ++LGR
Sbjct  274   IFGNALSLYEGCHVHAIARN-----YGALTAQSRQSLLEDTGFSFVSCRVTGSGALYLGR  328

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D TR+ TV++G+Y C GPGA+ + R  ++++L
Sbjct  329   AWGTFSRVVFAYTYMDNIIIPRGWYNWGDPTREMTVFYGQYKCTGPGANYAGRVQWSREL  388

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++  +IDG +WL
Sbjct  389   TDDEAKPFISLDFIDGFEWL  408


 Score = 57.8 bits (138),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 63/113 (56%), Gaps = 7/113 (6%)
 Frame = +3

Query  438  SHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            +  + VD N G  NF S+Q A+D++P  +    +I +++GTY EKV++   +  + ++G 
Sbjct  109  ARTLVVDKNPGAGNFTSIQAAVDSLPLINLARVVIRVNAGTYTEKVSISPMRAFVTVEGA  168

Query  615  GYLNTAISWNDTANstggtsssY-TFGA--FAPK---FIAYNISFQVTHHILR  755
            G   T + W DTA++ G       TFG+  FA     F+A NI+F+ T  + R
Sbjct  169  GADKTVVQWGDTADTAGAWGRPMGTFGSATFAVNSMFFVAKNITFKNTAPVPR  221



>ref|XP_002962215.1| hypothetical protein SELMODRAFT_165098 [Selaginella moellendorffii]
 gb|EFJ37475.1| hypothetical protein SELMODRAFT_165098 [Selaginella moellendorffii]
Length=359

 Score =   223 bits (568),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 140/204 (69%), Gaps = 6/204 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP P  G  G QA A  I GD +AFY CGFYGAQD L D  GRHYFK CFIQGSIDF
Sbjct  161   QNTAPPPPPGVNGRQAAAFRISGDMAAFYNCGFYGAQDTLCDDVGRHYFKGCFIQGSIDF  220

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLYE+C+++SIA+       GS+ AQ R S+ E +GFSF+ C+V G+G ++LGR
Sbjct  221   IFGNGRSLYEQCELHSIADS-----YGSVAAQDRQSQTENTGFSFVNCKVTGTGILYLGR  275

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDW-NDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             A G Y+ +V+S +    ++    W+DW +D++RD+TV FG+Y C GPGA  S R  +A++
Sbjct  276   AMGPYSRIVYSNSYFDNIIDVRGWDDWDHDASRDRTVSFGQYKCYGPGATSSLRVPWARE  335

Query  1358  LDESEAAPFLTTSYIDGEDWLIPT  1429
             L + E  PFL+ S++DG  WL  T
Sbjct  336   LSDMEVTPFLSLSFVDGTQWLPST  359


 Score = 54.3 bits (129),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 52/107 (49%), Gaps = 6/107 (6%)
 Frame = +3

Query  438  SHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQG  617
            + ++ VD +G  +F +VQ A++A+PD +     I I  G Y EKV V  +K  L  QG G
Sbjct  57   ARILVVDQSGNGDFVTVQDAVNAIPDGNDQRVTIRIGPGIYWEKVVVPATKPFLTFQGAG  116

Query  618  YLNTAISWNDTANstggtsssYT------FGAFAPKFIAYNISFQVT  740
               + I WN TA+  G      T             FIA +ISFQ T
Sbjct  117  IDRSLIVWNSTASDLGPDGQPLTAYRTASVTIVGANFIARDISFQNT  163



>gb|KHN40374.1| Putative pectinesterase 53 [Glycine soja]
Length=326

 Score =   219 bits (558),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 139/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NT P P+ GA G QA+A+ I  D +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  130   QNTTPVPAPGAVGKQAVALRISADTAAFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDF  189

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG + SL+E C +++IA       +G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  190   IFGNSLSLFEGCHVHAIAQN-----TGAVTAQGRSSMLEDTGFSFVNCKVTGSGALYLGR  244

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C G GA  + R  ++++L
Sbjct  245   AWGPFSRVVFAYTFMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGLGASFAGRVPWSREL  304

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EAAPFL+ S+IDG +W+
Sbjct  305   TDEEAAPFLSLSFIDGTEWI  324


 Score = 58.2 bits (139),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 61/108 (56%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ + VD + G  +F S+Q+AID++P  + V  +I + +G Y EKV +   K  + I+G 
Sbjct  25   SYTLHVDKDPGAGDFTSIQEAIDSLPFINLVRVVIKVHAGVYTEKVNIPPLKSYITIEGA  84

Query  615  GYLNTAISWNDTANstg------gtsssYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G      GT  S TF   +P F+A NI+FQ T
Sbjct  85   GTDKTIVKWGDTAQTPGPNGRPLGTYGSATFAVNSPYFLAKNITFQNT  132



>gb|EMT14893.1| Putative pectinesterase 53 [Aegilops tauschii]
Length=257

 Score =   226 bits (577),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 142/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  GATG QA+A+ +  D +AF GC F GAQD L DQ GRHY+K C+I+GSIDF
Sbjct  61    KNTAPVPKAGATGKQAVALRVSADNAAFVGCRFLGAQDTLYDQSGRHYYKDCYIEGSIDF  120

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++IA +      G++TAQ R S  E +GFSF+ C V GSG ++LGR
Sbjct  121   IFGNALSLYEGCHVHAIARD-----YGALTAQNRQSMLEDTGFSFVGCRVTGSGALYLGR  175

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C GPGA  S R S++++L
Sbjct  176   AWGTFSRVVFAYTYMDDIIVPRGWYNWGDPSRELTVFYGQYKCTGPGASYSGRVSWSREL  235

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  236   TDEEAKPFISLSFIDGTEWI  255



>ref|XP_002965129.1| hypothetical protein SELMODRAFT_167160 [Selaginella moellendorffii]
 gb|EFJ33967.1| hypothetical protein SELMODRAFT_167160 [Selaginella moellendorffii]
Length=359

 Score =   223 bits (568),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 140/204 (69%), Gaps = 6/204 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NTAP P  G  G QA A  I GD +AFY CGFYGAQD L D  GRHYFK CFIQGSIDF
Sbjct  161   QNTAPPPPPGVNGRQAAAFRISGDMAAFYNCGFYGAQDTLCDDVGRHYFKGCFIQGSIDF  220

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLYE+C+++SIA+       GS+ AQ R S+ E +GFSF+ C+V G+G ++LGR
Sbjct  221   IFGNGRSLYEQCELHSIADS-----YGSVAAQDRQSQTENTGFSFVNCKVTGTGILYLGR  275

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDW-NDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             A G Y+ +V+S +    ++    W+DW +D++RD+TV FG+Y C GPGA  S R  +A++
Sbjct  276   AMGPYSRIVYSNSYFDNIIDVRGWDDWDHDASRDRTVSFGQYKCYGPGATSSLRVPWARE  335

Query  1358  LDESEAAPFLTTSYIDGEDWLIPT  1429
             L + E  PFL+ S++DG  WL  T
Sbjct  336   LSDMEVTPFLSLSFVDGTQWLPST  359


 Score = 54.3 bits (129),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 52/107 (49%), Gaps = 6/107 (6%)
 Frame = +3

Query  438  SHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQG  617
            + ++ VD +G  +F +VQ A++A+PD +     I I  G Y EKV V  +K  L  QG G
Sbjct  57   ARILVVDQSGNGDFVTVQDAVNAIPDGNDQRVTIRIGPGIYWEKVVVPATKPFLTFQGAG  116

Query  618  YLNTAISWNDTANstggtsssYT------FGAFAPKFIAYNISFQVT  740
               + I WN TA+  G      T             FIA +ISFQ T
Sbjct  117  IDRSLIVWNSTASDLGPDGQPLTAYRTASVTIVGANFIARDISFQNT  163



>gb|KHG28421.1| putative pectinesterase 53 -like protein [Gossypium arboreum]
Length=381

 Score =   221 bits (563),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A  I  D + F GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  185   KNTTPVPPPGAVGKQAVAFRISADTATFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDF  244

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SL+E C +++IA      ++G++TAQGR S  + +GFSF+ C+V GSG ++LGR
Sbjct  245   IFGNGLSLFEGCHVHAIAT-----LTGAVTAQGRGSMLDDTGFSFVNCKVTGSGALYLGR  299

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ V+F+ T M  ++ P  W +W D +R+ TV++G+Y C GPGA  + R S++++L
Sbjct  300   AWGPFSRVIFAYTYMDNIIIPKGWYNWGDPSREMTVFYGQYKCTGPGASFAGRVSWSREL  359

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PFL+ S+IDG +W+
Sbjct  360   TDEEAKPFLSLSFIDGSEWI  379


 Score = 56.2 bits (134),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGC-ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ +TVD N    +F ++Q AID++P  + V  +I + +G Y EKV +   K  + I+G 
Sbjct  80   SYTLTVDKNPAKGDFTTIQDAIDSLPLVNLVRVVIKVHAGVYTEKVNIPPLKSFITIEGS  139

Query  615  GYLNTAISWNDTA------NstggtsssYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA          GT +S TF   +P FIA NI+F+ T
Sbjct  140  GADETIVQWGDTAQTPGPRGQPLGTYASATFAVNSPYFIAKNITFKNT  187



>ref|XP_010535938.1| PREDICTED: probable pectinesterase 53 [Tarenaya hassleriana]
Length=382

 Score =   223 bits (567),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A+ +  D + F GC   GAQD L D  GRHY+K C+I+GS+DF
Sbjct  186   KNTTPVPPPGAVGKQAVALRVSADNAVFMGCQILGAQDTLYDHLGRHYYKDCYIEGSVDF  245

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++IA++      G++TAQGR S  E +GFSFL+C+V G+G ++LGR
Sbjct  246   IFGNALSLYEGCHVHAIADK-----MGAVTAQGRSSVLEDTGFSFLRCKVTGTGVLYLGR  300

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C GPGA+ + R +++++L
Sbjct  301   AWGPFSRVVFAYTYMDNIILPRGWYNWGDPSREMTVFYGQYKCTGPGANHAGRVAWSREL  360

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PFL+ +++DG +W+
Sbjct  361   TDEEAKPFLSLTFVDGSEWI  380


 Score = 54.7 bits (130),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 56/108 (52%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ ITV  N    +F  +Q AID++P  + V  +I + SG Y EKV +   K  + ++G+
Sbjct  81   SYTITVHKNPNKGDFVKIQDAIDSLPFVNLVRVVIKVHSGVYTEKVNIPPMKSFITMEGE  140

Query  615  GYLNTAISWNDTANstggtsssY------TFGAFAPKFIAYNISFQVT  740
            G   T + W D+A + G            TF   AP F+A NI+F+ T
Sbjct  141  GAEKTIVQWGDSAQTPGARGQPLGTFNSATFAVNAPFFVAKNITFKNT  188



>ref|XP_010249481.1| PREDICTED: probable pectinesterase 53 [Nelumbo nucifera]
Length=378

 Score =   220 bits (560),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A  I GD +AF+GC F+GAQD L D  GRHY+K C+I+GS+DF
Sbjct  182   KNTTPLPPPGAIGKQAVAFRISGDTAAFWGCKFFGAQDTLYDHLGRHYYKDCYIEGSVDF  241

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SL+E C +++IA +      G++TAQ R S  E +GFSF+ C V GSG ++LGR
Sbjct  242   IFGNGLSLFEGCNVHAIAQK-----YGAVTAQSRMSLLEDTGFSFVNCRVTGSGALYLGR  296

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D  R  TV++G+Y C GPGA  + R S++++L
Sbjct  297   AWGTFSRVVFAYTYMDNIIIPKGWYNWGDPNRQMTVFYGQYKCTGPGASFAGRVSWSREL  356

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              ++EA PF + ++IDG +W+
Sbjct  357   TDAEAKPFTSLTFIDGSEWI  376


 Score = 56.6 bits (135),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 62/108 (57%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGCA-NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ +TV  N  A +F S+Q AID++P  + V  +I +++G Y EKV +   K  + I+G 
Sbjct  77   SYTLTVHKNPAAGDFTSIQDAIDSLPSVNLVRVVIKVNAGVYTEKVNIPPLKSFITIEGA  136

Query  615  GYLNTAISWNDTANstg------gtsssYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G      GT +S TF   +P FIA NI+F+ T
Sbjct  137  GADKTIVQWGDTAQTPGPNGRPIGTFNSATFAVNSPYFIAKNITFKNT  184



>emb|CDP03246.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   216 bits (551),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 137/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A  I  D + F GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  141   KNTTPVPPPGAIGKQAVAFRISADTAVFVGCRFLGAQDTLYDHLGRHYYKDCYIEGSVDF  200

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SL+E C + +IA      ++G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  201   IFGNGLSLFEGCHVRAIAQ-----LTGAVTAQGRSSLLEDTGFSFVNCKVTGSGALYLGR  255

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ V+F+ T M  ++ P  W++W D +R+ TV++G+Y C G GA  + R S++++L
Sbjct  256   AWGPFSRVIFAYTYMDNIIIPKGWHNWGDPSREMTVFYGQYKCSGAGASFAGRVSWSREL  315

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ ++IDG +W+
Sbjct  316   TDEEAKPFISLAFIDGSEWI  335


 Score = 59.7 bits (143),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 59/108 (55%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ +TVD N    +F ++Q+AID++P  + V  LI + +G Y EKV + + K  + ++G 
Sbjct  36   SYTLTVDKNPNYGDFTTIQQAIDSLPTVNLVRVLIKVHAGVYTEKVTIPQLKSYITVEGA  95

Query  615  GYLNTAISWNDTANstggtsssY------TFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G            TF   +P FIA NI+F+ T
Sbjct  96   GADKTIVQWGDTAQTPGAKGQPLGTFASATFAVNSPYFIAKNITFKNT  143



>gb|EYU33537.1| hypothetical protein MIMGU_mgv1a008469mg [Erythranthe guttata]
Length=373

 Score =   211 bits (538),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 138/204 (68%), Gaps = 6/204 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  G  G QA+A  I GD++ F GCGFYGAQD L D  GRHYFK+C+I+GSIDF
Sbjct  173   KNTAPAPLPGMQGWQAVAFRISGDKAFFSGCGFYGAQDTLCDDAGRHYFKECYIEGSIDF  232

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RS+Y+ C+++SIA        GSI AQ R+S +EK+GF+F+ C V G+G +++GR
Sbjct  233   IFGNGRSMYKNCELHSIATR-----FGSIAAQNRNSPDEKTGFAFVNCTVTGTGPLYVGR  287

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWND-STRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             A G Y+ +VFS T    VV+   W+DW+  S +++T YFG Y C GPGA      S+A++
Sbjct  288   AMGQYSRIVFSYTYFDDVVAHGGWDDWDHISNKNKTAYFGVYKCFGPGAARVRGVSWARE  347

Query  1358  LDESEAAPFLTTSYIDGEDWLIPT  1429
             LD   A PF+  S+++G  W+ P+
Sbjct  348   LDYDSAHPFIAKSFVNGRHWIAPS  371


 Score = 65.1 bits (157),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 61/124 (49%), Gaps = 11/124 (9%)
 Frame = +3

Query  387  KCDDSKWDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYRE  566
            K    KW  P   +     +ITVD+ G  +F SVQ A+D+VP+ +    LI+I +G Y E
Sbjct  57   KHGHHKWVGPSGHL-----LITVDVGGSGDFRSVQAAVDSVPENNRKNVLILIGAGYYIE  111

Query  567  KVAVKKSKINLIIQGQGYLNTAISWNDTA------NstggtsssYTFGAFAPKFIAYNIS  728
            KV V   K  +  +G G   T I W+D A           T  + +   FAP F A NIS
Sbjct  112  KVVVPACKPYITFEGAGRETTFIEWHDRASDKGPDGQQLRTYHTASVSVFAPYFSARNIS  171

Query  729  FQVT  740
            F+ T
Sbjct  172  FKNT  175



>gb|EYU27258.1| hypothetical protein MIMGU_mgv1a025960mg, partial [Erythranthe 
guttata]
Length=304

 Score =   202 bits (515),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 129/200 (65%), Gaps = 7/200 (4%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  GA G Q +A+ I GD SAF GC F GAQD L D RGRHY++ C+I+GS+DF
Sbjct  109   KNTAPIPPPGADGMQGVALRISGDASAFAGCKFLGAQDTLYDHRGRHYYEDCYIEGSVDF  168

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RS Y+ C++++IA       +G++ AQ R +  E +GFS + C V GS  V+L R
Sbjct  169   IFGDGRSYYKGCELHAIA-------TGAVAAQNRSASSENTGFSIVNCRVTGSDIVYLAR  221

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AW  ++T +F+ T M   V+P+ W DW D +R  TV FGEY C GPG++ + R  ++K L
Sbjct  222   AWAPFSTTIFAYTYMENNVNPEGWFDWGDPSRQSTVTFGEYQCSGPGSNTAGRVKWSKIL  281

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA  F +  +ID  +WL
Sbjct  282   TDEEAGRFTSLDFIDASEWL  301


 Score = 73.6 bits (179),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 65/112 (58%), Gaps = 2/112 (2%)
 Frame = +3

Query  420  VSMYNVSHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKIN  596
            V M   S +ITVD N G  NF S+Q AID++P  +    LI + +G Y EKV +  +K  
Sbjct  3    VIMTAPSIIITVDKNPGSGNFTSIQGAIDSLPLVNQERVLIDVHAGIYTEKVTIPSTKAY  62

Query  597  LIIQGQGYLNTAISWNDTA-NstggtsssYTFGAFAPKFIAYNISFQVTHHI  749
            + IQG G  NT + W DTA +   GT  S TFG  AP F+A NI+F+ T  I
Sbjct  63   IKIQGAGAENTVVQWGDTARSQPLGTYGSATFGVDAPYFVAKNITFKNTAPI  114



>ref|XP_006400534.1| hypothetical protein EUTSA_v10013810mg [Eutrema salsugineum]
 gb|ESQ41987.1| hypothetical protein EUTSA_v10013810mg [Eutrema salsugineum]
Length=382

 Score =   223 bits (568),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A+ + GD +AF+GC   GAQD L D  GRHY+K C+I+GS+DF
Sbjct  186   KNTTPVPLPGAVGKQAVALRVSGDNAAFFGCRMLGAQDTLYDHLGRHYYKDCYIEGSVDF  245

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++IA++      G++TAQGR S  E +GFSF+KC+V G+G ++LGR
Sbjct  246   IFGNALSLYEGCHVHAIADK-----LGAVTAQGRSSVLEDTGFSFVKCKVTGTGVLYLGR  300

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C G GA+ + R ++A++L
Sbjct  301   AWGPFSRVVFAYTYMDNIILPRGWYNWGDPSREMTVFYGQYKCTGAGANYAGRVAWAREL  360

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ ++IDG +W+
Sbjct  361   TDEEAKPFISLTFIDGSEWI  380


 Score = 53.5 bits (127),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 54/96 (56%), Gaps = 6/96 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F  +Q AID++P  + V  +I + +G Y+EKV +   K  + I+G+G   T + W DT
Sbjct  93   GDFTKIQDAIDSLPLINLVRVVIKVHAGVYKEKVNIPPMKAFITIEGEGAEKTIVEWGDT  152

Query  651  ANs------tggtsssYTFGAFAPKFIAYNISFQVT  740
            A +        GT +S +F   +P F+A NI+F+ T
Sbjct  153  AQTPDQRGNPMGTFNSASFAVNSPFFVAKNITFKNT  188



>ref|XP_002881461.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57720.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=306

 Score =   185 bits (469),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 115/200 (58%), Gaps = 39/200 (20%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP+P  G  G QA+A+ + GDQ+AFY  GFYGAQD L D +GRH+FK CFIQGSIDF
Sbjct  146   KNFAPEPKPGMEGSQAVALRVDGDQAAFYSFGFYGAQDTLLDNQGRHFFKNCFIQGSIDF  205

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IF   RSLY+                                       + G+GK+WLGR
Sbjct  206   IFRNGRSLYK---------------------------------------IYGTGKLWLGR  226

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AW  +ATVVF  T MS ++SPD WN+ +D TRD+T Y+ E+    P A  S R  YAKQL
Sbjct  227   AWKPFATVVFLNTYMSGIISPDGWNNMSDPTRDKTAYYREHQYYIPEAKHSKRVPYAKQL  286

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EAAPF   S+IDGE  L
Sbjct  287   TDVEAAPFTNISFIDGEQRL  306


 Score = 91.3 bits (225),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 67/107 (63%), Gaps = 10/107 (9%)
 Frame = +3

Query  444  VITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTY----------REKVAVKKSKI  593
            V TVDL+G  NF SVQ+AI+AVP+ S   TLII+ SG Y          REKV V + K 
Sbjct  30   VFTVDLHGSGNFISVQRAINAVPNSSNYKTLIIVKSGVYNIMYVPWKKKREKVNVSEKKK  89

Query  594  NLIIQGQGYLNTAISWNDTANstggtsssYTFGAFAPKFIAYNISFQ  734
             L++ G  Y NT I  NDTA S+  T +SY+F  FA  F+AYNISF+
Sbjct  90   KLVLHGTDYQNTVIELNDTAQSSRNTLNSYSFDVFAANFVAYNISFK  136



>ref|XP_008673062.1| PREDICTED: pectinesterase isoform X1 [Zea mays]
 gb|ACR36293.1| unknown [Zea mays]
Length=391

 Score =   224 bits (572),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 140/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT+P P  GA G QA+A+ +  D +AF GC F GAQD L D  GRHY+K C+IQGS+DF
Sbjct  195   KNTSPVPKPGAAGKQAVALRVSADNAAFVGCRFLGAQDTLYDHSGRHYYKDCYIQGSVDF  254

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE+C +++IA +      G++TAQ R S  E +GFSF+ C V GSG ++LGR
Sbjct  255   IFGNALSLYEDCHVHAIARD-----YGALTAQNRQSMLEDTGFSFVNCRVTGSGALYLGR  309

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P+ W +W D  R+ TV++G+Y C GPGA  + R +++ +L
Sbjct  310   AWGTFSRVVFAYTHMDDIIVPNGWFNWGDPNRELTVFYGQYKCTGPGATYAGRVAWSHEL  369

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  370   TDDEAKPFISLSFIDGTEWV  389


 Score = 52.0 bits (123),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 62/115 (54%), Gaps = 8/115 (7%)
 Frame = +3

Query  420  VSMYNVSHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKIN  596
            V+  + S+ + VD +    +F ++Q A+D++P  + V  +I +++GTY EKV V   +  
Sbjct  83   VARASPSYSLVVDKDPALGDFTTIQAAVDSLPAINLVRVVIRVNAGTYTEKVTVSAMRAF  142

Query  597  LIIQGQGYLNTAISWNDTANstggtss-------sYTFGAFAPKFIAYNISFQVT  740
            + ++G G   T + W DTA+S  G          S +F   A  F+A NI+F+ T
Sbjct  143  ITLEGAGADKTVVQWGDTADSPTGPKGRPLGTFNSASFAVNAQYFLARNITFKNT  197



>ref|XP_010110876.1| putative pectinesterase 53 [Morus notabilis]
 gb|EXC28695.1| putative pectinesterase 53 [Morus notabilis]
Length=380

 Score =   223 bits (569),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 140/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P+ GA G QA+A  I  D + F GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  184   KNTTPVPAPGAIGKQAVAFRISADTATFLGCKFLGAQDTLYDHYGRHYYKDCYIEGSVDF  243

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C ++++A      ++G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  244   IFGNALSLFEGCHVHAVAQ-----LTGALTAQGRKSIMEDTGFSFVNCKVTGSGALYLGR  298

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++TVVF+ T M  ++ P  W +W D +R+ TV++G+Y C GPGA+ + R +++++L
Sbjct  299   AWGPFSTVVFAYTYMDNIIIPKGWYNWGDPSREMTVFYGQYKCTGPGANFAGRVAWSREL  358

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
                E  PF++ S+IDG +W+
Sbjct  359   TNEEVKPFISLSFIDGSEWI  378


 Score = 52.8 bits (125),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 56/108 (52%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S  +TV  N    +F S+Q AID++P  + V   I + +G Y EKV +   K  + I+G 
Sbjct  79   SFTLTVSKNPATGDFTSIQDAIDSLPFINLVRVAIKVHAGVYTEKVNIPPFKSFITIEGA  138

Query  615  GYLNTAISWNDTA------NstggtsssYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA          GT +S TF   +P FIA NI+F+ T
Sbjct  139  GADKTIVQWGDTAQTPGPRGQPLGTYASATFAVNSPYFIAKNITFKNT  186



>ref|XP_003630703.1| Pectinesterase [Medicago truncatula]
 gb|AET05179.1| pectinesterase [Medicago truncatula]
Length=381

 Score =   220 bits (561),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  GA G Q +A+ I  D + F GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  183   KNTAPIPKPGAVGKQGVALRISADTAMFLGCKFLGAQDTLYDHIGRHYYKDCYIEGSVDF  242

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA        G++TAQGR+S  E +GFSF+ C+V GSG ++LGR
Sbjct  243   IFGNALSLFEGCHVHAIAQN-----IGALTAQGRNSLLEDTGFSFVHCKVTGSGALYLGR  297

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  + R +++++L
Sbjct  298   AWGPFSRVVFAYTYMDNIIIPKGWYNWGDPNREMTVFYGQYKCTGPGASYAGRVAWSREL  357

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ +Y+DG +W+
Sbjct  358   TDEEAKPFISLNYVDGSEWI  377


 Score = 55.8 bits (133),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 8/101 (8%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
              F+S+Q AID++P  + V  +I + +G Y EKV++   K  + IQG G   T + W DT
Sbjct  88   GGFSSIQAAIDSLPFINLVRVVIKVHAGVYTEKVSIPALKSFITIQGAGADKTIVQWGDT  147

Query  651  ANstggtsssYTFGAFA--------PKFIAYNISFQVTHHI  749
            A +    +   T G +         P FIA NI+F+ T  I
Sbjct  148  ALTPNPGAKGQTLGTYGSATFAVNSPYFIAKNITFKNTAPI  188



>ref|NP_001167796.1| pectinesterase precursor [Zea mays]
 gb|ACN26093.1| unknown [Zea mays]
 tpg|DAA57696.1| TPA: pectinesterase [Zea mays]
Length=399

 Score =   224 bits (572),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 141/202 (70%), Gaps = 5/202 (2%)
 Frame = +2

Query  815   GGKNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSI  994
              G+NT+P P  GA G QA+A+ +  D +AF GC F GAQD L D  GRHY+K C+IQGS+
Sbjct  201   AGQNTSPVPKPGAAGKQAVALRVSADNAAFVGCRFLGAQDTLYDHSGRHYYKDCYIQGSV  260

Query  995   DFIFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWL  1174
             DFIFG A SLYE+C +++IA +      G++TAQ R S  E +GFSF+ C V GSG ++L
Sbjct  261   DFIFGNALSLYEDCHVHAIARD-----YGALTAQNRQSMLEDTGFSFVNCRVTGSGALYL  315

Query  1175  GRAWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAK  1354
             GRAWG+++ VVF+ T M  ++ P+ W +W D  R+ TV++G+Y C GPGA  + R +++ 
Sbjct  316   GRAWGTFSRVVFAYTHMDDIIVPNGWFNWGDPNRELTVFYGQYKCTGPGATYAGRVAWSH  375

Query  1355  QLDESEAAPFLTTSYIDGEDWL  1420
             +L + EA PF++ S+IDG +W+
Sbjct  376   ELTDDEAKPFISLSFIDGTEWV  397


 Score = 51.6 bits (122),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 61/113 (54%), Gaps = 8/113 (7%)
 Frame = +3

Query  420  VSMYNVSHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKIN  596
            V+  + S+ + VD +    +F ++Q A+D++P  + V  +I +++GTY EKV V   +  
Sbjct  83   VARASPSYSLVVDKDPALGDFTTIQAAVDSLPAINLVRVVIRVNAGTYTEKVTVSAMRAF  142

Query  597  LIIQGQGYLNTAISWNDTANstggtss-------sYTFGAFAPKFIAYNISFQ  734
            + ++G G   T + W DTA+S  G          S +F   A  F+A NI+F+
Sbjct  143  ITLEGAGADKTVVQWGDTADSPTGPKGRPLGTFNSASFAVNAQYFLARNITFK  195



>ref|XP_008656475.1| PREDICTED: probable pectinesterase 53 isoform X2 [Zea mays]
Length=396

 Score =   222 bits (565),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 137/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  GA G Q +A+ I  D +AF GC F GAQD L D  GRHY++ C+I+GS+DF
Sbjct  200   KNTAPVPRPGALGKQGVALRISADNAAFVGCNFLGAQDTLYDHLGRHYYRDCYIEGSVDF  259

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++IA        G++TAQ R S  E +GFSF+KC V GSG ++LGR
Sbjct  260   IFGNALSLYEGCHVHAIARN-----YGALTAQNRQSLLEDTGFSFVKCRVTGSGALYLGR  314

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D TR+ TV++G+Y C GPGA+ + R  ++++L
Sbjct  315   AWGTFSRVVFAYTYMDNIIIPRGWYNWGDPTREMTVFYGQYKCTGPGANYAGRVQWSREL  374

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++  +IDG  WL
Sbjct  375   TDEEAKPFISLDFIDGFQWL  394


 Score = 54.3 bits (129),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 65/123 (53%), Gaps = 6/123 (5%)
 Frame = +3

Query  405  WDSPLVSMYNVSHVITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKK  584
            ++ P +++     ++     G  +F S+Q A+D++P  +    +I +++GTY EKV +  
Sbjct  85   YNRPALTLLPARTLVVDRRPGAGDFTSIQAAVDSLPLINLARVVIRVNAGTYTEKVNISP  144

Query  585  SKINLIIQGQGYLNTAISWNDTANstggtsssY-TFGA--FAPK---FIAYNISFQVTHH  746
             +  + ++G G   T + W DTA++ G       TFG+  FA     F+A NI+F+ T  
Sbjct  145  MRAFVTVEGAGADKTVVQWGDTADTAGSWGRPMGTFGSATFAVNSMFFVAKNITFKNTAP  204

Query  747  ILR  755
            + R
Sbjct  205  VPR  207



>ref|XP_009591684.1| PREDICTED: probable pectinesterase 53 [Nicotiana tomentosiformis]
Length=380

 Score =   223 bits (568),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P+ GA G QA+A  I  D +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  184   KNTTPVPAAGAIGKQAVAFRISADTAAFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDF  243

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   S +E C +++IA      ++G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  244   IFGNGLSFFEGCHLHAIAP-----VTGAVTAQGRSSMLEDTGFSFVNCKVTGSGALYLGR  298

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W++W D  R+ TV+FG+Y C GPGA  + R S+ ++L
Sbjct  299   AWGPFSRVVFAYTYMDNIIIPKGWHNWGDPLREMTVFFGQYKCSGPGASFAGRVSWCREL  358

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  359   TDQEAKPFISLSFIDGSEWI  378


 Score = 52.8 bits (125),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 58/108 (54%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGC-ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S  +TVD N    +F S+Q AID++P  + +  +I I +G Y EKV +   K  + I+G 
Sbjct  79   SFTLTVDKNPSHGDFTSIQDAIDSLPFVNLIRVVIKIHAGVYTEKVNIPPFKSFITIEGA  138

Query  615  GYLNTAISWNDTANstg------gtsssYTFGAFAPKFIAYNISFQVT  740
            G   T I W DTA + G      GT  S TF   +P F A NI+F+ T
Sbjct  139  GADKTIIQWGDTAQTPGPNGKPLGTFGSATFAVNSPYFQAKNITFKNT  186



>ref|XP_002440102.1| hypothetical protein SORBIDRAFT_09g026060 [Sorghum bicolor]
 gb|EES18532.1| hypothetical protein SORBIDRAFT_09g026060 [Sorghum bicolor]
Length=406

 Score =   221 bits (562),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 137/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  GA G Q +A+ I  D +AF GC F GAQD L D  GRHY++ C+I+GS+DF
Sbjct  210   KNTAPVPRPGALGKQGVALRISADNAAFVGCNFLGAQDTLYDHLGRHYYRDCYIEGSVDF  269

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++IA        G++TAQ R S  E +GFSF+ C V GSG ++LGR
Sbjct  270   IFGNALSLYEGCHVHAIARN-----YGALTAQNRQSLLEDTGFSFVNCRVTGSGALYLGR  324

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D TR+ TV++G+Y C GPGA+ + R  ++++L
Sbjct  325   AWGTFSRVVFAYTYMDNIIIPRGWYNWGDPTREMTVFYGQYKCTGPGANYAGRVQWSREL  384

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++  +IDG +WL
Sbjct  385   TDEEAKPFISLDFIDGFEWL  404


 Score = 55.5 bits (132),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 67/126 (53%), Gaps = 7/126 (6%)
 Frame = +3

Query  399  SKWDSPLVSMYNVSHVITVDLNGCA-NFASVQKAIDAVPDFSPVATLIIIDSGTYREKVA  575
            S ++  L   +  +  + VD N  A NF S+Q A+D++P  +    +I +++GTY EKV 
Sbjct  92   SSYNRALNRAFLPTRTLVVDKNPAAGNFTSIQAAVDSLPLINLARVVIRVNAGTYTEKVN  151

Query  576  VKKSKINLIIQGQGYLNTAISWNDTANstggtsssY-TFGA--FAPK---FIAYNISFQV  737
            +   +  + ++G G   T + W DTA++ G       TFG+  FA     F+A NI+F+ 
Sbjct  152  ISPMRAFVTVEGAGADKTVVQWGDTADTAGSFGRPMGTFGSATFAVNSMFFVAKNITFKN  211

Query  738  THHILR  755
            T  + R
Sbjct  212  TAPVPR  217



>ref|XP_011078244.1| PREDICTED: probable pectinesterase 53 [Sesamum indicum]
Length=380

 Score =   219 bits (558),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A  I  D +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  184   KNTTPVPPPGAVGKQAVAFRISADTAAFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDF  243

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA      I G++TAQGR S  + +GFSF+ C+V GSG ++LGR
Sbjct  244   IFGNALSLFENCHVHAIAP-----IIGAVTAQGRSSILDDTGFSFVNCKVTGSGALYLGR  298

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C G GA  + R S++++L
Sbjct  299   AWGPFSRVVFAYTYMDNIIIPKGWYNWGDPSREMTVFYGQYKCTGAGASFAGRVSWSREL  358

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ ++IDG +W+
Sbjct  359   TDEEAKPFISLTFIDGSEWI  378


 Score = 56.6 bits (135),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ + VD N    +F S+Q AID++P  + V  +I + +G Y EKV + + K  + I+G 
Sbjct  79   SYTLKVDRNPAYGDFTSIQDAIDSLPMVNLVRVVIKVHAGVYTEKVTIPQLKSFITIEGA  138

Query  615  GYLNTAISWNDTANst------ggtsssYTFGAFAPKFIAYNISFQVT  740
            G   T + W DTA +        GT  S TF   +P FIA NI+F+ T
Sbjct  139  GADKTIVQWGDTAQTAGPKGQPLGTYGSATFAVNSPYFIAKNITFKNT  186



>ref|XP_001774315.1| predicted protein [Physcomitrella patens]
 gb|EDQ60817.1| predicted protein [Physcomitrella patens]
Length=286

 Score =   226 bits (576),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 143/199 (72%), Gaps = 4/199 (2%)
 Frame = +2

Query  824   NTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDFI  1003
             N+AP P  GA G QA+A+ + GD++AFY C FYGAQD L  + GR Y++ C+IQGSID+I
Sbjct  92    NSAPAPPGGAVGKQAVALRVQGDKAAFYRCYFYGAQDTLYAKEGRQYYRNCYIQGSIDWI  151

Query  1004  FGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGRA  1183
             FG AR+L+ +C INSIA +     SGSITAQ R+S +E +GFSF+ C++ GSG ++LGRA
Sbjct  152   FGNARALFHKCHINSIAFKN----SGSITAQKRESNKEATGFSFVGCKITGSGTIYLGRA  207

Query  1184  WGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQLD  1363
             WG+++ VVF +  M  ++ P  W DWND  R +TVY+GEY C GPGA+   R+ +++ L 
Sbjct  208   WGTHSRVVFIRCYMQNMILPIGWQDWNDPARHKTVYYGEYLCSGPGANRKGRAKWSRALT  267

Query  1364  ESEAAPFLTTSYIDGEDWL  1420
             + EA PF T  +I+G++WL
Sbjct  268   KKEAEPFSTVKFINGKNWL  286



>ref|XP_002871903.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48162.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=386

 Score =   221 bits (564),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A+ I  D +AF+GC   GAQD L D  GRHY+K C+I+GS+DF
Sbjct  190   KNTTPVPLPGAVGKQAVALRISADNAAFFGCRMLGAQDTLYDHLGRHYYKDCYIEGSVDF  249

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++IA++      G++TAQGR S  E +GFSF+KC+V G+G ++LGR
Sbjct  250   IFGNALSLYEGCHVHAIADK-----LGAVTAQGRSSVLEDTGFSFVKCKVTGTGVLYLGR  304

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C G GA+   R ++A++L
Sbjct  305   AWGPFSRVVFAYTYMDNIILPRGWYNWGDPSREMTVFYGQYKCTGAGANYGGRVAWAREL  364

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PFL+ ++IDG +W+
Sbjct  365   TDEEAKPFLSLTFIDGSEWI  384


 Score = 54.3 bits (129),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 54/96 (56%), Gaps = 6/96 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F  +Q AID++P  + V  +I + +G Y+EKV +   K  + I+G+G   T + W DT
Sbjct  97   GDFTKIQDAIDSLPLINFVRVVIKVHAGVYKEKVNILPMKAFITIEGEGAEKTTVEWGDT  156

Query  651  A---NstggtsssYTFGAFA---PKFIAYNISFQVT  740
            A   +S G    +Y   +FA   P F+A NI+F+ T
Sbjct  157  AQTPDSKGNPMGTYNSASFAVNSPFFVAKNITFKNT  192



>ref|NP_197474.1| probable pectinesterase 53 [Arabidopsis thaliana]
 sp|Q8VYZ3.1|PME53_ARATH RecName: Full=Probable pectinesterase 53; Short=PE 53; AltName: 
Full=Pectin methylesterase 53; Short=AtPME53; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL38872.1| putative pectin methylesterase [Arabidopsis thaliana]
 gb|AAM20209.1| putative pectin methylesterase [Arabidopsis thaliana]
 gb|AED92743.1| probable pectinesterase 53 [Arabidopsis thaliana]
Length=383

 Score =   220 bits (560),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             +NT P P  GA G QA+A+ +  D +AF+GC   GAQD L D  GRHY+K C+I+GS+DF
Sbjct  187   RNTTPVPLPGAVGKQAVALRVSADNAAFFGCRMLGAQDTLYDHLGRHYYKDCYIEGSVDF  246

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++IA++      G++TAQGR S  E +GFSF+KC+V G+G ++LGR
Sbjct  247   IFGNALSLYEGCHVHAIADK-----LGAVTAQGRSSVLEDTGFSFVKCKVTGTGVLYLGR  301

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C G GA+   R ++A++L
Sbjct  302   AWGPFSRVVFAYTYMDNIILPRGWYNWGDPSREMTVFYGQYKCTGAGANYGGRVAWAREL  361

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PFL+ ++IDG +W+
Sbjct  362   TDEEAKPFLSLTFIDGSEWI  381


 Score = 55.8 bits (133),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 55/96 (57%), Gaps = 6/96 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F  +Q AID++P  + V  +I + +G Y+EKV++   K  + I+G+G   T + W DT
Sbjct  94   GDFTKIQDAIDSLPLINFVRVVIKVHAGVYKEKVSIPPLKAFITIEGEGAEKTTVEWGDT  153

Query  651  A---NstggtsssYTFGAFA---PKFIAYNISFQVT  740
            A   +S G    +Y   +FA   P F+A NI+F+ T
Sbjct  154  AQTPDSKGNPMGTYNSASFAVNSPFFVAKNITFRNT  189



>ref|XP_010688346.1| PREDICTED: probable pectinesterase 53 [Beta vulgaris subsp. vulgaris]
Length=402

 Score =   218 bits (554),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 137/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A  I  D +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  206   KNTTPVPQPGAVGAQAVAFRISADTAAFVGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDF  265

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SL+E C ++++A        G++TAQGR S  + +GFSF+ C+V GSG ++LGR
Sbjct  266   IFGNGLSLFEGCHVHAVAIR-----YGALTAQGRSSMLDDTGFSFVNCKVTGSGALYLGR  320

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ V+F+ T M  ++ P  W +W D +R+ TV++G+Y C GPGA  + R +++++L
Sbjct  321   AWGPFSRVIFAYTYMDNIIMPKGWYNWGDPSREMTVFYGQYKCTGPGASYAGRVAWSREL  380

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  381   TDEEAGPFISLSFIDGSEWI  400


 Score = 57.8 bits (138),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 6/96 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F ++Q AID++P  + V  +I + +GTY EKV +   K  + I+G+G  NT + W DT
Sbjct  113  GDFTTIQDAIDSLPAINFVRVIIKVKAGTYSEKVYIPPLKAFITIEGEGADNTIVEWGDT  172

Query  651  A------NstggtsssYTFGAFAPKFIAYNISFQVT  740
            A          GT +S TF   +P F+A NI+F+ T
Sbjct  173  AKTIGPNGKPLGTFNSATFAVNSPYFMAKNITFKNT  208



>ref|XP_009802490.1| PREDICTED: probable pectinesterase 53 [Nicotiana sylvestris]
Length=372

 Score =   222 bits (565),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 137/201 (68%), Gaps = 5/201 (2%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GA G QA+A+ I  D +AF  C F GAQD L D RGRHYFK C+IQGS+DF
Sbjct  175   KNVAPPPPSGALGKQAVALRISADTAAFINCKFIGAQDTLYDHRGRHYFKNCYIQGSVDF  234

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLYE C +N+          G++TAQ R+S  E++GFSF+ C+V GSG ++LGR
Sbjct  235   IFGDGLSLYENCHLNAKTKS-----YGALTAQKRESMLEETGFSFVNCKVTGSGALYLGR  289

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ V+F+ T M ++++   W DW D  R  TV++G++ C GPGA+   R  ++++L
Sbjct  290   AWGTFSRVIFAYTYMDKIITSKGWYDWGDKNRHMTVFYGQFKCSGPGANHGGRVKWSREL  349

Query  1361  DESEAAPFLTTSYIDGEDWLI  1423
              E EA PF++ S+IDG +WL+
Sbjct  350   TEQEANPFVSLSFIDGHEWLL  370


 Score = 53.5 bits (127),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 51/94 (54%), Gaps = 6/94 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F +VQ+AID++P  +    +I +  G YREK+ +  +   + ++G     T I W+DT
Sbjct  82   GDFTTVQEAIDSIPIANSCRVVISVSPGIYREKIEIPATMAYITLEGASSRKTTIKWDDT  141

Query  651  ANst------ggtsssYTFGAFAPKFIAYNISFQ  734
            A+         GT  S TF   +P FIA NI+F+
Sbjct  142  ADRVGKDGQPMGTYGSATFAVNSPYFIAKNITFK  175



>ref|XP_004251642.1| PREDICTED: probable pectinesterase 53 [Solanum lycopersicum]
Length=378

 Score =   222 bits (566),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 137/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A  I  D +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  182   KNTTPVPPPGAIGKQAVAFRISADTAAFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDF  241

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   S +E C +++IA      ++G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  242   IFGNGLSFFEGCHLHAIAQ-----VTGAVTAQGRSSMLEDTGFSFVNCKVTGSGALYLGR  296

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ V+F+ T M  ++ P  W++W D  R+ TV++G+Y C GPGA  + R S+ ++L
Sbjct  297   AWGPFSRVIFAYTYMDNIIIPKGWHNWGDPLREMTVFYGQYKCSGPGASFAGRVSWCREL  356

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              E EA PF++ S+IDG +W+
Sbjct  357   TEQEAKPFISLSFIDGSEWI  376


 Score = 53.1 bits (126),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (56%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGC-ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ + VD N    +F S+Q+AID++P  + +  +I I +G Y EKV +   K  + I+G+
Sbjct  77   SYTLIVDKNPSHGDFTSIQEAIDSLPFINLIRVVIKIHAGIYTEKVNIPPFKSFITIEGE  136

Query  615  GYLNTAISWNDTANs------tggtsssYTFGAFAPKFIAYNISFQVT  740
            G  NT I + DTA +        GT  S TF   +P F A NI+F+ T
Sbjct  137  GADNTIIQYGDTAQTIGPNGKPLGTFGSATFAVNSPYFQAKNITFKNT  184



>ref|XP_011031878.1| PREDICTED: probable pectinesterase 68 [Populus euphratica]
Length=367

 Score =   210 bits (534),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 137/204 (67%), Gaps = 6/204 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  G  G QA A  I GD++ F GCGFYGAQD L D  GRHYFK+C+I+GSIDF
Sbjct  167   KNTAPAPMPGMQGWQAAAFRISGDKAYFAGCGFYGAQDTLCDDAGRHYFKECYIEGSIDF  226

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RS+Y +C+++SIA        GSI AQ R+S +EK+GF+FL C V G+G +++GR
Sbjct  227   IFGNGRSMYRDCELHSIATR-----FGSIAAQDRNSPDEKTGFAFLNCRVTGTGPLYVGR  281

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWND-STRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             A G Y+ +V+S T    VV+   W+DW+  S +++TV+FG Y C GPGA      S+A++
Sbjct  282   AMGQYSRIVYSYTYFDNVVAHGGWDDWDHASNKNKTVFFGVYKCWGPGAAAVQGVSWARE  341

Query  1358  LDESEAAPFLTTSYIDGEDWLIPT  1429
             LD   A  FL  S+++G  W+ P+
Sbjct  342   LDYESAHKFLAKSFVNGRHWIAPS  365


 Score = 65.5 bits (158),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 56/104 (54%), Gaps = 6/104 (6%)
 Frame = +3

Query  447  ITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLN  626
            ITVD+NG   F SVQ A+DAVP+ +    +I+I +G Y EKV V  SK  +  QG+G   
Sbjct  66   ITVDVNGAGEFLSVQAAVDAVPENNGENVMILISAGYYIEKVTVPASKPYITFQGEGRDV  125

Query  627  TAISWNDTA------NstggtsssYTFGAFAPKFIAYNISFQVT  740
            T I W+D A           T  + +   FA  F A NISF+ T
Sbjct  126  TIIEWHDRACDRGANGQQLRTYRTASVSVFANYFSARNISFKNT  169



>gb|KHG26932.1| putative pectinesterase 53 -like protein [Gossypium arboreum]
Length=378

 Score =   221 bits (564),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 140/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P+ GA G QA+A  I  D + F GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  182   KNTAPIPAPGAIGKQAVAFRISADTATFVGCRFLGAQDTLYDHFGRHYYKDCYIEGSVDF  241

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E C +++IA      ++G++TAQ R S  + +GFSF+KC+V GSG ++LGR
Sbjct  242   IFGNALSLFEGCHVHAIAR-----LTGAVTAQNRGSILDDTGFSFVKCKVTGSGALYLGR  296

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  + R S++++L
Sbjct  297   AWGPFSRVVFAYTYMDNIILPKGWYNWGDPNREMTVFYGQYKCTGPGASFAGRVSWSREL  356

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +W+
Sbjct  357   TDEEAKPFISLSFIDGSEWI  376


 Score = 53.5 bits (127),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 55/108 (51%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLN-GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S  ITVD N    +F  +Q AID++P  + V  +I + +G Y EKV +   K  + I+G 
Sbjct  77   SRTITVDKNPKYGDFTKIQDAIDSLPFINLVRVVIKVHAGVYTEKVNIPPLKAFITIEGA  136

Query  615  GYLNTAISWNDTANstggtsssY------TFGAFAPKFIAYNISFQVT  740
            G   T + W DTA + G            TF   +P FIA +I+F+ T
Sbjct  137  GADKTIVQWGDTAQTPGARGQPLGTYGSATFAVNSPYFIAKHITFKNT  184



>emb|CDP01931.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   220 bits (560),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KN AP P  GA G QA A+ I  D +AF GC F GAQD L D +GRHYF+ C+IQGS+DF
Sbjct  124   KNKAPAPPSGALGKQAAALRISADTAAFIGCRFIGAQDTLYDHKGRHYFRDCYIQGSVDF  183

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   SLYE C + +  N       G++TAQ R+S  E++GFSF+ C+V GSG ++LGR
Sbjct  184   IFGDGLSLYENCHLRAKTNS-----YGALTAQKRESMLEETGFSFVNCKVTGSGALYLGR  238

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWGS++ VVF+ T M ++++P  W +W D  R+ TV++ ++ C GPGA+   R S++++L
Sbjct  239   AWGSFSRVVFAYTYMDKIITPRGWYNWGDKNREMTVFYAQFKCSGPGANFGGRVSWSREL  298

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +WL
Sbjct  299   TQQEAKPFISLSFIDGREWL  318


 Score = 55.1 bits (131),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 55/94 (59%), Gaps = 6/94 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             ++ +V+KAI+A+P  +    +I + +GTY+EK+ +  +   + ++G G   T I WNDT
Sbjct  31   GDYTTVRKAINAIPIINNCRVIISVSAGTYKEKIEIPATMAYVSLEGAGAGETIIQWNDT  90

Query  651  ANstg------gtsssYTFGAFAPKFIAYNISFQ  734
            A   G      GT +S TF   AP FIA +I+F+
Sbjct  91   AEEKGPNGQPLGTYASATFAVNAPYFIAKDITFK  124



>ref|XP_006353578.1| PREDICTED: probable pectinesterase 53-like [Solanum tuberosum]
Length=376

 Score =   222 bits (565),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 137/200 (69%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A  I  D +AF GC F GAQD L D  GRHY+K C+I+GS+DF
Sbjct  180   KNTTPVPPPGAIGKQAVAFRISADTAAFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDF  239

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG   S +E C +++IA      ++G++TAQGR S  E +GFSF+ C+V GSG ++LGR
Sbjct  240   IFGNGLSFFEGCHLHAIAQ-----VTGAVTAQGRSSMLEDTGFSFVNCKVTGSGALYLGR  294

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ V+F+ T M  ++ P  W++W D  R+ TV++G+Y C GPGA  + R S+ ++L
Sbjct  295   AWGPFSRVIFAYTYMDNIIIPKGWHNWGDPLREMTVFYGQYKCSGPGASFAGRVSWCREL  354

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              E EA PF++ S+IDG +W+
Sbjct  355   TEQEAKPFISLSFIDGYEWI  374


 Score = 53.1 bits (126),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (56%), Gaps = 7/108 (6%)
 Frame = +3

Query  438  SHVITVDLNGC-ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ + VD N    +F S+Q+AID++P  + +  +I I +G Y EKV +   K  + I+G+
Sbjct  75   SYTLIVDKNPSHGDFTSIQEAIDSLPFINLIRVVIKIHAGIYTEKVNISPFKSFITIEGE  134

Query  615  GYLNTAISWNDTANst------ggtsssYTFGAFAPKFIAYNISFQVT  740
            G  NT I + DTA +        GT  S TF   +P F A NI+F+ T
Sbjct  135  GADNTIIQYGDTAQTIGPNGKPLGTFGSATFAVNSPYFQAKNITFKNT  182



>ref|XP_008437714.1| PREDICTED: probable pectinesterase 68, partial [Cucumis melo]
Length=363

 Score =   215 bits (548),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 141/204 (69%), Gaps = 6/204 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  G  G QA A  I GD++ F GCGFYGAQD L D  GRHYFK+C+I+GSIDF
Sbjct  163   KNTAPAPLPGMQGWQAAAFRISGDKAYFSGCGFYGAQDTLCDDAGRHYFKECYIEGSIDF  222

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RS+Y++C+++SIA        GSI AQ R+S  EK+GF+FL+C+V GSG +++GR
Sbjct  223   IFGNGRSMYKDCELHSIATR-----FGSIAAQDRNSPHEKTGFAFLRCKVTGSGPIYVGR  277

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWND-STRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             A G Y+ +V++ T    VV+   W+DW+  S +++TV+FG Y C GPGA      S+AK+
Sbjct  278   AMGQYSRIVYAYTYFDDVVAHGGWDDWDHVSNKNKTVFFGVYKCWGPGASKVKGVSWAKE  337

Query  1358  LDESEAAPFLTTSYIDGEDWLIPT  1429
             L+  EA PFL  S+++G  W+ P+
Sbjct  338   LEYKEAHPFLAKSFVNGRHWIAPS  361


 Score = 59.3 bits (142),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 58/106 (55%), Gaps = 7/106 (7%)
 Frame = +3

Query  444  VITVDLNGCAN-FASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGY  620
            +I V++NG ++ F SVQ A+D++PD++ V T+I I  G Y EKV V  +K  +  +G G 
Sbjct  60   LIKVNVNGGSDVFLSVQAAVDSIPDYNTVNTIIRISPGYYVEKVVVPATKPYITFEGGGK  119

Query  621  LNTAISWNDTANstggtsssY------TFGAFAPKFIAYNISFQVT  740
              T I W+D A   G +          +   FA  F A NISF+ T
Sbjct  120  ETTVIEWHDRAGDRGPSGQQLRTYRTASVTVFANYFSARNISFKNT  165



>ref|XP_009120862.1| PREDICTED: probable pectinesterase 53 [Brassica rapa]
 emb|CDX92506.1| BnaA10g15450D [Brassica napus]
Length=382

 Score =   222 bits (565),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 142/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT P P  GA G QA+A+ +  D +AF+GC   GAQD L D  GRHY+K C+I+GS+DF
Sbjct  186   KNTTPVPLPGAVGKQAVALRVSADNAAFFGCKMLGAQDTLYDHLGRHYYKDCYIEGSVDF  245

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++IA++      G++TAQGR S  E +GFSF+KC+V G+G ++LGR
Sbjct  246   IFGNALSLYEGCHVHAIADK-----LGAVTAQGRSSVLEDTGFSFVKCKVTGTGVLYLGR  300

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG ++ VVF+ T M  ++ P  W +W D +R+ TV++G+Y C G GA+ + R ++A++L
Sbjct  301   AWGPFSRVVFAYTYMDNIILPKGWYNWGDPSREMTVFYGQYKCTGAGANYAGRVAWAREL  360

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ ++IDG +W+
Sbjct  361   TDEEAKPFISLTFIDGSEWI  380


 Score = 52.8 bits (125),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 54/96 (56%), Gaps = 6/96 (6%)
 Frame = +3

Query  471  ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQGYLNTAISWNDT  650
             +F  +Q AID++P  + V  +I + +G Y+EKV +   K  + I+G+G   T + W DT
Sbjct  93   GDFTKIQDAIDSLPLINLVRVVIKVHAGVYKEKVNIPPMKAFITIEGEGADKTIVQWGDT  152

Query  651  ANst------ggtsssYTFGAFAPKFIAYNISFQVT  740
            A +        GT +S +F   +P F+A NI+F+ T
Sbjct  153  AQTHDPKGNPMGTFNSASFAVNSPFFVAKNITFKNT  188



>ref|XP_003566023.2| PREDICTED: probable pectinesterase 53 [Brachypodium distachyon]
Length=334

 Score =   223 bits (567),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 139/200 (70%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  GA G Q +A+ I  D +AF GC F GAQD L D  GRHY++ C+I+GS+DF
Sbjct  138   KNTAPVPRPGALGKQGVALRISADNAAFVGCNFLGAQDTLYDHLGRHYYRDCYIEGSVDF  197

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SLYE C +++I+        G++TAQGR S  + +GFSFL C V GSG ++LGR
Sbjct  198   IFGNALSLYEGCHVHAISPR-----YGALTAQGRTSLLDDTGFSFLNCRVTGSGALYLGR  252

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D TR+ TV++G+Y C GPGA+ + R  ++++L
Sbjct  253   AWGTFSRVVFAYTYMDNIIIPRGWYNWGDPTREMTVFYGQYKCTGPGANYAGRVDWSREL  312

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ S+IDG +WL
Sbjct  313   TDEEAKPFISLSFIDGLEWL  332


 Score = 52.0 bits (123),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 9/106 (8%)
 Frame = +3

Query  465  GCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQG-QGYLNTAISW  641
            G  NF S+Q A+D++P  +    +I ++ GTY EKV +   +  + ++G  G   T + W
Sbjct  40   GAGNFTSIQAAVDSLPLINLARVVIRVNPGTYTEKVNISPMRGFVTVEGAAGAEKTVVQW  99

Query  642  NDTANstggtsssYTFGAFAPK--------FIAYNISFQVTHHILR  755
             DTA + G        G FA          F+A NI+F+ T  + R
Sbjct  100  GDTAETAGPWGRRSPLGTFASATFAVNAQFFVAKNITFKNTAPVPR  145



>ref|XP_006477195.1| PREDICTED: probable pectinesterase 68-like [Citrus sinensis]
Length=359

 Score =   207 bits (528),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 138/204 (68%), Gaps = 6/204 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  G  G QA A  I GD++ F GCGFYGAQD L D  GRHYFK+C+I+GSIDF
Sbjct  159   KNTAPAPLPGMQGWQAAAFRISGDKAYFSGCGFYGAQDTLCDDAGRHYFKECYIEGSIDF  218

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RSLY++C+++SIA        GSI A  R S +EK+GF+F++C V G+G +++GR
Sbjct  219   IFGNGRSLYKDCELHSIATR-----FGSIAAHDRKSPDEKTGFAFVRCRVTGTGPLYVGR  273

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWND-STRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             A G Y+ +V+S T    +V+   W+DW+  S +++T +FG Y C GPGA     +S+A++
Sbjct  274   AMGQYSRIVYSFTYFDDLVAHGGWDDWDHISNKNKTAFFGVYKCWGPGAANVRGASWARE  333

Query  1358  LDESEAAPFLTTSYIDGEDWLIPT  1429
             LD   A PFL  S+++G  W+ P+
Sbjct  334   LDYESAHPFLVKSFVNGRHWIAPS  357


 Score = 67.0 bits (162),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 61/120 (51%), Gaps = 13/120 (11%)
 Frame = +3

Query  402  KWDSPLVSMYNVSH-VITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAV  578
            KW  P      V H VITVD+NG   F SVQ A+D+VP+ + +  LI I +G Y EKV V
Sbjct  48   KWIGP------VGHRVITVDVNGSGEFKSVQAAVDSVPERNRMNVLIQISAGCYIEKVTV  101

Query  579  KKSKINLIIQGQGYLNTAISWNDTA------NstggtsssYTFGAFAPKFIAYNISFQVT  740
              SK  +  QG G   T I W+D A           T  + +   FA  F A NISF+ T
Sbjct  102  PVSKPYITFQGAGRDRTVIEWHDRACDRGANGQQLRTYQTASVTVFANYFSARNISFKNT  161



>gb|KDO61446.1| hypothetical protein CISIN_1g018249mg [Citrus sinensis]
Length=359

 Score =   207 bits (528),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 138/204 (68%), Gaps = 6/204 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNTAP P  G  G QA A  I GD++ F GCGFYGAQD L D  GRHYFK+C+I+GSIDF
Sbjct  159   KNTAPAPLPGMQGWQAAAFRISGDKAYFSGCGFYGAQDTLCDDAGRHYFKECYIEGSIDF  218

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG  RS+Y++C+++SIA        GSI A  R S +EK+GF+F++C V G+G +++GR
Sbjct  219   IFGNGRSMYKDCELHSIATR-----FGSIAAHDRKSPDEKTGFAFVRCRVTGTGPLYVGR  273

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWND-STRDQTVYFGEYDCRGPGADCSNRSSYAKQ  1357
             A G Y+ +V+S T    +V+   W+DW+  S +++T +FG Y C GPGA     +S+A++
Sbjct  274   AMGQYSRIVYSFTYFDDLVAHGGWDDWDHISNKNKTAFFGVYKCWGPGAANVRGASWARE  333

Query  1358  LDESEAAPFLTTSYIDGEDWLIPT  1429
             LD   A PFL  S+I+G  W+ P+
Sbjct  334   LDYESAHPFLVKSFINGRHWIAPS  357


 Score = 67.0 bits (162),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 61/120 (51%), Gaps = 13/120 (11%)
 Frame = +3

Query  402  KWDSPLVSMYNVSH-VITVDLNGCANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAV  578
            KW  P      V H VITVD+NG   F SVQ A+D+VP+ + +  LI I +G Y EKV V
Sbjct  48   KWIGP------VGHRVITVDVNGSGEFKSVQAAVDSVPERNRMNVLIQISAGCYIEKVTV  101

Query  579  KKSKINLIIQGQGYLNTAISWNDTA------NstggtsssYTFGAFAPKFIAYNISFQVT  740
              SK  +  QG G   T I W+D A           T  + +   FA  F A NISF+ T
Sbjct  102  PVSKPYITFQGAGRDRTVIEWHDRACDRGANGQQLRTYQTASVTVFANYFSARNISFKNT  161



>ref|NP_001044216.1| Os01g0743200 [Oryza sativa Japonica Group]
 dbj|BAB91933.1| pectin methyl esterase-like [Oryza sativa Japonica Group]
 dbj|BAF06130.1| Os01g0743200 [Oryza sativa Japonica Group]
 gb|EAY75779.1| hypothetical protein OsI_03695 [Oryza sativa Indica Group]
 gb|EAZ13496.1| hypothetical protein OsJ_03413 [Oryza sativa Japonica Group]
 dbj|BAG93545.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97491.1| unnamed protein product [Oryza sativa Japonica Group]
Length=384

 Score =   223 bits (569),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 142/200 (71%), Gaps = 5/200 (3%)
 Frame = +2

Query  821   KNTAPQPSQGATGGQALAISILGDQSAFYGCGFYGAQDILNDQRGRHYFKQCFIQGSIDF  1000
             KNT+P P  GA+G QA+A+ +  D +AF GC F GAQD L D  GRHY+K+C+I+GS+DF
Sbjct  188   KNTSPVPKPGASGKQAVALRVSADNAAFVGCRFLGAQDTLYDHSGRHYYKECYIEGSVDF  247

Query  1001  IFGKARSLYEECKINSIANEGGGGISGSITAQGRDSEEEKSGFSFLKCEVGGSGKVWLGR  1180
             IFG A SL+E+C +++IA +      G++TAQ R S  E +GFSF+ C V GSG ++LGR
Sbjct  248   IFGNALSLFEDCHVHAIARD-----YGALTAQNRQSMLEDTGFSFVNCRVTGSGALYLGR  302

Query  1181  AWGSYATVVFSKTQMSQVVSPDAWNDWNDSTRDQTVYFGEYDCRGPGADCSNRSSYAKQL  1360
             AWG+++ VVF+ T M  ++ P  W +W D  R+ TV++G+Y C GPGA  S R S++++L
Sbjct  303   AWGTFSRVVFAYTYMDDIIIPRGWYNWGDPNRELTVFYGQYKCTGPGASFSGRVSWSREL  362

Query  1361  DESEAAPFLTTSYIDGEDWL  1420
              + EA PF++ ++IDG +W+
Sbjct  363   TDEEAKPFISLTFIDGTEWV  382


 Score = 51.2 bits (121),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 62/109 (57%), Gaps = 8/109 (7%)
 Frame = +3

Query  438  SHVITVDLNGC-ANFASVQKAIDAVPDFSPVATLIIIDSGTYREKVAVKKSKINLIIQGQ  614
            S+ + VD N    +F ++Q A+D++P  + V  +I +++GTY EKV +   +  + ++G 
Sbjct  82   SYSLVVDKNPAFGDFTTIQAAVDSLPIINLVRVVIKVNAGTYTEKVNISPMRAFITLEGA  141

Query  615  GYLNTAISWNDTANstggts----ssYTFGAFAPK---FIAYNISFQVT  740
            G   T + W DTA+S  G +     +Y+  +FA     F+A NI+F+ T
Sbjct  142  GADKTIVQWGDTADSPSGRAGRPLGTYSSASFAVNAQYFLARNITFKNT  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6337946833044