BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25429_g1_i6 len=2810 path=[8755:0-271 13304:272-273 13306:274-278
13311:279-282 13315:283-299 9053:300-416 6313:417-451 6348:452-494
13396:495-535 6431:536-648 6544:649-651 6547:652-809 6703:810-831
6725:832-889 6783:890-902 6796:903-959 6853:960-966 6860:967-1008
6899:1009-1034 4993:1035-1046 5005:1047-1093 5052:1094-1139
13637:1140-1151 13025:1152-1157 7045:1158-1186 4702:1187-1194
4710:1195-1220 5460:1221-1260 3969:1261-1379 4088:1380-1413
4122:1414-1694 40:1695-1719 4486:1720-1756 111:1757-1790
145:1791-1824 757:1825-1993 926:1994-2135 1068:2136-2371
1304:2372-2809]

Length=2810
                                                                      Score     E

ref|XP_009616697.1|  PREDICTED: p21-activated protein kinase-inte...    425   6e-137   
ref|XP_009801369.1|  PREDICTED: p21-activated protein kinase-inte...    410   3e-131   
ref|XP_011096613.1|  PREDICTED: p21-activated protein kinase-inte...    404   6e-129   
emb|CDP18133.1|  unnamed protein product                                393   1e-124   
gb|EYU33395.1|  hypothetical protein MIMGU_mgv1a009556mg                390   9e-124   
ref|XP_006347093.1|  PREDICTED: p21-activated protein kinase-inte...    385   1e-121   
ref|XP_004232823.1|  PREDICTED: p21-activated protein kinase-inte...    382   2e-120   
ref|XP_002318775.2|  hypothetical protein POPTR_0012s10930g             373   5e-117   Populus trichocarpa [western balsam poplar]
ref|XP_002267244.1|  PREDICTED: p21-activated protein kinase-inte...    372   2e-116   Vitis vinifera
ref|XP_011042988.1|  PREDICTED: p21-activated protein kinase-inte...    371   2e-116   
ref|XP_008225515.1|  PREDICTED: p21-activated protein kinase-inte...    371   3e-116   
ref|XP_007214716.1|  hypothetical protein PRUPE_ppa008201mg             371   3e-116   
ref|XP_008371777.1|  PREDICTED: p21-activated protein kinase-inte...    371   3e-116   
gb|KDO75412.1|  hypothetical protein CISIN_1g019326mg                   370   6e-116   
ref|XP_002534379.1|  pak inhibitor skb15, putative                      369   2e-115   Ricinus communis
gb|KDO75411.1|  hypothetical protein CISIN_1g019326mg                   367   1e-114   
gb|KDP38003.1|  hypothetical protein JCGZ_04646                         366   3e-114   
ref|XP_006468054.1|  PREDICTED: p21-activated protein kinase-inte...    364   1e-113   
ref|XP_006449010.1|  hypothetical protein CICLE_v10015824mg             362   1e-112   
ref|XP_008356035.1|  PREDICTED: p21-activated protein kinase-inte...    361   2e-112   
ref|XP_008439607.1|  PREDICTED: p21-activated protein kinase-inte...    361   2e-112   
ref|XP_004134619.1|  PREDICTED: p21-activated protein kinase-inte...    360   7e-112   
ref|XP_008364194.1|  PREDICTED: LOW QUALITY PROTEIN: p21-activate...    359   8e-112   
ref|XP_009360927.1|  PREDICTED: p21-activated protein kinase-inte...    358   1e-111   
ref|XP_010246113.1|  PREDICTED: p21-activated protein kinase-inte...    358   2e-111   
ref|XP_010087006.1|  p21-activated protein kinase-interacting pro...    353   3e-109   
ref|XP_010056917.1|  PREDICTED: p21-activated protein kinase-inte...    352   4e-109   
ref|XP_004293569.1|  PREDICTED: p21-activated protein kinase-inte...    347   3e-107   
gb|KHG18244.1|  p21-activated protein kinase-interacting protein 1      346   9e-107   
ref|XP_007025019.1|  Pak inhibitor skb15, putative                      343   8e-106   
ref|XP_010696297.1|  PREDICTED: p21-activated protein kinase-inte...    339   3e-104   
ref|XP_010551050.1|  PREDICTED: p21-activated protein kinase-inte...    339   5e-104   
ref|XP_009105293.1|  PREDICTED: p21-activated protein kinase-inte...    337   3e-103   
emb|CDX96086.1|  BnaA07g26450D                                          337   3e-103   
emb|CDY01817.1|  BnaC06g28570D                                          337   4e-103   
ref|XP_002886792.1|  transducin family protein                          335   1e-102   
emb|CDY12650.1|  BnaA02g13180D                                          335   1e-102   
emb|CDY64887.1|  BnaC02g46010D                                          335   2e-102   
ref|XP_006391263.1|  hypothetical protein EUTSA_v10018816mg             334   3e-102   
gb|KFK40973.1|  hypothetical protein AALP_AA2G068300                    334   4e-102   
ref|NP_176683.1|  DDB1a-binding WD40 domain protein                     333   6e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AAN17449.1|  Unknown protein                                         332   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470381.1|  PREDICTED: p21-activated protein kinase-inte...    330   5e-101   
ref|XP_010414821.1|  PREDICTED: p21-activated protein kinase-inte...    331   6e-101   
ref|XP_010511387.1|  PREDICTED: p21-activated protein kinase-inte...    330   1e-100   
ref|XP_006302499.1|  hypothetical protein CARUB_v10020592mg             330   2e-100   
ref|XP_003533839.1|  PREDICTED: p21-activated protein kinase-inte...    326   1e-99    
ref|XP_008794486.1|  PREDICTED: p21-activated protein kinase-inte...    322   6e-98    
ref|XP_010923824.1|  PREDICTED: p21-activated protein kinase-inte...    321   1e-97    
ref|XP_004493242.1|  PREDICTED: p21-activated protein kinase-inte...    320   4e-97    
gb|AAF06037.1|AC009360_2  Contains 3 PF|00400 WD40, G-beta repeat...    321   5e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006597931.1|  PREDICTED: p21-activated protein kinase-inte...    319   1e-96    
ref|XP_006597932.1|  PREDICTED: p21-activated protein kinase-inte...    319   2e-96    
ref|XP_006597930.1|  PREDICTED: p21-activated protein kinase-inte...    318   5e-96    
ref|XP_003595555.1|  p21-activated protein kinase-interacting pro...    317   9e-96    
ref|XP_007138512.1|  hypothetical protein PHAVU_009G215400g             313   2e-94    
gb|EPS70459.1|  hypothetical protein M569_04298                         311   3e-94    
ref|XP_009397403.1|  PREDICTED: p21-activated protein kinase-inte...    307   2e-92    
ref|XP_006854704.1|  hypothetical protein AMTR_s00030p00230030          256   3e-71    
tpg|DAA63788.1|  TPA: nucleotide binding protein                        246   1e-69    
ref|XP_008650900.1|  PREDICTED: uncharacterized protein LOC100193...    245   1e-69    
ref|XP_002442548.1|  hypothetical protein SORBIDRAFT_08g021660          243   1e-68    Sorghum bicolor [broomcorn]
ref|NP_001132047.1|  uncharacterized protein LOC100193458               242   1e-68    Zea mays [maize]
gb|ACG36371.1|  nucleotide binding protein                              242   2e-68    Zea mays [maize]
ref|XP_004963211.1|  PREDICTED: p21-activated protein kinase-inte...    238   6e-67    
ref|XP_003577345.1|  PREDICTED: p21-activated protein kinase-inte...    236   2e-66    
gb|EAY83900.1|  hypothetical protein OsI_39122                          234   9e-66    Oryza sativa Indica Group [Indian rice]
gb|ABA99855.1|  transducin family protein, putative, expressed          234   1e-65    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ21227.1|  hypothetical protein OsJ_36880                          233   4e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004173731.1|  PREDICTED: p21-activated protein kinase-inte...    222   4e-63    
ref|XP_001770946.1|  predicted protein                                  209   9e-57    
ref|NP_001067278.1|  Os12g0615900                                       187   5e-50    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002971805.1|  hypothetical protein SELMODRAFT_96087              180   3e-46    
ref|XP_002963855.1|  hypothetical protein SELMODRAFT_80824              177   2e-45    
gb|KHN41431.1|  p21-activated protein kinase-interacting protein ...    148   2e-37    
gb|EMT10476.1|  hypothetical protein F775_28048                         143   1e-35    
gb|KHN35595.1|  p21-activated protein kinase-interacting protein ...    143   3e-35    
ref|XP_005649213.1|  WD40 repeat-like protein                           150   4e-35    
gb|EMS57756.1|  p21-activated protein kinase-interacting protein ...    141   9e-35    
ref|XP_005852245.1|  hypothetical protein CHLNCDRAFT_133558             147   1e-33    
gb|KFM22850.1|  P21-activated protein kinase-interacting protein ...    141   6e-32    
dbj|GAM25939.1|  hypothetical protein SAMD00019534_091140               139   3e-31    
gb|KHN35586.1|  p21-activated protein kinase-interacting protein ...    127   6e-30    
emb|CDY01885.1|  BnaC06g29250D                                          127   9e-30    
ref|XP_004158681.1|  PREDICTED: p21-activated protein kinase-inte...    126   1e-29    
ref|NP_957239.2|  p21-activated protein kinase-interacting protei...    132   1e-29    Danio rerio [leopard danio]
gb|AAH66416.2|  Zgc:56683                                               132   1e-29    Danio rerio [leopard danio]
ref|XP_005476727.1|  PREDICTED: p21-activated protein kinase-inte...    132   1e-29    
ref|XP_006634637.1|  PREDICTED: p21-activated protein kinase-inte...    132   2e-29    
tpg|DAA63787.1|  TPA: hypothetical protein ZEAMMB73_100665              128   8e-29    
ref|XP_001693185.1|  predicted protein                                  134   9e-29    Chlamydomonas reinhardtii
ref|XP_010571499.1|  PREDICTED: p21-activated protein kinase-inte...    129   2e-28    
ref|XP_005729087.1|  PREDICTED: p21-activated protein kinase-inte...    128   3e-28    
ref|XP_004078656.1|  PREDICTED: p21-activated protein kinase-inte...    128   3e-28    
emb|CCM02642.1|  predicted protein                                      129   3e-28    
ref|XP_004555307.1|  PREDICTED: p21-activated protein kinase-inte...    127   5e-28    
ref|XP_005924637.1|  PREDICTED: p21-activated protein kinase-inte...    127   5e-28    
ref|XP_007401103.1|  hypothetical protein PHACADRAFT_32944              129   5e-28    
ref|XP_009085014.1|  PREDICTED: p21-activated protein kinase-inte...    127   5e-28    
ref|XP_006792371.1|  PREDICTED: p21-activated protein kinase-inte...    127   5e-28    
ref|XP_006262038.1|  PREDICTED: p21-activated protein kinase-inte...    127   5e-28    
gb|AAH49528.2|  Zgc:56683                                               127   6e-28    Danio rerio [leopard danio]
ref|XP_006025506.1|  PREDICTED: p21-activated protein kinase-inte...    127   8e-28    
ref|XP_005041622.1|  PREDICTED: p21-activated protein kinase-inte...    127   1e-27    
ref|NP_001089472.1|  uncharacterized protein LOC734523                  126   1e-27    Xenopus laevis [clawed frog]
ref|XP_003975403.1|  PREDICTED: p21-activated protein kinase-inte...    126   1e-27    
ref|NP_001232513.1|  putative PAK1 interacting protein 1 variant 1      126   1e-27    
gb|EPZ32847.1|  hypothetical protein O9G_004894                         125   2e-27    
ref|XP_007567454.1|  PREDICTED: p21-activated protein kinase-inte...    125   2e-27    
ref|XP_009896406.1|  PREDICTED: p21-activated protein kinase-inte...    125   4e-27    
gb|EXX51928.1|  Mak11p                                                  125   4e-27    
ref|XP_005802049.1|  PREDICTED: p21-activated protein kinase-inte...    124   7e-27    
ref|XP_005525334.1|  PREDICTED: p21-activated protein kinase-inte...    124   9e-27    
ref|XP_003080465.1|  transducin family protein / WD-40 repeat fam...    123   1e-26    
ref|NP_001087421.1|  p21-activated protein kinase-interacting pro...    123   1e-26    Xenopus laevis [clawed frog]
ref|XP_007864910.1|  WD40 repeat-like protein                           124   1e-26    
gb|EIE91549.1|  hypothetical protein RO3G_16260                         123   2e-26    
ref|NP_001017054.2|  p21-activated protein kinase-interacting pro...    123   2e-26    Xenopus tropicalis [western clawed frog]
gb|KFV65477.1|  p21-activated protein kinase-interacting protein ...    122   2e-26    
gb|EOB02145.1|  p21-activated protein kinase-interacting protein ...    121   2e-26    
ref|XP_005149948.1|  PREDICTED: p21-activated protein kinase-inte...    122   2e-26    
ref|XP_010571498.1|  PREDICTED: p21-activated protein kinase-inte...    122   2e-26    
gb|ADO28286.1|  p21-activated protein kinase-interacting protein ...    122   2e-26    
ref|XP_009562443.1|  PREDICTED: p21-activated protein kinase-inte...    122   3e-26    
ref|XP_008432833.1|  PREDICTED: p21-activated protein kinase-inte...    122   4e-26    
ref|XP_005310026.1|  PREDICTED: p21-activated protein kinase-inte...    122   4e-26    
ref|XP_010903862.1|  PREDICTED: p21-activated protein kinase-inte...    122   4e-26    
ref|XP_005310024.1|  PREDICTED: p21-activated protein kinase-inte...    122   5e-26    
ref|XP_005018385.1|  PREDICTED: p21-activated protein kinase-inte...    121   5e-26    
gb|AAI35558.1|  pak1ip1 protein                                         121   5e-26    Xenopus tropicalis [western clawed frog]
ref|XP_007850380.1|  p21-activated protein kinase-interacting pro...    122   5e-26    
ref|XP_005310025.1|  PREDICTED: p21-activated protein kinase-inte...    121   6e-26    
emb|CEF98827.1|  G-protein beta WD-40 repeat                            122   7e-26    
ref|XP_001732707.1|  hypothetical protein MGL_0482                      123   7e-26    Malassezia globosa CBS 7966
ref|XP_009549045.1|  hypothetical protein HETIRDRAFT_238047             122   8e-26    
ref|XP_006682116.1|  hypothetical protein BATDEDRAFT_4260               119   1e-25    
gb|KGL92608.1|  p21-activated protein kinase-interacting protein ...    120   1e-25    
gb|EPB91934.1|  hypothetical protein HMPREF1544_01228                   121   1e-25    
ref|XP_004359413.1|  hypothetical protein DFA_01449                     122   1e-25    
emb|CCA68745.1|  related to MAK11 protein (maintenance of killer ...    120   1e-25    
ref|XP_005512629.1|  PREDICTED: p21-activated protein kinase-inte...    120   2e-25    
gb|KFV82868.1|  p21-activated protein kinase-interacting protein ...    119   2e-25    
emb|CEG73450.1|  hypothetical protein RMATCC62417_08829                 119   2e-25    
gb|KFO78582.1|  p21-activated protein kinase-interacting protein ...    119   2e-25    
ref|XP_009999291.1|  PREDICTED: p21-activated protein kinase-inte...    120   2e-25    
gb|ERZ98717.1|  hypothetical protein GLOINDRAFT_10248                   119   3e-25    
gb|EMC80779.1|  p21-activated protein kinase-interacting protein ...    119   4e-25    
gb|KFR09188.1|  p21-activated protein kinase-interacting protein ...    119   4e-25    
ref|XP_008333099.1|  PREDICTED: p21-activated protein kinase-inte...    118   4e-25    
gb|KFV55899.1|  p21-activated protein kinase-interacting protein ...    118   4e-25    
emb|CDH53501.1|  wd40 repeat-like protein                               119   4e-25    
ref|XP_006004484.1|  PREDICTED: p21-activated protein kinase-inte...    118   5e-25    
gb|KFZ56831.1|  p21-activated protein kinase-interacting protein ...    118   5e-25    
gb|KFZ60045.1|  p21-activated protein kinase-interacting protein ...    118   5e-25    
gb|KFV07234.1|  p21-activated protein kinase-interacting protein ...    118   5e-25    
ref|XP_007234941.1|  PREDICTED: p21-activated protein kinase-inte...    118   5e-25    
ref|XP_005355130.1|  PREDICTED: p21-activated protein kinase-inte...    118   5e-25    
ref|XP_007971916.1|  PREDICTED: p21-activated protein kinase-inte...    118   6e-25    
ref|XP_005355129.1|  PREDICTED: p21-activated protein kinase-inte...    118   6e-25    
gb|KFP93277.1|  p21-activated protein kinase-interacting protein ...    118   6e-25    
gb|KFP32385.1|  p21-activated protein kinase-interacting protein ...    118   6e-25    
ref|XP_010355459.1|  PREDICTED: p21-activated protein kinase-inte...    118   7e-25    
ref|XP_010201839.1|  PREDICTED: p21-activated protein kinase-inte...    117   9e-25    
emb|CDS12298.1|  hypothetical protein LRAMOSA04493                      117   1e-24    
gb|KFO56988.1|  p21-activated protein kinase-interacting protein ...    117   1e-24    
gb|KFP15201.1|  p21-activated protein kinase-interacting protein ...    117   1e-24    
ref|XP_009813237.1|  PREDICTED: p21-activated protein kinase-inte...    117   1e-24    
gb|KFM03774.1|  p21-activated protein kinase-interacting protein ...    117   1e-24    
gb|KFP54443.1|  p21-activated protein kinase-interacting protein ...    117   1e-24    
gb|KFP65638.1|  p21-activated protein kinase-interacting protein ...    116   1e-24    
ref|XP_010164824.1|  PREDICTED: p21-activated protein kinase-inte...    117   1e-24    
gb|KFO10520.1|  p21-activated protein kinase-interacting protein ...    117   1e-24    
ref|XP_006972855.1|  PREDICTED: p21-activated protein kinase-inte...    117   1e-24    
emb|CAG07115.1|  unnamed protein product                                115   1e-24    Tetraodon nigroviridis
gb|EFA80892.1|  hypothetical protein PPL_06127                          119   1e-24    Heterostelium album PN500
gb|KFW79616.1|  p21-activated protein kinase-interacting protein ...    117   1e-24    
gb|KFW68827.1|  p21-activated protein kinase-interacting protein ...    117   1e-24    
gb|KFP03452.1|  p21-activated protein kinase-interacting protein ...    116   2e-24    
ref|XP_003897095.1|  PREDICTED: p21-activated protein kinase-inte...    117   2e-24    
ref|XP_003219807.1|  PREDICTED: p21-activated protein kinase-inte...    117   2e-24    
ref|NP_001244344.1|  PAK1 interacting protein 1                         117   2e-24    
ref|XP_010072150.1|  PREDICTED: p21-activated protein kinase-inte...    116   2e-24    
dbj|BAA91296.1|  unnamed protein product                                117   2e-24    Homo sapiens [man]
ref|XP_004477017.1|  PREDICTED: p21-activated protein kinase-inte...    117   2e-24    
ref|XP_007971915.1|  PREDICTED: p21-activated protein kinase-inte...    117   2e-24    
ref|XP_006004483.1|  PREDICTED: p21-activated protein kinase-inte...    116   2e-24    
ref|XP_005481879.1|  PREDICTED: p21-activated protein kinase-inte...    116   2e-24    
gb|KFW07618.1|  p21-activated protein kinase-interacting protein ...    116   2e-24    
ref|XP_003468779.1|  PREDICTED: p21-activated protein kinase-inte...    116   2e-24    
ref|XP_005003323.1|  PREDICTED: p21-activated protein kinase-inte...    116   3e-24    
gb|KFQ78722.1|  p21-activated protein kinase-interacting protein ...    116   3e-24    
gb|KGL77869.1|  p21-activated protein kinase-interacting protein ...    115   3e-24    
ref|NP_001139979.1|  p21-activated protein kinase-interacting pro...    115   4e-24    Salmo salar
gb|KFW08264.1|  p21-activated protein kinase-interacting protein ...    115   4e-24    
ref|XP_010122274.1|  PREDICTED: p21-activated protein kinase-inte...    115   4e-24    
ref|XP_003827592.1|  PREDICTED: p21-activated protein kinase-inte...    116   4e-24    
gb|KFW92459.1|  p21-activated protein kinase-interacting protein ...    115   4e-24    
ref|XP_518863.3|  PREDICTED: p21-activated protein kinase-interac...    116   4e-24    Pan troglodytes
gb|KFP98116.1|  p21-activated protein kinase-interacting protein ...    115   4e-24    
gb|KDQ19095.1|  hypothetical protein BOTBODRAFT_154019                  117   4e-24    
gb|KFU98400.1|  p21-activated protein kinase-interacting protein ...    115   4e-24    
ref|XP_009324823.1|  PREDICTED: p21-activated protein kinase-inte...    115   5e-24    
ref|NP_060376.2|  p21-activated protein kinase-interacting protein 1    115   5e-24    Homo sapiens [man]
ref|XP_009448764.1|  PREDICTED: p21-activated protein kinase-inte...    115   6e-24    
ref|XP_008951136.1|  PREDICTED: p21-activated protein kinase-inte...    115   6e-24    
gb|KFU92118.1|  p21-activated protein kinase-interacting protein ...    115   6e-24    
ref|XP_005716957.1|  unnamed protein product                            115   6e-24    
ref|XP_005249261.1|  PREDICTED: p21-activated protein kinase-inte...    115   7e-24    
gb|ADD39719.1|  PAK1 interacting protein 1                              115   7e-24    Scylla serrata [Indo-Pacific swamp crab]
ref|XP_010213840.1|  PREDICTED: p21-activated protein kinase-inte...    114   7e-24    
ref|XP_007234942.1|  PREDICTED: p21-activated protein kinase-inte...    115   7e-24    
gb|AEB61011.1|  p21-activated protein kinase-interacting protein ...    114   8e-24    
gb|AAH10907.1|  PAK1 interacting protein 1                              115   8e-24    Homo sapiens [man]
gb|AIC62185.1|  PAK1IP1                                                 115   8e-24    
ref|XP_009272008.1|  PREDICTED: p21-activated protein kinase-inte...    114   8e-24    
ref|NP_001026170.1|  p21-activated protein kinase-interacting pro...    114   9e-24    Gallus gallus [bantam]
gb|AAK57477.1|AF283303_1  PAK/PLC-interacting protein 1                 115   9e-24    Homo sapiens [man]
ref|XP_003055007.1|  predicted protein                                  116   1e-23    
ref|XP_009505636.1|  PREDICTED: p21-activated protein kinase-inte...    114   1e-23    
gb|KFQ71823.1|  p21-activated protein kinase-interacting protein ...    114   1e-23    
ref|XP_008920547.1|  PREDICTED: p21-activated protein kinase-inte...    114   1e-23    
ref|XP_007488023.1|  PREDICTED: p21-activated protein kinase-inte...    114   1e-23    
gb|KFV40338.1|  p21-activated protein kinase-interacting protein ...    114   1e-23    
ref|XP_008038028.1|  WD40 repeat-like protein                           115   1e-23    
ref|XP_003033479.1|  hypothetical protein SCHCODRAFT_67600              115   2e-23    
ref|XP_009699666.1|  PREDICTED: p21-activated protein kinase-inte...    114   2e-23    
ref|XP_010752181.1|  PREDICTED: p21-activated protein kinase-inte...    114   2e-23    
ref|XP_009937720.1|  PREDICTED: p21-activated protein kinase-inte...    114   2e-23    
ref|XP_003263546.1|  PREDICTED: p21-activated protein kinase-inte...    114   2e-23    
ref|XP_009979903.1|  PREDICTED: p21-activated protein kinase-inte...    113   2e-23    
ref|XP_005435017.1|  PREDICTED: p21-activated protein kinase-inte...    115   2e-23    
gb|KFQ55350.1|  p21-activated protein kinase-interacting protein ...    113   2e-23    
gb|KFP84229.1|  p21-activated protein kinase-interacting protein ...    113   2e-23    
gb|ETE69891.1|  p21-activated protein kinase-interacting protein ...    113   2e-23    
ref|XP_002714216.1|  PREDICTED: p21-activated protein kinase-inte...    114   2e-23    Oryctolagus cuniculus [domestic rabbit]
gb|KFQ46849.1|  p21-activated protein kinase-interacting protein ...    113   2e-23    
ref|XP_009525739.1|  hypothetical protein PHYSODRAFT_503339             114   2e-23    
ref|XP_007327256.1|  hypothetical protein AGABI1DRAFT_69942             114   2e-23    
ref|XP_535884.1|  PREDICTED: p21-activated protein kinase-interac...    114   2e-23    Canis lupus familiaris [dogs]
gb|KFR14547.1|  p21-activated protein kinase-interacting protein ...    113   2e-23    
gb|AAL40652.1|AF386076_1  p21-activated protein kinase-interactin...    114   3e-23    Mus musculus [mouse]
ref|XP_004346604.1|  p21activated protein kinase-interacting prot...    115   3e-23    
ref|NP_080826.2|  p21-activated protein kinase-interacting protein 1    113   3e-23    Mus musculus [mouse]
ref|XP_010621142.1|  PREDICTED: p21-activated protein kinase-inte...    113   3e-23    
ref|XP_008163555.1|  PREDICTED: p21-activated protein kinase-inte...    113   3e-23    
ref|XP_004432185.1|  PREDICTED: p21-activated protein kinase-inte...    113   3e-23    
gb|KFP70400.1|  p21-activated protein kinase-interacting protein ...    113   3e-23    
ref|XP_008144340.1|  PREDICTED: p21-activated protein kinase-inte...    113   3e-23    
dbj|BAE22737.1|  unnamed protein product                                113   3e-23    Mus musculus [mouse]
ref|XP_006758808.1|  PREDICTED: p21-activated protein kinase-inte...    113   4e-23    
ref|XP_006092991.1|  PREDICTED: p21-activated protein kinase-inte...    113   4e-23    
ref|XP_008495385.1|  PREDICTED: p21-activated protein kinase-inte...    113   4e-23    
gb|EPT01159.1|  hypothetical protein FOMPIDRAFT_1036462                 114   5e-23    
ref|XP_005235130.1|  PREDICTED: p21-activated protein kinase-inte...    112   5e-23    
ref|XP_007174000.1|  PREDICTED: p21-activated protein kinase-inte...    112   5e-23    
ref|XP_006891662.1|  PREDICTED: p21-activated protein kinase-inte...    112   5e-23    
ref|XP_001491487.1|  PREDICTED: p21-activated protein kinase-inte...    112   5e-23    Equus caballus [domestic horse]
gb|ETP34656.1|  hypothetical protein F442_17041                         112   5e-23    
ref|XP_009968306.1|  PREDICTED: p21-activated protein kinase-inte...    112   6e-23    
ref|XP_003927401.1|  PREDICTED: p21-activated protein kinase-inte...    112   6e-23    
ref|XP_009489175.1|  PREDICTED: p21-activated protein kinase-inte...    112   6e-23    
ref|XP_003289134.1|  hypothetical protein DICPUDRAFT_8425               111   6e-23    
ref|XP_005398893.1|  PREDICTED: p21-activated protein kinase-inte...    112   6e-23    
ref|XP_005878494.1|  PREDICTED: p21-activated protein kinase-inte...    112   6e-23    
ref|XP_002416201.1|  U3 snoRNP-associated protein, putative             112   6e-23    Ixodes scapularis [blacklegged tick]
ref|XP_009862891.1|  PREDICTED: p21-activated protein kinase-inte...    112   7e-23    
ref|XP_005398894.1|  PREDICTED: p21-activated protein kinase-inte...    112   7e-23    
ref|XP_007321027.1|  WD40 repeat-containing protein                     112   7e-23    
ref|XP_007899046.1|  PREDICTED: p21-activated protein kinase-inte...    112   7e-23    
ref|XP_008260600.1|  PREDICTED: p21-activated protein kinase-inte...    112   7e-23    
ref|XP_010009476.1|  PREDICTED: p21-activated protein kinase-inte...    111   8e-23    
ref|XP_008260599.1|  PREDICTED: p21-activated protein kinase-inte...    112   8e-23    
ref|XP_006836329.1|  hypothetical protein AMTR_s00092p00076290          107   8e-23    
ref|XP_008912511.1|  hypothetical protein PPTG_16776                    112   8e-23    
gb|ETI36721.1|  hypothetical protein F443_17167                         112   9e-23    
ref|XP_010192005.1|  PREDICTED: p21-activated protein kinase-inte...    110   9e-23    
gb|KFQ20211.1|  p21-activated protein kinase-interacting protein ...    110   1e-22    
ref|XP_002763600.3|  PREDICTED: p21-activated protein kinase-inte...    111   1e-22    Callithrix jacchus [common marmoset]
ref|XP_008829847.1|  PREDICTED: p21-activated protein kinase-inte...    111   1e-22    
gb|EFX69655.1|  hypothetical protein DAPPUDRAFT_300865                  111   1e-22    
ref|XP_009073547.1|  PREDICTED: p21-activated protein kinase-inte...    111   1e-22    
ref|XP_010944031.1|  PREDICTED: p21-activated protein kinase-inte...    111   1e-22    
ref|XP_004847761.1|  PREDICTED: p21-activated protein kinase-inte...    111   1e-22    
ref|XP_010706753.1|  PREDICTED: p21-activated protein kinase-inte...    111   1e-22    
ref|XP_006864188.1|  PREDICTED: p21-activated protein kinase-inte...    111   1e-22    
ref|XP_006461749.1|  hypothetical protein AGABI2DRAFT_205620            111   1e-22    
ref|XP_010993086.1|  PREDICTED: p21-activated protein kinase-inte...    111   1e-22    
gb|KFO33785.1|  p21-activated protein kinase-interacting protein 1      112   1e-22    
ref|XP_007488024.1|  PREDICTED: p21-activated protein kinase-inte...    111   1e-22    
ref|XP_004847760.1|  PREDICTED: p21-activated protein kinase-inte...    111   1e-22    
ref|XP_010336356.1|  PREDICTED: p21-activated protein kinase-inte...    111   2e-22    
ref|XP_004896858.1|  PREDICTED: p21-activated protein kinase-inte...    110   2e-22    
ref|XP_010621141.1|  PREDICTED: p21-activated protein kinase-inte...    110   2e-22    
ref|XP_004896857.1|  PREDICTED: p21-activated protein kinase-inte...    110   2e-22    
ref|XP_007668785.1|  PREDICTED: p21-activated protein kinase-inte...    110   2e-22    
ref|XP_007949895.1|  PREDICTED: p21-activated protein kinase-inte...    110   2e-22    
emb|CCO30449.1|  hypothetical protein BN14_04478                        110   2e-22    
ref|XP_006198756.1|  PREDICTED: p21-activated protein kinase-inte...    110   2e-22    
gb|AAK51599.1|  putative PAK inhibitor SKB15                            110   2e-22    
ref|XP_003417902.1|  PREDICTED: p21-activated protein kinase-inte...    110   2e-22    
ref|XP_006758807.1|  PREDICTED: p21-activated protein kinase-inte...    110   3e-22    
ref|XP_006909335.1|  PREDICTED: p21-activated protein kinase-inte...    110   3e-22    
ref|XP_007173999.1|  PREDICTED: p21-activated protein kinase-inte...    110   3e-22    
ref|XP_007645216.1|  PREDICTED: p21-activated protein kinase-inte...    110   3e-22    
ref|XP_007466459.1|  PREDICTED: LOW QUALITY PROTEIN: p21-activate...    110   4e-22    
ref|XP_003760231.1|  PREDICTED: p21-activated protein kinase-inte...    110   4e-22    
gb|KDQ26504.1|  hypothetical protein PLEOSDRAFT_1077439                 110   4e-22    
ref|XP_005398892.1|  PREDICTED: p21-activated protein kinase-inte...    109   4e-22    
ref|XP_004281090.1|  PREDICTED: p21-activated protein kinase-inte...    109   5e-22    
ref|XP_006138889.1|  PREDICTED: p21-activated protein kinase-inte...    109   5e-22    
gb|KFO89434.1|  p21-activated protein kinase-interacting protein ...    109   5e-22    
ref|XP_005603622.1|  PREDICTED: p21-activated protein kinase-inte...    109   5e-22    
ref|XP_004364737.1|  conserved hypothetical protein                     111   5e-22    
gb|EUC59145.1|  MAK11 protein (maintenance of killer toxin-encodi...    109   5e-22    
ref|XP_010133946.1|  PREDICTED: p21-activated protein kinase-inte...    108   5e-22    
gb|KEP51406.1|  putative MAK11 protein (maintenance of killer tox...    109   6e-22    
ref|XP_007344021.1|  WD40 repeat-like protein                           109   6e-22    
ref|XP_004628426.1|  PREDICTED: p21-activated protein kinase-inte...    109   6e-22    
ref|XP_772742.1|  hypothetical protein CNBK1160                         110   6e-22    
gb|EKD04250.1|  nucleus protein                                         110   7e-22    
ref|XP_009882476.1|  PREDICTED: p21-activated protein kinase-inte...    108   8e-22    
ref|XP_006141266.1|  PREDICTED: p21-activated protein kinase-inte...    108   9e-22    
ref|XP_010993019.1|  PREDICTED: p21-activated protein kinase-inte...    108   1e-21    
ref|XP_006141265.1|  PREDICTED: p21-activated protein kinase-inte...    108   1e-21    
ref|XP_005554123.1|  PREDICTED: p21-activated protein kinase-inte...    108   1e-21    
ref|XP_009202696.1|  PREDICTED: p21-activated protein kinase-inte...    108   1e-21    
ref|XP_004668029.1|  PREDICTED: p21-activated protein kinase-inte...    108   1e-21    
ref|XP_001418755.1|  predicted protein                                  108   1e-21    
ref|XP_004596602.1|  PREDICTED: p21-activated protein kinase-inte...    108   1e-21    
ref|XP_009676255.1|  PREDICTED: p21-activated protein kinase-inte...    107   1e-21    
gb|EJT46104.1|  nucleus protein                                         109   2e-21    
ref|XP_006909334.1|  PREDICTED: p21-activated protein kinase-inte...    108   2e-21    
ref|XP_002899922.1|  p21-activated protein kinase-interacting pro...    108   2e-21    
ref|XP_006181167.1|  PREDICTED: p21-activated protein kinase-inte...    108   2e-21    
ref|XP_010944032.1|  PREDICTED: p21-activated protein kinase-inte...    108   2e-21    
gb|AFR98094.1|  protein MAK11                                           108   2e-21    
ref|XP_010993154.1|  PREDICTED: p21-activated protein kinase-inte...    107   2e-21    
ref|XP_010595874.1|  PREDICTED: p21-activated protein kinase-inte...    107   2e-21    
ref|XP_007073173.1|  PREDICTED: p21-activated protein kinase-inte...    107   3e-21    
ref|XP_009473695.1|  PREDICTED: p21-activated protein kinase-inte...    106   3e-21    
ref|XP_002763603.1|  PREDICTED: p21-activated protein kinase-inte...    107   4e-21    
gb|KGB77207.1|  protein MAK11                                           108   4e-21    
ref|XP_006715192.1|  PREDICTED: p21-activated protein kinase-inte...    106   4e-21    
ref|XP_004403770.1|  PREDICTED: p21-activated protein kinase-inte...    106   4e-21    
ref|XP_008629115.1|  PREDICTED: p21-activated protein kinase-inte...    105   4e-21    
ref|XP_001926235.1|  PREDICTED: p21-activated protein kinase-inte...    106   5e-21    
ref|XP_002915952.1|  PREDICTED: p21-activated protein kinase-inte...    106   5e-21    
ref|XP_009636251.1|  PREDICTED: p21-activated protein kinase-inte...    105   5e-21    
ref|XP_006739888.1|  PREDICTED: p21-activated protein kinase-inte...    106   5e-21    
ref|XP_009910289.1|  PREDICTED: p21-activated protein kinase-inte...    105   5e-21    
dbj|GAA95282.1|  hypothetical protein E5Q_01938                         107   5e-21    
ref|XP_007524326.1|  PREDICTED: p21-activated protein kinase-inte...    106   5e-21    
ref|XP_003985862.1|  PREDICTED: p21-activated protein kinase-inte...    106   6e-21    
ref|XP_007873134.1|  hypothetical protein PNEG_01217                    104   7e-21    
gb|KDQ61940.1|  hypothetical protein JAAARDRAFT_31433                   107   8e-21    
ref|XP_008691043.1|  PREDICTED: p21-activated protein kinase-inte...    105   9e-21    
ref|XP_010153129.1|  PREDICTED: p21-activated protein kinase-inte...    104   9e-21    
ref|XP_010300010.1|  PREDICTED: p21-activated protein kinase-inte...    104   9e-21    
ref|XP_008629114.1|  PREDICTED: p21-activated protein kinase-inte...    104   1e-20    
ref|XP_003196613.1|  hypothetical protein CGB_K1430W                    106   1e-20    
ref|XP_007100265.1|  PREDICTED: p21-activated protein kinase-inte...    105   1e-20    
ref|XP_004019186.1|  PREDICTED: p21-activated protein kinase-inte...    105   1e-20    
gb|KFM71634.1|  p21-activated protein kinase-interacting protein ...    103   1e-20    
ref|XP_005981212.1|  PREDICTED: p21-activated protein kinase-inte...    105   1e-20    
ref|XP_007421664.1|  PREDICTED: p21-activated protein kinase-inte...    104   1e-20    
ref|XP_009579170.1|  PREDICTED: p21-activated protein kinase-inte...    104   1e-20    
ref|XP_567711.1|  nucleus protein                                       108   2e-20    
ref|XP_005421045.1|  PREDICTED: p21-activated protein kinase-inte...    103   2e-20    
gb|ETP34657.1|  hypothetical protein, variant                           103   3e-20    
ref|XP_004847759.1|  PREDICTED: p21-activated protein kinase-inte...    104   3e-20    
ref|XP_006057819.1|  PREDICTED: p21-activated protein kinase-inte...    103   3e-20    
ref|XP_007006031.1|  hypothetical protein TREMEDRAFT_39966              107   4e-20    
ref|XP_004896856.1|  PREDICTED: p21-activated protein kinase-inte...    103   4e-20    
ref|XP_009948118.1|  PREDICTED: p21-activated protein kinase-inte...    102   4e-20    
gb|ETI36722.1|  hypothetical protein, variant                           103   5e-20    
ref|XP_006057820.1|  PREDICTED: p21-activated protein kinase-inte...    103   5e-20    
ref|XP_008912512.1|  hypothetical protein, variant                      103   5e-20    
ref|XP_007261469.1|  WD40 repeat-like protein                           104   5e-20    
ref|XP_002816462.1|  PREDICTED: p21-activated protein kinase-inte...    102   6e-20    
ref|XP_004753758.1|  PREDICTED: p21-activated protein kinase-inte...    102   7e-20    
ref|XP_007100264.1|  PREDICTED: p21-activated protein kinase-inte...    102   8e-20    
ref|XP_008071168.1|  PREDICTED: LOW QUALITY PROTEIN: p21-activate...    102   1e-19    
ref|XP_010281518.1|  PREDICTED: p21-activated protein kinase-inte...    101   1e-19    
ref|XP_005696916.1|  PREDICTED: p21-activated protein kinase-inte...    102   1e-19    
emb|CCA20016.1|  p21activated protein kinaseinteracting protein p...    102   1e-19    
ref|XP_003739050.1|  PREDICTED: p21-activated protein kinase-inte...    101   2e-19    
emb|CCU98766.1|  unnamed protein product                                103   2e-19    
ref|XP_005696917.1|  PREDICTED: p21-activated protein kinase-inte...    101   2e-19    
ref|NP_001032433.1|  p21-activated protein kinase-interacting pro...    101   2e-19    
ref|XP_007774647.1|  WD40 repeat-like protein                           102   2e-19    
gb|ELR49234.1|  p21-activated protein kinase-interacting protein 1      101   2e-19    
ref|XP_005223907.1|  PREDICTED: p21-activated protein kinase-inte...    100   3e-19    
ref|XP_005327575.1|  PREDICTED: p21-activated protein kinase-inte...    100   3e-19    
ref|XP_005905562.1|  PREDICTED: LOW QUALITY PROTEIN: p21-activate...    100   4e-19    
ref|XP_010834158.1|  PREDICTED: p21-activated protein kinase-inte...    100   4e-19    
ref|XP_004695513.1|  PREDICTED: p21-activated protein kinase-inte...    100   5e-19    
gb|AAI02509.1|  PAK1IP1 protein                                         100   5e-19    
ref|XP_007301423.1|  WD40 repeat-like protein                           101   5e-19    
tpg|DAA16089.1|  TPA: p21-activated protein kinase-interacting pr...    100   6e-19    
ref|NP_001014852.1|  p21-activated protein kinase-interacting pro...  99.8    7e-19    
gb|KDR20309.1|  p21-activated protein kinase-interacting protein ...  99.8    8e-19    
emb|CCI46437.1|  unnamed protein product                              99.0    1e-18    
ref|XP_004712273.1|  PREDICTED: p21-activated protein kinase-inte...  98.2    2e-18    
ref|XP_003485793.1|  PREDICTED: p21-activated protein kinase-inte...  97.8    2e-18    
ref|XP_004329321.1|  PREDICTED: p21-activated protein kinase-inte...  98.6    2e-18    
ref|XP_008107031.1|  PREDICTED: p21-activated protein kinase-inte...  97.8    2e-18    
ref|XP_002503934.1|  predicted protein                                99.4    3e-18    
emb|CCI46438.1|  unnamed protein product                              97.4    4e-18    
ref|XP_007386730.1|  WD40 repeat-like protein                         97.8    4e-18    
ref|XP_008277901.1|  PREDICTED: p21-activated protein kinase-inte...  96.7    5e-18    
gb|KDR80805.1|  hypothetical protein GALMADRAFT_264757                97.1    5e-18    
ref|XP_004988999.1|  hypothetical protein PTSG_10088                  99.0    7e-18    
ref|XP_008059199.1|  PREDICTED: p21-activated protein kinase-inte...  96.7    8e-18    
gb|KFH65610.1|  hypothetical protein MVEG_09086                       97.4    1e-17    
gb|ELU14628.1|  hypothetical protein CAPTEDRAFT_211065                94.7    3e-17    
ref|XP_007363155.1|  WD40 repeat-like protein                         94.0    4e-17    
gb|ELU43408.1|  PAK1IP1 protein                                       94.4    4e-17    
ref|XP_002764256.2|  PREDICTED: p21-activated protein kinase-inte...  92.4    5e-17    
gb|EDL40962.1|  PAK1 interacting protein 1, isoform CRA_c             93.2    5e-17    
ref|XP_001831252.2|  PAK1IP1 protein                                  94.0    7e-17    
ref|XP_005665621.1|  PREDICTED: p21-activated protein kinase-inte...  92.8    8e-17    
ref|XP_001607034.2|  PREDICTED: p21-activated protein kinase-inte...  94.4    1e-16    
gb|ADD24153.1|  p21-activated protein kinase-interacting protein ...  92.4    2e-16    
ref|XP_644112.1|  hypothetical protein DDB_G0274505                   93.6    2e-16    
ref|XP_008561403.1|  PREDICTED: p21-activated protein kinase-inte...  91.3    2e-16    
ref|XP_008543125.1|  PREDICTED: p21-activated protein kinase-inte...  90.5    4e-16    
ref|XP_003397415.1|  PREDICTED: p21-activated protein kinase-inte...  90.5    4e-16    
ref|XP_008561405.1|  PREDICTED: p21-activated protein kinase-inte...  89.4    8e-16    
gb|EJU03680.1|  WD40 repeat-like protein                              89.0    1e-15    
ref|XP_003690434.1|  PREDICTED: p21-activated protein kinase-inte...  89.4    1e-15    
emb|CDI54796.1|  related to MAK11 protein (maintenance of killer ...  91.3    1e-15    
ref|XP_010775819.1|  PREDICTED: p21-activated protein kinase-inte...  87.8    1e-15    
ref|XP_007054970.1|  PREDICTED: LOW QUALITY PROTEIN: p21-activate...  89.7    1e-15    
ref|XP_006617814.1|  PREDICTED: p21-activated protein kinase-inte...  90.9    2e-15    
ref|XP_001387726.1|  essential for cell growth and replication of...  89.7    2e-15    
ref|XP_795222.2|  PREDICTED: p21-activated protein kinase-interac...  89.0    2e-15    
ref|XP_007876575.1|  hypothetical protein PFL1_00883                  91.3    2e-15    
dbj|GAC99763.1|  hypothetical protein PHSY_007366                     91.3    2e-15    
ref|XP_006567530.1|  PREDICTED: p21-activated protein kinase-inte...  90.1    3e-15    
ref|XP_004390530.1|  PREDICTED: p21-activated protein kinase-inte...  87.4    3e-15    
ref|XP_002615624.1|  hypothetical protein CLUG_04506                  88.2    5e-15    
dbj|GAK68431.1|  WD40 repeat-containing protein                       89.7    5e-15    
gb|ADD38507.1|  p21-activated protein kinase-interacting protein ...  87.4    5e-15    
ref|XP_003788412.1|  PREDICTED: p21-activated protein kinase-inte...  87.0    6e-15    
emb|CCE43854.1|  hypothetical protein CPAR2_500800                    88.2    9e-15    
gb|EFN85984.1|  p21-activated protein kinase-interacting protein ...  88.6    9e-15    
ref|XP_005840206.1|  hypothetical protein GUITHDRAFT_150348           86.3    1e-14    
emb|CCF48910.1|  related to MAK11 protein (maintenance of killer ...  88.6    1e-14    
gb|ESX03618.1|  Protein MAK11                                         86.7    1e-14    
ref|XP_005853625.1|  hypothetical protein NGA_0430201                 87.0    2e-14    
gb|ACQ58965.1|  p21-activated protein kinase-interacting protein ...  84.0    2e-14    
ref|XP_002420146.1|  60S ribosomal subunit biogenesis, putative       86.7    3e-14    
gb|KFQ16839.1|  p21-activated protein kinase-interacting protein ...  83.6    4e-14    
gb|KDN52379.1|  WD40 repeat-like protein                              86.7    4e-14    
ref|XP_760214.1|  hypothetical protein UM04067.1                      86.7    4e-14    
emb|CBQ68694.1|  related to MAK11 protein (maintenance of killer ...  86.7    4e-14    
gb|EST04647.1|  hypothetical protein PSEUBRA_SCAF9g01370              86.7    4e-14    
gb|KDO20223.1|  hypothetical protein SPRG_14469                       85.1    5e-14    
ref|XP_008862213.1|  hypothetical protein H310_00993                  85.1    5e-14    
gb|ETS65107.1|  hypothetical protein PaG_00564                        86.3    6e-14    
ref|XP_008207190.1|  PREDICTED: p21-activated protein kinase-inte...  85.5    6e-14    
ref|XP_003867254.1|  hypothetical protein CORT_0B00960                85.1    7e-14    
ref|XP_008937480.1|  PREDICTED: p21-activated protein kinase-inte...  82.4    7e-14    
ref|XP_008611017.1|  hypothetical protein SDRG_06980                  84.7    8e-14    
dbj|GAC75004.1|  WD40 repeat-containing protein                       85.5    9e-14    
ref|XP_003707546.1|  PREDICTED: p21-activated protein kinase-inte...  85.1    1e-13    
ref|XP_011050986.1|  PREDICTED: p21-activated protein kinase-inte...  85.1    1e-13    
gb|EFZ17743.1|  hypothetical protein SINV_07395                       84.7    1e-13    
gb|EMG46973.1|  Ribosomal biogenesis protein, putative                83.2    1e-13    
ref|XP_009060955.1|  hypothetical protein LOTGIDRAFT_234571           83.6    1e-13    
ref|NP_587918.1|  p21 activated protein kinase inhibitor Skb15        82.8    2e-13    
gb|ACO15388.1|  p21-activated protein kinase-interacting protein ...  82.8    2e-13    
ref|XP_005098977.1|  PREDICTED: p21-activated protein kinase-inte...  83.2    2e-13    
ref|XP_003647188.1|  hypothetical protein Ecym_5635                   82.8    2e-13    
ref|XP_009013869.1|  hypothetical protein HELRODRAFT_190875           84.3    2e-13    
ref|XP_003388740.1|  PREDICTED: p21-activated protein kinase-inte...  83.6    2e-13    
ref|XP_001630701.1|  predicted protein                                82.8    2e-13    
ref|NP_983568.2|  ACR166Wp                                            82.4    4e-13    
gb|KHC51057.1|  protein MAK11                                         83.2    4e-13    
ref|XP_009822040.1|  hypothetical protein, variant 1                  82.0    5e-13    
gb|KHC37505.1|  protein MAK11                                         82.8    6e-13    
gb|KGU07979.1|  protein MAK11                                         82.8    6e-13    
gb|KGR07217.1|  protein MAK11                                         82.4    6e-13    
gb|EPX71958.1|  Shk1 kinase binding protein 15                        80.9    6e-13    
gb|EFN65710.1|  p21-activated protein kinase-interacting protein ...  82.4    6e-13    
gb|EPY49873.1|  Shk1 kinase binding protein 15                        80.5    8e-13    
gb|KHC60869.1|  protein MAK11                                         82.0    8e-13    
gb|KHC34654.1|  protein MAK11                                         82.0    8e-13    
gb|KGR09041.1|  protein MAK11                                         82.0    8e-13    
gb|ACO11688.1|  p21-activated protein kinase-interacting protein ...  81.3    8e-13    
gb|KDE06911.1|  hypothetical protein MVLG_02799                       82.4    9e-13    
ref|XP_006391265.1|  hypothetical protein EUTSA_v10019798mg           79.0    9e-13    
gb|KHC34207.1|  protein MAK11                                         82.0    9e-13    
gb|EEQ44979.1|  maintenance of killer 11 protein                      81.6    1e-12    
gb|KGQ88378.1|  protein MAK11                                         81.6    1e-12    
ref|XP_002549579.1|  maintenance of killer 11 protein                 81.6    1e-12    
gb|ACO11053.1|  p21-activated protein kinase-interacting protein ...  80.5    1e-12    
ref|XP_711456.1|  hypothetical protein CaO19.9357                     81.6    1e-12    
ref|XP_005187890.1|  PREDICTED: p21-activated protein kinase-inte...  81.3    2e-12    
gb|KHC76290.1|  protein MAK11                                         81.3    2e-12    



>ref|XP_009616697.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Nicotiana tomentosiformis]
Length=337

 Score =   425 bits (1093),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 228/317 (72%), Positives = 260/317 (82%), Gaps = 7/317 (2%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSLIAGSY+ FIWG+KL+SPKD Q  +L PLFSFPSHLS IKC  V+GSVAVSGG+DDTI
Sbjct  1     MSLIAGSYERFIWGFKLRSPKDDQKYELTPLFSFPSHLSPIKCTAVAGSVAVSGGADDTI  60

Query  502   KIYDLSTCSEIGSLHESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTV  681
             KIYDLSTCSEIGSLH+SATI SL+F TPPSLSFP NLI+AAD+G+VSIY  DPFVHLKTV
Sbjct  61    KIYDLSTCSEIGSLHQSATITSLSFLTPPSLSFPRNLIAAADDGTVSIYDADPFVHLKTV  120

Query  682   KVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTL  861
             KVHRK +NS+ IHPSG L  SVGRDEC+AM++L RGRRSFY  LGKE S++ +++TG+  
Sbjct  121   KVHRKAVNSVCIHPSGRLALSVGRDECMAMINLVRGRRSFYSRLGKEASLVNYSDTGEKF  180

Query  862   YMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVA  1041
             YMVMD+K+SV E     + VLE +N K+VLCA PG  GILFTGGE+RNI AWD  SGKVA
Sbjct  181   YMVMDDKISVHE-SEDAKIVLELDNNKKVLCATPGTHGILFTGGEERNIKAWDITSGKVA  239

Query  1042  HRIDDAHSARVKGIVVL-SNNDG---EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLA  1209
             + I+DAHS RVKGIVVL  NNDG   E  ++VASASSDG I VWDVRM    KEKP PLA
Sbjct  240   YSIEDAHSTRVKGIVVLYKNNDGDAEENQHIVASASSDGIIRVWDVRMTR--KEKPIPLA  297

Query  1210  MANTKSRLTCLAGSSIK  1260
              ANTKSRLTCLAGSSIK
Sbjct  298   EANTKSRLTCLAGSSIK  314



>ref|XP_009801369.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Nicotiana sylvestris]
Length=337

 Score =   410 bits (1054),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 221/317 (70%), Positives = 252/317 (79%), Gaps = 7/317 (2%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSLIAGSY+ FIWG+KL+SPKD Q  +L PLFSFPSHLS IKC  V+GS AVSGG+DDTI
Sbjct  1     MSLIAGSYERFIWGFKLRSPKDDQKYELTPLFSFPSHLSPIKCTAVAGSAAVSGGADDTI  60

Query  502   KIYDLSTCSEIGSLHESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTV  681
             KIYDLSTCSEIGSLH+SATI SL+F TPPSLSFP NLI+AAD+G+VSIY  DPFVHLKT+
Sbjct  61    KIYDLSTCSEIGSLHQSATITSLSFLTPPSLSFPRNLIAAADDGTVSIYDADPFVHLKTM  120

Query  682   KVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTL  861
             KVHRK +NS+ IHPSG L  SVGRDEC+AM++L RGRRSFY  LGKE S++ +++TG+  
Sbjct  121   KVHRKAVNSVCIHPSGRLALSVGRDECMAMINLVRGRRSFYCRLGKEASLVNYSDTGEKF  180

Query  862   YMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVA  1041
             YMVMD+K+SV E     + VLE +N K+VLCA PG  GILFTGGE+RNI AWD  SGKVA
Sbjct  181   YMVMDDKISVHE-SEDAKIVLELDNKKKVLCATPGTHGILFTGGEERNIKAWDITSGKVA  239

Query  1042  HRIDDAHSARVKGIVVL-SNNDGEY---PYLVASASSDGNICVWDVRMGMGGKEKPNPLA  1209
             + I+DAHS RVKGIVVL  NNDG            SSDG I VWDVRM M  KEKP PLA
Sbjct  240   YSIEDAHSTRVKGIVVLYKNNDGXKMNCDIYFGIXSSDGIIRVWDVRMTM--KEKPIPLA  297

Query  1210  MANTKSRLTCLAGSSIK  1260
              ANTKSRLTCL GSSIK
Sbjct  298   EANTKSRLTCLTGSSIK  314



>ref|XP_011096613.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Sesamum indicum]
Length=338

 Score =   404 bits (1039),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 216/318 (68%), Positives = 256/318 (81%), Gaps = 8/318 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSL+AGSY+ FIWGYKLKS K   +L L PLFSFPSHLSTIK   V+GS AVSGG+DDTI
Sbjct  1     MSLVAGSYERFIWGYKLKSRKHPHSLTLTPLFSFPSHLSTIKAVAVAGSAAVSGGNDDTI  60

Query  502   KIYDLSTCSEIGSLHESATINSLAFYTPPSLS-FPHNLISAADNGSVSIYHTDPFVHLKT  678
             KIYDLS+ SEIGSLH S++I SL+F++PP LS FP NL++A   GS+SIY  DPFVHLKT
Sbjct  61    KIYDLSSSSEIGSLHHSSSITSLSFFSPPPLSSFPRNLLAADAEGSLSIYDADPFVHLKT  120

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +KVH+K +NSL++HPSG L  +VG D+CLAMV+L RGRRSFY  L KE S+++F++TG+ 
Sbjct  121   LKVHKKAVNSLTVHPSGKLALTVGHDDCLAMVNLVRGRRSFYCKLSKEASVVQFDQTGEK  180

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
              +MV+DEK+SV E     + ++E +N KRVLCAAPG  GILFTGGEDRNITAWDT SGKV
Sbjct  181   FFMVVDEKISVHE-SEDAKIIVELDNRKRVLCAAPGASGILFTGGEDRNITAWDTASGKV  239

Query  1039  AHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             A+ I+DAH+ARVKGIVVLS N+G    E PY+VASASSDG I VWDVRM   G  KP PL
Sbjct  240   AYSIEDAHAARVKGIVVLSKNNGGSEEEDPYIVASASSDGVIRVWDVRMANKG--KPTPL  297

Query  1207  AMANTKSRLTCLAGSSIK  1260
             A ANTKSRLTCLAGSSIK
Sbjct  298   AEANTKSRLTCLAGSSIK  315



>emb|CDP18133.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   393 bits (1010),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 220/329 (67%), Positives = 259/329 (79%), Gaps = 10/329 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSLIAGSY+ F+WG+KLKS K  Q+  L PLFSFP+HLS IKCA VSGS AV+GGSDDTI
Sbjct  1     MSLIAGSYERFLWGFKLKSQKHPQSFSLNPLFSFPAHLSPIKCAAVSGSAAVTGGSDDTI  60

Query  502   KIYDLSTCSEIGSLHESATINSLAFYTPPS--LSFPHNLISAADNGSVSIYHTDPFVHLK  675
             KIYDLST SEIGSLH S++I SL F+TPPS  L+ P NLI+AAD+G+V IY  DPFVHLK
Sbjct  61    KIYDLSTSSEIGSLHYSSSITSLCFFTPPSSALALPRNLIAAADDGAVIIYDADPFVHLK  120

Query  676   TVK-VHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETG  852
             TVK VH+KG+N LS+HPSG L  SVGRDECLAMV+L RGRRSF   LGKE SI++F+ +G
Sbjct  121   TVKSVHKKGVNDLSVHPSGTLALSVGRDECLAMVNLLRGRRSFCCRLGKEASIVRFSGSG  180

Query  853   KTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
             +  +MV+D+K+++ E     + V E +  KRVLCAAPG  GILFTGGEDRNITAWDT SG
Sbjct  181   EKFFMVLDDKINIHE-SEDAKIVAELDIKKRVLCAAPGADGILFTGGEDRNITAWDTNSG  239

Query  1033  KVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEKPN  1200
             KVA+ I+DAHSARVKGIVVLS++ G    + PYLVASASSDG I VWDVRM   G  +P+
Sbjct  240   KVAYSIEDAHSARVKGIVVLSHSGGPAPEDEPYLVASASSDGVIRVWDVRMAYRG--RPD  297

Query  1201  PLAMANTKSRLTCLAGSSIKCE*VYIGIT  1287
             PLA A TKSRLTCLAGSS + +   IG T
Sbjct  298   PLAEAKTKSRLTCLAGSSFRTKRSQIGNT  326



>gb|EYU33395.1| hypothetical protein MIMGU_mgv1a009556mg [Erythranthe guttata]
Length=338

 Score =   390 bits (1003),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 212/317 (67%), Positives = 253/317 (80%), Gaps = 7/317 (2%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSL+AGSY+ FIWGYKLKS K+   L L PLFSFPSHLSTIK   V+GSVAVSGG+DDTI
Sbjct  1     MSLVAGSYERFIWGYKLKSRKNPDTLTLSPLFSFPSHLSTIKTVAVAGSVAVSGGNDDTI  60

Query  502   KIYDLSTCSEIGSLHESATINSLAFYTPPSLS-FPHNLISAADNGSVSIYHTDPFVHLKT  678
             KIYDLS+ +EIGSL+ +++I SLA Y+PP+LS FP NLI+A   GS+SIY  DPFV LK+
Sbjct  61    KIYDLSSSAEIGSLYHTSSITSLALYSPPALSSFPRNLIAADAEGSLSIYDADPFVLLKS  120

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             VK+H+K +NS+S+HPSG L  +VG D+CLAMV+L RGRRSFY  L KE SI++F+ TG+ 
Sbjct  121   VKIHKKSVNSISVHPSGKLALTVGHDDCLAMVNLIRGRRSFYCKLSKEASIVQFDGTGER  180

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
              +MV+DEK+ V E     + + E +N KR+LCAAPG  GILFTGGED+N+TAWDT SGKV
Sbjct  181   FFMVVDEKIGVHE-SEDAKLIFELDNKKRILCAAPGNNGILFTGGEDKNLTAWDTVSGKV  239

Query  1039  AHRIDDAHSARVKGIVVL---SNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLA  1209
             A+ I+DAH AR+KGIVVL   S+N GE PYLVASASSDG I VWDVR  M GK K NPLA
Sbjct  240   AYTIEDAHPARLKGIVVLSKNSDNSGEDPYLVASASSDGVIRVWDVR--MAGKGKTNPLA  297

Query  1210  MANTKSRLTCLAGSSIK  1260
              ANTKSRLTCLAGSSIK
Sbjct  298   EANTKSRLTCLAGSSIK  314



>ref|XP_006347093.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Solanum tuberosum]
Length=337

 Score =   385 bits (989),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 215/317 (68%), Positives = 257/317 (81%), Gaps = 7/317 (2%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSLIAGSY+ FIWG+KL+S K+ QN +L PLFSFPSHLS IKC  V+GS AVSGG+DDTI
Sbjct  1     MSLIAGSYERFIWGFKLRSTKNDQNYELTPLFSFPSHLSPIKCTAVAGSAAVSGGADDTI  60

Query  502   KIYDLSTCSEIGSLHESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTV  681
             KIYDLSTCSEIGSLH SAT+ SL+F+TP S SFP NLI+A+++GSVSIY  DPFVHLK+V
Sbjct  61    KIYDLSTCSEIGSLHHSATVTSLSFFTPSSFSFPRNLIAASEDGSVSIYDADPFVHLKSV  120

Query  682   KVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTL  861
             KVHRK +NS+ IHPSG L  +VGRDEC+AMV+L RGRRSFY  LGKE S++ F++ G+  
Sbjct  121   KVHRKAVNSICIHPSGRLALTVGRDECMAMVNLVRGRRSFYCRLGKEASLVNFSDGGEKF  180

Query  862   YMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVA  1041
             +MVMD+K+SV E     +T+LE ++ KRVLCA  G  GILFTGGEDR+I AWD  SGK+A
Sbjct  181   FMVMDDKISVHE-SEDAKTILELDSKKRVLCATSGMHGILFTGGEDRSIKAWDITSGKIA  239

Query  1042  HRIDDAHSARVKGIVVL-SNNDG---EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLA  1209
             + I+DAHS RVKGIVVL  N+DG   ++ ++VASASSDG I VWDVR  M  K+KPNPLA
Sbjct  240   YSIEDAHSTRVKGIVVLHKNSDGDAEDHQHIVASASSDGVIRVWDVR--MTNKDKPNPLA  297

Query  1210  MANTKSRLTCLAGSSIK  1260
               NTKSRLTCLAGSSIK
Sbjct  298   EVNTKSRLTCLAGSSIK  314



>ref|XP_004232823.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Solanum lycopersicum]
Length=337

 Score =   382 bits (981),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 215/317 (68%), Positives = 256/317 (81%), Gaps = 7/317 (2%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSLIAGSY+ FIWG+KL+S K+ QN +L PLFSFPSHLS IKC  V+GS AVSGG+DDTI
Sbjct  1     MSLIAGSYERFIWGFKLRSLKNDQNYELTPLFSFPSHLSPIKCTAVAGSAAVSGGADDTI  60

Query  502   KIYDLSTCSEIGSLHESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTV  681
             KIYDLSTCSEIGSLH SAT+ SL+F+TP S SFP NLI+A+++GSVSIY  DPFVHLKTV
Sbjct  61    KIYDLSTCSEIGSLHHSATVTSLSFFTPSSFSFPRNLIAASEDGSVSIYDADPFVHLKTV  120

Query  682   KVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTL  861
             KVHRK +NS+ IHPSG L  +VGRDEC+AMV+L RGRRSFY  LGKE S++ F++ G+  
Sbjct  121   KVHRKAVNSICIHPSGRLALTVGRDECMAMVNLVRGRRSFYCRLGKEASLVNFSDGGEKF  180

Query  862   YMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVA  1041
             +MVMD+K+SV E     + +LE ++ KRVLCA  G  GILFTGGEDR+I AWD  SGK+A
Sbjct  181   FMVMDDKISVHE-SEDAKAILELDSKKRVLCATYGMHGILFTGGEDRSIKAWDITSGKLA  239

Query  1042  HRIDDAHSARVKGIVVL-SNNDG---EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLA  1209
             + I+DAHS RVKGIVVL  N+DG   ++ ++VASASSDG I VWDVR  M  K+KPNPLA
Sbjct  240   YSIEDAHSTRVKGIVVLHKNSDGDAEDHQHIVASASSDGVIRVWDVR--MTNKDKPNPLA  297

Query  1210  MANTKSRLTCLAGSSIK  1260
               NTKSRLTCLAGSSIK
Sbjct  298   EVNTKSRLTCLAGSSIK  314



>ref|XP_002318775.2| hypothetical protein POPTR_0012s10930g [Populus trichocarpa]
 gb|EEE96995.2| hypothetical protein POPTR_0012s10930g [Populus trichocarpa]
Length=337

 Score =   373 bits (958),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 204/317 (64%), Positives = 243/317 (77%), Gaps = 9/317 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MSLIAGSY+ FIWG+KLK+ K     QNL L PLFS+ SHL+ I  A  +G  A SG +D
Sbjct  1     MSLIAGSYEKFIWGFKLKTLKHEPSSQNLTLTPLFSYQSHLAHITSAAAAGPAAASGSAD  60

Query  493   dTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             DTI +YDL + S +GSLH+ ++++ S+ F+TPPSLSFP NL+SA+ +GSV I+ TDPFVH
Sbjct  61    DTIHLYDLPSASSLGSLHQHTSSVTSVTFFTPPSLSFPRNLLSASADGSVCIFDTDPFVH  120

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNET  849
             LKTV VH+K +N LS+HPSG L  +VGRDECLAM++L RGRRSFY  LGKE S++KF+  
Sbjct  121   LKTVLVHKKAVNDLSVHPSGKLALTVGRDECLAMLNLVRGRRSFYCRLGKEASLVKFDLG  180

Query  850   GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKS  1029
             G+  +MV +EKV V E     + V EF   KRVL AAPGE G+LFTGGEDR+ITAWD  S
Sbjct  181   GERFFMVTEEKVGVHE-AEDAKLVTEFECQKRVLSAAPGENGLLFTGGEDRSITAWDVNS  239

Query  1030  GKVAHRIDDAHSARVKGIVVLSNNDG--EYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
             GKVA+ IDDAHSARVKGIVVL  ND   + PYL+ASASSDG I VWDVRM M  KEKPNP
Sbjct  240   GKVAYCIDDAHSARVKGIVVLMRNDSTVDDPYLLASASSDGVIRVWDVRMSM--KEKPNP  297

Query  1204  LAMANTKSRLTCLAGSS  1254
             LA ANTKSRLTCLAGSS
Sbjct  298   LAEANTKSRLTCLAGSS  314



>ref|XP_002267244.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Vitis vinifera]
 emb|CBI30543.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   372 bits (954),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 210/318 (66%), Positives = 250/318 (79%), Gaps = 8/318 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MS++AGSY+ FIWG+KLKS K  Q L L PLFS+PSHLS IK   V+G VA SGG+DD++
Sbjct  1     MSIVAGSYEKFIWGFKLKSLKKSQTLTLTPLFSYPSHLSPIKSVAVAGPVAASGGTDDSV  60

Query  502   KIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             K+YDLS+CSEIG+L + S  + SL+F++P SLSFP NL+SA+D+GSV IY  DPFVHLKT
Sbjct  61    KVYDLSSCSEIGTLTDHSGAVTSLSFFSPSSLSFPRNLLSASDDGSVCIYDADPFVHLKT  120

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +  H+KG+N LSIHPSG L  +VGRD CLAM++L RGRRSFY  LGKE S++KF+ +G  
Sbjct  121   IAAHKKGVNDLSIHPSGKLALTVGRDSCLAMLNLVRGRRSFYCRLGKEASLVKFDLSGDK  180

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
              YMVM+EKV V E     + V E  N KRVLCAAPG  G+LFTGGEDRNITAWDT SGKV
Sbjct  181   FYMVMEEKVCVHE-AEDAKLVFEMENPKRVLCAAPGSNGLLFTGGEDRNITAWDTASGKV  239

Query  1039  AHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             A+ I+DAHSARVKGIVVLS ND     + PY+VASASSDG I VWD+R  M  +EKPNPL
Sbjct  240   AYCIEDAHSARVKGIVVLSRNDSGTADDDPYMVASASSDGVIRVWDIR--MANREKPNPL  297

Query  1207  AMANTKSRLTCLAGSSIK  1260
             A ANTKSRLTCLAGSS+K
Sbjct  298   AEANTKSRLTCLAGSSLK  315



>ref|XP_011042988.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Populus euphratica]
Length=337

 Score =   371 bits (953),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 203/317 (64%), Positives = 243/317 (77%), Gaps = 9/317 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MSLIAGSY+ FIWG+KLK+ K     QNL L PLFS+ SHL+ I  A  +G  A SG +D
Sbjct  1     MSLIAGSYEKFIWGFKLKTLKHEPSSQNLTLTPLFSYQSHLAHITSAAAAGPAAASGSAD  60

Query  493   dTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             DTI +YDL + S +GSLH+ ++++ S+ F+TPPSLSFP NL+SA+ +GSV I+ TDPFVH
Sbjct  61    DTIHLYDLPSASSLGSLHQHTSSVTSVTFFTPPSLSFPRNLLSASADGSVCIFDTDPFVH  120

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNET  849
             LKTV VH+K +N LS+HPSG L  +VGRDECLAM++L RGRRSFY  LGKE S++KF+  
Sbjct  121   LKTVLVHKKAVNDLSVHPSGKLALTVGRDECLAMLNLVRGRRSFYCRLGKEASLVKFDLG  180

Query  850   GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKS  1029
             G+  +MV +EKV V E     + + EF   KRVL AAPGE G+LFTGGEDR+ITAWD  S
Sbjct  181   GEKFFMVTEEKVGVHE-AEDAKLLTEFECKKRVLSAAPGENGLLFTGGEDRSITAWDVNS  239

Query  1030  GKVAHRIDDAHSARVKGIVVLSNNDG--EYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
             GKVA+ IDDAHSARVKGIVVL  ND   + PYL+ASASSDG I VWDVRM M  KEKPNP
Sbjct  240   GKVAYCIDDAHSARVKGIVVLMRNDSTVDDPYLLASASSDGVIRVWDVRMSM--KEKPNP  297

Query  1204  LAMANTKSRLTCLAGSS  1254
             LA ANTKSRLTCLAGSS
Sbjct  298   LAEANTKSRLTCLAGSS  314



>ref|XP_008225515.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Prunus mume]
Length=341

 Score =   371 bits (953),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 247/321 (77%), Gaps = 11/321 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MSLIAGSY+ FIWG+KLKS K   D Q+L L PLFS+PSHLS+I     +GS A SGGSD
Sbjct  1     MSLIAGSYEKFIWGFKLKSLKANPDSQSLTLAPLFSYPSHLSSITTVATAGSAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             DTI +YD+S+ + +GSLH+ SAT+ SL+F+TPP LSFP NL+SAA +GS  IY  DPFV 
Sbjct  61    DTIHLYDMSSATSLGSLHDHSATVTSLSFFTPPHLSFPLNLVSAAADGSFCIYEADPFVL  120

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNET  849
             LK++K HRK IN +S+HPSG L  +VG+DECL+M++L RGRRSFY  LGKE S++ ++ +
Sbjct  121   LKSLKPHRKAINDVSLHPSGKLALTVGKDECLSMINLVRGRRSFYCRLGKEASLVTYDGS  180

Query  850   GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKS  1029
             G   YM M++KV V E     R + E  N+KRVLC  PGE G+L+TGGEDR ITAWDT S
Sbjct  181   GDKFYMAMEDKVMVHE-AEDARLLCELENSKRVLCVEPGENGVLYTGGEDRCITAWDTHS  239

Query  1030  GKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEKP  1197
             GKVA+RI+DAH ARVKGIVVL++  G    + PYLVASASSDG I +WDVRM +  KEKP
Sbjct  240   GKVAYRIEDAHPARVKGIVVLTSKAGAVADDDPYLVASASSDGVIRLWDVRMAV--KEKP  297

Query  1198  NPLAMANTKSRLTCLAGSSIK  1260
             NPLA ANTKSRLTCLAGSS+K
Sbjct  298   NPLAEANTKSRLTCLAGSSLK  318



>ref|XP_007214716.1| hypothetical protein PRUPE_ppa008201mg [Prunus persica]
 gb|EMJ15915.1| hypothetical protein PRUPE_ppa008201mg [Prunus persica]
Length=341

 Score =   371 bits (953),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 247/321 (77%), Gaps = 11/321 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MSLIAGSY+ FIWG+KLKS K   D Q+L L PLFS+PSHLS+I     +GS A SGGSD
Sbjct  1     MSLIAGSYEKFIWGFKLKSLKPNPDSQSLALTPLFSYPSHLSSITTVATAGSAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             DTI +YD+S+ + +GSLH+ SAT+ SL+F+TPP LSFP NL+SAA +GS  IY  DPFV 
Sbjct  61    DTIHLYDMSSATSLGSLHDHSATVTSLSFFTPPHLSFPLNLVSAAADGSFCIYEADPFVL  120

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNET  849
             LK++K HRK IN +S+HPSG L  +VG+DECL+M++L RGRRSFY  LGKE S++ ++ +
Sbjct  121   LKSLKPHRKAINDVSLHPSGKLALTVGKDECLSMINLVRGRRSFYCRLGKEASLVTYDGS  180

Query  850   GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKS  1029
             G   YM M++KV V E     R + E  N+KRVLC  PGE G+L+TGGEDR ITAWDT S
Sbjct  181   GDKFYMAMEDKVMVHE-AEDARLLCELENSKRVLCVEPGENGVLYTGGEDRCITAWDTNS  239

Query  1030  GKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEKP  1197
             GKVA+RI+DAH ARVKGIVVL++  G    + PYLVASASSDG I +WDVRM +  KEKP
Sbjct  240   GKVAYRIEDAHPARVKGIVVLTSKAGAVADDDPYLVASASSDGVIRLWDVRMAV--KEKP  297

Query  1198  NPLAMANTKSRLTCLAGSSIK  1260
             NPLA ANTKSRLTCLAGSS+K
Sbjct  298   NPLAEANTKSRLTCLAGSSLK  318



>ref|XP_008371777.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Malus domestica]
Length=338

 Score =   371 bits (952),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 199/321 (62%), Positives = 246/321 (77%), Gaps = 11/321 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKS---PKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MSLIAGSY+ FIWG+KL+      D Q+L L PLFS+PSHLS+I     +GS A SGG+D
Sbjct  1     MSLIAGSYEKFIWGFKLRPLNPSSDSQSLTLTPLFSYPSHLSSITTVATAGSAAASGGTD  60

Query  493   dTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             DTI +YD+S+ + +GSLH+ SAT+ SL+F+TPP LSFP NLISA  +GS+ IY  DPFV 
Sbjct  61    DTIHLYDMSSATSLGSLHDHSATVTSLSFFTPPHLSFPLNLISADADGSLCIYEADPFVL  120

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNET  849
             LK++K HRK IN +S+HPSG L  +VG+DECLAM++L RG+RSFY  +GKE S++ ++ +
Sbjct  121   LKSLKPHRKAINDVSLHPSGKLALTVGKDECLAMINLVRGKRSFYCRVGKEASLVSYDFS  180

Query  850   GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKS  1029
             G+  YM M+EKV V E     + + EF N+KRVLC  PGE G+LFTGGEDR+ITAWDT S
Sbjct  181   GEKFYMAMEEKVMVHE-AEDAKLLCEFENSKRVLCVEPGENGVLFTGGEDRSITAWDTNS  239

Query  1030  GKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEKP  1197
             GKVA+RI+DAHS RVKGIV L++  G    E PYLVASASSDG I VWDVRM +   EKP
Sbjct  240   GKVAYRIEDAHSTRVKGIVTLTSKAGAVANEDPYLVASASSDGVIRVWDVRMAVN--EKP  297

Query  1198  NPLAMANTKSRLTCLAGSSIK  1260
             NPLA ANTKSRLTCLAGSS+K
Sbjct  298   NPLAEANTKSRLTCLAGSSLK  318



>gb|KDO75412.1| hypothetical protein CISIN_1g019326mg [Citrus sinensis]
Length=340

 Score =   370 bits (950),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 200/325 (62%), Positives = 246/325 (76%), Gaps = 13/325 (4%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK----DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             MSLIAGSY+ FIWGYKLK       D + L L  LFS+P+HLS I    VSG+ A SGG+
Sbjct  1     MSLIAGSYEKFIWGYKLKPSNHYSSDQKTLTLTQLFSYPAHLSPITTVAVSGTAAASGGT  60

Query  490   ddTIKIYDLSTCSEIGSLH--ESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DDTI +YDLST S +G++H  ES+++ SLAFYTP +LS P NL S + +G VSI+  DPF
Sbjct  61    DDTIHLYDLSTSSSLGAIHHHESSSVTSLAFYTPQNLSVPRNLFSTSADGFVSIFDADPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V L +VKVH+KG+N L++H SG L  +VGRD+CLAMV+L RGRRSFY+ +GKE S++KF+
Sbjct  121   VLLTSVKVHKKGVNDLAVHHSGKLALTVGRDDCLAMVNLVRGRRSFYHKIGKEASLIKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDT  1023
              +G+  +MV +EKV + +     + + E +  KR+LCAAPGE G+LFTGGEDR+ITAWDT
Sbjct  181   GSGEKFFMVTEEKVGIHQ-AEDAKLLCELDGKKRILCAAPGENGVLFTGGEDRSITAWDT  239

Query  1024  KSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKE  1191
              SGKVA+ I+DAHSARVKGIVVL+ NDG    E PYLVASASSDG ICVWDVRM +  KE
Sbjct  240   NSGKVAYCIEDAHSARVKGIVVLTKNDGGSTAENPYLVASASSDGVICVWDVRMAI--KE  297

Query  1192  KPNPLAMANTKSRLTCLAGSSIKCE  1266
             KP PLA A T SRLTCLAGSS KCE
Sbjct  298   KPLPLAEAKTNSRLTCLAGSSTKCE  322



>ref|XP_002534379.1| pak inhibitor skb15, putative [Ricinus communis]
 gb|EEF28003.1| pak inhibitor skb15, putative [Ricinus communis]
Length=342

 Score =   369 bits (947),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 201/320 (63%), Positives = 244/320 (76%), Gaps = 10/320 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK-DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddT  498
             MSLIAGSY+ FIWG+KLK  K D Q L L PLFS+PSH+S I  A  SG VA SG +DDT
Sbjct  1     MSLIAGSYEKFIWGFKLKPLKHDQQTLTLTPLFSYPSHISPITTAAASGPVAASGSADDT  60

Query  499   IKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLK  675
             I +YD+ + + +GSLH+ SA+I +L+FYTPPSLSFP NLISAA +GSV I+  DPFVHLK
Sbjct  61    IHVYDIPSAASLGSLHDHSASITALSFYTPPSLSFPRNLISAAADGSVCIFDADPFVHLK  120

Query  676   TVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGK  855
             TV  H+KG+N L+IHPSG L  SVGRDECLAM++L RGRRSF+  LGKE S++KF+  G 
Sbjct  121   TVSAHKKGVNDLTIHPSGKLALSVGRDECLAMLNLVRGRRSFFCRLGKEASLVKFDIDGD  180

Query  856   TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGK  1035
               +MV +  + + +     + V E   +KRVLCAAPGE G+LFTGGEDRN+TAWDT SGK
Sbjct  181   KFFMVTECTIGIHQ-SEDAKLVTELECSKRVLCAAPGENGVLFTGGEDRNVTAWDTNSGK  239

Query  1036  VAHRIDDAHSARVKGIVVLSNN-----DGEYPYLVASASSDGNICVWDVRMGMGGKEKPN  1200
             +A+ I+ AHSARVKGIVVL+ N      G+ PYL+ASASSDG I VWDVRM +  KEKPN
Sbjct  240   IAYCIEGAHSARVKGIVVLNRNDGGGGGGDDPYLLASASSDGVIRVWDVRMAV--KEKPN  297

Query  1201  PLAMANTKSRLTCLAGSSIK  1260
             PLA  NT+SRLTCLAGSS+K
Sbjct  298   PLAETNTRSRLTCLAGSSLK  317



>gb|KDO75411.1| hypothetical protein CISIN_1g019326mg [Citrus sinensis]
Length=343

 Score =   367 bits (942),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 198/323 (61%), Positives = 244/323 (76%), Gaps = 13/323 (4%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK----DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             MSLIAGSY+ FIWGYKLK       D + L L  LFS+P+HLS I    VSG+ A SGG+
Sbjct  1     MSLIAGSYEKFIWGYKLKPSNHYSSDQKTLTLTQLFSYPAHLSPITTVAVSGTAAASGGT  60

Query  490   ddTIKIYDLSTCSEIGSLH--ESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DDTI +YDLST S +G++H  ES+++ SLAFYTP +LS P NL S + +G VSI+  DPF
Sbjct  61    DDTIHLYDLSTSSSLGAIHHHESSSVTSLAFYTPQNLSVPRNLFSTSADGFVSIFDADPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V L +VKVH+KG+N L++H SG L  +VGRD+CLAMV+L RGRRSFY+ +GKE S++KF+
Sbjct  121   VLLTSVKVHKKGVNDLAVHHSGKLALTVGRDDCLAMVNLVRGRRSFYHKIGKEASLIKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDT  1023
              +G+  +MV +EKV + +     + + E +  KR+LCAAPGE G+LFTGGEDR+ITAWDT
Sbjct  181   GSGEKFFMVTEEKVGIHQ-AEDAKLLCELDGKKRILCAAPGENGVLFTGGEDRSITAWDT  239

Query  1024  KSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKE  1191
              SGKVA+ I+DAHSARVKGIVVL+ NDG    E PYLVASASSDG ICVWDVRM +  KE
Sbjct  240   NSGKVAYCIEDAHSARVKGIVVLTKNDGGSTAENPYLVASASSDGVICVWDVRMAI--KE  297

Query  1192  KPNPLAMANTKSRLTCLAGSSIK  1260
             KP PLA A T SRLTCLAGSS K
Sbjct  298   KPLPLAEAKTNSRLTCLAGSSTK  320



>gb|KDP38003.1| hypothetical protein JCGZ_04646 [Jatropha curcas]
Length=341

 Score =   366 bits (939),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 195/319 (61%), Positives = 241/319 (76%), Gaps = 9/319 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MSLIAGSY+ FIWG+KLK  K     + L L PLFS+PSHL+ I CA  +G  A SG SD
Sbjct  1     MSLIAGSYEKFIWGFKLKPLKHNDSQETLTLTPLFSYPSHLAPITCAAAAGPAAASGSSD  60

Query  493   dTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             DTI IYDL + + +GSLH  +++I SL+F+TPPS SFP NL+SA+ +GSV I+  DPF+H
Sbjct  61    DTIHIYDLPSAASLGSLHHHTSSITSLSFFTPPSFSFPRNLLSASADGSVCIFDADPFLH  120

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNET  849
             LKT++ H+KG+N LS+HPSG L  +VGRDECLAM++L RGRRSFY  LGKE S++KF+  
Sbjct  121   LKTIRAHKKGVNDLSVHPSGKLALTVGRDECLAMLNLVRGRRSFYCRLGKEASLVKFDLD  180

Query  850   GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKS  1029
             G+  +MV +EKV + +     R V E    KRVLCA PGE GILFTGG+DRN+TAWDT +
Sbjct  181   GERFFMVTEEKVGIHQ-AENARLVTELECRKRVLCAVPGENGILFTGGDDRNLTAWDTHT  239

Query  1030  GKVAHRIDDAHSARVKGIVVLSNNDG--EYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
             GK A+ I++AHS RVKGI VL+ +DG  + PYL ASASSDG I VWDVRM +  KEKPNP
Sbjct  240   GKAAYCIENAHSTRVKGIEVLTKSDGVADDPYLFASASSDGVIRVWDVRMAL--KEKPNP  297

Query  1204  LAMANTKSRLTCLAGSSIK  1260
             LA  NTKSRLTCLAGSS+K
Sbjct  298   LAEVNTKSRLTCLAGSSLK  316



>ref|XP_006468054.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Citrus sinensis]
Length=343

 Score =   364 bits (935),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 198/323 (61%), Positives = 244/323 (76%), Gaps = 13/323 (4%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK----DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             MSLIAGSY+ FIWGYKLK       D + L L  LFS+P+HLS I    VSG+ A SGG+
Sbjct  1     MSLIAGSYEKFIWGYKLKPSNHYSSDQKTLTLTQLFSYPAHLSPITTVAVSGTAAASGGT  60

Query  490   ddTIKIYDLSTCSEIGSLH--ESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DDTI +YDLST S +G++H  ES+++ SLAFYTP +LS P NL S + +G VSI+  DPF
Sbjct  61    DDTIHLYDLSTSSSLGAIHHHESSSVTSLAFYTPQNLSVPRNLFSTSADGFVSIFDADPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V L +VKVH+KG+N L++H SG L  +VGRD+CLAMV+L RGRRSFY+ +GKE S++KF+
Sbjct  121   VLLTSVKVHKKGVNDLAVHHSGKLALTVGRDDCLAMVNLVRGRRSFYHKIGKEASLIKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDT  1023
              +G+  +MV +EKV + +     + + E +  KR+LCAAPGE G+LFTGGEDR+ITAWDT
Sbjct  181   GSGEKFFMVTEEKVGIHQ-AEDAKLLCELDGKKRILCAAPGENGVLFTGGEDRSITAWDT  239

Query  1024  KSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKE  1191
              SGKVA+ I+DAHSARVKGIVVL+ NDG    E PYLVASASSDG I VWDVRM +  KE
Sbjct  240   NSGKVAYCIEDAHSARVKGIVVLTKNDGGSTAENPYLVASASSDGVIRVWDVRMAI--KE  297

Query  1192  KPNPLAMANTKSRLTCLAGSSIK  1260
             KP PLA A T SRLTCLAGSSIK
Sbjct  298   KPLPLAEAKTNSRLTCLAGSSIK  320



>ref|XP_006449010.1| hypothetical protein CICLE_v10015824mg [Citrus clementina]
 gb|ESR62250.1| hypothetical protein CICLE_v10015824mg [Citrus clementina]
Length=343

 Score =   362 bits (928),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 197/323 (61%), Positives = 242/323 (75%), Gaps = 13/323 (4%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK----DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             MSLIAGSY+ FIWGYKLK       D + L L  LFS+P+HLS I    VSG+ A SGG+
Sbjct  1     MSLIAGSYEKFIWGYKLKPSNHYSSDQKTLTLTQLFSYPAHLSPITTVAVSGTAAASGGT  60

Query  490   ddTIKIYDLSTCSEIGSLH--ESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DDTI +YDLST S +G++H  ES+++ SLAFYTP +LS P NL S + +G VSI+  DPF
Sbjct  61    DDTIHLYDLSTSSSLGAIHHHESSSVTSLAFYTPQNLSVPRNLFSTSADGFVSIFDADPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V L +VKVH+KG+N L++H SG L  +VGRDECLAMV+L RGRRSFY+ +GKE S++KF+
Sbjct  121   VLLTSVKVHKKGVNDLAVHHSGKLALTVGRDECLAMVNLVRGRRSFYHKIGKEASLIKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDT  1023
              +G+  +MV +EKV + +     + + E +  KR+LCA PGE G+L TGGEDR+ITAWDT
Sbjct  181   GSGEKFFMVTEEKVGIHQ-AEDAKLLCELDGKKRILCATPGENGVLLTGGEDRSITAWDT  239

Query  1024  KSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKE  1191
              SGKVA+ I+DAHSARVKGIVVL+ NDG    E PYLVASASSDG I VWDVRM +  KE
Sbjct  240   NSGKVAYCIEDAHSARVKGIVVLTKNDGGGTAENPYLVASASSDGVIRVWDVRMAI--KE  297

Query  1192  KPNPLAMANTKSRLTCLAGSSIK  1260
             KP PLA A T SRLTCLAGSSIK
Sbjct  298   KPLPLAEAKTNSRLTCLAGSSIK  320



>ref|XP_008356035.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Malus domestica]
Length=338

 Score =   361 bits (927),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 197/322 (61%), Positives = 243/322 (75%), Gaps = 13/322 (4%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK----SPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             MSLIAGSY+ FIWG+KL+    SP D Q+L L PLFS+PSHLS+I     +GS A SGG+
Sbjct  1     MSLIAGSYEKFIWGFKLRPLNPSP-DSQSLTLTPLFSYPSHLSSITSVATAGSAAASGGT  59

Query  490   ddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             DDT+ +Y++S+ + +GSLH+ SAT+ SL+F+TPP LSFP NLISA   GS+ IY  DPFV
Sbjct  60    DDTVHLYNMSSATSLGSLHDHSATVTSLSFFTPPHLSFPLNLISADAEGSLCIYEADPFV  119

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LKT+K HRK IN +++HPSG L  +VG+DECLAM++L RG+RSFY  + KE S++ ++ 
Sbjct  120   LLKTLKPHRKAINDVALHPSGKLALTVGKDECLAMINLVRGKRSFYCRVAKEASLVSYDF  179

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G+  YM M+EKV V E     + + EF N+KRVLC  PGE GILFTGGEDR ITAWDT 
Sbjct  180   SGEKFYMTMEEKVMVHE-AEDAKLLCEFENSKRVLCIEPGENGILFTGGEDRXITAWDTN  238

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEK  1194
             SGKVA+RI+ AH  RVKGIV L++  G    E PYLVASASSDG I VWDVRM +   EK
Sbjct  239   SGKVAYRIEGAHPTRVKGIVTLTSKAGAEVNEDPYLVASASSDGIIRVWDVRMAV--TEK  296

Query  1195  PNPLAMANTKSRLTCLAGSSIK  1260
             PNPLA ANTKSRLTCLAGSS+K
Sbjct  297   PNPLAEANTKSRLTCLAGSSLK  318



>ref|XP_008439607.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Cucumis melo]
Length=340

 Score =   361 bits (927),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 197/319 (62%), Positives = 238/319 (75%), Gaps = 9/319 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSLIAGSY++FIWG+KL+ P + Q L L P FS+ SH+S IK    +G VA SGG+D TI
Sbjct  1     MSLIAGSYENFIWGFKLR-PSEPQTLTLTPFFSYHSHISAIKTVAAAGPVAASGGNDQTI  59

Query  502   KIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
              +YDLST S +GSLH+ SA I SLAFYTPP+LSFP NL+SAA +GSV IY TDPFVHLKT
Sbjct  60    HLYDLSTTSSLGSLHDHSAYITSLAFYTPPNLSFPRNLVSAAADGSVCIYDTDPFVHLKT  119

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             V  HRK +N LSIHPSG L  +VG DECLA+++L RGRRSFY  LGKE S++ F+  G  
Sbjct  120   VLPHRKAVNDLSIHPSGKLALTVGHDECLAIINLVRGRRSFYCRLGKEASLVDFDVGGDK  179

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
              +MVM EKVSV E     R + EF N KRV C  P E GIL TGG+DR +TAWD KSGKV
Sbjct  180   FFMVMKEKVSVHE-AEDARLLCEFENKKRVSCVTPCENGILLTGGDDRCLTAWDVKSGKV  238

Query  1039  AHRIDDAHSARVKGIVVLSNNDG-----EYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
             A+ I++AH ARV+GIVV++ N       + P++VASAS+DG I VWDVRM    K+KPNP
Sbjct  239   AYTIEEAHPARVRGIVVMTKNSSGAFSDDDPHVVASASTDGVIRVWDVRM-TAIKDKPNP  297

Query  1204  LAMANTKSRLTCLAGSSIK  1260
             LA ANTK+RLTCLAGS++K
Sbjct  298   LAEANTKARLTCLAGSALK  316



>ref|XP_004134619.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Cucumis sativus]
 gb|KGN49418.1| hypothetical protein Csa_6G524070 [Cucumis sativus]
Length=340

 Score =   360 bits (923),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 197/319 (62%), Positives = 238/319 (75%), Gaps = 9/319 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSLIAGSY++FIWG+KL+ P + Q+L L P FS+ SH+S IK    +G VA SGG+D TI
Sbjct  1     MSLIAGSYENFIWGFKLR-PSEPQSLTLTPFFSYHSHISAIKTVAAAGPVAASGGNDQTI  59

Query  502   KIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
              +YDLST S +GSLH+ SA I SLAFYTPP+LSFP NL+SAA +GSV IY TDPFVHLKT
Sbjct  60    HLYDLSTTSSLGSLHDHSAYITSLAFYTPPNLSFPRNLVSAAADGSVCIYDTDPFVHLKT  119

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             V  HRK +N LSIHPSG L  +VG DECLA+++L RGRRSFY  LG E S++ F+  G  
Sbjct  120   VLPHRKAVNDLSIHPSGKLALTVGHDECLAIINLVRGRRSFYCRLGNEASLVDFDVGGDK  179

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
              +MVM EKVSV E     R + EF N KRV C  P E GIL TGG+DR +TAWD KSGKV
Sbjct  180   FFMVMKEKVSVHE-AEDARLLCEFENKKRVSCITPCENGILLTGGDDRCLTAWDVKSGKV  238

Query  1039  AHRIDDAHSARVKGIVVLSNNDG-----EYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
             A+ I++AH ARV+GIVVL+ N       + P++VASAS+DG I VWDVRM    K+KPNP
Sbjct  239   AYTIEEAHPARVRGIVVLTKNSSGAFTDDDPHVVASASTDGVIRVWDVRM-TAIKDKPNP  297

Query  1204  LAMANTKSRLTCLAGSSIK  1260
             LA ANTK+RLTCLAGS++K
Sbjct  298   LAEANTKARLTCLAGSALK  316



>ref|XP_008364194.1| PREDICTED: LOW QUALITY PROTEIN: p21-activated protein kinase-interacting 
protein 1-like [Malus domestica]
Length=337

 Score =   359 bits (922),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 194/320 (61%), Positives = 241/320 (75%), Gaps = 10/320 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK--SPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsdd  495
             MSLIAGSY+ FIWG+KL+  +    Q+L L PLFS+PSHLS+I     +GS A SGG+DD
Sbjct  1     MSLIAGSYEXFIWGFKLRXLNLXRSQSLTLTPLFSYPSHLSSITSVATAGSXAASGGTDD  60

Query  496   TIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHL  672
             T+ +Y++S+ + +GSLH+ SAT+ SL+F+TPP LSFP NLISA   GS+ IY  DPFV L
Sbjct  61    TVHLYNMSSATSLGSLHDHSATVTSLSFFTPPHLSFPLNLISADAEGSLCIYEADPFVLL  120

Query  673   KTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETG  852
             KT+K HRK IN +++HPSG L  +VG+DECLAM++L RG+RSFY  + KE S++ ++ +G
Sbjct  121   KTLKPHRKAINDVALHPSGKLALTVGKDECLAMINLVRGKRSFYCRVAKEASLVSYDFSG  180

Query  853   KTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
             +  YM M+EKV V E     + + EF N+KRVLC  PGE GILFTGGEDR ITAWDT SG
Sbjct  181   EKFYMTMEEKVMVHE-AEDAKLLCEFENSKRVLCIEPGENGILFTGGEDRXITAWDTNSG  239

Query  1033  KVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEKPN  1200
             KVA+RI+ AH  RVKGIV L++  G    E PYLVASASSDG I VWDVRM +   EKPN
Sbjct  240   KVAYRIEGAHPTRVKGIVTLTSKAGAEVNEDPYLVASASSDGIIRVWDVRMAV--TEKPN  297

Query  1201  PLAMANTKSRLTCLAGSSIK  1260
             PLA ANTKSRLTCLAGSS+K
Sbjct  298   PLAEANTKSRLTCLAGSSLK  317



>ref|XP_009360927.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Pyrus x bretschneideri]
 ref|XP_009360928.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Pyrus x bretschneideri]
Length=338

 Score =   358 bits (920),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 197/322 (61%), Positives = 243/322 (75%), Gaps = 13/322 (4%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK----SPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             MSLIAGSY+ FIWG+KL+    SP D Q+L L PLFS+PSHLS+I     +GS A SGG+
Sbjct  1     MSLIAGSYEKFIWGFKLRPLNPSP-DSQSLTLTPLFSYPSHLSSITSVATAGSAAASGGT  59

Query  490   ddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             DDT+ +YD+S+ + +GSLH+ SAT+ SL+F+TPP LSFP NLISA   GS+ IY  DPFV
Sbjct  60    DDTVHLYDMSSATSLGSLHDHSATVTSLSFFTPPHLSFPLNLISADAEGSLCIYEADPFV  119

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LKT+K HRK IN +++HPSG L  +VG+DECLAM++L RG+RSFY  + KE S++ ++ 
Sbjct  120   LLKTLKPHRKAINDVALHPSGKLALTVGKDECLAMINLVRGKRSFYCRVAKEASLVSYDF  179

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G+  YM M+EKV V E     + + EF N+KRVLC  PGE GILFTGGEDR+ITAWDT 
Sbjct  180   SGEKFYMTMEEKVLVHE-AEDAKLLCEFENSKRVLCIEPGENGILFTGGEDRSITAWDTN  238

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEK  1194
             SGKVA+ I+DAH  RVKGIV L++  G    E PYLVASASSDG I VWDVRM +   EK
Sbjct  239   SGKVAYCIEDAHPTRVKGIVTLTSKAGAEVNEDPYLVASASSDGIIRVWDVRMAV--TEK  296

Query  1195  PNPLAMANTKSRLTCLAGSSIK  1260
              NPLA ANTKSRLTCLAGSS+K
Sbjct  297   ANPLAEANTKSRLTCLAGSSLK  318



>ref|XP_010246113.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Nelumbo nucifera]
Length=333

 Score =   358 bits (919),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 198/319 (62%), Positives = 244/319 (76%), Gaps = 13/319 (4%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M+L+AGSY+ FIWGY+LK+   L +  L PLFS+PSHL+TIKC  VSG VAVSGG+DDTI
Sbjct  1     MTLVAGSYEKFIWGYQLKT---LDSPTLKPLFSYPSHLTTIKCVAVSGPVAVSGGADDTI  57

Query  502   KIYDLSTCSEIGSL--HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLK  675
             KIYDLST SE+GSL  H+ A + +L+FYTPPSLSFP NL+S +++G+V IY  DPF+HLK
Sbjct  58    KIYDLSTSSEVGSLLDHKGA-VTALSFYTPPSLSFPRNLLSGSEDGTVCIYDADPFIHLK  116

Query  676   TVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGK  855
             TV  H++G+N L+IH SG L  +VGRD   AM++L RG+RSF+  L +E SI+KF+  G 
Sbjct  117   TVTAHKRGVNDLTIHLSGKLALTVGRDSSFAMLNLVRGKRSFHCRLDEEASIVKFDCEGG  176

Query  856   TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGK  1035
               +MV +EKVS+ E     + VLE  N KRVLC AP   G+LF+GGEDRNITAWDT SGK
Sbjct  177   KFFMVSEEKVSMHE-SIDAKLVLEMQNQKRVLCVAPATNGLLFSGGEDRNITAWDTTSGK  235

Query  1036  VAHRIDDAHSARVKGIVVLS----NNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
             VA+ I++AHS RVKGIVVL+    ++D   P+LVASASSDG I VWDVRM    KEKPNP
Sbjct  236   VAYCIENAHSTRVKGIVVLTRSSGSDDSNNPFLVASASSDGVIRVWDVRMAK--KEKPNP  293

Query  1204  LAMANTKSRLTCLAGSSIK  1260
             L  ANTKSRLTCLAG+SIK
Sbjct  294   LVEANTKSRLTCLAGTSIK  312



>ref|XP_010087006.1| p21-activated protein kinase-interacting protein 1-like protein 
[Morus notabilis]
 gb|EXB25446.1| p21-activated protein kinase-interacting protein 1-like protein 
[Morus notabilis]
Length=343

 Score =   353 bits (905),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 195/321 (61%), Positives = 240/321 (75%), Gaps = 11/321 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPL---FSFPSHLSTIKCadvsgsvavsggsd  492
             MSLIAGSY+ FIWG+KLK  K       + L   FS+PSHLS++  A  +G  A SGGSD
Sbjct  1     MSLIAGSYERFIWGFKLKPLKTDPTTQTLTLTPLFSYPSHLSSVTSAAAAGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             DT+ +YDLS  S +GSLH+ +A++ SL+F+TPP LSFP NL+SA  +GSV IY  DPFV 
Sbjct  61    DTVHLYDLSAASSLGSLHDHAASVTSLSFFTPPGLSFPRNLVSADADGSVCIYDADPFVL  120

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNET  849
             LKTV+VH+KGIN L+IHPSG L  +VGRDECL M++L RGRRSFY  +G+E S+++F+  
Sbjct  121   LKTVRVHKKGINDLAIHPSGKLALTVGRDECLGMLNLIRGRRSFYCRIGREASLVRFDSG  180

Query  850   GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKS  1029
             G   +MV+D K+SV E     + V E  +  RVLCAA GE G+LFTGGED +ITAWDT S
Sbjct  181   GDKFFMVVDRKISVHE-AEDAKIVAELESPMRVLCAASGENGLLFTGGEDCSITAWDTNS  239

Query  1030  GKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEKP  1197
             GKVA+ I +AHS+RVKGI+VLS N G    + PYLV+SASSDG I VWDVRM M  KEKP
Sbjct  240   GKVAYNIKEAHSSRVKGIIVLSRNAGAAADDDPYLVSSASSDGVIRVWDVRMAM--KEKP  297

Query  1198  NPLAMANTKSRLTCLAGSSIK  1260
             NPLA ANTKSR+TCLAGSS+K
Sbjct  298   NPLAEANTKSRITCLAGSSLK  318



>ref|XP_010056917.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Eucalyptus grandis]
 gb|KCW73825.1| hypothetical protein EUGRSUZ_E02427 [Eucalyptus grandis]
Length=341

 Score =   352 bits (904),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 197/322 (61%), Positives = 238/322 (74%), Gaps = 12/322 (4%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MSLIAGSY+ FIWG+KLK  K   D   L L  LF +PSHLS I     +G VA SG  D
Sbjct  1     MSLIAGSYEKFIWGFKLKPLKHSSDGGALTLTKLFCYPSHLSPISSVAAAGPVAASGAGD  60

Query  493   dTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             DTI +YDL+  S +GSLH  SAT+ +L FYTP +LSFP NL+SA+ +GSV I+  DPFVH
Sbjct  61    DTIHLYDLAAASSLGSLHHHSATVTALCFYTPSNLSFPRNLLSASADGSVCIFDADPFVH  120

Query  670   LKTVKVHRKG-INSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
             L TVKVH+KG +NSLS+HPSG L  +VGRDECLAMV+L RGRRSF   L KE S++ F+ 
Sbjct  121   LTTVKVHKKGGVNSLSVHPSGKLALTVGRDECLAMVNLVRGRRSFCCRLAKEASLVGFDL  180

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G+  +MVM +KV + E     R V E  + KRVLCAAP E G+L+TGGEDR++TAWDTK
Sbjct  181   SGERFFMVMGDKVGIHE-AEDARLVWEMESGKRVLCAAPSESGLLYTGGEDRSVTAWDTK  239

Query  1027  SGKVAHRIDDAHSARVKGIVVLS---NNDGE-YPYLVASASSDGNICVWDVRMGMGGKEK  1194
             +GK+A++I+DAHS RVKGIVVLS   +  GE  PYLV SASSDG I VWDVRM M  KE+
Sbjct  240   TGKMAYQIEDAHSTRVKGIVVLSKSTDTSGEDDPYLVTSASSDGVIRVWDVRMAM--KER  297

Query  1195  PNPLAMANTKSRLTCLAGSSIK  1260
             P PLA  NTKSRLTCLAG+S+K
Sbjct  298   PLPLAEVNTKSRLTCLAGTSLK  319



>ref|XP_004293569.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Fragaria vesca subsp. vesca]
Length=343

 Score =   347 bits (891),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 191/321 (60%), Positives = 234/321 (73%), Gaps = 10/321 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK---SPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MSLIAGSY+ F+WG+KLK   +  + + L L PLFS+PSHLS I     +GS A SGGSD
Sbjct  1     MSLIAGSYEKFLWGFKLKPLNTDPNSKTLTLTPLFSYPSHLSAITSLAAAGSAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             DTI++YDLS  + +GSL++ +AT+ SL+F+T P LS P NL+S    GS  IY  DPFV 
Sbjct  61    DTIQLYDLSHATSVGSLNDHAATVTSLSFFTRPDLSVPLNLVSGDAEGSFCIYEADPFVL  120

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNET  849
             LK++K HRK IN LS+HPSG L  +VG+DECLAM++L RGRRSFY  LG E S++ FN  
Sbjct  121   LKSLKPHRKAINDLSLHPSGKLALTVGKDECLAMINLVRGRRSFYCRLGMEASLVDFNGD  180

Query  850   GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKS  1029
             G   Y+  +EKV+V E     + V E  N KRVLCA PGE G+LFTGGEDR ITAWDT +
Sbjct  181   GDKFYLATEEKVTVHE-AEDAKLVCEMENLKRVLCAEPGENGLLFTGGEDRGITAWDTNT  239

Query  1030  GKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEKP  1197
             GKVA+RI+DAHS RVKGIVV+ ++ G    E PY+VAS SSDG I VWDVRM +    KP
Sbjct  240   GKVAYRIEDAHSTRVKGIVVMKSSSGDVANEDPYIVASGSSDGVIRVWDVRMAV-KDNKP  298

Query  1198  NPLAMANTKSRLTCLAGSSIK  1260
             NPLA ANTKSRLTCLAGS++K
Sbjct  299   NPLAEANTKSRLTCLAGSAMK  319



>gb|KHG18244.1| p21-activated protein kinase-interacting protein 1 [Gossypium 
arboreum]
Length=337

 Score =   346 bits (887),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 191/320 (60%), Positives = 237/320 (74%), Gaps = 11/320 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK----SPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             MSLIAGSY+ FIWG+KLK     P   Q+L L  +FS+PSH++ I     +G  A SG S
Sbjct  1     MSLIAGSYERFIWGFKLKPLTHDPPS-QSLTLTQIFSYPSHIAPITTVAAAGPAAASGSS  59

Query  490   ddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             DDTI IYDLS+ + +G LH  S++I SL+FY PP+LSFP NL+SAA +G++SI+ T+PFV
Sbjct  60    DDTIHIYDLSSAASLGPLHHFSSSITSLSFYCPPNLSFPRNLLSAAADGTISIFDTEPFV  119

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK+ + H+K IN L++HPSG L  SV RD CLAM +L RG+RSF   LGKE +I+KF+ 
Sbjct  120   LLKSFRSHKKCINDLAVHPSGKLALSVSRDGCLAMSNLMRGKRSFCCRLGKEATIVKFDA  179

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G   +M  +EK+ V  L    R + E +N KRVLCAA GEGGILFTGGE R+ITAWDT 
Sbjct  180   SGDRFFMASEEKIGV-HLAEDARLLFELDNQKRVLCAASGEGGILFTGGESRSITAWDTN  238

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDG--EYPYLVASASSDGNICVWDVRMGMGGKEKPN  1200
             SGKVA+ I+DAHS R+KGIVVL+ + G  + PYLVASASSDG I VWDVRM +  KEKPN
Sbjct  239   SGKVAYCIEDAHSTRLKGIVVLTKDGGSDDEPYLVASASSDGFIRVWDVRMAV--KEKPN  296

Query  1201  PLAMANTKSRLTCLAGSSIK  1260
             PLA A TKSRLTCLAGSS+K
Sbjct  297   PLAEAITKSRLTCLAGSSLK  316



>ref|XP_007025019.1| Pak inhibitor skb15, putative [Theobroma cacao]
 gb|EOY27641.1| Pak inhibitor skb15, putative [Theobroma cacao]
Length=338

 Score =   343 bits (881),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 190/320 (59%), Positives = 235/320 (73%), Gaps = 11/320 (3%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK----SPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             MSLIAGSY+ FIWG++LK     P   Q L L  LFS+PSH + I     +G  A SG S
Sbjct  1     MSLIAGSYERFIWGFRLKPLNYDPSS-QTLTLTQLFSYPSHNAPITTVAAAGPAAASGSS  59

Query  490   ddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             DDTI IYDLST + +G LH  S++I +L+FY+PP+LSFP NL+SA+ +GS+SI+ T+PFV
Sbjct  60    DDTIHIYDLSTAASLGPLHHFSSSITALSFYSPPNLSFPRNLLSASADGSISIFDTEPFV  119

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK+ + H+KGIN L++H SG L  SV RD CLAM +L RG+RSF   LGKE +I+KF+ 
Sbjct  120   LLKSFRSHKKGINDLAVHSSGKLALSVSRDGCLAMSNLMRGKRSFCCRLGKEATIVKFDG  179

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G+  +M  +EK+ V  L    R + E  N KRVLCAA GE GILFTGGE R+ITAWDT 
Sbjct  180   SGERFFMASEEKIGV-HLAEDARLLYELENEKRVLCAASGESGILFTGGESRSITAWDTN  238

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDG--EYPYLVASASSDGNICVWDVRMGMGGKEKPN  1200
             SGKVA+ I+DAHS RVKGIVVL+ + G  + PYLVASASSDG I VWDVRM + G  KPN
Sbjct  239   SGKVAYCIEDAHSTRVKGIVVLAKDGGVDDAPYLVASASSDGFIRVWDVRMAIKG--KPN  296

Query  1201  PLAMANTKSRLTCLAGSSIK  1260
             PLA ANTKSRLTCLAGSS++
Sbjct  297   PLAEANTKSRLTCLAGSSLQ  316



>ref|XP_010696297.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Beta vulgaris subsp. vulgaris]
Length=340

 Score =   339 bits (870),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 189/322 (59%), Positives = 231/322 (72%), Gaps = 12/322 (4%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQN----LDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             MSLIAGSY+ FIWGYKL+ PK  ++    L L P FS+ +HLS +K   VSG VA S   
Sbjct  1     MSLIAGSYEKFIWGYKLRQPKSPESQTLTLALTPQFSYAAHLSPLKSVAVSGVVAASSAG  60

Query  490   ddTIKIYDLSTCSEIGSLHESATINSLAFYTPPSLS-FPHNLISAADNGSVSIYHTDPFV  666
             DDT+K+YDLST SE+GSL   ++  SL+F+TPPSLS FP NL +A+D+GS SI+  DPFV
Sbjct  61    DDTVKLYDLSTSSELGSLLLESSATSLSFFTPPSLSSFPRNLFAASDDGSFSIFDVDPFV  120

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LKTV VH+KGIN  S+HPSG L  +VG+D CL MV+L RGRRSF   L KE SI+++  
Sbjct  121   LLKTVSVHKKGINYTSVHPSGKLALTVGKDSCLGMVNLVRGRRSFLCRLEKEASIVEYCL  180

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G   +M  D+K+SV E     + V EF  AKRVLCAA GE G+++TGGEDR +TAWD  
Sbjct  181   DGGRFFMSFDDKISVHE-AEDAKLVGEFETAKRVLCAASGENGLIYTGGEDRGVTAWDAV  239

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEK  1194
             SGKVA+ IDDAH +R+KGIVVLS +      E P+LVASASSDG I VWDVR     KEK
Sbjct  240   SGKVAYSIDDAHKSRIKGIVVLSKDGNSSAVENPFLVASASSDGVIRVWDVR--AINKEK  297

Query  1195  PNPLAMANTKSRLTCLAGSSIK  1260
               P++ ANTKSR+TCLAGSSIK
Sbjct  298   SIPVSEANTKSRITCLAGSSIK  319



>ref|XP_010551050.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Tarenaya hassleriana]
Length=345

 Score =   339 bits (869),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 235/325 (72%), Gaps = 15/325 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MSLIAGSY+ FIWG+KLK  K   D + L L PLFS+PSH+S I     +G  A SGGSD
Sbjct  1     MSLIAGSYERFIWGFKLKPSKHEDDSKTLTLAPLFSYPSHISPITTVAAAGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             D I +YDL + + +GSL   + +A+I +L+F+TPPSLSFP NL+SAA +GSV+I+  DPF
Sbjct  61    DAIHLYDLPSAASLGSLLGHNHTASITALSFFTPPSLSFPRNLVSAAADGSVAIFDADPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+KG+N L+IHPSG L  +V RDECLAM +L RG+RSF   LG E S++KF+
Sbjct  121   VLLKSFRPHKKGVNDLAIHPSGKLALTVSRDECLAMSNLVRGKRSFCCRLGHEASLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPGEGGILFTGGEDRNITAW  1017
              +G+  +MV++ KV V +     + + E  N   KR+LCA+PGE G LFT GEDR ITAW
Sbjct  181   SSGEKFFMVVNSKVGVHQ-AEDAKLLFELENPSRKRILCASPGENGTLFTAGEDRAITAW  239

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGG  1185
             DT  GKVA+ I+DAH AR+KG+VVL+ ND     E P+LVASASSDG I VWD+RM +  
Sbjct  240   DTNCGKVAYSIEDAHPARIKGVVVLTRNDNDGASEDPFLVASASSDGIIRVWDIRMAV--  297

Query  1186  KEKPNPLAMANTKSRLTCLAGSSIK  1260
             KEK  PLA  NTKSRLTCLAGSS+K
Sbjct  298   KEKAKPLAETNTKSRLTCLAGSSLK  322



>ref|XP_009105293.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Brassica rapa]
Length=344

 Score =   337 bits (864),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 235/325 (72%), Gaps = 15/325 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ FIWG+KLK  K   D Q L L PLFS+PSH+S+I     SG  A SGGSD
Sbjct  1     MSIIAGSYERFIWGFKLKPTKHDADTQTLTLSPLFSYPSHISSITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YDL + S +GSL   + +A+I +L+FYTP SLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDLPSASSLGSLLDHNHTASITALSFYTPSSLSFPRNLISAAADGSVAIFDTDPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+K +N LSIHPSG L  +V RDEC AM++L RG+RSF   LG E S++KF+
Sbjct  121   VLLKSFRPHKKAVNDLSIHPSGKLALAVYRDECFAMLNLVRGKRSFCCRLGHEASLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPGEGGILFTGGEDRNITAW  1017
              +G+  +MV++ KV V +     + +LE +N   KR+LCA+PG+ G LFT GEDR ITAW
Sbjct  181   PSGERFFMVVNSKVDVHQ-SEDAKLLLELDNGSRKRILCASPGDSGTLFTAGEDRAITAW  239

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGG  1185
             DT SGK+A+ I DAH AR+KG+V L+ N+     E PYLVASASSDG I VWD+R  M  
Sbjct  240   DTNSGKLAYSIQDAHPARIKGVVTLTRNENDGASEDPYLVASASSDGIIRVWDMR--MAA  297

Query  1186  KEKPNPLAMANTKSRLTCLAGSSIK  1260
             KE   PLA  NTKSRLTCLAGS++K
Sbjct  298   KENAKPLAETNTKSRLTCLAGSALK  322



>emb|CDX96086.1| BnaA07g26450D [Brassica napus]
Length=344

 Score =   337 bits (864),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 235/325 (72%), Gaps = 15/325 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ FIWG+KLK  K   D Q L L PLFS+PSH+S+I     SG  A SGGSD
Sbjct  1     MSIIAGSYERFIWGFKLKPTKHDADTQTLTLSPLFSYPSHISSITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YDL + S +GSL   + +A+I +L+FYTP SLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDLPSASSLGSLLDHNHTASITALSFYTPSSLSFPRNLISAAADGSVAIFDTDPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+K +N LSIHPSG L  +V RDEC AM++L RG+RSF   LG E S++KF+
Sbjct  121   VLLKSFRPHKKAVNDLSIHPSGKLALAVYRDECFAMLNLVRGKRSFCCRLGHEASLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPGEGGILFTGGEDRNITAW  1017
              +G+  +MV++ KV V +     + +LE +N   KR+LCA+PG+ G LFT GEDR ITAW
Sbjct  181   PSGERFFMVVNSKVGVHQ-SEDAKLLLELDNGSRKRILCASPGDSGTLFTAGEDRAITAW  239

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGG  1185
             DT SGK+A+ I DAH AR+KG+V L+ N+     E PYLVASASSDG I VWD+R  M  
Sbjct  240   DTNSGKLAYSIQDAHPARIKGVVTLTRNENDGASEDPYLVASASSDGIIRVWDMR--MAA  297

Query  1186  KEKPNPLAMANTKSRLTCLAGSSIK  1260
             KE   PLA  NTKSRLTCLAGS++K
Sbjct  298   KENAKPLAETNTKSRLTCLAGSALK  322



>emb|CDY01817.1| BnaC06g28570D [Brassica napus]
Length=344

 Score =   337 bits (863),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 234/324 (72%), Gaps = 15/324 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ FIWG+KLK  K   D Q L L PLFS+PSH+S+I     SG  A SGGSD
Sbjct  1     MSIIAGSYERFIWGFKLKPTKHDADTQTLTLSPLFSYPSHISSITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YDL + S +GSL   + +A+I +L+FYTP SLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDLPSASSLGSLLDHNHTASITALSFYTPSSLSFPRNLISAAADGSVAIFDTDPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+K +N LSIHPSG L  +V RDEC AM++L RG+RSF   LG E S++KF+
Sbjct  121   VLLKSFRPHKKAVNDLSIHPSGKLALAVYRDECFAMLNLVRGKRSFCCRLGHEASLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPGEGGILFTGGEDRNITAW  1017
              +G+  +MV++ KV V +     + +LE +N   KR+LCA+PG+ G LFT GEDR ITAW
Sbjct  181   PSGERFFMVVNSKVGVHQ-SEDAKLLLELDNGSRKRILCASPGDSGTLFTAGEDRAITAW  239

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNND----GEYPYLVASASSDGNICVWDVRMGMGG  1185
             DT SGK+A+ I DAH AR+KG+V L+ ND     E PYLVASASSDG I VWD+R  M  
Sbjct  240   DTNSGKLAYSIQDAHPARIKGVVTLTKNDSDGASEDPYLVASASSDGIIRVWDMR--MAA  297

Query  1186  KEKPNPLAMANTKSRLTCLAGSSI  1257
             KE   PLA  NTKSRLTCLAGS++
Sbjct  298   KENAKPLAETNTKSRLTCLAGSAL  321



>ref|XP_002886792.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63051.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=345

 Score =   335 bits (860),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 188/325 (58%), Positives = 233/325 (72%), Gaps = 15/325 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ FIWG++LK  K   D Q L L PLFS+PSH+S I     SG  A SGGSD
Sbjct  1     MSIIAGSYERFIWGFRLKPTKHDADNQTLTLSPLFSYPSHISPITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YDL + S +GSL   + +A+I +L+FYTP SLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDLPSASSLGSLLDHNHAASITALSFYTPSSLSFPRNLISAAADGSVAIFDTDPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+K +N L+IHPSG L  +V RDE  AM++L RG+RSF   LG E S++KF+
Sbjct  121   VLLKSFRPHKKAVNDLAIHPSGKLALAVYRDEFFAMLNLVRGKRSFCCRLGLEASLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPGEGGILFTGGEDRNITAW  1017
              +G+  +MV+  KV V +     + +LE  N   KR+LCAAPGE G LFTGGEDR ITAW
Sbjct  181   PSGERFFMVVSNKVGVHQ-SEDAKLLLELENPSRKRILCAAPGESGTLFTGGEDRAITAW  239

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGG  1185
             DT SGK+A+ I+DAH AR+KGIVVL+ ND     E PYL+ SASSDG I VWDVR  M  
Sbjct  240   DTNSGKLAYSIEDAHPARIKGIVVLTRNDSDGSLEDPYLIGSASSDGGIRVWDVR--MAA  297

Query  1186  KEKPNPLAMANTKSRLTCLAGSSIK  1260
             KE   PLA  NTKSRLTCLAGS++K
Sbjct  298   KENTKPLAETNTKSRLTCLAGSALK  322



>emb|CDY12650.1| BnaA02g13180D [Brassica napus]
Length=344

 Score =   335 bits (859),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 233/325 (72%), Gaps = 15/325 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ FIWG+KLK  K   D   L L PLFS+PSHLS+I     SG  A SGGSD
Sbjct  1     MSIIAGSYERFIWGFKLKPTKHDPDTHTLTLSPLFSYPSHLSSITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YDL + S +GSL   + +A+I +L+FYTP SLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDLPSASSLGSLLDHNHAASITALSFYTPSSLSFPRNLISAAADGSVAIFDTDPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+K +N LSIHPSG L  +V RDEC AM++L RG+RSF   LG E S++KF+
Sbjct  121   VLLKSFRPHKKAVNDLSIHPSGKLALAVYRDECFAMLNLVRGKRSFCCRLGHEASLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKR--VLCAAPGEGGILFTGGEDRNITAW  1017
              +G+  +MV++ KV V +     + +LE +N  R  +LCA+PG+ G LFT GEDR ITAW
Sbjct  181   PSGERFFMVVNSKVGVHQ-SEDAKLLLELDNGSRKPILCASPGDSGTLFTAGEDRAITAW  239

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNNDGEY----PYLVASASSDGNICVWDVRMGMGG  1185
             DT SGK+A+ I DAH AR+KG+V L+ ND E     PYLVASASSDG I VWD+R  M  
Sbjct  240   DTNSGKLAYAIQDAHPARIKGVVTLTRNDSESASEDPYLVASASSDGIIRVWDMR--MAA  297

Query  1186  KEKPNPLAMANTKSRLTCLAGSSIK  1260
             KE   PLA  NTKSRLTCLAGS++K
Sbjct  298   KENAKPLAETNTKSRLTCLAGSALK  322



>emb|CDY64887.1| BnaC02g46010D [Brassica napus]
Length=342

 Score =   335 bits (858),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 186/323 (58%), Positives = 236/323 (73%), Gaps = 13/323 (4%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ FIWG+KLK  K   D Q L L PLFS+PSHLS+I     SG  A SGGSD
Sbjct  1     MSIIAGSYERFIWGFKLKPTKHDADNQTLTLSPLFSYPSHLSSITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YDL + S +GSL   + +A+I +L+FYTP SLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDLPSASSLGSLLDHNHTASITALSFYTPSSLSFPRNLISAAADGSVAIFDTDPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+K +N LSIHPSG L  +V RDEC AM++L RG+RSF   LG E S++KF+
Sbjct  121   VLLKSFRPHKKAVNDLSIHPSGKLALAVYRDECFAMLNLVRGKRSFCCRLGHEASLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPGEGGILFTGGEDRNITAW  1017
              +G+  +MV++ KV V +     + +LE +N   KR+LCA+PG+ G LFT GEDR ITAW
Sbjct  181   PSGERFFMVVNTKVGVHQ-SEDAKLLLELDNGSRKRILCASPGDSGTLFTAGEDRAITAW  239

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNNDG--EYPYLVASASSDGNICVWDVRMGMGGKE  1191
             DT SGK+A+ I DAH AR+KG+V  ++++G  E PYLVASASSDG I VWD+R  M  KE
Sbjct  240   DTNSGKLAYAIQDAHPARIKGVVTRNDSEGASEDPYLVASASSDGIIRVWDMR--MAAKE  297

Query  1192  KPNPLAMANTKSRLTCLAGSSIK  1260
                PLA  NTKSRLTCLAGS++K
Sbjct  298   NAKPLAETNTKSRLTCLAGSALK  320



>ref|XP_006391263.1| hypothetical protein EUTSA_v10018816mg [Eutrema salsugineum]
 gb|ESQ28549.1| hypothetical protein EUTSA_v10018816mg [Eutrema salsugineum]
Length=342

 Score =   334 bits (856),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 188/325 (58%), Positives = 235/325 (72%), Gaps = 16/325 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ FIWG+KLK  K   D Q L L PLFS+PSH+S I     SG  A SGGSD
Sbjct  1     MSIIAGSYERFIWGFKLKPTKHDADNQTLTLSPLFSYPSHISAITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YDL + S +GSL   + +A+I +L+F+TP SLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDLPSASSLGSLLDHNHTASITALSFFTP-SLSFPRNLISAAADGSVAIFDTDPF  119

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+K +N LSIHPSG L  +V RDEC AM++L RG+RSF   LG E S++KF+
Sbjct  120   VLLKSFRPHKKAVNDLSIHPSGKLALAVYRDECFAMLNLVRGKRSFCCRLGHEASLVKFD  179

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPGEGGILFTGGEDRNITAW  1017
              +G   +MV++ KV V +     + +LE +N   KR+LCA+PGE G L+T GEDR ITAW
Sbjct  180   PSGDKFFMVVNSKVGVHQ-SEDAKLLLELDNTSHKRILCASPGESGTLYTAGEDRAITAW  238

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNND----GEYPYLVASASSDGNICVWDVRMGMGG  1185
             DT SGK+A+ I DAH AR+KG+VVL+ ND     E PYLVASASSDG I VWD+R  M G
Sbjct  239   DTNSGKLAYSIQDAHPARIKGVVVLTRNDSEGASEDPYLVASASSDGVIRVWDMR--MAG  296

Query  1186  KEKPNPLAMANTKSRLTCLAGSSIK  1260
             KE   PLA  NTKSRLTCLAGS++K
Sbjct  297   KENAKPLAETNTKSRLTCLAGSALK  321



>gb|KFK40973.1| hypothetical protein AALP_AA2G068300 [Arabis alpina]
Length=346

 Score =   334 bits (857),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 184/325 (57%), Positives = 237/325 (73%), Gaps = 15/325 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ +IWG+KLK  K   D Q L L PLFS+PSH+S I     SG  A SGGSD
Sbjct  1     MSIIAGSYERYIWGFKLKPSKHDADNQTLTLSPLFSYPSHISPITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YD+ + S +GSL   + +A+I +L+FYTPPSLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDIPSASSLGSLLDHNHTASITALSFYTPPSLSFPRNLISAAADGSVAIFDTDPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             + LK+ + H+K +N L+IHPSG L  +V RD+CLAM++L RG+RSF  SLG E +++KF+
Sbjct  121   LLLKSFRPHKKPVNDLAIHPSGKLALAVYRDDCLAMLNLVRGKRSFCCSLGHEATLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPGEGGILFTGGEDRNITAW  1017
              TG T +MV++ KV V       + + + +N   KR+LCA+PGE G LFT GEDR ITAW
Sbjct  181   PTGDTFFMVVNTKVGV-HHSEDAKLLFQLHNPIRKRILCASPGESGTLFTAGEDRAITAW  239

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNND----GEYPYLVASASSDGNICVWDVRMGMGG  1185
             DT SGK+A+ I+DAH AR+KG+VVL+ ND     + PYL+ASASSDG I VWDVR  M  
Sbjct  240   DTNSGKLAYSIEDAHQARIKGVVVLTRNDSDGASQDPYLIASASSDGVIRVWDVR--MAP  297

Query  1186  KEKPNPLAMANTKSRLTCLAGSSIK  1260
             K+K  PLA  NT SRLTCLAGS++K
Sbjct  298   KDKATPLAETNTNSRLTCLAGSALK  322



>ref|NP_176683.1| DDB1a-binding WD40 domain protein [Arabidopsis thaliana]
 gb|AAU94425.1| At1g65030 [Arabidopsis thaliana]
 gb|AEE34317.1| DDB1a-binding WD40 domain protein [Arabidopsis thaliana]
Length=345

 Score =   333 bits (855),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 188/325 (58%), Positives = 232/325 (71%), Gaps = 15/325 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ FIWG+KLK  K   + Q L L PLFS+PSH+S I     SG  A SGGSD
Sbjct  1     MSIIAGSYERFIWGFKLKPTKHDAESQTLTLSPLFSYPSHISPITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YDL + S +GSL   + +A+I +L+FYTP SLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDLPSASSLGSLLDHNHAASITALSFYTPSSLSFPRNLISAAADGSVAIFDTDPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+K +N L+IHPSG L  +V RDE  AM++L RG+RSF   LG E S++KF+
Sbjct  121   VLLKSFRPHKKAVNDLAIHPSGKLALAVYRDEFFAMLNLVRGKRSFCCRLGHEASLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPGEGGILFTGGEDRNITAW  1017
              +G+  YMV+  KV V +     + +LE  N   KR+LCA PGE G LFTGGEDR ITAW
Sbjct  181   PSGERFYMVVSNKVGVHQ-SEDAKLLLELENPSRKRILCATPGESGTLFTGGEDRAITAW  239

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGG  1185
             DT SGK+A+ I+DAH AR+KGIVVL+ ND     E PYL+ SASSDG I VWDVR  M  
Sbjct  240   DTNSGKLAYSIEDAHPARIKGIVVLTRNDSDGSLEDPYLIGSASSDGIIRVWDVR--MAA  297

Query  1186  KEKPNPLAMANTKSRLTCLAGSSIK  1260
             KE   PLA  NTKSRLTCLAGS++K
Sbjct  298   KENTKPLAETNTKSRLTCLAGSALK  322



>gb|AAN17449.1| Unknown protein [Arabidopsis thaliana]
Length=345

 Score =   332 bits (852),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 231/325 (71%), Gaps = 15/325 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ FIWG+KLK  K   + Q L L PLFS+PSH+S I     SG  A SGGSD
Sbjct  1     MSIIAGSYERFIWGFKLKPTKHDAESQTLTLSPLFSYPSHISPITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YDL + S +GSL   + +A+I +L+FYTP SLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDLPSASSLGSLLDHNHAASITALSFYTPSSLSFPRNLISAAADGSVAIFDTDPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+K +N L+IHPSG L  +V RDE  AM++L RG+RSF   LG E S++KF+
Sbjct  121   VLLKSFRPHKKAVNDLAIHPSGKLALAVYRDEFFAMLNLVRGKRSFCCRLGHEASLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPGEGGILFTGGEDRNITAW  1017
              +G+  YMV+  KV V +     + +LE  N   KR+LCA PGE G LFTGGEDR ITAW
Sbjct  181   PSGERFYMVVSNKVGVHQ-SEDAKLLLELENPSRKRILCATPGESGTLFTGGEDRAITAW  239

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGG  1185
             DT SGK+A+ I+DAH AR+KGIVV + ND     E PYL+ SASSDG I VWDVR  M  
Sbjct  240   DTNSGKLAYSIEDAHPARIKGIVVFTRNDSDGSLEDPYLIGSASSDGIIRVWDVR--MAA  297

Query  1186  KEKPNPLAMANTKSRLTCLAGSSIK  1260
             KE   PLA  NTKSRLTCLAGS++K
Sbjct  298   KENTKPLAETNTKSRLTCLAGSALK  322



>ref|XP_010470381.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Camelina sativa]
Length=332

 Score =   330 bits (847),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 233/325 (72%), Gaps = 15/325 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ FIWG+KLK  K   D Q L L PLFS+PSH+S I     SG  A SGGSD
Sbjct  1     MSIIAGSYERFIWGFKLKPTKHDADNQTLILTPLFSYPSHISPITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YDL + S +GSL   + +A+I +L+FYTP SLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDLPSASSLGSLLDHNHTASITALSFYTPSSLSFPRNLISAAADGSVAIFDTDPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+K +N L+IHPSG L  +V RDE   M++L RG+RSF   LG E S++KF+
Sbjct  121   VLLKSFRPHKKAVNDLAIHPSGKLALAVYRDEFFTMLNLVRGKRSFCCRLGHEASLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPGEGGILFTGGEDRNITAW  1017
              +G++ +MV++ KV V +     + +LE  N   KR+LCA PGE G LFTGGEDR ITAW
Sbjct  181   PSGESFFMVVNNKVGVHQ-SEDAKLLLELENPSRKRILCATPGESGTLFTGGEDRAITAW  239

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGG  1185
             DT SGK+A+ I+DAH AR+KGIVVL+ N+     E PYL+ SASSDG I VWDVR  M  
Sbjct  240   DTNSGKLAYSIEDAHPARIKGIVVLTRNESDGSLEDPYLIGSASSDGIIRVWDVR--MAA  297

Query  1186  KEKPNPLAMANTKSRLTCLAGSSIK  1260
             KE   PLA  NTKSRLTCLAGS+++
Sbjct  298   KENTKPLAETNTKSRLTCLAGSALR  322



>ref|XP_010414821.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Camelina sativa]
Length=343

 Score =   331 bits (848),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 233/325 (72%), Gaps = 15/325 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ FIWG+KLK  K   D Q L L PLFS+PSH+S I     SG  A SGGSD
Sbjct  1     MSIIAGSYERFIWGFKLKPTKHDADNQTLILTPLFSYPSHISPITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YDL + S +GSL   + +A+I +L+FYTP SLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDLPSASSLGSLLDHNHTASITALSFYTPSSLSFPRNLISAAADGSVAIFDTDPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+K +N L+IHPSG L  +V RDE   M++L RG+RSF   LG E S++KF+
Sbjct  121   VLLKSFRPHKKAVNDLAIHPSGKLALAVYRDEFFTMLNLVRGKRSFCCRLGHEASLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPGEGGILFTGGEDRNITAW  1017
              +G++ +MV++ KV V +     + +LE  N   KR+LCA PGE G LFTGGEDR ITAW
Sbjct  181   PSGESFFMVVNNKVGVHQ-SEDAKLLLELENPSRKRILCATPGESGTLFTGGEDRAITAW  239

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGG  1185
             DT SGK+A+ I+DAH AR+KGIVVL+ N+     E PYL+ SASSDG I VWDVR  M  
Sbjct  240   DTNSGKLAYSIEDAHPARIKGIVVLTRNESDGSLEDPYLIGSASSDGIIRVWDVR--MAA  297

Query  1186  KEKPNPLAMANTKSRLTCLAGSSIK  1260
             KE   PLA  NTKSRLTCLAGS+++
Sbjct  298   KENTKPLAETNTKSRLTCLAGSALR  322



>ref|XP_010511387.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Camelina sativa]
Length=343

 Score =   330 bits (846),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 234/325 (72%), Gaps = 15/325 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ FIWG+KLK  K   D Q L L PLFS+PSH+S I     SG  A SGGSD
Sbjct  1     MSIIAGSYERFIWGFKLKPTKHDADNQTLILTPLFSYPSHISPITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YDL + S +GSL   + +A+I +L+FYTP SLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDLPSASSLGSLLDHNHTASITALSFYTPSSLSFPRNLISAAADGSVAIFDTDPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+K +N L+IHPSG L  +V RDE   M++L RG+RSF   LG E S++KF+
Sbjct  121   VLLKSFRPHKKAVNDLAIHPSGKLALAVYRDEFFTMLNLVRGKRSFCCRLGHEASLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPGEGGILFTGGEDRNITAW  1017
              +G++ +MV++ KV V +     + +LE  N   KR+LCA PGE G LFTGGEDR ITAW
Sbjct  181   PSGESFFMVVNNKVGVHQ-SEDAKLLLELENPSRKRILCATPGESGTLFTGGEDRAITAW  239

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNN--DG--EYPYLVASASSDGNICVWDVRMGMGG  1185
             DT SGK+A+ I+DAH AR+KGIVVL+ N  DG  E PYL+ SASSDG I VWDVR  M  
Sbjct  240   DTNSGKLAYSIEDAHPARIKGIVVLTRNGSDGSLEDPYLIGSASSDGIIRVWDVR--MAA  297

Query  1186  KEKPNPLAMANTKSRLTCLAGSSIK  1260
             K+   PLA  NTKSRLTCLAGS+++
Sbjct  298   KQNTKPLAETNTKSRLTCLAGSALR  322



>ref|XP_006302499.1| hypothetical protein CARUB_v10020592mg [Capsella rubella]
 gb|EOA35397.1| hypothetical protein CARUB_v10020592mg [Capsella rubella]
Length=343

 Score =   330 bits (845),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 231/325 (71%), Gaps = 15/325 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ FIWG+KLK  K   D Q L L  +FS+PSH+S I     SG  A SGGSD
Sbjct  1     MSIIAGSYERFIWGFKLKPTKHDPDNQTLTLSTIFSYPSHISPITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YDL + S +GSL   + +A+I +LAFYTP SLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDLPSASSLGSLLDHNHTASITALAFYTPSSLSFPRNLISAAADGSVAIFDTDPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+K +N L+IHPSG L  +V RDE   M++L RG+RSF   LG E S++KF+
Sbjct  121   VLLKSFRPHKKAVNDLAIHPSGKLALAVYRDEFFTMLNLVRGKRSFCCRLGHEASLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPGEGGILFTGGEDRNITAW  1017
              +G + +MV++ KV V +     + +LE  N   KR+LCA PGE G LFTGGEDR ITAW
Sbjct  181   PSGDSFFMVVNNKVGVHQ-SEDAKLLLELENPSRKRILCATPGESGTLFTGGEDRAITAW  239

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGG  1185
             DT SGK+A+ I+DAH AR+KGIVVL+ ND     E PYL+ SASSDG I VWDVR  M  
Sbjct  240   DTNSGKLAYSIEDAHPARIKGIVVLTRNDSDGSLEDPYLIGSASSDGIIRVWDVR--MAA  297

Query  1186  KEKPNPLAMANTKSRLTCLAGSSIK  1260
             KE   PLA  NTKSRLTCLAGS++K
Sbjct  298   KENTKPLAETNTKSRLTCLAGSALK  322



>ref|XP_003533839.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Glycine max]
Length=319

 Score =   326 bits (836),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 181/319 (57%), Positives = 231/319 (72%), Gaps = 15/319 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSL+AGSY+ FIWG+ L+S    Q+  L PLFS+PSHLS+IK   +SG V  SGG DDTI
Sbjct  1     MSLVAGSYEKFIWGFTLRS----QSQTLTPLFSYPSHLSSIKSVAISGPVVASGGEDDTI  56

Query  502   KIYDLSTCSEIGSLH-ESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YDL+  + +GSLH  SAT+ +L+FY PP L FP NL+SA   G+VSI+  D FVHL T
Sbjct  57    QLYDLAAAASLGSLHTHSATVTALSFYAPPHLPFPRNLVSADAAGNVSIFDADGFVHLTT  116

Query  679   VKVHRKG-INSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGK  855
             + VHR   IN L++HPSG    +V RD+CLA+V+L RGRR+    LGKE S++KF+ TG 
Sbjct  117   ISVHRNAAINDLALHPSGQRALTVARDDCLAVVNLVRGRRNCCLRLGKEASLVKFDATGD  176

Query  856   TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGK  1035
               +MV+ EKVSV +     R + EF   K VLCA P + G+L+TGGEDRNITAWD K+GK
Sbjct  177   QFFMVVKEKVSVHQTEDA-RILFEFECPKPVLCATPAKNGLLYTGGEDRNITAWDIKTGK  235

Query  1036  VAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
             VA+ +++AH+ARVKGIV L+++DG    + PYLVASASSDG I VWDVR  M  +EK  P
Sbjct  236   VAYCLEEAHTARVKGIVALTDSDGATGDDNPYLVASASSDGIIRVWDVR--MAAREK--P  291

Query  1204  LAMANTKSRLTCLAGSSIK  1260
             L   NT+SRLTCLAGSS+K
Sbjct  292   LTEHNTRSRLTCLAGSSLK  310



>ref|XP_008794486.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Phoenix dactylifera]
Length=321

 Score =   322 bits (825),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 181/324 (56%), Positives = 232/324 (72%), Gaps = 14/324 (4%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKS--PKDLQNLDLI--PLFSFPSHLSTIKCadvsgsvavsggs  489
             M+L+AGSY+ FIWG+ LK+  P D + L L   PLFS+PSH + IK   V+G VA SGG+
Sbjct  1     MTLVAGSYEKFIWGFSLKTLKPGDGETLTLALKPLFSYPSHTAPIKSVAVAGPVAASGGA  60

Query  490   ddTIKIYDLSTCSEIGSLHESA-TINSLAFYTPP-SLSFPHNLISAADNGSVSIYHTDPF  663
             DD IKIYDL++ +E+GSL + A  + +LAFYT P + S P NL+SA+D+G+V IY  DPF
Sbjct  61    DDAIKIYDLASAAELGSLLDHAGAVTALAFYTSPLAPSLPRNLLSASDDGAVCIYDADPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKF-  840
             VHLKTV  HR+G+  L++HPSG +  +VGRD CLAM++L RGRRSF   L +E SI+++ 
Sbjct  121   VHLKTVAAHRRGVVDLAVHPSGRVALTVGRDSCLAMLNLVRGRRSFSCRLAQEASIVRYG  180

Query  841   NETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWD  1020
             +E G    MV +EK+SV +     R + E +  KRVLC AP E G+LFTGGEDR++TAWD
Sbjct  181   SEGGGRFVMVAEEKISVHD-SEDARLIHELDAPKRVLCIAPAENGLLFTGGEDRSVTAWD  239

Query  1021  TKSGKVAHRIDDAHSARVKGIVVLSN----NDGEYPYLVASASSDGNICVWDVRMGMGGK  1188
             T SG+VA+ + DAHS RVKG+VV  N     + E    +ASASSDG I +WDVR  M   
Sbjct  240   TASGRVAYCMQDAHSTRVKGLVVFKNSSEGQNSETSNFIASASSDGVIRIWDVR--MTSN  297

Query  1189  EKPNPLAMANTKSRLTCLAGSSIK  1260
             EKPNPLA ANTKSRLTCLAGSS+K
Sbjct  298   EKPNPLAEANTKSRLTCLAGSSMK  321



>ref|XP_010923824.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Elaeis guineensis]
Length=319

 Score =   321 bits (823),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 180/322 (56%), Positives = 232/322 (72%), Gaps = 12/322 (4%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKS--PKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsdd  495
             M+L+AGSY+ FIWG+ LK+  P   + L L PLFS+PSH + IK   V+G VA SGG+DD
Sbjct  1     MTLVAGSYEKFIWGFSLKTLKPGAGETLALKPLFSYPSHTAPIKSVAVAGPVAASGGADD  60

Query  496   TIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSF-PHNLISAADNGSVSIYHTDPFVH  669
              IKIYDL++ +E+GSL +    + +LAFYT P   F P NL+SA+D+G+V IY  DPFVH
Sbjct  61    AIKIYDLASAAELGSLLDHGGAVTALAFYTSPLAPFLPRNLLSASDDGAVCIYDADPFVH  120

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN-E  846
             LKTV  HR+G+  L++HPSG +  +VGRD CLAM++L RGRRSF   L +E SI+++  E
Sbjct  121   LKTVSAHRRGVVDLAVHPSGRVALTVGRDSCLAMLNLVRGRRSFSCRLAQEASIVRYEPE  180

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+  +MV +E++SV +     R + E +  KRVLC AP E G+LFTGGEDR++TAWDT 
Sbjct  181   GGERFFMVAEERISVHD-SEDARLIHELDAPKRVLCIAPAENGLLFTGGEDRSVTAWDTA  239

Query  1027  SGKVAHRIDDAHSARVKGIVVL-SNNDG---EYPYLVASASSDGNICVWDVRMGMGGKEK  1194
             SGKVA+ I DAHS RVKG+VV   ++DG   E    ++SASSDG I +WDVR  M   EK
Sbjct  240   SGKVAYCIQDAHSTRVKGLVVFKKSSDGQNSEISNFISSASSDGVIRIWDVR--MTSNEK  297

Query  1195  PNPLAMANTKSRLTCLAGSSIK  1260
             PNPLA ANTKSRLTCLAGSS+K
Sbjct  298   PNPLAEANTKSRLTCLAGSSMK  319



>ref|XP_004493242.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Cicer arietinum]
Length=339

 Score =   320 bits (821),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 227/319 (71%), Gaps = 12/319 (4%)
 Frame = +1

Query  316   KSMSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsdd  495
             + +SL+AGSY+ FIWG+ L   K      L PLFS+PSHLS IK   VS SV  SGGSDD
Sbjct  5     RRISLVAGSYERFIWGFTLNPNKQT----LTPLFSYPSHLSLIKTVAVSNSVVASGGSDD  60

Query  496   TIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHL  672
             TI +Y+LS  S +GSL++ SAT+ +L+FY PP L FP NL+SA  +G+++I+  D FVHL
Sbjct  61    TIHLYNLSASSSLGSLNQHSATVTALSFYAPPHLPFPRNLVSADADGNLAIFDADGFVHL  120

Query  673   KTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETG  852
              T+ VHRK +N L+IHPSG L  +V  D C AMV+L RGRRSF   L KE SI++F+ +G
Sbjct  121   NTLSVHRKAVNDLAIHPSGKLALTVSHDNCFAMVNLVRGRRSFCCRLDKEASIVRFDASG  180

Query  853   KTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
              + YM  DE VSV +     R +LE    KRVLCAAP   G+L+TGGEDRNITAWD KSG
Sbjct  181   DSFYMAADETVSVHQ-AEDARLLLELQCPKRVLCAAPARNGLLYTGGEDRNITAWDIKSG  239

Query  1033  KVAHRIDDAHSARVKGIVVLSNN---DGEYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
             K A+ I++AH+ARVKGIVVLS+    D E PYLVASASSDG I VWDVR  M   EKPNP
Sbjct  240   KAAYCIEEAHAARVKGIVVLSDEATGDDE-PYLVASASSDGTIRVWDVR--MAATEKPNP  296

Query  1204  LAMANTKSRLTCLAGSSIK  1260
             LA   T+SRLTCLAGS +K
Sbjct  297   LAECKTQSRLTCLAGSCLK  315



>gb|AAF06037.1|AC009360_2 Contains 3 PF|00400 WD40, G-beta repeat domains [Arabidopsis 
thaliana]
Length=365

 Score =   321 bits (823),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 188/345 (54%), Positives = 232/345 (67%), Gaps = 35/345 (10%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             MS+IAGSY+ FIWG+KLK  K   + Q L L PLFS+PSH+S I     SG  A SGGSD
Sbjct  1     MSIIAGSYERFIWGFKLKPTKHDAESQTLTLSPLFSYPSHISPITTVACSGPAAASGGSD  60

Query  493   dTIKIYDLSTCSEIGSL---HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             DTI +YDL + S +GSL   + +A+I +L+FYTP SLSFP NLISAA +GSV+I+ TDPF
Sbjct  61    DTIHLYDLPSASSLGSLLDHNHAASITALSFYTPSSLSFPRNLISAAADGSVAIFDTDPF  120

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
             V LK+ + H+K +N L+IHPSG L  +V RDE  AM++L RG+RSF   LG E S++KF+
Sbjct  121   VLLKSFRPHKKAVNDLAIHPSGKLALAVYRDEFFAMLNLVRGKRSFCCRLGHEASLVKFD  180

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA--KRVLCAAPG-----------------  966
              +G+  YMV+  KV V +     + +LE  N   KR+LCA PG                 
Sbjct  181   PSGERFYMVVSNKVGVHQ-SEDAKLLLELENPSRKRILCATPGEVVFLTLWNPQLRFHLG  239

Query  967   ---EGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLV  1125
                E G LFTGGEDR ITAWDT SGK+A+ I+DAH AR+KGIVVL+ ND     E PYL+
Sbjct  240   TLKESGTLFTGGEDRAITAWDTNSGKLAYSIEDAHPARIKGIVVLTRNDSDGSLEDPYLI  299

Query  1126  ASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLAGSSIK  1260
              SASSDG I VWDVR  M  KE   PLA  NTKSRLTCLAGS++K
Sbjct  300   GSASSDGIIRVWDVR--MAAKENTKPLAETNTKSRLTCLAGSALK  342



>ref|XP_006597931.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
isoform X2 [Glycine max]
Length=347

 Score =   319 bits (818),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 228/319 (71%), Gaps = 15/319 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSL+AGSY+ FIWG+ L+S     N    PLFS+PSHLS+IK   VSG V  SGG DDTI
Sbjct  1     MSLVAGSYEKFIWGFTLRSNSQTLN----PLFSYPSHLSSIKSVAVSGPVVASGGEDDTI  56

Query  502   KIYDLSTCSEIGSLH-ESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YDL+  + +GSLH  SAT+ +L+FY PP L FP NL+SA  +G++SI+  D FVHL T
Sbjct  57    QLYDLAAAASLGSLHTHSATVTALSFYAPPHLPFPRNLVSADASGNLSIFDADGFVHLTT  116

Query  679   VKVHRK-GINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGK  855
             + VHR   IN L++HPSG    +VGRDECLA+V+L RGRR+    LGKE S++KF+ +G 
Sbjct  117   LSVHRNSAINDLALHPSGERALTVGRDECLAVVNLVRGRRNCCLRLGKEASLVKFDASGD  176

Query  856   TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGK  1035
               +M + EKVSV +     R + E    K VLCA P + G+L+TGGEDRNITAWD K+GK
Sbjct  177   QFFMAVKEKVSVHQTEDA-RILFELECPKPVLCATPAKNGLLYTGGEDRNITAWDIKTGK  235

Query  1036  VAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
             +A+ +++AH+ARVKGIV L+ +DG    + PYLVASASSDG I VWDVR  M  +EK  P
Sbjct  236   IAYCLEEAHTARVKGIVALTESDGATGDDDPYLVASASSDGIIRVWDVR--MAAREK--P  291

Query  1204  LAMANTKSRLTCLAGSSIK  1260
             L   NT+SRLTCLAGSS+K
Sbjct  292   LTEHNTRSRLTCLAGSSLK  310



>ref|XP_006597932.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
isoform X3 [Glycine max]
Length=344

 Score =   319 bits (817),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 228/319 (71%), Gaps = 15/319 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSL+AGSY+ FIWG+ L+S     N    PLFS+PSHLS+IK   VSG V  SGG DDTI
Sbjct  1     MSLVAGSYEKFIWGFTLRSNSQTLN----PLFSYPSHLSSIKSVAVSGPVVASGGEDDTI  56

Query  502   KIYDLSTCSEIGSLH-ESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YDL+  + +GSLH  SAT+ +L+FY PP L FP NL+SA  +G++SI+  D FVHL T
Sbjct  57    QLYDLAAAASLGSLHTHSATVTALSFYAPPHLPFPRNLVSADASGNLSIFDADGFVHLTT  116

Query  679   VKVHRK-GINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGK  855
             + VHR   IN L++HPSG    +VGRDECLA+V+L RGRR+    LGKE S++KF+ +G 
Sbjct  117   LSVHRNSAINDLALHPSGERALTVGRDECLAVVNLVRGRRNCCLRLGKEASLVKFDASGD  176

Query  856   TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGK  1035
               +M + EKVSV +     R + E    K VLCA P + G+L+TGGEDRNITAWD K+GK
Sbjct  177   QFFMAVKEKVSVHQTEDA-RILFELECPKPVLCATPAKNGLLYTGGEDRNITAWDIKTGK  235

Query  1036  VAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
             +A+ +++AH+ARVKGIV L+ +DG    + PYLVASASSDG I VWDVR  M  +EK  P
Sbjct  236   IAYCLEEAHTARVKGIVALTESDGATGDDDPYLVASASSDGIIRVWDVR--MAAREK--P  291

Query  1204  LAMANTKSRLTCLAGSSIK  1260
             L   NT+SRLTCLAGSS+K
Sbjct  292   LTEHNTRSRLTCLAGSSLK  310



>ref|XP_006597930.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
isoform X1 [Glycine max]
Length=349

 Score =   318 bits (814),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 228/319 (71%), Gaps = 15/319 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSL+AGSY+ FIWG+ L+S     N    PLFS+PSHLS+IK   VSG V  SGG DDTI
Sbjct  1     MSLVAGSYEKFIWGFTLRSNSQTLN----PLFSYPSHLSSIKSVAVSGPVVASGGEDDTI  56

Query  502   KIYDLSTCSEIGSLH-ESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YDL+  + +GSLH  SAT+ +L+FY PP L FP NL+SA  +G++SI+  D FVHL T
Sbjct  57    QLYDLAAAASLGSLHTHSATVTALSFYAPPHLPFPRNLVSADASGNLSIFDADGFVHLTT  116

Query  679   VKVHRK-GINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGK  855
             + VHR   IN L++HPSG    +VGRDECLA+V+L RGRR+    LGKE S++KF+ +G 
Sbjct  117   LSVHRNSAINDLALHPSGERALTVGRDECLAVVNLVRGRRNCCLRLGKEASLVKFDASGD  176

Query  856   TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGK  1035
               +M + EKVSV +     R + E    K VLCA P + G+L+TGGEDRNITAWD K+GK
Sbjct  177   QFFMAVKEKVSVHQTEDA-RILFELECPKPVLCATPAKNGLLYTGGEDRNITAWDIKTGK  235

Query  1036  VAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
             +A+ +++AH+ARVKGIV L+ +DG    + PYLVASASSDG I VWDVR  M  +EK  P
Sbjct  236   IAYCLEEAHTARVKGIVALTESDGATGDDDPYLVASASSDGIIRVWDVR--MAAREK--P  291

Query  1204  LAMANTKSRLTCLAGSSIK  1260
             L   NT+SRLTCLAGSS+K
Sbjct  292   LTEHNTRSRLTCLAGSSLK  310



>ref|XP_003595555.1| p21-activated protein kinase-interacting protein 1-like protein 
[Medicago truncatula]
 gb|AES65806.1| p21-activated kinase-interacting-like protein [Medicago truncatula]
Length=338

 Score =   317 bits (811),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 183/323 (57%), Positives = 234/323 (72%), Gaps = 12/323 (4%)
 Frame = +1

Query  304   IEAGKSMSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsg  483
             + + + +SL+AGSY+ FIWG+ L          L P+FS+PSHLS IK   VS SV  SG
Sbjct  1     MSSKRRISLVAGSYERFIWGFNLNP----NTQTLTPVFSYPSHLSLIKTVAVSNSVVASG  56

Query  484   gsddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDP  660
             GSDDTI +YDLST S +GSL + S+T+ +L+FY+PP+L FP NL+SA  +GS++I+  D 
Sbjct  57    GSDDTIHLYDLSTSSSLGSLTDHSSTVTALSFYSPPNLPFPRNLVSADADGSLAIFDADG  116

Query  661   FVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKF  840
             FVHLKT+ VH+KG+N L+IHPSG +  +V RD C AMV+L RGRRSF   L KE SI++F
Sbjct  117   FVHLKTLSVHKKGVNDLAIHPSGKIALTVSRDSCFAMVNLVRGRRSFCCRLDKEASIVRF  176

Query  841   NETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWD  1020
             + +G + +M +DE V+V +     R ++E    KRVLCAAP + G+L+TGGEDRNITAWD
Sbjct  177   DVSGDSFFMAVDEIVNVHQ-AEDARLLMELQCPKRVLCAAPAKNGLLYTGGEDRNITAWD  235

Query  1021  TKSGKVAHRIDDAHSARVKGIVVLSNN---DGEYPYLVASASSDGNICVWDVRMGMGGKE  1191
              KSGKVA+ I++AH+ARVKGIVVLS+    D E PYLVASASSDG I  WDVR  M   E
Sbjct  236   LKSGKVAYCIEEAHAARVKGIVVLSDEATGDDE-PYLVASASSDGTIRAWDVR--MAATE  292

Query  1192  KPNPLAMANTKSRLTCLAGSSIK  1260
             K  PLA   T+SRLTCLAGSS+K
Sbjct  293   KSEPLAECKTQSRLTCLAGSSLK  315



>ref|XP_007138512.1| hypothetical protein PHAVU_009G215400g [Phaseolus vulgaris]
 gb|ESW10506.1| hypothetical protein PHAVU_009G215400g [Phaseolus vulgaris]
Length=336

 Score =   313 bits (802),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 229/318 (72%), Gaps = 15/318 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSL+AGSY+ FIWG  LK     Q+  L PLFS+PSHLS+IK   VSGSV  SGG+DDTI
Sbjct  1     MSLVAGSYEKFIWGLTLKP----QSQTLTPLFSYPSHLSSIKTVAVSGSVVASGGADDTI  56

Query  502   KIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YDLST S +GSLH+ SA++ +++FY PP+L FP NLISA  +GS+SI+  D FVHL T
Sbjct  57    QLYDLSTASSLGSLHQHSASVTAISFYAPPNLPFPRNLISADASGSLSIFDADGFVHLTT  116

Query  679   VKVHRK-GINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGK  855
             + VHR   IN L++HPSG    +V RD CLA+V+L RGRR+    L KE +++KFN +G 
Sbjct  117   LSVHRNSAINDLALHPSGERALTVARDNCLAVVNLVRGRRNCCLRLDKEATLVKFNASGD  176

Query  856   TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGK  1035
               +M   EKVSV +     R + E   +K VLCAAP   G+L+TGGED++ITAWD K+GK
Sbjct  177   HFFMATKEKVSVHQTEDA-RILFEMECSKPVLCAAPARNGLLYTGGEDKSITAWDIKTGK  235

Query  1036  VAHRIDDAHSARVKGIVVL----SNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
             VA+ ++DAH++RVKGIVVL         + PYLVASASSDGNI VWDVRM +  +EK  P
Sbjct  236   VAYCLEDAHTSRVKGIVVLTDTDGATGDDDPYLVASASSDGNIRVWDVRMAV--REK--P  291

Query  1204  LAMANTKSRLTCLAGSSI  1257
             LA  NT+SRLTCLAG+S+
Sbjct  292   LAEYNTRSRLTCLAGTSL  309



>gb|EPS70459.1| hypothetical protein M569_04298 [Genlisea aurea]
Length=307

 Score =   311 bits (798),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 188/317 (59%), Positives = 234/317 (74%), Gaps = 12/317 (4%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             MSL+AGSY+ FIWGY+LKS     +L L+PLFSFPSHLSTIK   V G+ A SGG+DDTI
Sbjct  1     MSLVAGSYERFIWGYRLKSA---DSLALVPLFSFPSHLSTIKTVAVYGTAAASGGNDDTI  57

Query  502   KIYDLSTCSEIGSLHESATINSLAFYTPPSLS-FPHNLISAADNGSVSIYHTDPFVHLKT  678
             KIYDLS+ +EIGSLH +A++ +L+F++PPSLS  P NL++   +GS+SIY  DPFVHLKT
Sbjct  58    KIYDLSSSTEIGSLHLTASVTALSFFSPPSLSSVPRNLLAGNADGSLSIYDADPFVHLKT  117

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             VKVH+K +NSLS+HPSG L  +VG DECLAMV+L RGRRSF+  LG+E SIL+F+E+G+ 
Sbjct  118   VKVHKKAVNSLSVHPSGKLALTVGHDECLAMVNLVRGRRSFFSKLGREASILQFDESGER  177

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
              +M +++K+SV E     +   E  N KRV C AP   GI+F GGED +ITAWDT  GKV
Sbjct  178   FFMAVEDKISVHE-SEDAKLTHELENRKRVHCIAPAANGIVFAGGEDGSITAWDTSCGKV  236

Query  1039  AHRIDDAHSARVKGIVVL-SNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMA  1215
             A  I++AH+AR+KGIVVL    D    Y++ASASSDG I VWD RM         P A A
Sbjct  237   AFSIEEAHAARIKGIVVLHRKRDDPSSYIIASASSDGVIRVWDGRM------VKKPAAEA  290

Query  1216  NTKSRLTCLAGSSIKCE  1266
             NT+SRLTCLAGSS K E
Sbjct  291   NTRSRLTCLAGSSTKRE  307



>ref|XP_009397403.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Musa acuminata subsp. malaccensis]
Length=315

 Score =   307 bits (787),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 172/317 (54%), Positives = 218/317 (69%), Gaps = 15/317 (5%)
 Frame = +1

Query  325   SLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIK  504
             +L+AGSY+ FIWG+  K     + L L PLFS+PSH+  IK    +G+VA SGGSDD IK
Sbjct  3     TLVAGSYEKFIWGFAFKP----ETLTLKPLFSYPSHIGPIKAVATAGTVAASGGSDDAIK  58

Query  505   IYDLSTCSEIGSLHE-SATINSLAFYTPPSL--SFPHNLISAADNGSVSIYHTDPFVHLK  675
             +YDL+  +E+G+L + S  + +LAFY P S     P NL+SA+D+G+V IY  DPFVHLK
Sbjct  59    LYDLAAAAEVGTLLDHSGAVTALAFYAPASSPGGLPRNLLSASDDGAVCIYDADPFVHLK  118

Query  676   TVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN-ETG  852
             TV  HRKGI  L++HP+G    +VGRD CLA+++L RGRRSF   L +E SI+++    G
Sbjct  119   TVPTHRKGIADLAVHPTGRAALTVGRDACLALINLVRGRRSFSCRLDREASIVRYGCGDG  178

Query  853   KTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
                +MV DE+++V +     R + E +  KRVLC AP E G+LFTGGEDR+ITAWDT SG
Sbjct  179   ARFFMVADERITVHD-SEDARLIQEMDGQKRVLCVAPSENGVLFTGGEDRSITAWDTTSG  237

Query  1033  KVAHRIDDAHSARVKGIVVLSN-NDGEYPY---LVASASSDGNICVWDVRMGMGGKEKPN  1200
             KVA+ I+DAHS RVKG+V   N ND E       + SASSDG + VWD R  M  KEKPN
Sbjct  238   KVAYSIEDAHSTRVKGLVTFKNGNDAESSEASNFIVSASSDGVVRVWDAR--MTAKEKPN  295

Query  1201  PLAMANTKSRLTCLAGS  1251
             PLA  NTKSRLTCLAGS
Sbjct  296   PLAETNTKSRLTCLAGS  312



>ref|XP_006854704.1| hypothetical protein AMTR_s00030p00230030 [Amborella trichopoda]
 gb|ERN16171.1| hypothetical protein AMTR_s00030p00230030 [Amborella trichopoda]
Length=519

 Score =   256 bits (654),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 216/324 (67%), Gaps = 14/324 (4%)
 Frame = +1

Query  319   SMSLIAGSYDHFIWGYKLK--SPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             +M+L+AG+Y+  +WG+KL+  +  + +   L P+FS  +HLS IK   VSG +A S GSD
Sbjct  5     AMNLVAGTYEQVVWGFKLRLHNENETEQAFLSPIFSHHAHLSPIKALSVSGPIAASSGSD  64

Query  493   dTIKIYDLSTCSEIGSL-HESATINSLAFY--TPP--SLSFPHNLISAADNGSVSIYHTD  657
             +T++++D++  +EIG+L H++   + LAFY  TP   S++FP +LI+ ++ GS+SI+  +
Sbjct  65    ETVRVFDINQRAEIGALIHDNGAASCLAFYGFTPKNSSVNFPVHLITGSEQGSISIFDVE  124

Query  658   PFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILK  837
               VHLK+++ H+KG+N L+IHP+G +  S+GRD  L M +L +GRRSF   L KE S+++
Sbjct  125   ALVHLKSIRAHKKGVNDLTIHPTGRVGLSIGRDLQLCMTNLIKGRRSFGCKLQKEASLIR  184

Query  838   FNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAW  1017
             +   GKT ++V +  +S  +     R +L   N+KRV C AP E G+LFTGGED ++ AW
Sbjct  185   YGLDGKTFFVVTERVISSHD-SEDARLLLSMENSKRVNCIAPAENGLLFTGGEDCSVRAW  243

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLS---NNDGEYPYLVASASSDGNICVWDVRMGMGGK  1188
             D  +GKVA   ++AHS R+KG+VV     +   + PY++ASASSDG I VWD+RM     
Sbjct  244   DPMTGKVAFSFENAHSTRLKGLVVFGERYDQGDDAPYIIASASSDGFIKVWDLRMAT---  300

Query  1189  EKPNPLAMANTKSRLTCLAGSSIK  1260
             E+P PL  A+ K RLTC  GS I+
Sbjct  301   ERPTPLEEASIKCRLTCFGGSCIR  324



>tpg|DAA63788.1| TPA: nucleotide binding protein, partial [Zea mays]
Length=333

 Score =   246 bits (627),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 144/333 (43%), Positives = 208/333 (62%), Gaps = 23/333 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK---SPKDL-----QNLDLIPLFSFPSHLSTIKCadvsgsvav  477
             M+L+AGSY+ FIWG+ LK   SP        + L L PLFS+P+H   ++C   +    +
Sbjct  1     MALVAGSYERFIWGFSLKTLTSPSATGASPSETLTLAPLFSYPAHTGPVRCVAAAPRAGL  60

Query  478   sgg--sddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIY  648
                  +DD++++YDL + +++G L + SA +++LAFY+   +  P NL++A D+GS+ IY
Sbjct  61    VASGGADDSVRLYDLPSAADLGPLLDPSAAVSALAFYSRGPV--PRNLLAACDDGSLHIY  118

Query  649   HTDPFVHLKTVKV--HRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKE  822
               D F  L T++     +   +L++HPSG +  +VGR   LAM++L RGRRSF   L   
Sbjct  119   DADGFALLSTLRAFPRHEAAEALAVHPSGRVALAVGRAGALAMLNLVRGRRSFACRLEHP  178

Query  823   VSILKFNET---GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGG  993
              S + + E    G    M  + KVSV +     R + + +  K+VL  AP + G+L+TGG
Sbjct  179   ASAIAYAEDRDGGDRFVMAAENKVSVHD-SVDARVIHDMDCGKKVLAMAPAKSGVLYTGG  237

Query  994   EDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSN-NDG-EYPYLVASASSDGNICVWDV  1167
             EDR ITAWD  SGKV+ RI+ AH+ RVKG+VV  N NDG +   L++SASSDG I +WD+
Sbjct  238   EDRCITAWDLSSGKVSSRIEGAHATRVKGVVVFGNSNDGSQLSNLISSASSDGVIRIWDI  297

Query  1168  RMGMGGKEKPNPLAMANTKSRLTCLAGSSIKCE  1266
             R    G  KP PLA ANTK+RLTCLAG+S+KC+
Sbjct  298   R--TIGNGKPTPLAEANTKARLTCLAGTSLKCK  328



>ref|XP_008650900.1| PREDICTED: uncharacterized protein LOC100193458 isoform X1 [Zea 
mays]
Length=338

 Score =   245 bits (626),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 144/333 (43%), Positives = 208/333 (62%), Gaps = 23/333 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK---SPKDL-----QNLDLIPLFSFPSHLSTIKCadvsgsvav  477
             M+L+AGSY+ FIWG+ LK   SP        + L L PLFS+P+H   ++C   +    +
Sbjct  1     MALVAGSYERFIWGFSLKTLTSPSATGASPSETLTLAPLFSYPAHTGPVRCVAAAPRAGL  60

Query  478   sgg--sddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIY  648
                  +DD++++YDL + +++G L + SA +++LAFY+   +  P NL++A D+GS+ IY
Sbjct  61    VASGGADDSVRLYDLPSAADLGPLLDPSAAVSALAFYSRGPV--PRNLLAACDDGSLHIY  118

Query  649   HTDPFVHLKTVKV--HRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKE  822
               D F  L T++     +   +L++HPSG +  +VGR   LAM++L RGRRSF   L   
Sbjct  119   DADGFALLSTLRAFPRHEAAEALAVHPSGRVALAVGRAGALAMLNLVRGRRSFACRLEHP  178

Query  823   VSILKFNET---GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGG  993
              S + + E    G    M  + KVSV +     R + + +  K+VL  AP + G+L+TGG
Sbjct  179   ASAIAYAEDRDGGDRFVMAAENKVSVHD-SVDARVIHDMDCGKKVLAMAPAKSGVLYTGG  237

Query  994   EDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSN-NDG-EYPYLVASASSDGNICVWDV  1167
             EDR ITAWD  SGKV+ RI+ AH+ RVKG+VV  N NDG +   L++SASSDG I +WD+
Sbjct  238   EDRCITAWDLSSGKVSSRIEGAHATRVKGVVVFGNSNDGSQLSNLISSASSDGVIRIWDI  297

Query  1168  RMGMGGKEKPNPLAMANTKSRLTCLAGSSIKCE  1266
             R    G  KP PLA ANTK+RLTCLAG+S+KC+
Sbjct  298   R--TIGNGKPTPLAEANTKARLTCLAGTSLKCK  328



>ref|XP_002442548.1| hypothetical protein SORBIDRAFT_08g021660 [Sorghum bicolor]
 gb|EES16386.1| hypothetical protein SORBIDRAFT_08g021660 [Sorghum bicolor]
Length=330

 Score =   243 bits (619),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 141/335 (42%), Positives = 208/335 (62%), Gaps = 27/335 (8%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK---SPK---------DLQNLDLIPLFSFPSHLSTIKCadvsg  465
             M+L+AGSY+ FIWG+ LK   SP            + L L PLFS+P+H   ++C   + 
Sbjct  1     MALVAGSYERFIWGFSLKTLTSPSASTTATGASSSETLTLAPLFSYPAHTGPVRCVAAAP  60

Query  466   svavsgg--sddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGS  636
                ++    +DD++++YDL + +++G L + SA +++LAFY+   +  P NL++A D+G+
Sbjct  61    RAGLAASGGADDSVRLYDLPSAADLGPLLDPSAAVSALAFYSRGPV--PRNLLAACDDGA  118

Query  637   VSIYHTDPFVHLKTVKV--HRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYS  810
             + +Y  D F  L T++     + +  L++HPSG +  +VGR   LAM++L RGRRSF   
Sbjct  119   LLLYDADGFALLATLRAFPRHEAVEGLAVHPSGRVALAVGRAGALAMLNLVRGRRSFTCR  178

Query  811   LGKEVSILKFNET---GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGIL  981
             L +  S + + E    G    M  +EKV+V +     R + + +  KRVL  AP + G+L
Sbjct  179   LERPASAVAYAEDKDGGDRFVMAAEEKVAVHD-SEDARVIHQMDCGKRVLVMAPAKNGVL  237

Query  982   FTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG--EYPYLVASASSDGNIC  1155
             +TGGEDR +TAWD  SGKV+ RI+ AH+ RVKG+VV  N  G  E+  L+ASASSDG I 
Sbjct  238   YTGGEDRCVTAWDLSSGKVSSRIEGAHATRVKGVVVFDNRKGGSEFCNLIASASSDGIIR  297

Query  1156  VWDVRMGMGGKEKPNPLAMANTKSRLTCLAGSSIK  1260
             +WDVR    G  KP PLA ANTK+RLTCL+G+S+K
Sbjct  298   IWDVR--AIGNGKPTPLAEANTKARLTCLSGTSLK  330



>ref|NP_001132047.1| uncharacterized protein LOC100193458 [Zea mays]
 gb|ACF80728.1| unknown [Zea mays]
 gb|ACN36433.1| unknown [Zea mays]
Length=326

 Score =   242 bits (618),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 143/331 (43%), Positives = 206/331 (62%), Gaps = 23/331 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK---SPKDL-----QNLDLIPLFSFPSHLSTIKCadvsgsvav  477
             M+L+AGSY+ FIWG+ LK   SP        + L L PLFS+P+H   ++C   +    +
Sbjct  1     MALVAGSYERFIWGFSLKTLTSPSATGASPSETLTLAPLFSYPAHTGPVRCVAAAPRAGL  60

Query  478   sgg--sddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIY  648
                  +DD++++YDL + +++G L + SA +++LAFY+   +  P NL++A D+GS+ IY
Sbjct  61    VASGGADDSVRLYDLPSAADLGPLLDPSAAVSALAFYSRGPV--PRNLLAACDDGSLHIY  118

Query  649   HTDPFVHLKTVKV--HRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKE  822
               D F  L T++     +   +L++HPSG +  +VGR   LAM++L RGRRSF   L   
Sbjct  119   DADGFALLSTLRAFPRHEAAEALAVHPSGRVALAVGRAGALAMLNLVRGRRSFACRLEHP  178

Query  823   VSILKFNET---GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGG  993
              S + + E    G    M  + KVSV +     R + + +  K+VL  AP + G+L+TGG
Sbjct  179   ASAIAYAEDRDGGDRFVMAAENKVSVHD-SVDARVIHDMDCGKKVLAMAPAKSGVLYTGG  237

Query  994   EDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSN-NDG-EYPYLVASASSDGNICVWDV  1167
             EDR ITAWD  SGKV+ RI+ AH+ RVKG+VV  N NDG +   L++SASSDG I +WD+
Sbjct  238   EDRCITAWDLSSGKVSSRIEGAHATRVKGVVVFGNSNDGSQLSNLISSASSDGVIRIWDI  297

Query  1168  RMGMGGKEKPNPLAMANTKSRLTCLAGSSIK  1260
             R    G  KP PLA ANTK+RLTCLAG+S+K
Sbjct  298   R--TIGNGKPTPLAEANTKARLTCLAGTSLK  326



>gb|ACG36371.1| nucleotide binding protein [Zea mays]
Length=326

 Score =   242 bits (617),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 142/333 (43%), Positives = 206/333 (62%), Gaps = 27/333 (8%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK----------SPKDLQNLDLIPLFSFPSHLSTIKCadvsgsv  471
             M+L+AGSY+ FIWG+ LK          SP   + L L PLFS+P+H   ++C   +   
Sbjct  1     MALVAGSYERFIWGFSLKTLTTPSATGASPS--ETLTLAPLFSYPAHTGPVRCVAAAPRA  58

Query  472   avsgg--sddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVS  642
              +     +D+++++YDL + +++G L + SA +++LAFY+   +  P NL++A D+GS+ 
Sbjct  59    GLVASGGADNSVRLYDLPSAADLGPLLDPSAAVSALAFYSRGPV--PRNLLAACDDGSLH  116

Query  643   IYHTDPFVHLKTVKV--HRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLG  816
             IY  D F  L T++     +   +L++HPSG +  +VGR   LAM++L RGRRSF   L 
Sbjct  117   IYDADGFALLSTLRAFPRHEAAEALAVHPSGRVALAVGRAGALAMLNLVRGRRSFACRLE  176

Query  817   KEVSILKFNET---GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFT  987
                S + + E    G    M  + KVSV +     R + + +  K+VL  AP + G+L+T
Sbjct  177   HPASAIAYAEDRDGGDRFVMAAENKVSVHD-SVDARVIHDMDCGKKVLAMAPAKSGVLYT  235

Query  988   GGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSN-NDG-EYPYLVASASSDGNICVW  1161
             GGEDR ITAWD  SGKV+ RI+ AH+ RVKG+VV  N NDG +   L++SASSDG I +W
Sbjct  236   GGEDRCITAWDLSSGKVSSRIEGAHATRVKGVVVFGNSNDGSQLSNLISSASSDGVIRIW  295

Query  1162  DVRMGMGGKEKPNPLAMANTKSRLTCLAGSSIK  1260
             D+R    G  KP PLA ANTK+RLTCLAG+S+K
Sbjct  296   DIR--TIGNGKPTPLAEANTKARLTCLAGTSLK  326



>ref|XP_004963211.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Setaria italica]
Length=323

 Score =   238 bits (606),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 141/328 (43%), Positives = 203/328 (62%), Gaps = 20/328 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLD-----LIPLFSFPSHLSTIKCadvsgsvavsgg  486
             M+L+AGSY+ FIWG+ LK+             L PLFS+ +H   ++C   +    ++  
Sbjct  1     MALVAGSYERFIWGFSLKTLTSSTASSSETLTLAPLFSYQAHTGPVRCVAAAPRAGLAAS  60

Query  487   --sddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTD  657
               +DD++++YDL T +++G L + +A +++LAFY+   +  P NL++A D+G++ +Y  D
Sbjct  61    GGADDSVRLYDLPTAADLGPLLDPTAAVSALAFYSRGPV--PRNLLAACDDGALHLYDAD  118

Query  658   PFVHLKTVKV--HRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSI  831
              F  L T++     +    L++HPSG +  +VGR   LAMV+L RGRRSF   L +  S 
Sbjct  119   GFALLSTLRAFPRHEAAEGLAVHPSGRVALAVGRAGALAMVNLVRGRRSFACRLERPASA  178

Query  832   LKFNET---GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDR  1002
             + + E    G    M  +EKV+ L      R + E +  KRVL  AP + G+L++GGEDR
Sbjct  179   VAYAEDRDGGDRFVMAAEEKVT-LHDSEDARIIHEMDCGKRVLAFAPAKNGVLYSGGEDR  237

Query  1003  NITAWDTKSGKVAHRIDDAHSARVKGIVVLSNN-DG-EYPYLVASASSDGNICVWDVRMG  1176
              ITAWD  SGKV+ RI+ AH+ RVKG+VV  N  DG E   L+ASASSDG I +WDVR  
Sbjct  238   GITAWDLSSGKVSSRIEGAHATRVKGVVVFDNRKDGSELSNLIASASSDGVIRIWDVR--  295

Query  1177  MGGKEKPNPLAMANTKSRLTCLAGSSIK  1260
               G  KP PLA+ANTK+RLTCLAG+S+K
Sbjct  296   TIGNGKPTPLAVANTKARLTCLAGTSLK  323



>ref|XP_003577345.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Brachypodium distachyon]
Length=321

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 144/326 (44%), Positives = 206/326 (63%), Gaps = 18/326 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLD--LIPLFSFPSHLSTIKCadvsgsvavsgg--s  489
             M+L+AGSY+ FIWG+ LK+     + +  L PLFS+P+H   I+C   +    ++    +
Sbjct  1     MALVAGSYERFIWGFSLKTLTTSSSSEQALAPLFSYPAHAGPIRCVAAAPRAGLAASGGA  60

Query  490   ddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             DD++++YDL   +++G L + SA +++LAF++   +  P NL++A+D+G + +Y  D F 
Sbjct  61    DDSVRLYDLPAAADLGPLLDPSAAVSALAFHSIGPV--PRNLLAASDDGLLHLYDADGFA  118

Query  667   HLKTVKVHRKG---INSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILK  837
              L +++V  +G    + +++H SG +  +VGR   LAM++L RGRRSF   L +  S + 
Sbjct  119   LLSSLRVFPRGREPADDVAVHRSGRVALAVGRAGGLAMLNLLRGRRSFACRLERPASAVA  178

Query  838   FNET---GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNI  1008
             + E    G    M  +EKV+V +     R + E    KRVL     + GIL+TGGEDR I
Sbjct  179   YVEDAAGGDRFVMAAEEKVTVHD-SEDARIIHEMRCDKRVLAFGAAKNGILYTGGEDRGI  237

Query  1009  TAWDTKSGKVAHRIDDAHSARVKGIVVLSN-NDG-EYPYLVASASSDGNICVWDVRMGMG  1182
             TAWD  SGKV+ RI+ AHS RVKGIV+  N NDG E   LVASASSDG I +WDVR  M 
Sbjct  238   TAWDLSSGKVSSRIEGAHSTRVKGIVIFDNRNDGSELCTLVASASSDGIIKIWDVR--MI  295

Query  1183  GKEKPNPLAMANTKSRLTCLAGSSIK  1260
             G EKP PLA  NTK+RLTCLAG+S+K
Sbjct  296   GDEKPTPLAETNTKARLTCLAGTSLK  321



>gb|EAY83900.1| hypothetical protein OsI_39122 [Oryza sativa Indica Group]
Length=333

 Score =   234 bits (598),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 147/330 (45%), Positives = 212/330 (64%), Gaps = 20/330 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLD---LIPLFSFPSHLSTIKCadvsgsvavsgg--  486
             M+LIAGSY+ FIWG+ LK+     + +   L PLFS+P+H   I+CA  +    ++    
Sbjct  1     MALIAGSYERFIWGFSLKTLTSSSSSETLALAPLFSYPAHAGPIRCATAAPRAGLAASGG  60

Query  487   sddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHT-DP  660
             SDDT+++YDL   +++G L + +A +++LA ++   +  P NL++A+D+G + +Y   + 
Sbjct  61    SDDTVRLYDLPAAADLGPLLDPAAPVSALAIHSLGPV--PRNLLAASDDGLLHLYDAGEG  118

Query  661   FVHLKTVKV---HRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSI  831
             F  L +++V   HR+  ++L++HP+G +  +VGR   LAM++L RGRRSF   L +  + 
Sbjct  119   FPLLASLRVFPRHREPADALAVHPTGRVALAVGRSGGLAMLNLVRGRRSFSCRLERPATA  178

Query  832   LKFNETGK---TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDR  1002
             + + E G       M  +EKV+V +     R + E +  KRVL  AP + GIL+TGGE+R
Sbjct  179   IAYAEDGAGGDRFVMAAEEKVTVHD-SEDARIIHEIDCGKRVLAFAPAKKGILYTGGEER  237

Query  1003  NITAWDTKSGKVAHRIDDAHSARVKGIVVLSN-NDG-EYPYLVASASSDGNICVWDVRMG  1176
              ITAWD  SGKV  RI+DAHS RVKGIVV  + NDG E   L+ASASSDG I +WD R  
Sbjct  238   GITAWDLSSGKVKSRIEDAHSTRVKGIVVFDDKNDGSELCNLIASASSDGIIRIWDAR--  295

Query  1177  MGGKEKPNPLAMANTKSRLTCLAGSSIKCE  1266
             M  KEKP PLA A TK+RLTCLAGSS+ C+
Sbjct  296   MIAKEKPTPLAEAKTKARLTCLAGSSLNCK  325



>gb|ABA99855.1| transducin family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=327

 Score =   234 bits (596),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 144/331 (44%), Positives = 206/331 (62%), Gaps = 24/331 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKS-------PKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavs  480
             M+LIAGSY+ FIWG+ LK+           + L L PLFS+P+H   I+CA  +    ++
Sbjct  1     MALIAGSYERFIWGFSLKTLTSSSASASSSETLALAPLFSYPAHAGPIRCAAAAARAGLA  60

Query  481   ggsdd--TIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYH  651
                    T+++YDL   +++G L + +A +++LA ++   +  P NL++A+D+G + +Y 
Sbjct  61    ASGGSDDTVRLYDLPAAADLGPLLDPAAPVSALAIHSLGPV--PRNLLAASDDGLLHLYD  118

Query  652   T-DPFVHLKTVKV---HRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGK  819
               + F  L +++V   HR+  ++L++HP+G +  +VGR   LAM++L RGRRSF   L  
Sbjct  119   AGEGFPLLASLRVFPRHREPADALAVHPTGRVALAVGRSGGLAMLNLLRGRRSFSCRLEH  178

Query  820   EVSILKFNETGK---TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTG  990
               + + + E G       M  +EKV+V +     R + E +  KRVL  AP + GIL+TG
Sbjct  179   PATAIAYAEDGAGGDRFVMAAEEKVTVHD-SEDARIIHEIDCGKRVLAFAPAKKGILYTG  237

Query  991   GEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSN-NDG-EYPYLVASASSDGNICVWD  1164
             GE+R ITAWD  SGKV  RI+DAHS RVKGIVV  + NDG E   L+ASASSDG I +WD
Sbjct  238   GEERGITAWDLSSGKVTSRIEDAHSTRVKGIVVFDDKNDGSELCNLIASASSDGIIRIWD  297

Query  1165  VRMGMGGKEKPNPLAMANTKSRLTCLAGSSI  1257
              R  M  KEK  PLA ANTK+RLTCLAGSS+
Sbjct  298   AR--MIAKEKTTPLAEANTKARLTCLAGSSL  326



>gb|EAZ21227.1| hypothetical protein OsJ_36880 [Oryza sativa Japonica Group]
Length=356

 Score =   233 bits (595),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 144/331 (44%), Positives = 206/331 (62%), Gaps = 24/331 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKS-------PKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavs  480
             M+LIAGSY+ FIWG+ LK+           + L L PLFS+P+H   I+CA  +    ++
Sbjct  1     MALIAGSYERFIWGFSLKTLTSSSASASSSETLALAPLFSYPAHAGPIRCAAAAAPAGLA  60

Query  481   ggsdd--TIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYH  651
                    T+++YDL   +++G L + +A +++LA ++   +  P NL++A+D+G + +Y 
Sbjct  61    ASGGSDDTVRLYDLPAAADLGPLLDPAAPVSALAIHSLGPV--PRNLLAASDDGLLHLYD  118

Query  652   T-DPFVHLKTVKV---HRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGK  819
               + F  L +++V   HR+  ++L++HP+G +  +VGR   LAM++L RGRRSF   L  
Sbjct  119   AGEGFPLLASLRVFPRHREPADALAVHPTGRVALAVGRSGGLAMLNLLRGRRSFSCRLEH  178

Query  820   EVSILKFNETGK---TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTG  990
               + + + E G       M  +EKV+V +     R + E +  KRVL  AP + GIL+TG
Sbjct  179   PATAIAYAEDGAGGDRFVMAAEEKVTVHD-SEDARIIHEIDCGKRVLAFAPAKKGILYTG  237

Query  991   GEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSN-NDG-EYPYLVASASSDGNICVWD  1164
             GE+R ITAWD  SGKV  RI+DAHS RVKGIVV  + NDG E   L+ASASSDG I +WD
Sbjct  238   GEERGITAWDLSSGKVTSRIEDAHSTRVKGIVVFDDKNDGSELCNLIASASSDGIIRIWD  297

Query  1165  VRMGMGGKEKPNPLAMANTKSRLTCLAGSSI  1257
              R  M  KEK  PLA ANTK+RLTCLAGSS+
Sbjct  298   AR--MIAKEKTTPLAEANTKARLTCLAGSSL  326



>ref|XP_004173731.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like, 
partial [Cucumis sativus]
Length=202

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 147/193 (76%), Gaps = 2/193 (1%)
 Frame = +1

Query  322  MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
            MSLIAGSY++FIWG+KL+ P + Q+L L P FS+ SH+S IK    +G VA SGG+D TI
Sbjct  1    MSLIAGSYENFIWGFKLR-PSEPQSLTLTPFFSYHSHISAIKTVAAAGPVAASGGNDQTI  59

Query  502  KIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             +YDLST S +GSLH+ SA I SLAFYTPP+LSFP NL+SAA +GSV IY TDPFVHLKT
Sbjct  60   HLYDLSTTSSLGSLHDHSAYITSLAFYTPPNLSFPRNLVSAAADGSVCIYDTDPFVHLKT  119

Query  679  VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
            V  HRK +N LSIHPSG L  +VG DECLA+++L RGRRSFY  LG E S++ F+  G  
Sbjct  120  VLPHRKAVNDLSIHPSGKLALTVGHDECLAIINLVRGRRSFYCRLGNEASLVDFDVGGDK  179

Query  859  LYMVMDEKVSVLE  897
             +MVM EKVSV E
Sbjct  180  FFMVMKEKVSVHE  192



>ref|XP_001770946.1| predicted protein [Physcomitrella patens]
 gb|EDQ64276.1| predicted protein [Physcomitrella patens]
Length=333

 Score =   209 bits (532),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 135/330 (41%), Positives = 197/330 (60%), Gaps = 21/330 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M L+AGSY+ F+WGY +K    L+  +L   F++P+H+  IKC   SG+V  +GG+DDTI
Sbjct  1     MKLVAGSYERFLWGYDVK----LKKQELQWKFAYPAHIGAIKCIASSGAVVATGGADDTI  56

Query  502   KIYDLSTCSEIGSL--HESATINSLAFYTP-PSLSFPHNLISAADNGSVSIYHTDPFVHL  672
             +I+DL+   ++GSL  HE A +  L F+   PS++ P +L+S +++GS+ I+ TD +VHL
Sbjct  57    RIFDLNAQKDMGSLYKHEGA-VTCLDFHNSHPSINHPTHLLSGSEDGSICIWDTDAWVHL  115

Query  673   KTVKVHR---KGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKF-  840
              T+K  +     +  LSIH SG L  S+ R+  + M +L +GR SF   L  E  I+KF 
Sbjct  116   LTMKAKKGPKSAVQDLSIHVSGLLALSIERNHNMKMWNLTKGRCSFTTKLPSEAEIVKFF  175

Query  841   NETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWD  1020
              ++G++  +V+   + +        T+    + K+V C A  E  +L TGGED  +  WD
Sbjct  176   PQSGESYALVLGTALEIRN-AETGSTIHRLQHDKKVFCIAQREDNLLVTGGEDCIVRGWD  234

Query  1021  TKSGKVAHRIDDAHSARVKGIVVLSN------NDGEYPYLVASASSDGNICVWDVRMGMG  1182
             T+SGK A  I +AHS R+KG+ +L +      N GE P +VASASSDG + VWD RM   
Sbjct  235   TRSGKQAWSIANAHSNRIKGVAILRSKSATDENTGEPPVIVASASSDGLLKVWDTRMVRS  294

Query  1183  GK-EKPNPLAMANTKSRLTCLAGSS-IKCE  1266
                  P PL  A TK+RLTCL  SS +K E
Sbjct  295   NSGAAPAPLLQAETKARLTCLVSSSGVKSE  324



>ref|NP_001067278.1| Os12g0615900 [Oryza sativa Japonica Group]
 dbj|BAF30297.1| Os12g0615900, partial [Oryza sativa Japonica Group]
Length=250

 Score =   187 bits (476),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 159/248 (64%), Gaps = 14/248 (6%)
 Frame = +1

Query  541   LHESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHT-DPFVHLKTVKV---HRKGINS  708
             L  +A +++LA ++   +  P NL++A+D+G + +Y   + F  L +++V   HR+  ++
Sbjct  7     LDPAAPVSALAIHSLGPV--PRNLLAASDDGLLHLYDAGEGFPLLASLRVFPRHREPADA  64

Query  709   LSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGK---TLYMVMDE  879
             L++HP+G +  +VGR   LAM++L RGRRSF   L    + + + E G       M  +E
Sbjct  65    LAVHPTGRVALAVGRSGGLAMLNLLRGRRSFSCRLEHPATAIAYAEDGAGGDRFVMAAEE  124

Query  880   KVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDA  1059
             KV+V +     R + E +  KRVL  AP + GIL+TGGE+R ITAWD  SGKV  RI+DA
Sbjct  125   KVTVHD-SEDARIIHEIDCGKRVLAFAPAKKGILYTGGEERGITAWDLSSGKVTSRIEDA  183

Query  1060  HSARVKGIVVLSN-NDG-EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRL  1233
             HS RVKGIVV  + NDG E   L+ASASSDG I +WD R  M  KEK  PLA ANTK+RL
Sbjct  184   HSTRVKGIVVFDDKNDGSELCNLIASASSDGIIRIWDAR--MIAKEKTTPLAEANTKARL  241

Query  1234  TCLAGSSI  1257
             TCLAGSS+
Sbjct  242   TCLAGSSL  249



>ref|XP_002971805.1| hypothetical protein SELMODRAFT_96087 [Selaginella moellendorffii]
 gb|EFJ27554.1| hypothetical protein SELMODRAFT_96087 [Selaginella moellendorffii]
Length=336

 Score =   180 bits (456),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 122/315 (39%), Positives = 181/315 (57%), Gaps = 18/315 (6%)
 Frame = +1

Query  328   LIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKI  507
             ++AGSY+ F+W +      DL   +L   FS PSHL  IKCA   G   V+GGSDDTI I
Sbjct  5     IVAGSYERFVWAW----DADLATGELSQSFSRPSHLGPIKCAAGWGGDLVTGGSDDTIHI  60

Query  508   YDLSTCSEIGSLH-ESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVK  684
             +D++   ++G      A++ +L F+   +     +L SA+++G++ ++    ++H KT+K
Sbjct  61    FDVAANRDVGVAEGHRASVTALEFFGTDATGKASHLFSASEDGTICVWDAGSWIHFKTMK  120

Query  685   VHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKF-NETGKTL  861
                 GI  LSIH SG L  SV R     M +L RGR SF   + +E S++ F  E   + 
Sbjct  121   GGNAGILDLSIHSSGKLAISVERHGGFRMWNLLRGRCSFKTKVAREASLVSFLPEKEHSY  180

Query  862   YMVMDEKVSV--LELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGK  1035
              M     V +   E G   +T+   ++ K VLC AP    +L TGGED +++ WD +SGK
Sbjct  181   AMACGSAVEIHNAEDGKVFQTL---DHDKPVLCMAPFHDELLCTGGEDCSVSVWDFRSGK  237

Query  1036  VAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKE--KPNPLA  1209
              AHRI  AH++RVKG+  LS++      L+ SASSDG + VWD+R+    ++  KP PL 
Sbjct  238   TAHRIAAAHASRVKGVDRLSDSQ-----LLVSASSDGTVKVWDLRVVSQAEDDGKPVPLM  292

Query  1210  MANTKSRLTCLAGSS  1254
              A+T++RLTC+ G S
Sbjct  293   QADTRARLTCVVGFS  307



>ref|XP_002963855.1| hypothetical protein SELMODRAFT_80824 [Selaginella moellendorffii]
 gb|EFJ35726.1| hypothetical protein SELMODRAFT_80824 [Selaginella moellendorffii]
Length=336

 Score =   177 bits (449),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 120/315 (38%), Positives = 180/315 (57%), Gaps = 18/315 (6%)
 Frame = +1

Query  328   LIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKI  507
             ++AGSY+ F+W +      DL   +L   FS PSHL  IKCA   G   V+GGSDDTI I
Sbjct  5     IVAGSYERFVWAWD----ADLATGELSQSFSRPSHLGPIKCAAGWGGDLVTGGSDDTIHI  60

Query  508   YDLSTCSEIGSLH-ESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVK  684
             +D++   ++G      A++ +L F+   +     +L SA+++G++ ++    ++H KT+K
Sbjct  61    FDVAANRDVGVAEGHRASVTALEFFGADATGKASHLFSASEDGTICVWDAGSWIHFKTMK  120

Query  685   VHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKF-NETGKTL  861
                 GI  LSIH SG L  SV R     M +L RGR SF   + ++ S++ F  E   + 
Sbjct  121   GGNAGILDLSIHSSGKLAISVERHGGFRMWNLLRGRCSFKTKVARQASLVSFLPEKEHSY  180

Query  862   YMVMDEKVSV--LELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGK  1035
              M     V +   E G   +T+   ++ K VLC AP    +L TGGED +++ WD +SGK
Sbjct  181   AMACGSAVEIHNAEDGKVFQTL---DHDKPVLCMAPFHDELLCTGGEDCSVSVWDFRSGK  237

Query  1036  VAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKE--KPNPLA  1209
              AHRI  AH++RVKG+  L ++      L+ SASSDG + VWD+R+    ++  KP PL 
Sbjct  238   TAHRIAAAHASRVKGVDRLGDSQ-----LLVSASSDGTVKVWDLRVVSQAEDDGKPVPLM  292

Query  1210  MANTKSRLTCLAGSS  1254
              A+T++RLTC+ G S
Sbjct  293   QADTRARLTCVVGFS  307



>gb|KHN41431.1| p21-activated protein kinase-interacting protein 1-like [Glycine 
soja]
Length=140

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 101/136 (74%), Gaps = 9/136 (7%)
 Frame = +1

Query  865   MVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAH  1044
             MV+ EKVSV +     R + EF   K VLCA P + G+L+TGGEDRNITAWD K+GKVA+
Sbjct  1     MVVKEKVSVHQTEDA-RILFEFECPKPVLCATPAKNGLLYTGGEDRNITAWDIKTGKVAY  59

Query  1045  RIDDAHSARVKGIVVLSNNDG----EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAM  1212
              +++AH+ARVKGIV L+++DG    + PYLVASASSDG I VWDVR  M  +EK  PL  
Sbjct  60    CLEEAHTARVKGIVALTDSDGATGDDNPYLVASASSDGIIRVWDVR--MAAREK--PLTE  115

Query  1213  ANTKSRLTCLAGSSIK  1260
              NT+SRLTCLAGSS+K
Sbjct  116   HNTRSRLTCLAGSSLK  131



>gb|EMT10476.1| hypothetical protein F775_28048 [Aegilops tauschii]
Length=143

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 96/136 (71%), Gaps = 5/136 (4%)
 Frame = +1

Query  865   MVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAH  1044
             M  +EKV+V +     R + E    KRVL  AP + GIL+TGGEDR ITAWD  SGKV+ 
Sbjct  1     MAAEEKVTVHD-SEDARIIHEMRCDKRVLALAPSKNGILYTGGEDRGITAWDLTSGKVSS  59

Query  1045  RIDDAHSARVKGIVVLSN-NDG-EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
             RI+ AHS RVKGIVV  + NDG E   LVASASSDG I +WDVR  M G EKP PLA AN
Sbjct  60    RIEGAHSTRVKGIVVFDDRNDGSESSTLVASASSDGIIRIWDVR--MIGSEKPTPLAEAN  117

Query  1219  TKSRLTCLAGSSIKCE  1266
             TK+RLTCLAG+S+K +
Sbjct  118   TKARLTCLAGTSLKWQ  133



>gb|KHN35595.1| p21-activated protein kinase-interacting protein 1-like [Glycine 
soja]
Length=163

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 105/159 (66%), Gaps = 8/159 (5%)
 Frame = +1

Query  793   RSFYYSLGKE--VSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPG  966
             RSF   LGKE  +S++KFN  G   ++   EKVSV  +    R +LEF  +KRVLCAA  
Sbjct  9     RSFCRPLGKEESLSLVKFNAAGDRFFVAALEKVSVY-VTKTERFLLEFECSKRVLCAASS  67

Query  967   EGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDG  1146
                +L+T GEDRNITAW+ KSGKVA+ +    + RVKGIVV +++DG+ PYL+A  SSDG
Sbjct  68    RNALLYTDGEDRNITAWNIKSGKVAYCVRKKIT-RVKGIVVTTDSDGDEPYLMAFGSSDG  126

Query  1147  NICVWDVRMGMGGKEKPNPLAMANTKSRLTCLAGSSIKC  1263
              I  WDVR  M  +EK  PL   NT SRLTCLAGS  KC
Sbjct  127   IIRFWDVR--MAAREK--PLVECNTNSRLTCLAGSYHKC  161



>ref|XP_005649213.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24669.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=428

 Score =   150 bits (378),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 101/313 (32%), Positives = 162/313 (52%), Gaps = 9/313 (3%)
 Frame = +1

Query  325   SLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIK  504
             +L+AGSY+ F + Y+++ P   +N +L   FSFP+H   +KC   +     SGG+DDT+ 
Sbjct  4     TLVAGSYERFWFAYEVE-PSQNENQELSRAFSFPAHQGPVKCIAGAAPFVASGGADDTVH  62

Query  505   IYDLSTCSEIGSLHE--SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTD-PFVHLK  675
             IY+     ++G L       + ++ FYTP   S P +L+S A +GS+S++     +  LK
Sbjct  63    IYNAEAGKDLGFLMNPGDGAVTAVEFYTPAGTSQPTHLLSGAADGSISVWGAGGSWECLK  122

Query  676   TVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGK  855
              +K H+K + SLS+HPSG L  S  RD+ L M ++ +GR  +   +      + F+  G 
Sbjct  123   VLKGHKKEVTSLSVHPSGLLALSTSRDDMLRMWNMAKGRSQYKTKIPPGTESVSFSPNGD  182

Query  856   TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGK  1035
                ++   KV+   +         F   KR LC       ++  GGED ++   D ++  
Sbjct  183   IYALLSGLKVTAHNVSEEGDIAATFELEKRGLCMTFMSDQVIVVGGEDGSLRTLDLRTDG  242

Query  1036  VAHRIDDAHSARVKGIVVLS---NNDGEYPYLVASASSDGNICVWDVR-MGMGGKEKPNP  1203
             V   +  AH  RV+G+  LS    +D E  + VASA++DG I +WD+R  G     +   
Sbjct  243   VQSTL-KAHGTRVRGVAALSPGDASDSEPAHQVASAATDGFIRLWDLRNTGSASSSQAQQ  301

Query  1204  LAMANTKSRLTCL  1242
             L   +T +RLTCL
Sbjct  302   LCETSTSARLTCL  314



>gb|EMS57756.1| p21-activated protein kinase-interacting protein 1-like protein 
[Triticum urartu]
Length=144

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 97/145 (67%), Gaps = 5/145 (3%)
 Frame = +1

Query  865   MVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAH  1044
             M  +EKV+V +     R + E    KR+L  AP + G L+TGGEDR ITAWD  SGKV+ 
Sbjct  1     MAAEEKVTVHD-SEDARIIHEMRCDKRILALAPSKNGALYTGGEDRGITAWDLSSGKVSS  59

Query  1045  RIDDAHSARVKGIVVL--SNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
             RI+ AHS RVKGIV+    NN  E   LVASASSDG I +WDVR  M G EKP PLA AN
Sbjct  60    RIEGAHSTRVKGIVIFDNQNNGSESSTLVASASSDGIIRIWDVR--MIGSEKPTPLAEAN  117

Query  1219  TKSRLTCLAGSSIKCE*VYIGITLY  1293
             TK+RLTCLAG+S+K   V +G  ++
Sbjct  118   TKARLTCLAGTSLKYLSVPLGQDMW  142



>ref|XP_005852245.1| hypothetical protein CHLNCDRAFT_133558 [Chlorella variabilis]
 gb|EFN60143.1| hypothetical protein CHLNCDRAFT_133558 [Chlorella variabilis]
Length=497

 Score =   147 bits (370),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 102/327 (31%), Positives = 176/327 (54%), Gaps = 15/327 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK------SPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsg  483
             MSL+AG Y+ F++GY+L+      + +  Q L L   F+  +H   +KC   +G    +G
Sbjct  1     MSLLAGCYERFLFGYQLEGEVQGDAAEGEQKLGLHRSFTHAAHKGVVKCVAAAGQWGATG  60

Query  484   gsddTIKIYDLSTCSEIGSLHE--SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTD  657
             G+DD I +YDL +  ++G L       + +LAF+ P     P +L+S + +GSVS++   
Sbjct  61    GADDLIHLYDLKSDKDLGFLMSPGEGAVTALAFFAPAGAYNPTHLLSGSADGSVSVWQAG  120

Query  658   P-FVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSIL  834
               +  LKT++ HRK + ++S+HPSG L  +V RD  + M DL +GR +++  L  E   +
Sbjct  121   GGWECLKTMRGHRKDVAAISVHPSGLLALTVSRDGFMRMWDLVKGRCTYHVRLEVEAEGV  180

Query  835   KF-NETGKTLYMVM-DEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNI  1008
             +F  E G   Y ++   +++V  +      +   ++  R LC A   G  + +G ED ++
Sbjct  181   EFCREDGGARYALLCGARLTVHGVQGDAGVLCTLSHPGRTLCMAWAPGNRIVSGCEDGSL  240

Query  1009  TAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDV----RMG  1176
               WD ++G     I  AH +RV+ + +L  +      L A+ SSDG++ +WD+      G
Sbjct  241   RLWDAQAGVELLCISRAHVSRVRTLALLPPSSAGGRLLAATGSSDGSLKLWDLTKAAAAG  300

Query  1177  MGGKEKPNPLAMANTKSRLTCLAGSSI  1257
             + G    + LA A T++RLTC+A + +
Sbjct  301   VHGSSGGSCLAEAQTRARLTCMAAADL  327



>gb|KFM22850.1| P21-activated protein kinase-interacting protein 1-like protein 
[Auxenochlorella protothecoides]
Length=490

 Score =   141 bits (355),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 101/331 (31%), Positives = 165/331 (50%), Gaps = 27/331 (8%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M   AGSY+ F++G++    ++     L   F+ P+H   I+    +G     GGS+DTI
Sbjct  1     MLFAAGSYERFLFGFEWD--QEQATSSLTKSFTHPAHKGAIRSIAAAGPFLACGGSEDTI  58

Query  502   KIYDLSTCSEIGSLHE--SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTD-PFVHL  672
              IY+L T  ++G L       + +  F+TP   S P +L++ + +GS+SI+     +  L
Sbjct  59    HIYNLRTNKDLGFLMAPGEGAVTAAVFHTPTGRSTPTHLLTGSADGSLSIWGVGGEWTCL  118

Query  673   KTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETG  852
             KT K H K +  +++HPSG +  S+ RD  L + DL +GR +F   L +    + F+ +G
Sbjct  119   KTFKAHTKEVTGVAVHPSGRVALSISRDGTLRIWDLVKGRSTFATKLPQAAEAITFSPSG  178

Query  853   KTLYMVMDEKVSVLELGYCPRTVLE-FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKS  1029
                 ++    +S+  +     T L   ++ +RVLC A     +L TG +D ++ AW    
Sbjct  179   DVYALLAGAVLSMHSVAAESSTALATLSHERRVLCHAFHGEDVLLTGCDDGSLHAWSIPD  238

Query  1030  GKVAHRIDDAHSARVKGIVVLS-----------------NNDGEYPYLVASASSDGNICV  1158
                   I +AH +R++G+ V                   +     P LV +ASSDG + +
Sbjct  239   EAEILTIPEAHGSRIRGLAVAPQSSASDASSSIQASKSPSTAHALPRLVGTASSDGTLRL  298

Query  1159  W---DVRMGMGGKEKPNPLAMANTKSRLTCL  1242
             W   D+R G GG   P PLA  +T++RLTCL
Sbjct  299   WNLEDIRAGAGGA-APQPLAEVDTRARLTCL  328



>dbj|GAM25939.1| hypothetical protein SAMD00019534_091140, partial [Acytostelium 
subglobosum LB1]
Length=536

 Score =   139 bits (351),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 110/326 (34%), Positives = 175/326 (54%), Gaps = 32/326 (10%)
 Frame = +1

Query  304   IEAGKSMSLIAGSYDHFIWGYK---------LKSPKDLQNLDLIPLFSFPSHLSTIKCad  456
             IE   S  L  G Y+H I GY+         L +P +++ L L  +F++ +H   +K   
Sbjct  108   IEKEYSPLLTIGCYEHSILGYEALLMADHPELGNPDEMEVL-LQQVFAYAAHSGCVKAVG  166

Query  457   vsg--svavsggsddTIKIYDLSTCSEIGSL--HESATINSLAFYTPPSLSFPHNLISAA  624
              +      VS  +D+T+++Y LS   E G+L  HE   IN++ F+         ++++A+
Sbjct  167   TTADGEFLVSSSTDETMRVYRLSKREEFGTLSKHE-GWINAIQFFGS------SHMLAAS  219

Query  625   DNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFY  804
              + ++S++    +  LKT+K H+  +NSLSIHPSG    SVG+D  L + DL RG  + Y
Sbjct  220   RDHTLSVWRVADWECLKTLKGHKDIVNSLSIHPSGKAALSVGKDRRLFLWDLMRGVAANY  279

Query  805   YSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILF  984
               L KE  I++++ TG    +V  ++V++           EF     VL     +  IL 
Sbjct  280   NKLPKEGLIVQWSPTGNHYSVVYADRVAIYTTDAKELHSFEFKQP--VLTMKYYDDDILM  337

Query  985   TGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWD  1164
              GGED+ IT  D K+GKV  ++ + +SARVKG+ VL  +  + PY+V S SSDGN+ VW+
Sbjct  338   VGGEDKLITLLDYKNGKVIKQL-EGNSARVKGLEVLRFDSVKKPYVV-SISSDGNVVVWN  395

Query  1165  VRMGMGGKEKPNPLAMANTKSRLTCL  1242
             +   +       P+ MA T +RLTC+
Sbjct  396   IDTEL-------PVGMAETGARLTCI  414



>gb|KHN35586.1| p21-activated protein kinase-interacting protein 1-like [Glycine 
soja]
Length=129

 Score =   127 bits (318),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 65/102 (64%), Positives = 81/102 (79%), Gaps = 8/102 (8%)
 Frame = +1

Query  967   EGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG----EYPYLVASA  1134
             + G+L+TGGEDRNITAWD K+GK+A+ +++AH+ARVKGIV L+ +DG    + PYLVASA
Sbjct  3     QNGLLYTGGEDRNITAWDIKTGKIAYCLEEAHTARVKGIVALTESDGATGDDDPYLVASA  62

Query  1135  SSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLAGSSIK  1260
             SSDG I VWDVR  M  +EK  PL   NT+SRLTCLAGSS+K
Sbjct  63    SSDGIIRVWDVR--MAAREK--PLTEHNTRSRLTCLAGSSLK  100



>emb|CDY01885.1| BnaC06g29250D [Brassica napus]
Length=159

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 73/100 (73%), Gaps = 6/100 (6%)
 Frame = +1

Query  973   GILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNND----GEYPYLVASASS  1140
             G LFT GEDR ITAWDT  GK+A+ I DAH AR+KG+V L+ ND     E PYLVASASS
Sbjct  40    GTLFTAGEDRAITAWDTNRGKLAYSIQDAHPARIKGVVTLTKNDSDGASEDPYLVASASS  99

Query  1141  DGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLAGSSIK  1260
             DG I VWD+R  M  KE   PLA  NTKSRLTCLAGS++K
Sbjct  100   DGIIRVWDMR--MAAKENAKPLAETNTKSRLTCLAGSALK  137



>ref|XP_004158681.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like, 
partial [Cucumis sativus]
Length=125

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 80/101 (79%), Gaps = 6/101 (6%)
 Frame = +1

Query  973   GILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG-----EYPYLVASAS  1137
             GIL TGG+DR +TAWD KSGKVA+ I++AH ARV+GIVVL+ N       + P++VASAS
Sbjct  2     GILLTGGDDRCLTAWDVKSGKVAYTIEEAHPARVRGIVVLTKNSSGAFTDDDPHVVASAS  61

Query  1138  SDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLAGSSIK  1260
             +DG I VWDVRM    K+KPNPLA ANTK+RLTCLAGS++K
Sbjct  62    TDGVIRVWDVRM-TAIKDKPNPLAEANTKARLTCLAGSALK  101



>ref|NP_957239.2| p21-activated protein kinase-interacting protein 1-like [Danio 
rerio]
 sp|Q6TNS2.1|PK1IP_DANRE RecName: Full=p21-activated protein kinase-interacting protein 
1-like; AltName: Full=PAK1-interacting protein 1-like [Danio 
rerio]
 gb|AAQ91257.1| PAK1 interacting protein 1 [Danio rerio]
Length=368

 Score =   132 bits (333),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 159/311 (51%), Gaps = 16/311 (5%)
 Frame = +1

Query  313   GKSMSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             G  + L+AG Y+  ++GY++  P D +   + P F+  +H +++     S     +G  D
Sbjct  9     GDHIELVAGCYEQIVFGYRV-CPAD-EEWTIEPTFTHHAHTASLNAVSSSNQFIATGSKD  66

Query  493   dTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             +TI++YD+   +E G+L H   TI+ L FY         +L+S   +G + ++ T  +  
Sbjct  67    ETIQLYDMCKKTEHGALLHHDGTISCLEFYGTS------HLLSGGQDGLICVWSTKKWEC  120

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNET  849
             LKT++ H+  + SLS+HPSG L  SVG D+ L   +L  GR +F  ++ +   I+ ++  
Sbjct  121   LKTIRAHKGQVTSLSVHPSGKLALSVGTDKTLRTWNLIEGRSAFIKNIKQNAEIVLWSPD  180

Query  850   GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKS  1029
             G    +V+++KV +  L      +      KR+ C    +  +L  GG+D ++  +D  S
Sbjct  181   GDKYAVVVNDKVDIYTLDS-ATIIGTIAFTKRISCLKFLKNSLLAVGGDDESVRIYDVTS  239

Query  1030  GKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLA  1209
              K       AH  RVK I     +D  +  LV +AS+DG I +W  ++ +   E P  L 
Sbjct  240   QKCVCEF-KAHENRVKAIESFMKDD--FCVLV-TASNDGFIKLW--KLNLESIESPTLLG  293

Query  1210  MANTKSRLTCL  1242
               NT +RLTCL
Sbjct  294   QLNTTARLTCL  304



>gb|AAH66416.2| Zgc:56683 [Danio rerio]
Length=368

 Score =   132 bits (333),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/311 (30%), Positives = 159/311 (51%), Gaps = 16/311 (5%)
 Frame = +1

Query  313   GKSMSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             G  + L+AG Y+  ++GY++  P D +   + P F+  +H +++     +     +G  D
Sbjct  9     GDHIELVAGCYEQIVFGYRV-CPAD-EEWTIEPTFTHHAHTASLNAVSSNNQFIATGSKD  66

Query  493   dTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             +TI++YD+   +E G+L H   TI+ L FY         +L+S   +G + ++ T  +  
Sbjct  67    ETIQLYDMCKKTEHGALLHHDGTISCLEFYGTS------HLLSGGQDGLICVWSTKKWEC  120

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNET  849
             LKT++ H+  + SLS+HPSG L  SVG D+ L   +L  GR +F  ++ +   I+ ++  
Sbjct  121   LKTIRAHKGQVTSLSVHPSGKLALSVGTDKTLRTWNLIEGRSAFIKNIKQNAEIVLWSPD  180

Query  850   GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKS  1029
             G    +V+++KV +  L      +      KR+ C    +  +L  GG+D ++  +D  S
Sbjct  181   GDKYAVVVNDKVDIYTLDS-ATIIGTIAFTKRISCLKFLKNSLLAVGGDDESVRIYDVTS  239

Query  1030  GKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLA  1209
              K       AH  RVK I     +D  +  LV +AS+DG I +W  ++ +   E P  L 
Sbjct  240   QKCVCEF-KAHENRVKAIESFMKDD--FCVLV-TASNDGFIKLW--KLNLESIESPTLLG  293

Query  1210  MANTKSRLTCL  1242
               NT +RLTCL
Sbjct  294   QLNTTARLTCL  304



>ref|XP_005476727.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Oreochromis niloticus]
Length=359

 Score =   132 bits (332),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 99/309 (32%), Positives = 158/309 (51%), Gaps = 15/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + L+AGSY+   +GY++K+  D +       F+  +H +++     S    V+G  D+TI
Sbjct  5     LELVAGSYEQITFGYQVKT--DEKEWTAKAEFTHHAHTASVSAVAASERFVVTGSKDETI  62

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YD+    E G+L H   TI  L FY         +L+S  ++G + ++ T  +  LK+
Sbjct  63    QVYDMKKRIEHGALLHHDGTITCLEFYGTS------HLLSGGEDGLLCVWSTKKWECLKS  116

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLS+HPSG LV SVG D+ L   +L  GR +F  ++ +   I++++  G  
Sbjct  117   IKAHKGHVTSLSVHPSGKLVLSVGTDKTLRTWNLINGRSAFIKNIKQNAHIVRWSPDGDR  176

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               +VM++KV++ EL     T     N KR+         IL   G+D  +   D +  K 
Sbjct  177   YVVVMNDKVNIYELETATVTGT-VANPKRIASVKFLNNSILAVAGDDETVRLCDVEKAKW  235

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  RVK   V S N  +Y  +V +AS+DG I +W + +     E P  L   N
Sbjct  236   VCEF-KAHETRVK--TVDSVNVDDYS-VVVTASNDGFIKMWKIHLK-EELESPTLLGEVN  290

Query  1219  TKSRLTCLA  1245
             T +RLTCLA
Sbjct  291   TSARLTCLA  299



>ref|XP_006634637.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Lepisosteus oculatus]
Length=381

 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 93/308 (30%), Positives = 160/308 (52%), Gaps = 20/308 (6%)
 Frame = +1

Query  328   LIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKI  507
             L+AG Y+   +GY++++ K++ N+D+   FS+ +H +++     +     +G  D+TI +
Sbjct  7     LVAGCYEQITFGYRVETTKEVSNIDI---FSYHAHSASLSVVATNEKFIATGSRDETICL  63

Query  508   YDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVK  684
             YD+   +E G+L H   TI  L FY         +L+S  ++G + I+ T  +  L+++K
Sbjct  64    YDMKKRTEHGALLHHDGTITCLEFYGSS------HLLSGGEDGLICIWSTKKWECLQSIK  117

Query  685   VHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLY  864
              H+  ++S S+HPSG L  SVG D+ L   +L  GR +F  ++ +   I+ ++  G    
Sbjct  118   AHKGQVSSFSVHPSGKLALSVGTDKTLRTWNLIDGRSAFIKNIKENAHIVLWSPAGDKYV  177

Query  865   MVMDEKVSV--LELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
             +V D K+ V  LE     R +L   N KR+         I+   G++  +  +DT SG  
Sbjct  178   VVADNKIDVYSLETATVTRAIL---NQKRISSVKFVTNSIVAVAGDEECLRLYDTDSGVC  234

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  RVK +   + +D    +++ASAS+DG I +W + +    K+ P  L   N
Sbjct  235   LSEF-KAHENRVKALSSFTVDD---RHILASASNDGYIKMWKLNLEQ-MKDPPVLLGEVN  289

Query  1219  TKSRLTCL  1242
             T +RL CL
Sbjct  290   TTARLACL  297



>tpg|DAA63787.1| TPA: hypothetical protein ZEAMMB73_100665 [Zea mays]
Length=293

 Score =   128 bits (322),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 83/236 (35%), Positives = 132/236 (56%), Gaps = 19/236 (8%)
 Frame = +1

Query  322  MSLIAGSYDHFIWGYKLK---SPKDL-----QNLDLIPLFSFPSHLSTIKCadvsgsvav  477
            M+L+AGSY+ FIWG+ LK   SP        + L L PLFS+P+H   ++C   +    +
Sbjct  1    MALVAGSYERFIWGFSLKTLTSPSATGASPSETLTLAPLFSYPAHTGPVRCVAAAPRAGL  60

Query  478  sgg--sddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIY  648
                 +DD++++YDL + +++G L + SA +++LAFY+      P NL++A D+GS+ IY
Sbjct  61   VASGGADDSVRLYDLPSAADLGPLLDPSAAVSALAFYS--RGPVPRNLLAACDDGSLHIY  118

Query  649  HTDPFVHLKTVKV--HRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKE  822
              D F  L T++     +   +L++HPSG +  +VGR   LAM++L RGRRSF   L   
Sbjct  119  DADGFALLSTLRAFPRHEAAEALAVHPSGRVALAVGRAGALAMLNLVRGRRSFACRLEHP  178

Query  823  VSILKFNET---GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGIL  981
             S + + E    G    M  + KVSV +     R + + +  K+VL  AP +  I+
Sbjct  179  ASAIAYAEDRDGGDRFVMAAENKVSVHD-SVDARVIHDMDCGKKVLAMAPAKLHIM  233



>ref|XP_001693185.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03211.1| predicted protein [Chlamydomonas reinhardtii]
Length=743

 Score =   134 bits (336),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 83/277 (30%), Positives = 140/277 (51%), Gaps = 17/277 (6%)
 Frame = +1

Query  328   LIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKI  507
             L AGSY+ FI+GY         N D           S +KC    G    SGG+DD I +
Sbjct  4     LFAGSYERFIFGYS-------ANADC--------SESAVKCCVAGGPYVASGGADDLIHL  48

Query  508   YDLSTCSEIGSLHE--SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTV  681
             YD+    ++GSL       +  L F+TP   S P +++  + +G+++I+    + HLK +
Sbjct  49    YDMVAERDLGSLMNPCDGAVPCLQFFTPEGRSTPSHMLGGSADGAINIWRCRDWEHLKVM  108

Query  682   KVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTL  861
             + H+  +N+L++HPSG L  SV RD  + M +L +GR ++   L  E   + F+ +G   
Sbjct  109   RGHKGAVNALAVHPSGKLALSVARDAAIRMWNLVKGRCTYTTRLEAEAEAVAFSHSGDAY  168

Query  862   YMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVA  1041
              ++   ++SV            +   +R+LC A     ++  G ED ++  WD ++  V 
Sbjct  169   SLLAGSRISVFSTDGEGGLKATYTAPRRILCTASQSDNLMLLGLEDGSVRVWDVRTSGVV  228

Query  1042  HRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNI  1152
                + AH++RV+G+ +L     + P  +A+ASSDG I
Sbjct  229   GGWERAHASRVRGMAILKEGANDLPASLATASSDGTI  265



>ref|XP_010571499.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X2 [Haliaeetus leucocephalus]
Length=368

 Score =   129 bits (323),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 97/309 (31%), Positives = 161/309 (52%), Gaps = 16/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M L+AG Y+  ++G+   + +  ++  ++P+F+  +H +++    V+    V+G  D+TI
Sbjct  1     MELVAGCYEQVLFGF---AARPAESWTVVPVFTHHAHSASLSAVAVNNRYVVTGSRDETI  57

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             +IYD+    E G+L   + TI  L FY         +L+S A++G + I++T  +  LK+
Sbjct  58    QIYDMKKKIEHGALLQHNGTITCLEFYGTA------HLLSGAEDGLICIWNTKRWECLKS  111

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++  G+ 
Sbjct  112   IKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGER  171

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
                V+  KV + +L     T       KR+         IL   G+D  I  +   S K 
Sbjct  172   YVTVITNKVDIYKLDTASITGT-ITTEKRISSLRFITDSILAIAGDDEIIRFYSCDSQKC  230

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  R+K I      + E  +++ +ASSDG I +W++ +    K+ P+ L   N
Sbjct  231   LCEF-KAHENRIKDIYSF---EREGQHVIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVN  285

Query  1219  TKSRLTCLA  1245
             TK+RLTCLA
Sbjct  286   TKARLTCLA  294



>ref|XP_005729087.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Pundamilia nyererei]
Length=359

 Score =   128 bits (321),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 98/309 (32%), Positives = 157/309 (51%), Gaps = 15/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + L+AGSY+   +GY++K+  D +       F+  +H +++     S    V+G  D+TI
Sbjct  5     LELVAGSYEQITFGYQVKT--DEKEWTAKAEFTHHAHTASVSAVAASERFVVTGSKDETI  62

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++Y++    E G+L H   TI  L FY         +L+S  ++G + ++ T  +  LK+
Sbjct  63    QVYNMKKRIEHGALLHHDGTITCLEFYGTS------HLLSGGEDGLLCVWSTKKWECLKS  116

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++  G  
Sbjct  117   IKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLINGRSAFIKNIKQNAHIVRWSPDGDR  176

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               +VM++KV++ EL     T     N KR+         IL   G+D  +   D +  K 
Sbjct  177   YVVVMNDKVNIYELETATVTGT-VTNPKRIASVNFLNNSILAVAGDDETVRLCDVEKAKW  235

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  RVK   V S N  +Y  +V +AS+DG I +W + +     E P  L   N
Sbjct  236   VCDF-KAHETRVK--TVDSVNVDDYS-VVVTASNDGFIKMWKIHLK-EELEPPTLLGEVN  290

Query  1219  TKSRLTCLA  1245
             T +RLTCLA
Sbjct  291   TSARLTCLA  299



>ref|XP_004078656.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Oryzias latipes]
Length=356

 Score =   128 bits (321),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 99/314 (32%), Positives = 158/314 (50%), Gaps = 25/314 (8%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + L+AGSY+  I+GY++K+ +     +    F+  +H ++I     S     +G  D+TI
Sbjct  5     LGLVAGSYEQIIFGYRVKTAEKEWTAE--ADFTHHTHTASISAVAASQRFVATGSKDETI  62

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YD+   +E G+L H   TI  L FY         +L+S  ++G + ++ T  +  LK+
Sbjct  63    QLYDMKKRTEHGALLHHDGTITCLQFYGES------HLLSGGEDGLMCVWSTKKWECLKS  116

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLS+HPSG L  SVG D+ L   +L  GR +F  ++ +   I++++  G  
Sbjct  117   IKAHKGHVTSLSVHPSGKLALSVGTDKTLRTWNLINGRSAFIKNIKQNAHIVRWSPDGDR  176

Query  859   LYMVMDEKVSV--LELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
                V+++KV +  LE      TV    N KR+         IL   G+D ++   D    
Sbjct  177   YVAVINDKVDIYKLETASVTGTV---TNPKRISSLKFLNNSILAVAGDDESVRLCDVDKA  233

Query  1033  KVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEK---PNP  1203
             +       AH  RVK +   S  D  Y  LV +AS+DG I +W + +    KEK   P  
Sbjct  234   EWVCEF-KAHETRVKAVDSFSMED--YCVLV-TASNDGFIKMWKIHL----KEKLESPTL  285

Query  1204  LAMANTKSRLTCLA  1245
             L   NT +RLTCLA
Sbjct  286   LGEVNTSARLTCLA  299



>emb|CCM02642.1| predicted protein [Fibroporia radiculosa]
Length=443

 Score =   129 bits (324),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 104/338 (31%), Positives = 180/338 (53%), Gaps = 43/338 (13%)
 Frame = +1

Query  319   SMSLIAGSYDHFIWGYKLKSPKD--LQNLDLIPLFSFPSHLSTIKCadvsgsv---avsg  483
             +  ++AGSY+  ++G +  S  +       L P+F FP+HLS+++    S        +G
Sbjct  64    AFKIVAGSYEKLLYGLEASSSVEGLSYKFSLKPVFIFPAHLSSVRAIAASPQGGKWLATG  123

Query  484   gsddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDP  660
               D+ IK++DL    EIG L +   +I  L F   PS S   +L+SA+++G++ ++H   
Sbjct  124   SGDEIIKVWDLRRRKEIGGLMQHEGSITHLEF---PSRS---HLLSASEDGTICLFHARD  177

Query  661   FVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKF  840
             +  L+ +K H+  +NSL++HPSG +  SVG+D+ L M DL RG+ S    LGKE  ++++
Sbjct  178   WAVLRVLKGHKGRVNSLAVHPSGKVALSVGKDKTLRMWDLMRGKGSASTKLGKEAEVVRW  237

Query  841   NETGKTLYMVMDEK--------VSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGE  996
             +  G +L++V+ +         +++L     P  + +    +RV+    G G +L    E
Sbjct  238   SIDG-SLFVVLSQSTMDIYSIDMTLLHSITHPSRLHDVRFCRRVV----GNGEVLLVAAE  292

Query  997   DRNITAWDTKSGK------VAHRIDDAHSARVKGIVVLSNN------DGEYPYLVASASS  1140
             D+ ++ +D  S K      +A  I   H+ RVK + VLS +         +  LV++ SS
Sbjct  293   DKKVSVYDVSSDKTVIPNIIAEMI--GHTNRVKAVEVLSVSLPTAYTIRSWTTLVSTISS  350

Query  1141  DGNICVWD---VRMGMGGKEKPNPLAMANTK-SRLTCL  1242
             DG + ++D   V +   GK + + +A  +TK SRLTCL
Sbjct  351   DGRVRLYDMASVPVSTEGKIQLDAIAEYDTKGSRLTCL  388



>ref|XP_004555307.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Maylandia zebra]
Length=359

 Score =   127 bits (320),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 98/309 (32%), Positives = 157/309 (51%), Gaps = 15/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + L+AGSY+   +GY++K+  D +       F+  +H +++     S    V+G  D+TI
Sbjct  5     LELVAGSYEQITFGYQVKT--DEKEWTAKAEFTHHAHTASVSAVAASERFVVTGSKDETI  62

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++Y++    E G+L H   TI  L FY         +L+S  ++G + ++ T  +  LK+
Sbjct  63    QVYNMKKRIEHGALLHHDGTITCLEFYGTS------HLLSGGEDGLLCVWSTKKWECLKS  116

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++  G  
Sbjct  117   IKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLINGRSAFIKNIKQNAHIVRWSPDGDR  176

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               +VM++KV++ EL     T     N KR+         IL   G+D  +   D +  K 
Sbjct  177   YVVVMNDKVNIYELETATVTGT-VANPKRIASVNFLNNSILAVAGDDETVRLCDVEKAKW  235

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  RVK   V S N  +Y  +V +AS+DG I +W + +     E P  L   N
Sbjct  236   VCDF-KAHETRVK--TVDSVNVDDYS-VVVTASNDGFIKMWKIHLK-EELEPPTLLGEVN  290

Query  1219  TKSRLTCLA  1245
             T +RLTCLA
Sbjct  291   TSARLTCLA  299



>ref|XP_005924637.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Haplochromis burtoni]
Length=359

 Score =   127 bits (320),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 98/309 (32%), Positives = 157/309 (51%), Gaps = 15/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + L+AGSY+   +GY++K+  D +       F+  +H +++     S    V+G  D+TI
Sbjct  5     LELVAGSYEQITFGYQVKT--DEKEWTAKAEFTHHAHTASVSAVAASERFVVTGSKDETI  62

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++Y++    E G+L H   TI  L FY         +L+S  ++G + ++ T  +  LK+
Sbjct  63    QVYNMKKRIEHGALLHHDGTITCLEFYGTS------HLLSGGEDGLLCVWSTKKWECLKS  116

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++  G  
Sbjct  117   IKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLINGRSAFIKNIKQNAHIVRWSPDGDR  176

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               +VM++KV++ EL     T     N KR+         IL   G+D  +   D +  K 
Sbjct  177   YVVVMNDKVNIYELETATVTGT-VANPKRIASVNFLNNSILAVAGDDETVRLCDVEKAKW  235

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  RVK   V S N  +Y  +V +AS+DG I +W + +     E P  L   N
Sbjct  236   VCDF-KAHETRVK--TVDSVNVDDYS-VVVTASNDGFIKMWKIHLK-EELEPPTLLGEVN  290

Query  1219  TKSRLTCLA  1245
             T +RLTCLA
Sbjct  291   TSARLTCLA  299



>ref|XP_007401103.1| hypothetical protein PHACADRAFT_32944 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM50100.1| hypothetical protein PHACADRAFT_32944 [Phanerochaete carnosa 
HHB-10118-sp]
Length=489

 Score =   129 bits (324),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 104/340 (31%), Positives = 177/340 (52%), Gaps = 39/340 (11%)
 Frame = +1

Query  319   SMSLIAGSYDHFIWGYK--LKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             S  ++AGSY+  ++G +  +          L P+F FP+H+S++K    S +      + 
Sbjct  88    SFKIMAGSYEKLLYGLEGTVSVEGSSHQFHLKPIFIFPAHISSVKAVAASPNGGKWLATG  147

Query  493   dT---IKIYDLSTCSEIGSL--HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTD  657
              +   IK++DL    E+G L  HE+  + S+     PS S   +L+SA+++G++ I+H  
Sbjct  148   SSDEIIKVWDLRRRKEVGGLMHHEAYLLGSITHLAFPSRS---HLVSASEDGTLCIFHAR  204

Query  658   PFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILK  837
              +  L+T+K H+  +N +++HPSG    SVG+D  L M DL RG+ S    LGKE  +++
Sbjct  205   DWTVLRTLKGHKGRVNCVAVHPSGKAALSVGKDRTLRMWDLMRGKGSASTKLGKEGELVR  264

Query  838   FNETGKTLYMVMDEKVSVLELGYCPRTVLE-FNNAKRV----LCA-APGEGGILFTGGED  999
             ++ TG TL++V  + +S L++      ++    +  R+     C    GEG +L    ED
Sbjct  265   WS-TGGTLFVV--QTMSTLDIYTTDMNMIHTVQHRSRIHDIKFCKRVEGEGELLLVAAED  321

Query  1000  RNITAWDTKSGK------VAHRIDDAHSARVKGI----VVLSNNDGEY---PYLVASASS  1140
             + ++ ++  + +      +AH +   H  RVK I    V L    G +     LV + SS
Sbjct  322   KKVSVYEIPADREQTPRIIAHFV--GHENRVKAIDALAVALPPASGTHRTSTTLVGTISS  379

Query  1141  DGNICVWDV-RMGMGGKEKP---NPLAMANTK-SRLTCLA  1245
             DG I V+D+  M +   E P   +PL   ++K SRLTC+A
Sbjct  380   DGKIRVYDLASMPVEAAEAPAELHPLTEYDSKGSRLTCMA  419



>ref|XP_009085014.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Serinus canaria]
Length=368

 Score =   127 bits (320),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 98/309 (32%), Positives = 159/309 (51%), Gaps = 16/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M L+AG Y+  + G+   + +  Q+  ++P F+  +H +++    V+    V+G  D+TI
Sbjct  1     MELVAGCYEQVLLGF---ATRPGQSWTVVPDFTHHAHTASLSAVAVNNRYVVTGSRDETI  57

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             +IYD+    E G+L   + TI SL FY         +L+S A++G + I++T  +  LK+
Sbjct  58    QIYDMKKKIEHGALLQHNGTITSLEFYGTA------HLLSGAEDGLICIWNTKRWECLKS  111

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++  G+ 
Sbjct  112   IKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGEK  171

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
                V+  KV +  L     T       KR+         IL   G+D  I  +   S K 
Sbjct  172   YVTVIANKVDIYRLDTASITGT-ITTEKRISSLRFITDSILAIAGDDEMIRFYSCDSQKC  230

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  R+K I      + E  +++ +ASSDG I +W++ +    ++ P+ L   N
Sbjct  231   LCEF-KAHENRIKDIYSF---EREGQHVIVTASSDGYIKMWNLDLD-KIRDGPSLLCEVN  285

Query  1219  TKSRLTCLA  1245
             TK+RLTCLA
Sbjct  286   TKARLTCLA  294



>ref|XP_006792371.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Neolamprologus brichardi]
Length=359

 Score =   127 bits (319),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 98/309 (32%), Positives = 157/309 (51%), Gaps = 15/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + L+AGSY+   +GY++K+  D +       F+  +H +++     S    V+G  D+TI
Sbjct  5     LELVAGSYEQITFGYQVKT--DEKEWTAKAEFTHHAHTASVSAVAASERFVVTGSKDETI  62

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++Y++    E G+L H   TI  L FY         +L+S  ++G + ++ T  +  LK+
Sbjct  63    QVYNMKKRIEHGALLHHDGTITCLEFYGTS------HLLSGGEDGLLCVWSTKKWECLKS  116

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++  G  
Sbjct  117   IKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLINGRSAFIKNIKQNAHIVRWSPDGDR  176

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               +VM++KV++ EL     T     N KR+         IL   G+D  +   D +  K 
Sbjct  177   YVVVMNDKVNIYELETATVTGT-VANPKRIASVNFLNNSILAVAGDDETVRLCDVEKAKW  235

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  RVK   V S N  +Y  +V +AS+DG I +W + +     E P  L   N
Sbjct  236   VCDF-KAHETRVK--TVDSVNVDDYS-VVVTASNDGFIKMWKIHLK-EELEPPTLLGEVN  290

Query  1219  TKSRLTCLA  1245
             T +RLTCLA
Sbjct  291   TSARLTCLA  299



>ref|XP_006262038.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Alligator mississippiensis]
Length=366

 Score =   127 bits (320),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 92/309 (30%), Positives = 162/309 (52%), Gaps = 16/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M L++G Y+  ++G+ ++     +N   +P F+  +H +++    V+    V+G  D+TI
Sbjct  1     MELVSGCYEQVLFGFAVRPA---ENWTAVPDFTHHAHTASLSAVAVNNRYVVTGSRDETI  57

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             +IYD+    E G+L   + T+  L FY         +L+S A++G + I++T  +  LK+
Sbjct  58    QIYDMKKKIEYGALLQHNGTVTCLEFYGNA------HLLSGAEDGLIYIWNTKKWECLKS  111

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++ +G+ 
Sbjct  112   IKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPSGEK  171

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               +V+  K+ V +L      +   +  KR+         +L   G+D  +  ++ +S K 
Sbjct  172   YVVVISNKMDVYKLD-TASIIGTISTEKRISSVRFITDSVLAIAGDDEVVRLYNCESQKC  230

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  R+K I      + E   ++ +ASSDG I +W + +    ++ P+ L   N
Sbjct  231   LCEF-KAHENRIKDIYSF---EREGQQVMVTASSDGYIKMWSLNLN-KIQDAPSLLCEVN  285

Query  1219  TKSRLTCLA  1245
             TK+RLTCLA
Sbjct  286   TKARLTCLA  294



>gb|AAH49528.2| Zgc:56683 [Danio rerio]
Length=368

 Score =   127 bits (320),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 92/308 (30%), Positives = 157/308 (51%), Gaps = 16/308 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + L+AG Y+  ++GY++  P D +   + P F+  +H +++     S     +G  D+TI
Sbjct  12    IELVAGCYEQIVFGYRV-CPAD-EEWTIEPTFTHHAHTASLNAVSSSNQFIATGSKDETI  69

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++ D+   +E G+L H   TI+ L FY         +L+S   +G + ++ T  +  LKT
Sbjct  70    QLCDMCKKTEHGALLHHDGTISCLEFYGTS------HLLSGGQDGLICVWSTKKWECLKT  123

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             ++ H+  + SLS+HPSG L  SVG D+ L   +L  GR +F  ++ +   I+ ++  G  
Sbjct  124   IRAHKGQVTSLSVHPSGKLALSVGTDKTLRTWNLIEGRSAFIKNIKQNAEIVLWSPDGDK  183

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               +V+++KV +  L      +      KR+ C    +  +L  GG+D ++  +D  S K 
Sbjct  184   YAVVVNDKVDIYTLDS-ATIIGTIAFTKRISCLKFLKNSLLAVGGDDESVRIYDVTSQKC  242

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  RVK I     +D  +  LV +AS+DG I +W  ++ +   E P  L   N
Sbjct  243   VCEF-KAHENRVKAIESFMKDD--FCVLV-TASNDGFIKLW--KLNLESIESPTLLGQLN  296

Query  1219  TKSRLTCL  1242
             T +RLTCL
Sbjct  297   TTARLTCL  304



>ref|XP_006025506.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Alligator sinensis]
Length=368

 Score =   127 bits (318),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 91/309 (29%), Positives = 162/309 (52%), Gaps = 16/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M L++G Y+  ++G+ ++     +N   +P F+  +H +++    V+    V+G  D+TI
Sbjct  1     MELVSGCYEQVLFGFAVRPA---ENWTAVPDFTHHAHTASLSAVAVNNRYVVTGSRDETI  57

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             +IYD+    E G+L   + T+  L FY         +L+S A++G + I++T  +  LK+
Sbjct  58    QIYDMKKKIEYGALLQHNGTVTCLEFYGNA------HLLSGAEDGLIYIWNTKKWECLKS  111

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++ +G+ 
Sbjct  112   IKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPSGEK  171

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               +V+  K+ + +L      +   +  KR+         +L   G+D  +  ++ +S K 
Sbjct  172   YVVVISNKMDIYKLD-TASIIGTISTEKRISSVRFITDSVLAIAGDDEVVRLYNCESQKC  230

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  R+K I      + E   ++ +ASSDG I +W + +    ++ P+ L   N
Sbjct  231   LCEF-KAHENRIKDIYSF---EREGQQVMVTASSDGYIKMWSLNLN-KIQDAPSLLCEVN  285

Query  1219  TKSRLTCLA  1245
             TK+RLTCLA
Sbjct  286   TKARLTCLA  294



>ref|XP_005041622.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Ficedula albicollis]
Length=368

 Score =   127 bits (318),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 98/309 (32%), Positives = 158/309 (51%), Gaps = 16/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M L+AG Y+  + G+   + +  Q+  ++P F+  +H +++    V+    V+G  D+TI
Sbjct  1     MELVAGCYEQVLLGF---ATRPGQSWTVVPDFTHHAHSASLSAVAVNNRFVVTGSRDETI  57

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             +IYD+    E G+L   + TI  L FY         +L+S A++G + I++T  +  LK+
Sbjct  58    QIYDMKKKIEHGALIQHNGTITCLEFYGTA------HLLSGAEDGLICIWNTKRWECLKS  111

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++  G+ 
Sbjct  112   IKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGEK  171

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
                V+  KV +  L     T       KR+         IL   G+D  I  +   S K 
Sbjct  172   YVTVITNKVDIYRLDTASITGT-ITTEKRISSLRFITDSILVIAGDDEMIRFYSCDSQKC  230

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  R+K I      + E  +++ +ASSDG I +W++ +    K+ P+ L   N
Sbjct  231   LCEF-KAHENRIKDIYSF---EREGQHVIVTASSDGYIKMWNLDLD-KIKDGPSLLCEVN  285

Query  1219  TKSRLTCLA  1245
             TK+RLTCLA
Sbjct  286   TKARLTCLA  294



>ref|NP_001089472.1| uncharacterized protein LOC734523 [Xenopus laevis]
 gb|AAH97669.1| MGC114939 protein [Xenopus laevis]
Length=369

 Score =   126 bits (317),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 96/314 (31%), Positives = 163/314 (52%), Gaps = 19/314 (6%)
 Frame = +1

Query  316   KSMSLIAGSYDHFIWGYK--LKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             +S+ L+ G Y+  ++GY+  L+  + L + D    F+  +H +++     S     +G  
Sbjct  3     ESIELLVGCYEQVLFGYRVHLEGEQWLSSAD----FTHHAHTASLSVVAASNRFVATGSR  58

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI+IYD+    E G+L H + TI  L FY         +L+S A++G + +++T  + 
Sbjct  59    DETIQIYDMKKKVEHGALQHHNGTITCLEFYGNT------HLLSGAEDGLICVWNTKKWE  112

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
               +T K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  ++ K   I++++ 
Sbjct  113   CRQTFKAHKGQVLSLSIHPSGKLALSVGTDKTLRTWNLVEGRAAFIKNIKKNAHIVQWSP  172

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G    +V+ +KV V +L      V   NN KR+         ++   G++  I  +DT 
Sbjct  173   SGDKYVVVIHDKVDVYQLETAA-VVGTINNPKRISSVQFVTDALIAVAGDEEVIRLYDTA  231

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             S K      +AH  RVK + V    + E  ++V S+SSDG + +W + M    +  P+ L
Sbjct  232   SQKCICEF-EAHENRVKNLHVF---ELEGAHIVVSSSSDGYVKMWKIDME-KVQTPPSLL  286

Query  1207  AMANTKSRLTCLAG  1248
                +T +RLTCL+ 
Sbjct  287   CEVSTSARLTCLSA  300



>ref|XP_003975403.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Takifugu rubripes]
Length=356

 Score =   126 bits (317),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 95/309 (31%), Positives = 157/309 (51%), Gaps = 16/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + L+AGSY+   +GY++K+  D +       F+  +H + I     S    V+G +D+TI
Sbjct  5     LELVAGSYEQITFGYRVKT--DDKEWTPKADFTHHAHTAAITTVAASERFVVTGSNDETI  62

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YD+    E G+L H + TI  L FY         +L+S   +G V +++T  +  LK+
Sbjct  63    QLYDMKKRVEHGALLHHNGTITCLEFYGSS------HLLSGGQDGLVCVWNTKKWQCLKS  116

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             ++ H+  + SLS+HPSG L  +VG D+ L   +L  GR +F  ++ +   I++++  G  
Sbjct  117   IRAHKGSVMSLSVHPSGKLALTVGTDQTLRTWNLINGRSAFIKNIKQNSHIVRWSPDGDK  176

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               +V+D++V + EL     T     N KR+         IL   G+D ++   D    K+
Sbjct  177   YAVVIDDRVDIYELETASVTAT-ITNPKRISSLQFLNNSILAIAGDDESVRLHDMSEKKM  235

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  RVK +      D  Y  +V +AS+DG I +W  ++ +   E P  L   N
Sbjct  236   VCEF-KAHETRVKAMDSFVMED--YCVMV-TASNDGLIKMW--KLHLKELETPTLLGEVN  289

Query  1219  TKSRLTCLA  1245
             T +RLTCLA
Sbjct  290   TSARLTCLA  298



>ref|NP_001232513.1| putative PAK1 interacting protein 1 variant 1 [Taeniopygia guttata]
 gb|ACH43987.1| putative PAK1 interacting protein 1 variant 1 [Taeniopygia guttata]
Length=368

 Score =   126 bits (316),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 99/309 (32%), Positives = 155/309 (50%), Gaps = 16/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M L+AG Y+  + G+  +     Q+  ++P F+  +H +++    V+    V+G  D+TI
Sbjct  1     MELVAGCYEQVLLGFATRPG---QSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETI  57

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             +IYD+    E G+L H + TI  L FY         +L+S A++G + I++T  +  LK+
Sbjct  58    QIYDMKKEEEHGALLHHNGTITCLEFYGTA------HLLSGAEDGLICIWNTKRWECLKS  111

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H   + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++  G+ 
Sbjct  112   IKAHGGRVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGEK  171

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
                V+  KV +  L     T       KR+         IL   G+D  I  +   S K 
Sbjct  172   YVTVITNKVDIYRLDTASITGT-ITTEKRISSLRFITDSILAIAGDDEMIRFYSCDSQKC  230

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  R+K I      + E   ++ +ASSDG I +W++      K+ P+ L   N
Sbjct  231   LCEF-KAHENRIKDIFSF---EREGQQVIVTASSDGYIKMWNLDFDK-IKDGPSLLCEVN  285

Query  1219  TKSRLTCLA  1245
             TK+RLTCLA
Sbjct  286   TKARLTCLA  294



>gb|EPZ32847.1| hypothetical protein O9G_004894 [Rozella allomycis CSF55]
Length=305

 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 103/318 (32%), Positives = 163/318 (51%), Gaps = 31/318 (10%)
 Frame = +1

Query  328   LIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKI  507
             +IAGSY+  ++G K +      N DL P F  PSH + + C         SG +D+TI+I
Sbjct  6     VIAGSYERLLYGLKYEEG----NTDLTPSFIMPSHTNMVSCVSAGSRYLASGSTDETIRI  61

Query  508   YDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVK  684
             YDL T  E+GSL +   +I SLAFY         +L+SA+D+G + ++ T+ +  LK+ K
Sbjct  62    YDLKTKKELGSLFQHDNSIRSLAFYENT------HLLSASDDGKICLFRTNDWECLKSFK  115

Query  685   VHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLY  864
              H   + SLSIHPSG L  S+G+D+ + + +L     +    L +    + +N++G +LY
Sbjct  116   DHSGPVLSLSIHPSGRLALSIGKDKKMCIWNLMNASLAKSIKLQQVFEKVHWNQSG-SLY  174

Query  865   MVMDE---KVSVLELGYCPRTVLEFNNAKRVL-CAAPGEGGILFTGGEDRNITAWDTKSG  1032
             +++ E   +V  +E   C   V E+    +V  C   GE  I+F GGED  +   D  + 
Sbjct  175   ILVSENFFRVFSIEPNTC---VFEYKPHTKVYACRFVGERHIVF-GGEDSELYLLDIDNE  230

Query  1033  KVAHRIDD-AHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPN--P  1203
                 +++    S RVK I V+    G Y   +++  S G + VW        K+  N  P
Sbjct  231   GSMKKLESFPDSRRVKDIDVIYTTSGTY---ISAVYSSGTVGVWSC-----PKDSQNFTP  282

Query  1204  LAMANTKSRLTCLAGSSI  1257
              A+  +K RLTC+  S +
Sbjct  283   SAVYQSKCRLTCVTTSHV  300



>ref|XP_007567454.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Poecilia formosa]
Length=361

 Score =   125 bits (315),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 95/312 (30%), Positives = 159/312 (51%), Gaps = 21/312 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + LIAGSY+   +GY++K+  +  +    P F+  +H +++     S    V+G  D+TI
Sbjct  5     LELIAGSYEQITFGYRVKTEGN--DWTAKPDFTHHAHTASVSAVAASERFVVTGSKDETI  62

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YD+   +E G+L H   TI  L FY         +L+S  ++G + ++ T  +  + T
Sbjct  63    QLYDMKKRTEHGALLHHEGTITCLEFYGSS------HLLSGGEDGLLCVWSTKKWECMTT  116

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLS+HPSG L  SVG D+ L   +L  GR +F  ++ +   I++++  G  
Sbjct  117   IKAHKGHVTSLSVHPSGKLALSVGTDKTLRTWNLINGRSAFIKNIKQNAHIVRWSPDGDR  176

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               +V+D+K+ + +L     T     N KR+         +L   G+D  +   D +  K 
Sbjct  177   YVVVVDDKIDIYKLETASVTGT-ITNPKRISSVKFLNNSVLAIAGDDETVRFCDVEKAKW  235

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNP---LA  1209
                   AH  RVK +  L  +D  Y  L+ +AS+DG I +W + +    KE+  P   L 
Sbjct  236   VCEF-KAHETRVKAVDSLIVDD--YCVLL-TASNDGYIKMWKLHL----KEELEPPVLLG  287

Query  1210  MANTKSRLTCLA  1245
               NT +RLTCLA
Sbjct  288   EVNTTARLTCLA  299



>ref|XP_009896406.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Picoides pubescens]
Length=367

 Score =   125 bits (313),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 158/309 (51%), Gaps = 16/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M L+AG Y+  ++G+   + +  +   ++P F+  +H +++    V+    V+G  D+TI
Sbjct  1     MELVAGCYEQVLFGF---TTRPTEPWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETI  57

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             +IYD+    E G+L   + TI  L FY         +L+S A++G + I++T  +  LK+
Sbjct  58    QIYDMKKKVEHGALLQHNGTITCLEFYGTA------HLLSGAEDGLICIWNTKRWECLKS  111

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++  G+ 
Sbjct  112   IKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGER  171

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
                V+  KV + +L     T       KR+         I+   G+D  +  +   S K 
Sbjct  172   YVTVITNKVDIYKLDTASITGT-ITTEKRISSLRFITDSIIAIAGDDEIVRFYSCDSQKC  230

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  RVK I      + E  +++ +ASSDG I +W++ +     E P+ L   N
Sbjct  231   LCEF-KAHENRVKDIYSF---EREGKHIIVTASSDGYIKMWNLDLNKIEDE-PSLLCEVN  285

Query  1219  TKSRLTCLA  1245
             TK+RLTCLA
Sbjct  286   TKARLTCLA  294



>gb|EXX51928.1| Mak11p [Rhizophagus irregularis DAOM 197198w]
Length=412

 Score =   125 bits (314),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 103/337 (31%), Positives = 170/337 (50%), Gaps = 33/337 (10%)
 Frame = +1

Query  316   KSMSLIAGSYDHFIWGYKL-------KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsva  474
             K   +IAGSY+  ++G           S  D  +L L P+F F +H   IK   V G   
Sbjct  68    KDFLIIAGSYERILYGIDAHWIKSGESSDDDDFSLKLDPIFVFSAHTGCIKTVSVGGKFL  127

Query  475   vsggsddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYH  651
              SG +D+ IK+Y+L    E+GSL     +I ++ F+         ++ S +++G++ I+ 
Sbjct  128   ASGSTDEVIKLYNLRKRKELGSLLQHEGSITTIQFFNKT------HMFSGSEDGTICIWR  181

Query  652   TDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSI  831
             T  +  LKT+K H+  +NSL++HPSG +  SV  D+ + + +L  G+++    LG+E  I
Sbjct  182   TKDWECLKTLKGHKGRVNSLAVHPSGKIALSVSNDKTVRLWNLLAGQKASVNKLGREGEI  241

Query  832   LKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAK-RVLCAAPGE----GGILFTGGE  996
             + +N +G+   ++M  ++ +       + +  F +   R LC    E    G +L  G E
Sbjct  242   ILWNSSGEQYAILMAREIEIYSTSDA-QILQRFQSGNSRFLCMQYYEHEHLGDLLIVGSE  300

Query  997   DRNITAWDTKSGKVAHRIDDAHSARVKGIVVLS----NNDGEYPYLVASASSDGNICVWD  1164
             D+ I  ++ KSG     +   H  R+K I ++     NN   +  L++S SSDG I VW+
Sbjct  301   DKAIRVYEVKSGNCLITL-LGHKNRIKDISIIQSIPPNNSAPFT-LLSSISSDGVINVWN  358

Query  1165  VRMGM--GGKEKPN-----PLAMANTKSRLTCLAGSS  1254
             +   +    KE  N     PLA  +TKSRLTC+  S 
Sbjct  359   LNKVLPHNYKEGNNPIFNLPLATYDTKSRLTCVVLSQ  395



>ref|XP_005802049.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Xiphophorus maculatus]
Length=359

 Score =   124 bits (310),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 93/309 (30%), Positives = 159/309 (51%), Gaps = 16/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + LIAGSY+   +GY++K+ ++  +    P F+  +H +++     S    V+G  D+TI
Sbjct  5     LELIAGSYEQITFGYRVKTGEN--DWTAKPDFTHHAHTASVSAVAASERFVVTGSKDETI  62

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YD+   +E G+L H   TI+ L FY         +L+S  ++G + ++ T  +  + T
Sbjct  63    QLYDMKKRTEHGALLHHEGTISCLEFYGTS------HLLSGGEDGLLCVWSTKKWECMTT  116

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLS+HPSG L  SVG D+ L   +L  GR +F  ++ +   I++++  G  
Sbjct  117   IKAHKGHVTSLSVHPSGKLALSVGTDKTLRTWNLINGRSAFIKNIKQNAHIVRWSPDGDR  176

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               +V+++K+ + +L     T     N KR+          L   G+D  +   D +  K 
Sbjct  177   YVVVVNDKIDIYKLETASVTGT-IANPKRISSVKFLNNSFLAVAGDDETVRFCDVEKAKW  235

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  RVK +  L  +D  Y  L+ +AS+DG I +W  ++ +   E P  L   N
Sbjct  236   VCE-SKAHETRVKAVDSLMVDD--YCVLL-TASNDGYIKMW--KIHLKELEPPVLLGEVN  289

Query  1219  TKSRLTCLA  1245
             T +RLTCLA
Sbjct  290   TTARLTCLA  298



>ref|XP_005525334.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Pseudopodoces humilis]
Length=368

 Score =   124 bits (310),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 98/309 (32%), Positives = 156/309 (50%), Gaps = 16/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M L+AG Y+  + G+   + +  Q+  + P F+  +H +++    V+    V+G  D+TI
Sbjct  1     MELLAGCYEQVLLGF---ATRPGQSWTVAPDFTHHAHSASLSAVAVNNRYVVTGSRDETI  57

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             +IYD+    E G+L   + TI  L FY         +L+S A++G + I++T  +  LK+
Sbjct  58    QIYDMKKKIEHGALLQHNGTITCLEFYGTA------HLLSGAEDGLICIWNTKRWECLKS  111

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++  G+ 
Sbjct  112   IKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGEK  171

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
                V+  KV +  L     T       KR+         IL   G+D  I  +   S K 
Sbjct  172   YVTVITNKVDIYRLDTASITGT-ITTQKRISSLRFITDSILAIAGDDEIIRFYSCDSQKC  230

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  R+K I      + E  +++ +ASSDG I +W++      K+ P+ L   N
Sbjct  231   LCEF-KAHENRIKAIYSF---EREGQHVIVTASSDGYIKMWNLDFDK-IKDGPSLLCEVN  285

Query  1219  TKSRLTCLA  1245
             TK+RLTCLA
Sbjct  286   TKARLTCLA  294



>ref|XP_003080465.1| transducin family protein / WD-40 repeat family protein (ISS) 
[Ostreococcus tauri]
Length=347

 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 100/322 (31%), Positives = 161/322 (50%), Gaps = 22/322 (7%)
 Frame = +1

Query  325   SLIAGSYDHFIWGYKLKSPKDL-QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             ++IAGSY+ F++GY +       +   L   F+  +HLS++KC   SG  A SGGSDD I
Sbjct  5     TVIAGSYERFVFGYGVHGEGAAGETSRLEKCFTADAHLSSVKCVAASGGFAASGGSDDLI  64

Query  502   KIYDLSTCSEIGSL-----HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHT-DPF  663
             ++Y       +  L     HE   + +LAF+ P   + P  L+S   +GSV ++   D F
Sbjct  65    RVYHCDASGAVADLGVLVGHE-GDVRALAFHAPSGRA-PTRLLSGGADGSVRVWDARDNF  122

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
               +KT++ HR G+ S++ H SG +  + G D  +AM D+ +GR ++ +   + V  L F 
Sbjct  123   NMMKTMRAHRGGVLSIAAHRSGRVALTSGADSHVAMWDMLKGRVAYKFKTPERVERLTFT  182

Query  844   ETGKTLYMVMDEKVSV--LELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAW  1017
             + GK    +  +++SV  +E G   RT   F    + L      G + + G E  ++  +
Sbjct  183   QDGKEYVSLTSKRLSVTDVEAGSIVRT---FATPSKALT-FEARGRVAYVGCEGGDVIVY  238

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLS-----NNDGEYPYLVASASSDGNICVWDVRMGM-  1179
             DT++     +I  AH  RV+G+   S       +   P L+ SA S+G + VWD+R    
Sbjct  239   DTRTEDAVGQIVKAHPQRVRGLAFGSMTLEEAEEDSNPKLLISAGSEGAVRVWDLRTATR  298

Query  1180  GGKEKP-NPLAMANTKSRLTCL  1242
                E P   +   NT +R TCL
Sbjct  299   SSAEAPAESVVEINTGARYTCL  320



>ref|NP_001087421.1| p21-activated protein kinase-interacting protein 1-like [Xenopus 
laevis]
 sp|Q68FJ6.1|PK1IP_XENLA RecName: Full=p21-activated protein kinase-interacting protein 
1-like; AltName: Full=PAK1-interacting protein 1-like [Xenopus 
laevis]
 gb|AAH79760.1| MGC86205 protein [Xenopus laevis]
Length=363

 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 95/314 (30%), Positives = 163/314 (52%), Gaps = 19/314 (6%)
 Frame = +1

Query  316   KSMSLIAGSYDHFIWGYKLKSPKD--LQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             +S+ L+ G Y+  ++GY++    +  L + D    F+  +H +++    V+     +G  
Sbjct  3     ESIKLLVGCYEQVLFGYRVHREGEQWLSSAD----FTHHAHTASVSVLAVNNRFVATGSR  58

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI+IYD+    E G+L H + TI  L FY         +L+S A++G + +++T  + 
Sbjct  59    DETIQIYDMKKKVEHGALLHHNGTITCLEFYGNT------HLLSGAEDGLICVWNTKKWE  112

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
               +T K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  ++ K   I+ ++ 
Sbjct  113   CQQTFKAHKGQVLSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKKNAHIVHWSP  172

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G+   +V+ + V V +L      V   NN KR+  A      ++   G++  I  +DT 
Sbjct  173   SGEKYVVVIHDTVDVYQLETAA-VVGTINNPKRISSAQFITDALIAVAGDEEVIRLYDTA  231

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             S K       AH  RVK + V+   + +  ++V S+SSDG I +W + M    +  P+ L
Sbjct  232   SQKCVCEF-KAHENRVKNLHVI---ELQGTHVVVSSSSDGYIKMWRIDMEK-VQTSPSLL  286

Query  1207  AMANTKSRLTCLAG  1248
                +T +RLTCL+ 
Sbjct  287   CEVSTSARLTCLSA  300



>ref|XP_007864910.1| WD40 repeat-like protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ56136.1| WD40 repeat-like protein [Gloeophyllum trabeum ATCC 11539]
Length=468

 Score =   124 bits (312),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 105/342 (31%), Positives = 171/342 (50%), Gaps = 46/342 (13%)
 Frame = +1

Query  328   LIAGSYDHFIWGYKLKSPKDLQN----LDLIPLFSFPSHLSTIKCadvsgsv---avsgg  486
             L+AGSY+  ++G +  S  D        +L P+F+FP+H+S +K   +S        +G 
Sbjct  80    LVAGSYEKLLYGLEGSSHFDESEGALKYELKPIFAFPAHVSCVKAVSISPEGGKWLATGS  139

Query  487   sddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
             +D+ IK++DL    EIG L H   +I  L F   PS S   +L+SA+++G +S++HT  +
Sbjct  140   ADEIIKVWDLRRRKEIGGLMHHEGSITQLTF---PSRS---HLMSASEDGMLSLFHTRDW  193

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
               L+T+K H+  +NS + HPSG +  SVG+D  L M DL RG+ S    LGKE  I++++
Sbjct  194   AVLRTLKGHKGRVNSFAAHPSGKVALSVGKDRTLRMWDLMRGKGSASVKLGKEGEIVRWS  253

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRV----LCAAPGEGG----ILFTGGED  999
               G    + +   + V         +    +  RV     C  P +G      L  G ED
Sbjct  254   SDGTMFIVQVQNTIDVYATDMS--LLCSITHPSRVQDVKFCKIPVQGDEEREFLLVGAED  311

Query  1000  RNITAWDTKSGK-------VAHRIDDAHSARVKGI----VVLSNNDGEYPYLVA-SASSD  1143
             + ++ +D  S         VA  +   H+ RVK +    + L  + G     +A + SSD
Sbjct  312   KKVSLYDIASASDKQIPAIVAEMV--GHANRVKAVDTIRISLPPSSGRRTTTIAGTVSSD  369

Query  1144  GNICVWDVR--MGMGGKEKPN-----PLAMANTK-SRLTCLA  1245
             G + V+D++  +      + N     P+A  +TK +RLTC+A
Sbjct  370   GKVLVYDLQSSLSQASLNRDNVTVIQPVAEYDTKGTRLTCMA  411



>gb|EIE91549.1| hypothetical protein RO3G_16260 [Rhizopus delemar RA 99-880]
Length=364

 Score =   123 bits (308),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 94/343 (27%), Positives = 167/343 (49%), Gaps = 24/343 (7%)
 Frame = +1

Query  253   EGHSQRYQVL*RTNRESI-------EAGKSMSLIAGSYDHFIWGYKLK-SPKDLQNLDLI  408
             E  +++ Q+L +    S+       +  +   +I G+Y+  ++G     + +    + + 
Sbjct  3     ESQAKKKQILDKVTSSSLLPTTSLLDPEEDFRVIVGTYERLLYGVNATWTDEQKTKVKME  62

Query  409   PLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL--HESATINSLAFYT  582
             P+F  P+H   I+   V G    SG SD+ I++YD+    E GSL  H S  I  + F+ 
Sbjct  63    PVFIIPAHTGCIRTVSVGGHFLASGSSDEIIRLYDVKKRKEYGSLGGHHSGDITDIKFHG  122

Query  583   PPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDEC  762
                      ++SA+D+  ++++ T  + +LKT+K HR  INS++IHP+G +  SV  D  
Sbjct  123   K-------YMLSASDDQKINLWRTKDWEYLKTLKGHRGKINSMAIHPTGKIALSVASDRY  175

Query  763   LAMVDLERGRRSFYYSLGK-EVSILKFNETGKTLYMVMDEKVSVLEL--GYCPRTVLEFN  933
               + +L  GR++    LG+ E  ++ +N  G    ++ ++ V++  +       T+   +
Sbjct  176   AIVWNLMTGRKASVNKLGRDEGLVVLWNSEGDKYAIMFNKAVNIYNVSDAQVSSTISHTS  235

Query  934   NAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEY  1113
                 +      +   + TG ED+ +  W+T SG+    I   H  RVK + VL   D   
Sbjct  236   KFHTMQYFKRQDDEYIVTGHEDKIVRIWNTSSGECIKEI-KGHKLRVKALTVLEYED---  291

Query  1114  PYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCL  1242
               +++S SSDG I  WD+   M  +E+  PL   NTK R TC+
Sbjct  292   KIILSSVSSDGVIKCWDLGQIMDSEEEAEPLGEFNTKCRATCI  334



>ref|NP_001017054.2| p21-activated protein kinase-interacting protein 1 [Xenopus (Silurana) 
tropicalis]
 emb|CAJ83478.1| PAK1 interacting protein 1 [Xenopus (Silurana) tropicalis]
Length=365

 Score =   123 bits (308),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 159/311 (51%), Gaps = 19/311 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKD--LQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsdd  495
             M L+ G Y+  ++GY++    +  L + D    F+  +H +++    V+     +G  D+
Sbjct  5     MELVVGCYEQVLFGYRVHREGEQWLSSAD----FTHHAHTASLSVVAVNNRFVATGSKDE  60

Query  496   TIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHL  672
             TI+IYD+    E G+L H + TI  L FY         +L+S A++G + +++T  +   
Sbjct  61    TIQIYDMKKKVEHGALLHHNGTITCLQFYGNT------HLLSGAEDGLICVWNTKKWECQ  114

Query  673   KTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETG  852
             +T K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  ++ K   I++++ +G
Sbjct  115   QTFKAHKGQVLSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKKNAHIVQWSPSG  174

Query  853   KTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
                 +V+ +KV V +L      +   NN KR+         ++   G++  I  +DT S 
Sbjct  175   DKYVVVIHDKVDVYQLETAA-VIGTINNPKRISSVQFITDALIAVAGDEEVIRLYDTASQ  233

Query  1033  KVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAM  1212
             K       AH  RVK + V    + E  ++V S+SSDG + +W +      K  P+ L  
Sbjct  234   KCVCEF-KAHENRVKNLHVF---ELEETHIVVSSSSDGFVKMWGIDTE-KVKTPPSLLCE  288

Query  1213  ANTKSRLTCLA  1245
              +T +RLTCL+
Sbjct  289   VSTSARLTCLS  299



>gb|KFV65477.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Picoides pubescens]
Length=364

 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 95/307 (31%), Positives = 157/307 (51%), Gaps = 16/307 (5%)
 Frame = +1

Query  328   LIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKI  507
             L+AG Y+  ++G+   + +  +   ++P F+  +H +++    V+    V+G  D+TI+I
Sbjct  1     LVAGCYEQVLFGF---TTRPTEPWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQI  57

Query  508   YDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVK  684
             YD+    E G+L   + TI  L FY         +L+S A++G + I++T  +  LK++K
Sbjct  58    YDMKKKVEHGALLQHNGTITCLEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIK  111

Query  685   VHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLY  864
              H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++  G+   
Sbjct  112   AHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYV  171

Query  865   MVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAH  1044
              V+  KV + +L     T       KR+         I+   G+D  +  +   S K   
Sbjct  172   TVITNKVDIYKLDTASITGT-ITTEKRISSLRFITDSIIAIAGDDEIVRFYSCDSQKCLC  230

Query  1045  RIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTK  1224
                 AH  RVK I      + E  +++ +ASSDG I +W++ +     E P+ L   NTK
Sbjct  231   EF-KAHENRVKDIYSF---EREGKHIIVTASSDGYIKMWNLDLNKIEDE-PSLLCEVNTK  285

Query  1225  SRLTCLA  1245
             +RLTCLA
Sbjct  286   ARLTCLA  292



>gb|EOB02145.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Anas platyrhynchos]
Length=299

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 93/287 (32%), Positives = 146/287 (51%), Gaps = 13/287 (5%)
 Frame = +1

Query  388   LQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATIN  564
             LQ   ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI 
Sbjct  2     LQPWTVVPDFTHHAHTASLSAVAVNNRYVVTGSRDETIQIYDMKKKVEHGALLQHNGTIT  61

Query  565   SLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCS  744
              L FY         +L+S A++G + I++T  +  LK++K H+  + S+SIHPSG L  S
Sbjct  62    CLEFYGTS------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSISIHPSGKLALS  115

Query  745   VGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVL  924
             VG D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV +  L     T  
Sbjct  116   VGTDKTLRTWNLVEGRPAFIKNLKQNAHIIKWSPDGERYVTVISNKVDIYRLDTASITG-  174

Query  925   EFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNND  1104
                  KR+         IL   G+D  +  +   S K       AH  R+K I      +
Sbjct  175   TITTEKRISSLRFITDSILAIAGDDETVRFYSCDSQKCLCEF-KAHENRIKDIYSF---E  230

Query  1105  GEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
              E  +L+ +ASSDG I VW++ +    K+ P+ L   NTK+RLTCLA
Sbjct  231   REGQHLIVTASSDGYIKVWNLDLNK-IKDAPSLLCEVNTKARLTCLA  276



>ref|XP_005149948.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Melopsittacus undulatus]
Length=368

 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 94/309 (30%), Positives = 158/309 (51%), Gaps = 16/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M L+AG Y+  ++G+ ++     ++  + P F+  +H +++    V+    V+G  D+TI
Sbjct  1     MELVAGCYEQVLFGFAVRPT---ESWTVAPDFTHHAHTASLSAVAVNNRYVVTGSKDETI  57

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             +IYD+    E G+L   + T+  L FY         +L+S A++G + I++T  +  LK+
Sbjct  58    QIYDMRKKVEHGALLQHNGTVTCLEFYGTA------HLLSGAEDGVICIWNTKRWECLKS  111

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I++++  G+ 
Sbjct  112   IKAHKGHVTSLSIHPSGKLCLSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIRWSPDGEK  171

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
                V+  KV + +L     T       KR+         IL   G D  +  +   S + 
Sbjct  172   YVTVITNKVDIYKLDTASITGT-ITTEKRISSLRFITDSILAIAGGDEIVRFYSCDSQEC  230

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  R+K I      + E  +++A+A SDG I +W++ +    KE P+ L   N
Sbjct  231   LCEF-KAHENRIKDIYSF---EREGQHIIATACSDGYIKMWNLDLNK-IKEVPSLLCEVN  285

Query  1219  TKSRLTCLA  1245
             TK+RLTCLA
Sbjct  286   TKARLTCLA  294



>ref|XP_010571498.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X1 [Haliaeetus leucocephalus]
Length=379

 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 95/296 (32%), Positives = 153/296 (52%), Gaps = 13/296 (4%)
 Frame = +1

Query  361   GYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGS  540
             G K ++P  L +  ++P+F+  +H +++    V+    V+G  D+TI+IYD+    E G+
Sbjct  22    GGKRENPPSLSSWTVVPVFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGA  81

Query  541   L-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSI  717
             L   + TI  L FY         +L+S A++G + I++T  +  LK++K H+  + SLSI
Sbjct  82    LLQHNGTITCLEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSI  135

Query  718   HPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLE  897
             HPSG L  SVG D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +
Sbjct  136   HPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYK  195

Query  898   LGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVK  1077
             L     T       KR+         IL   G+D  I  +   S K       AH  R+K
Sbjct  196   LDTASITGT-ITTEKRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIK  253

Query  1078  GIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
              I      + E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  254   DIYSF---EREGQHVIVTASSDGYIKMWNLDLNK-IKDVPSLLCEVNTKARLTCLA  305



>gb|ADO28286.1| p21-activated protein kinase-interacting protein 1-like [Ictalurus 
furcatus]
Length=359

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 87/312 (28%), Positives = 158/312 (51%), Gaps = 16/312 (5%)
 Frame = +1

Query  313   GKSMSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             G  + LI GSY+  ++GY++   ++   L+  P+F+  +H++ +     +     +G  D
Sbjct  2     GDEVELIVGSYEQIVFGYRVCPGEEEWRLE--PVFTHHAHVACLSAVAANEQFVATGSKD  59

Query  493   dTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             +TI++Y++ T +E G+L H   TI  L F +        +L+S  ++G + ++ T  +  
Sbjct  60    ETIQLYNMKTRTEHGALLHHGGTILCLEFGSTA------HLLSGGEDGLLCVWSTKTWEC  113

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNET  849
             LK++  H   + SLS+HPSG L  SVG D  L   +L  GR +F  ++ +   I++++  
Sbjct  114   LKSITAHTGHVTSLSLHPSGKLALSVGTDRKLRTWNLIEGRPAFTKNIKQNAQIVRWSPA  173

Query  850   GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKS  1029
             G    +V+++++ +  L      +  F+  KR+ C    +  +L   G+D ++  +D  S
Sbjct  174   GDKYVVVVNDQLDIYNL-ESASIISSFSYRKRISCVRFLKNTLLAVAGDDEHVLVYDLTS  232

Query  1030  GKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLA  1209
              K       AH  RVK +     ND     ++ +AS+DG I +WD       +E    L 
Sbjct  233   EKCICEF-KAHENRVKALDSFEMND---LCVLVTASNDGFIKLWD--FSTERQEAARLLG  286

Query  1210  MANTKSRLTCLA  1245
               NT +RLTCL+
Sbjct  287   QVNTTARLTCLS  298



>ref|XP_009562443.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Cuculus canorus]
Length=368

 Score =   122 bits (306),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 158/309 (51%), Gaps = 16/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M ++AG Y+  ++G+ +      ++  ++P F+  +H +++    V+    V+G  D+TI
Sbjct  1     MEVVAGCYEQVLFGFSVPYR---ESWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETI  57

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             +IYD+    E G+L   + TI  L FY         +L+S A++G + I++T  +  LK+
Sbjct  58    QIYDMKKKIEHGALLQHNGTITCLEFYGTA------HLLSGAEDGLICIWNTKRWECLKS  111

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             ++ H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++  G+ 
Sbjct  112   IRAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGER  171

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
                V+  KV V +L     T       KR+         IL   G+D  I  +   S K 
Sbjct  172   YVTVITNKVDVYKLDTASITGT-IRTEKRISSLRFITDSILAIAGDDEIIRFYSCDSQKC  230

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  R+K I      + E   ++ +ASSDG I +W++ +    K+ P+ L   N
Sbjct  231   LCEF-KAHENRIKDIYSF---EREGQRVIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVN  285

Query  1219  TKSRLTCLA  1245
             TK+RLTCLA
Sbjct  286   TKARLTCLA  294



>ref|XP_008432833.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Poecilia reticulata]
Length=361

 Score =   122 bits (305),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 93/312 (30%), Positives = 159/312 (51%), Gaps = 21/312 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + LIAGSY+   +GY++K+  +  +    P F+  +H +++     S    V+G  D+TI
Sbjct  5     LELIAGSYEQITFGYRVKTGGN--DWTAKPDFTHHAHTASVSAVAASERFVVTGSKDETI  62

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YD+   +E G+L H   TI  L FY         +L+S  ++G + ++ T  +  + +
Sbjct  63    QLYDMQKRTEHGALLHHEGTITCLEFYGSS------HLLSGGEDGLLCVWSTKKWECMTS  116

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLS+HPSG L  SVG D+ L   +L  GR +F  ++ +   I++++  G  
Sbjct  117   IKAHKGHVTSLSVHPSGKLALSVGTDKTLRTWNLINGRSAFIKNIKQNAHIVRWSAXGDR  176

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               +V+D+K+ + +L     T     + KR+         +L   G+D  +   D +  K 
Sbjct  177   YVVVVDDKIDIYKLETASVTGT-IASPKRISSVKFLNNSVLAVAGDDETVRFCDVEKAKW  235

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNP---LA  1209
                   AH  RVK +  L  +D  Y  L+ +AS+DG I +W + +    KE+  P   L 
Sbjct  236   VCEF-KAHETRVKAVDSLIVDD--YCVLL-TASNDGFIKMWKLHL----KEELEPPVLLG  287

Query  1210  MANTKSRLTCLA  1245
               NT +RLTCLA
Sbjct  288   EVNTTARLTCLA  299



>ref|XP_005310026.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X4 [Chrysemys picta bellii]
Length=367

 Score =   122 bits (305),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 160/311 (51%), Gaps = 16/311 (5%)
 Frame = +1

Query  316   KSMSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsdd  495
             + M L+ G Y+  ++G+ ++     +N   IP F+  +H +++    V+    V+G  D+
Sbjct  20    REMELVGGCYEQILFGFAVRPE---ENWTPIPDFTHHAHTASLSAVAVNNRYVVTGSRDE  76

Query  496   TIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHL  672
             TI+IYD+    E G+L H + TI  L FY         +L+S A++G + I+ T  +  L
Sbjct  77    TIQIYDMKKKIEHGALLHHNGTITCLEFYGNA------HLLSGAEDGLICIWDTKKWECL  130

Query  673   KTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETG  852
             K++K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++ +G
Sbjct  131   KSIKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIVKWSPSG  190

Query  853   KTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
             +   +V+  KV V +L     +       KR+         +L   G+D  I  +D  S 
Sbjct  191   EKYVVVVTNKVDVYKLETASVSG-AITTEKRISSVRFITDSVLAIAGDDEVIRLYDCDSQ  249

Query  1033  KVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAM  1212
             K       AH  R+K I        +   ++ +ASSDG I +W + +    +++P+ L  
Sbjct  250   KCLCEF-KAHENRIKDIYSFEKQGLQ---VIVTASSDGYIKLWSLELDK-IQDRPSLLCE  304

Query  1213  ANTKSRLTCLA  1245
              NTK+RLTCLA
Sbjct  305   VNTKARLTCLA  315



>ref|XP_010903862.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Esox lucius]
Length=362

 Score =   122 bits (305),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 91/314 (29%), Positives = 158/314 (50%), Gaps = 20/314 (6%)
 Frame = +1

Query  313   GKSMSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             G  + LIAGSY+   +GY+L + +  +       F+  +H +++     S     +G  D
Sbjct  2     GPVVELIAGSYEQITFGYRLCTSE--EEWTATADFTHHAHTASVSAVATSERYIATGSRD  59

Query  493   dTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             +TI+IYD+    E G+L H   TI+ L FY         +L+S   +G + ++ T  +  
Sbjct  60    ETIQIYDMKKKIEHGALLHHDGTISCLEFYGSS------HLLSGGQDGLLCVWSTKNWEC  113

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNET  849
             LK+++ H+  + SLS+HPSG L  +VG D+ L   +L  GR +F  ++ +   ++K++  
Sbjct  114   LKSIRAHKGQVTSLSVHPSGKLALTVGTDKTLRTWNLIDGRSAFIKNIKQNALLVKWSPP  173

Query  850   GKTLYMVMDEKVSV--LELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDT  1023
             G    +V+++ V V  LE      T++   N KR+         +L   G+D+ +  +D 
Sbjct  174   GDKYVLVVNDHVDVYDLETATVTSTII---NPKRISSIKFLNNSVLAIAGDDQTVRLFDI  230

Query  1024  KSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
              + K+     +AH  RVK +   +  D     +V +AS+DG I +W + +   G   P  
Sbjct  231   NTQKLLCEF-EAHETRVKSVDSFTMED---LCVVVTASNDGFIKLWKLNLETLG--SPQL  284

Query  1204  LAMANTKSRLTCLA  1245
             L   NT +RLTCL+
Sbjct  285   LGKVNTTARLTCLS  298



>ref|XP_005310024.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X1 [Chrysemys picta bellii]
Length=400

 Score =   122 bits (305),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 160/311 (51%), Gaps = 16/311 (5%)
 Frame = +1

Query  316   KSMSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsdd  495
             + M L+ G Y+  ++G+ ++     +N   IP F+  +H +++    V+    V+G  D+
Sbjct  20    REMELVGGCYEQILFGFAVRPE---ENWTPIPDFTHHAHTASLSAVAVNNRYVVTGSRDE  76

Query  496   TIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHL  672
             TI+IYD+    E G+L H + TI  L FY         +L+S A++G + I+ T  +  L
Sbjct  77    TIQIYDMKKKIEHGALLHHNGTITCLEFYGNA------HLLSGAEDGLICIWDTKKWECL  130

Query  673   KTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETG  852
             K++K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++ +G
Sbjct  131   KSIKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIVKWSPSG  190

Query  853   KTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
             +   +V+  KV V +L     +       KR+         +L   G+D  I  +D  S 
Sbjct  191   EKYVVVVTNKVDVYKLETASVSG-AITTEKRISSVRFITDSVLAIAGDDEVIRLYDCDSQ  249

Query  1033  KVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAM  1212
             K       AH  R+K I        +   ++ +ASSDG I +W + +    +++P+ L  
Sbjct  250   KCLCEF-KAHENRIKDIYSFEKQGLQ---VIVTASSDGYIKLWSLELDK-IQDRPSLLCE  304

Query  1213  ANTKSRLTCLA  1245
              NTK+RLTCLA
Sbjct  305   VNTKARLTCLA  315



>ref|XP_005018385.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like, 
partial [Anas platyrhynchos]
Length=363

 Score =   121 bits (304),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 93/290 (32%), Positives = 147/290 (51%), Gaps = 13/290 (4%)
 Frame = +1

Query  379   PKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESA  555
             P  +Q   ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + 
Sbjct  12    PPRIQPWTVVPDFTHHAHTASLSAVAVNNRYVVTGSRDETIQIYDMKKKVEHGALLQHNG  71

Query  556   TINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGL  735
             TI  L FY         +L+S A++G + I++T  +  LK++K H+  + S+SIHPSG L
Sbjct  72    TITCLEFYGTS------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSISIHPSGKL  125

Query  736   VCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPR  915
               SVG D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV +  L     
Sbjct  126   ALSVGTDKTLRTWNLVEGRPAFIKNLKQNAHIIKWSPDGERYVTVISNKVDIYRLDTASI  185

Query  916   TVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLS  1095
             T       KR+         IL   G+D  +  +   S K       AH  R+K I    
Sbjct  186   TGT-ITTEKRISSLRFITDSILAIAGDDETVRFYSCDSQKCLCEF-KAHENRIKDIYSF-  242

Query  1096  NNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
               + E  +L+ +ASSDG I VW++ +    K+ P+ L   NTK+RLTCLA
Sbjct  243   --EREGQHLIVTASSDGYIKVWNLDLN-KIKDAPSLLCEVNTKARLTCLA  289



>gb|AAI35558.1| pak1ip1 protein [Xenopus (Silurana) tropicalis]
Length=365

 Score =   121 bits (304),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 93/311 (30%), Positives = 158/311 (51%), Gaps = 19/311 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKD--LQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsdd  495
             M L+ G Y+  ++GY++    +  L + D    F+  +H +++    V+     +G  D+
Sbjct  5     MELVVGCYEQVLFGYRVHREGEQWLSSAD----FTHHAHTASLSVVAVNNRFVATGSKDE  60

Query  496   TIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHL  672
             TI+IYD+    E G+L H + TI  L FY         +L+S A++G + +++T  +   
Sbjct  61    TIQIYDMKKKVEHGALLHHNGTITCLQFYGNT------HLLSGAEDGLICVWNTKKWECQ  114

Query  673   KTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETG  852
             +T K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  ++ K   I++++ +G
Sbjct  115   QTFKAHKGQVLSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKKNAHIVQWSPSG  174

Query  853   KTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
                 +V+ +KV V +L      +   NN KR+         ++   G++  I  +DT S 
Sbjct  175   DKYVVVIHDKVDVYQLETAA-VIGTINNPKRISSVQFITDALIAVAGDEEVIRLYDTASQ  233

Query  1033  KVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAM  1212
             K       AH  RVK + V    + E  ++V S+SSDG + +W +      K  P+    
Sbjct  234   KCVCEF-KAHENRVKNLHVF---ELEETHIVVSSSSDGFVKMWGIDTE-KVKTPPSLFCE  288

Query  1213  ANTKSRLTCLA  1245
              +T +RLTCL+
Sbjct  289   VSTSARLTCLS  299



>ref|XP_007850380.1| p21-activated protein kinase-interacting protein 1-like [Moniliophthora 
roreri MCA 2997]
 gb|ESK90346.1| p21-activated protein kinase-interacting protein 1-like [Moniliophthora 
roreri MCA 2997]
Length=491

 Score =   122 bits (307),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 106/348 (30%), Positives = 178/348 (51%), Gaps = 51/348 (15%)
 Frame = +1

Query  307   EAGKSMSLIAGSYDHFIWGYK-----LKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsv  471
             +A K   +IAGSY+  ++G +      K   ++Q  DL P+F FP+H+S IK    S S 
Sbjct  78    QAPKKFKIIAGSYEKLLYGLEGTTSLAKGSNEVQ-FDLKPMFIFPAHVSCIKAVAASPSG  136

Query  472   a---vsggsddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSV  639
                  +G +D+ IK++DL    EIG L H   +I  L F +        +LISA+++G++
Sbjct  137   GKWLATGSADEIIKVWDLRRRKEIGGLMHHEGSITHLNFASR------SHLISASEDGTL  190

Query  640   SIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGK  819
              ++H   +  L+ +K H+  +N++++HPSG +  SVG+D  L M DL RG+      LGK
Sbjct  191   CLFHARDWSVLRALKGHKGRVNAVAVHPSGKVALSVGKDRTLRMWDLMRGKGCASTKLGK  250

Query  820   EVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE-FNNAKRVLCA-----APGEGGIL  981
             E  I++++  G +L++VM    + +++     T+L   N+  R+  A       G G +L
Sbjct  251   EGEIVRWSSDG-SLFIVMSG--TTIDVYNTSMTLLHTINHPSRLHDAKFTPRVDGNGEVL  307

Query  982   FTGGEDRNITAWDTKS---------GKVAHRIDDAHSARVKGIVVLS--------NNDGE  1110
               G ED+ ++ +D  S         GK+       H  R+K +  LS         +  +
Sbjct  308   LVGAEDKTVSIYDISSDQEQLPKIIGKMV-----GHKNRIKAVQTLSISLPTTEAESRAK  362

Query  1111  YPYLVASASSDGNICVWDVRMGMGGKEK---PNPLAMANTK-SRLTCL  1242
                +V +ASSDG I V+D+        +    +P+A  +TK +RLTC+
Sbjct  363   ATTIVCTASSDGRIHVYDLAALPANSSELATIHPVATYDTKGTRLTCV  410



>ref|XP_005310025.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X2 [Chrysemys picta bellii]
Length=385

 Score =   121 bits (304),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 160/311 (51%), Gaps = 16/311 (5%)
 Frame = +1

Query  316   KSMSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsdd  495
             + M L+ G Y+  ++G+ ++     +N   IP F+  +H +++    V+    V+G  D+
Sbjct  20    REMELVGGCYEQILFGFAVRPE---ENWTPIPDFTHHAHTASLSAVAVNNRYVVTGSRDE  76

Query  496   TIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHL  672
             TI+IYD+    E G+L H + TI  L FY         +L+S A++G + I+ T  +  L
Sbjct  77    TIQIYDMKKKIEHGALLHHNGTITCLEFYGNA------HLLSGAEDGLICIWDTKKWECL  130

Query  673   KTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETG  852
             K++K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++ +G
Sbjct  131   KSIKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIVKWSPSG  190

Query  853   KTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
             +   +V+  KV V +L     +       KR+         +L   G+D  I  +D  S 
Sbjct  191   EKYVVVVTNKVDVYKLETASVSGA-ITTEKRISSVRFITDSVLAIAGDDEVIRLYDCDSQ  249

Query  1033  KVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAM  1212
             K       AH  R+K I        +   ++ +ASSDG I +W + +    +++P+ L  
Sbjct  250   KCLCEF-KAHENRIKDIYSFEKQGLQ---VIVTASSDGYIKLWSLELDK-IQDRPSLLCE  304

Query  1213  ANTKSRLTCLA  1245
              NTK+RLTCLA
Sbjct  305   VNTKARLTCLA  315



>emb|CEF98827.1| G-protein beta WD-40 repeat [Ostreococcus tauri]
Length=437

 Score =   122 bits (305),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 101/322 (31%), Positives = 161/322 (50%), Gaps = 22/322 (7%)
 Frame = +1

Query  325   SLIAGSYDHFIWGYKLKSPKDL-QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             ++IAGSY+ F++GY +       +   L   F+  +HLS++KC   SG  A SGGSDD I
Sbjct  5     TVIAGSYERFVFGYGVHGEGAAGETSRLEKCFTADAHLSSVKCVAASGGFAASGGSDDLI  64

Query  502   KIYDLSTCSEIGSL-----HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHT-DPF  663
             ++Y       +  L     HE   + +LAF+ P S   P  L+S   +GSV ++   D F
Sbjct  65    RVYHCDASGAVADLGVLVGHE-GDVRALAFHAP-SGRAPTRLLSGGADGSVRVWDARDNF  122

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
               +KT++ HR G+ S++ H SG +  + G D  +AM D+ +GR ++ +   + V  L F 
Sbjct  123   NMMKTMRAHRGGVLSIAAHRSGRVALTSGADSHVAMWDMLKGRVAYKFKTPERVERLTFT  182

Query  844   ETGKTLYMVMDEKVSV--LELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAW  1017
             + GK    +  +++SV  +E G   RT   F    + L      G + + G E  ++  +
Sbjct  183   QDGKEYVSLTSKRLSVTDVEAGSIVRT---FATPSKALT-FEARGRVAYVGCEGGDVIVY  238

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLS-----NNDGEYPYLVASASSDGNICVWDVRMGM-  1179
             DT++     +I  AH  RV+G+   S       +   P L+ SA S+G + VWD+R    
Sbjct  239   DTRTEDAVGQIVKAHPQRVRGLAFGSMTLEEAEEDSNPKLLISAGSEGAVRVWDLRTATR  298

Query  1180  GGKEKP-NPLAMANTKSRLTCL  1242
                E P   +   NT +R TCL
Sbjct  299   SSAEAPAESVVEINTGARYTCL  320



>ref|XP_001732707.1| hypothetical protein MGL_0482 [Malassezia globosa CBS 7966]
 gb|EDP45493.1| hypothetical protein MGL_0482 [Malassezia globosa CBS 7966]
Length=587

 Score =   123 bits (309),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 176/349 (50%), Gaps = 51/349 (15%)
 Frame = +1

Query  316   KSMSLIAGSYDHFIWGYKLKSPKDLQN---LDLIPLFSFPSHLSTIKCad---vsgsvav  477
             K + ++AG+Y+ F++G +    KD Q+   + L P F FP+H+S+I+C            
Sbjct  152   KGIRIVAGTYERFLYGLEGTVQKDSQSSYSIRLEPRFIFPAHVSSIRCVACAGQDSKWLA  211

Query  478   sggsddTIKIYDLSTCSEIGSL--HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYH  651
             +GG D+ IK++DL    E+G+L  HE  TI SL+F   P+ +F   L+SA+++G +++Y 
Sbjct  212   TGGMDELIKVWDLRRRKEMGALTGHE-GTITSLSF---PNRTF---LLSASEDGVINMYR  264

Query  652   TDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSI  831
             T  +  L+T++ H   INS+S HPSG +  SVG D  + M DL RG  S    +G E   
Sbjct  265   TRDWALLRTLRGHTGRINSVSAHPSGRVALSVGADRMIRMWDLMRGMGSASVKIGTEADR  324

Query  832   LKFNETGKTLYMVMDEKVSVL-----------------ELGYCPRTVLEFNNAKR----V  948
             + ++  G    ++   K+ V                  ++G+  RT +  NN KR     
Sbjct  325   VLWDTLGTRFAVLTGRKIIVYATNMSKVAQIEHPKRLHDIGFV-RTNITGNNDKRDDQHE  383

Query  949   LCAAPGEGGILFTGG-EDRNITAWDTKSGKVAHRIDDAHSARVKGIVV--LSNNDGEYPY  1119
             L     E GIL     +D   T  D    +VA  +   H+ RV+  V   +  NDG    
Sbjct  384   LMLVASESGILHVFDLDDLQGTGEDASPREVARLV--GHTNRVRSAVATHVQANDGTERL  441

Query  1120  LVASASSDGNICVWDVRMGMGGKEKP-----NPLAMANT-KSRLTCLAG  1248
             LV + SSDG I V+++ +    +E+P       LA  +T KSRLTCL+ 
Sbjct  442   LVTTISSDGYIRVFELCL---SREEPLVPELEALAAYDTKKSRLTCLSA  487



>ref|XP_009549045.1| hypothetical protein HETIRDRAFT_238047, partial [Heterobasidion 
irregulare TC 32-1]
 gb|ETW78732.1| hypothetical protein HETIRDRAFT_238047, partial [Heterobasidion 
irregulare TC 32-1]
Length=447

 Score =   122 bits (305),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 109/358 (30%), Positives = 183/358 (51%), Gaps = 48/358 (13%)
 Frame = +1

Query  319   SMSLIAGSYDHFIWGYK----LKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsv---av  477
             +  ++AGSY+  ++G +      S +DL    L PLF FP+H+S +K    S        
Sbjct  54    AFKIVAGSYEKLLYGLEGTVSASSSEDL-TFSLKPLFIFPAHVSCVKAVTASPQGGKWLA  112

Query  478   sggsddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHT  654
             +G +D+ IK++DL    EIG L H   ++  L+F   PS S   +L+SA+++G++ ++  
Sbjct  113   TGSADEIIKVWDLRRRREIGGLMHHEGSVTHLSF---PSRS---HLLSASEDGTLCLFRA  166

Query  655   DPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSIL  834
               +  L+ +K H+  +NS+++HPSG +  SVG+D+ L M DL RGR S    LG E  ++
Sbjct  167   RDWSVLRALKGHKGPVNSVAVHPSGKVALSVGKDKTLRMWDLMRGRASGSTKLGVEGELV  226

Query  835   KFNETGKTLYMVMDEKVSV-------LELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGG  993
             +++ +G  L +   + + V       L     P  + +    +RV     G   +L    
Sbjct  227   RWSTSGSLLVVQYQKTIDVYSNDLTRLHTVIHPSRIQDVKFVQRVT----GVDEVLLVAA  282

Query  994   EDRNITAWDTKSG-KVAHR-IDD--AHSARVKGI----VVLSNNDGEYPYLVASASSDGN  1149
             ED+ +T +D  +  K+A + I +   H  RVK +    + L         ++++ SSDGN
Sbjct  283   EDKKVTVYDVGADCKIAPKPIAEFVGHENRVKAMDTLRIALPIPSRPSTTILSTVSSDGN  342

Query  1150  ICVWDV---------RMGMGGKEKPN--PLAMANTK-SRLTC--LAGSSIKCE*VYIG  1281
             I V+D+             GG EKP+  P+A+ ++K SRLTC  LA   I  + V +G
Sbjct  343   IHVYDLFAIPPPPTNAETAGGNEKPSIVPVAIYDSKGSRLTCVTLADGEISGDSVAVG  400



>ref|XP_006682116.1| hypothetical protein BATDEDRAFT_4260 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77100.1| hypothetical protein BATDEDRAFT_4260 [Batrachochytrium dendrobatidis 
JAM81]
Length=280

 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 89/293 (30%), Positives = 151/293 (52%), Gaps = 24/293 (8%)
 Frame = +1

Query  328   LIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKI  507
             +IAG+Y+  ++G    +  D     + P+F +P+H++ IK          +G +D+ +K+
Sbjct  1     IIAGTYERLLYGLSCSTSPDNT---ITPVFIYPAHINCIKTVAAGCRFLATGSTDEHVKL  57

Query  508   YDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVK  684
             YDL  C E+G+L H S TI +LAFY         +L++A+++G++ I  +  +  LKT+K
Sbjct  58    YDLRKCKEVGTLMHHSGTITALAFYNSS------HLMTASEDGTIGIVRSSDWELLKTLK  111

Query  685   VHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLY  864
              H   I S+++HPSG ++ SV +D+ L   DL RG  ++   L      + ++ +G    
Sbjct  112   GHTSSILSIAVHPSGKILLSVSKDKTLRCWDLMRGVCAYTLKLHAIAEQVVWSPSGSHYA  171

Query  865   MVMDEKVSV--LELGYC------PRTVLEFNNAKRVLCAA--PGEGGILFTGGEDRNITA  1014
             ++    V V  +E G        PR+ L  N     LC A    +  ++  GGED+ IT 
Sbjct  172   LLFSNSVIVYLVETGDVFGKFDSPRSRL--NAISFTLCTASDSTKTEVIIIGGEDKIITV  229

Query  1015  WDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRM  1173
                 +GKV+ +    H +R+K I  L     +   + A+ SSDG I +WD+ M
Sbjct  230   -ILPTGKVSMQWKSGHDSRIKDIAALVCTKRQ-TTVFATCSSDGAIFIWDLNM  280



>gb|KGL92608.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Charadrius vociferus]
Length=345

 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 93/286 (33%), Positives = 148/286 (52%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGVICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +   S K       AH  R+K I  +   + 
Sbjct  174   ITTEKRISSLRFITNSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSI---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    KE P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLN-KIKEVPSLLCEVNTKARLTCLA  274



>gb|EPB91934.1| hypothetical protein HMPREF1544_01228 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=425

 Score =   121 bits (303),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 86/321 (27%), Positives = 161/321 (50%), Gaps = 20/321 (6%)
 Frame = +1

Query  304   IEAGKSMSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsg  483
             ++  +   ++ G+Y+  ++G      ++   + L P+F  P+H   I+   + G    SG
Sbjct  44    LDIEEDFRIVVGTYERLLFGINALWNQEKTQVKLEPVFIIPAHTGCIRTVAIGGHFLASG  103

Query  484   gsddTIKIYDLSTCSEIGSL--HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTD  657
              +D+ I++YD+    E GSL  H S  I  + F+          ++SA+D+ S++++ T 
Sbjct  104   STDEIIRLYDVKKRKEYGSLGGHHSGDITDIQFHGK-------YMLSASDDHSINLWRTK  156

Query  658   PFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILK  837
              +  LKT+K H+  +NS++IHP+G +  SVG D    + +L  GR++    LGKE  +L 
Sbjct  157   DWEFLKTLKAHKGRVNSIAIHPTGKIALSVGIDRAAIVWNLMTGRKASVNKLGKEEPMLV  216

Query  838   -FNETGKTLYMVMDEKVSVLEL--GYCPRTVLEFN--NAKRVLCAAPGEGGILFTGGEDR  1002
              +N  G    ++ D+ +++  +       T+ + +  ++ +   +   +   + TG ED+
Sbjct  217   LWNPAGDQYAIMFDKTINIYNVSDAKIATTITQTSRLHSMKYFHSKKHDKDYIVTGSEDK  276

Query  1003  NITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMG  1182
              I  ++  SG+    I   H  RVK + V+ ++D     ++ S SSDG +  WD+   + 
Sbjct  277   TIRIYNVTSGECVKEI-KGHKLRVKSVTVVESDD---RIVLVSVSSDGIVKCWDLEAALD  332

Query  1183  GKEKPNPLAMANTKSRLTCLA  1245
             G     PL   NTK R TC+ 
Sbjct  333   G--DVEPLGEYNTKCRATCIT  351



>ref|XP_004359413.1| hypothetical protein DFA_01449 [Dictyostelium fasciculatum]
 gb|EGG21563.1| hypothetical protein DFA_01449 [Dictyostelium fasciculatum]
Length=527

 Score =   122 bits (305),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 97/321 (30%), Positives = 164/321 (51%), Gaps = 30/321 (9%)
 Frame = +1

Query  328   LIAGSYDHFIWGYK---------LKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavs  480
             +  G Y++ I G++         L +P DL+ + L  +F++ SH   IK         VS
Sbjct  117   ITVGCYENSILGFEAIKLADYPELGNPDDLE-VHLEQIFAYASHSGCIKSIASGSEYLVS  175

Query  481   ggsddTIKIYDLSTCSEIGSL--HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHT  654
               +D+T+K+Y LS   E G L  HE   I SL FY         +LI+++ + ++S+++ 
Sbjct  176   SSTDETVKVYSLSKREEFGQLVKHE-GFITSLKFYKN------SHLIASSRDHTLSVWNV  228

Query  655   DPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSIL  834
             + +  LK +K H+  +N +SIHPSG +  SVG+D    + DL RG  + +     E  ++
Sbjct  229   NGWDCLKQLKGHKDAVNWVSIHPSGKVALSVGKDNRFFLWDLMRGVAAHFQKTKGEPFLV  288

Query  835   KFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITA  1014
             +++++G    +   +++ V       + V  +   + +L     +   L  GG+D+ I+ 
Sbjct  289   EWSKSGDHFVIAYADRLVVHTAD--GKEVHTYPTKQPILAIHFFDDDTLVAGGDDKVISF  346

Query  1015  WDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEK  1194
              D KSGK+  +I +  S R+K +   S +  + PYLV S SSDGNI +W+V   M     
Sbjct  347   IDYKSGKLIKQIKEIDS-RIKALSSFSFDPQDTPYLV-SLSSDGNIVIWNVETDM-----  399

Query  1195  PNPLAMANTKSRLTCLAGSSI  1257
               P+  A T +RLTCL  S +
Sbjct  400   --PVGFAETGARLTCLTISDV  418



>emb|CCA68745.1| related to MAK11 protein (maintenance of killer toxin-encoding 
satellite M1 dsRNA) [Piriformospora indica DSM 11827]
Length=433

 Score =   120 bits (302),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 98/341 (29%), Positives = 171/341 (50%), Gaps = 47/341 (14%)
 Frame = +1

Query  310   AGKSMSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsv---avs  480
             + K + ++AGSYD  ++G +++  KD    +  P+F FP+H+S +K    S        +
Sbjct  73    SSKPLIVVAGSYDKILYGLQIEPEKD-SGAEFKPVFCFPAHISCVKAVAASPQGGKWLAT  131

Query  481   ggsddTIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTD  657
             G +D+TIKI+DL    E+GSL +   +I  L+F   P+ S   +L+S +++G + +YHT 
Sbjct  132   GATDETIKIWDLRRRKELGSLQQHQGSITHLSF---PTRS---HLLSTSEDGVICLYHTR  185

Query  658   PFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILK  837
              +  L T++ HR+ +N L++HPS  +  SVG+D  L M DL RG+ S    LGKE   ++
Sbjct  186   DWSVLTTMRGHRERVNDLAVHPSAKVCLSVGKDRTLRMWDLMRGKGSASIKLGKEGEGVR  245

Query  838   FNETGK-----------------TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPG  966
             +   G                  +L   +D    V  +G+C     + + ++  LC A  
Sbjct  246   WTPLGTRFAIFSGVTIDIYSTKMSLLQTIDHPARVHGIGFC-----QDSKSREFLCVAGE  300

Query  967   EGGIL---FTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASAS  1137
             +  +     +G +D       +    V++ +   H  RVK + + +N    Y   V++ S
Sbjct  301   DKQVTVYRLSGIDDEATETHSSSPPAVSYLV--GHKNRVKALDISTNMGNTY---VSTVS  355

Query  1138  SDGNICVWDVRMGMGGK--EKP---NPLAMANTK-SRLTCL  1242
             SDG I ++D+   +  +   +P    P+A  +T  SRLTC+
Sbjct  356   SDGRIHLYDMSEALSAEPGSEPSEIQPMASYDTNGSRLTCV  396



>ref|XP_005512629.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Columba livia]
Length=381

 Score =   120 bits (300),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 93/287 (32%), Positives = 148/287 (52%), Gaps = 13/287 (5%)
 Frame = +1

Query  388   LQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATIN  564
             LQ+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI 
Sbjct  33    LQSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTIT  92

Query  565   SLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCS  744
              L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  S
Sbjct  93    CLEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALS  146

Query  745   VGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVL  924
             VG D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T  
Sbjct  147   VGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYQLDTASITGT  206

Query  925   EFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNND  1104
                  KR+         IL   G+D  I  +   S K       AH  R+K I      +
Sbjct  207   -ITTEKRISSLIFVTDSILAIAGDDEMIRFYSCDSQKCLCEF-KAHENRIKDIYSF---E  261

Query  1105  GEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
              E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  262   REGQHVIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  307



>gb|KFV82868.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Struthio camelus australis]
Length=347

 Score =   119 bits (299),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 91/286 (32%), Positives = 147/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + T+  
Sbjct  1     QSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTVTC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++ +G+    V+  KV V +L         
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAQIIKWSPSGEKYVTVITNKVDVYKLDTAS-IAGT  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  ++  S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLTFITDSILAIAGDDEVIRLFNCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P  L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLN-KIKDMPTLLCEVNTKARLTCLA  274



>emb|CEG73450.1| hypothetical protein RMATCC62417_08829 [Rhizopus microsporus]
Length=354

 Score =   119 bits (299),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 91/312 (29%), Positives = 161/312 (52%), Gaps = 19/312 (6%)
 Frame = +1

Query  328   LIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKI  507
             +I G+Y+  ++G  +   ++   L L P+F  P+H   I+   V G    SG SD+ I++
Sbjct  48    VIVGTYERLLYGLNVNWIQEKTKLRLEPIFIIPAHTGCIRTVSVGGHFLASGSSDEIIRL  107

Query  508   YDLSTCSEIGSL--HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTV  681
             YD+    E GSL  H S  I  + F+          ++SA+++ +++++ T  + +LKT+
Sbjct  108   YDVKKRKEYGSLGGHHSGDITDIKFHGKY-------MLSASEDHTINLWRTKDWEYLKTL  160

Query  682   KVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGK-EVSILKFNETGKT  858
             K H+  +NS++IHP+G +  SVG D C  + +L  G+++    LG+ E  I+ +N TG  
Sbjct  161   KGHKAKVNSMAIHPTGKIALSVGTDRCAIVWNLMTGKKASINKLGRDEGMIVLWNTTGDK  220

Query  859   LYMVMDEKVSVLEL--GYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
               ++ D+K++V  +       T+   +    +      +   L +G ED+ I  W+  SG
Sbjct  221   YAIMFDKKINVYNVSDAQVATTMSHTSKFHTIKYFVLNDEEYLISGHEDKIIRIWNL-SG  279

Query  1033  KVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVR--MGMGGKEKPNPL  1206
             +    I   H  RVK + V+  ++     L ASASSDG +  WD+   +    K++   L
Sbjct  280   ECIKEI-KGHKLRVKALTVIKCDE---KTLCASASSDGVVKCWDLESIVQSESKDEFECL  335

Query  1207  AMANTKSRLTCL  1242
                +TK R+TC+
Sbjct  336   GEYDTKCRITCI  347



>gb|KFO78582.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Cuculus canorus]
Length=365

 Score =   119 bits (299),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 95/307 (31%), Positives = 157/307 (51%), Gaps = 16/307 (5%)
 Frame = +1

Query  328   LIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKI  507
             ++AG Y+  ++G+ +      ++  ++P F+  +H +++    V+    V+G  D+TI+I
Sbjct  1     VVAGCYEQVLFGFSVPYR---ESWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQI  57

Query  508   YDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVK  684
             YD+    E G+L   + TI  L FY         +L+S A++G + I++T  +  LK+++
Sbjct  58    YDMKKKIEHGALLQHNGTITCLEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIR  111

Query  685   VHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLY  864
              H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++  G+   
Sbjct  112   AHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYV  171

Query  865   MVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAH  1044
              V+  KV V +L     T       KR+         IL   G+D  I  +   S K   
Sbjct  172   TVITNKVDVYKLDTASITGT-IRTEKRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLC  230

Query  1045  RIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTK  1224
                 AH  R+K I      + E   ++ +ASSDG I +W++ +    K+ P+ L   NTK
Sbjct  231   EF-KAHENRIKDIYSF---EREGQRVIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTK  285

Query  1225  SRLTCLA  1245
             +RLTCLA
Sbjct  286   ARLTCLA  292



>ref|XP_009999291.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Chaetura pelagica]
Length=397

 Score =   120 bits (300),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 99/316 (31%), Positives = 159/316 (50%), Gaps = 17/316 (5%)
 Frame = +1

Query  301   SIEAGKSMSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavs  480
             S+ A  S  ++ GS D  I  Y +K     +   ++P F+  +H +++    V+    V+
Sbjct  24    SVVAVNSRYVVTGSRDETIQIYDMKK----RAWAVVPDFTHHAHSASLSVVAVNSRYVVT  79

Query  481   ggsddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTD  657
             G  D+TI+IYD+    E G+L   + TI  L FY         +L+S A++G + I++T 
Sbjct  80    GSRDETIQIYDMKKRVEHGALLQHNGTITCLEFYGTA------HLLSGAEDGLICIWNTK  133

Query  658   PFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILK  837
              +  LK+++ H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K
Sbjct  134   RWECLKSIRAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIK  193

Query  838   FNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAW  1017
             ++  G+    V+  KV + +L     T       KR+         IL   G+D  I  +
Sbjct  194   WSPDGEKYVTVITNKVDIYKLDTASITGT-ITIEKRISSLRFITDSILAIAGDDEIIRFY  252

Query  1018  DTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKP  1197
                S K       AH  R+K I      + E  +++ +ASSDG I +W++ +    K+ P
Sbjct  253   SCDSQKCLCEF-KAHENRIKDIFSF---EREGQHVIVTASSDGYIKMWNLDLN-KIKDVP  307

Query  1198  NPLAMANTKSRLTCLA  1245
             + L   NTK+RLTCLA
Sbjct  308   SLLCEVNTKARLTCLA  323



>gb|ERZ98717.1| hypothetical protein GLOINDRAFT_10248 [Rhizophagus irregularis 
DAOM 181602]
Length=342

 Score =   119 bits (297),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 96/310 (31%), Positives = 159/310 (51%), Gaps = 26/310 (8%)
 Frame = +1

Query  376   SPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HES  552
             S  D  +L L P+F F +H   IK   V G    SG +D+ IK+Y+L    E+GSL    
Sbjct  25    SDDDDFSLKLDPIFVFSAHTGCIKTVSVGGKFLASGSTDEVIKLYNLRKRKELGSLLQHE  84

Query  553   ATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGG  732
              +I ++ F+         ++ S +++G++ I+ T  +  LKT+K H+  +NSL++HPSG 
Sbjct  85    GSITTIQFFNKT------HMFSGSEDGTICIWRTKDWECLKTLKGHKGRVNSLAVHPSGK  138

Query  733   LVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCP  912
             +  SV  D+ + + +L  G+++    LG+E  I+ +N +G+   ++M  ++ +       
Sbjct  139   IALSVSNDKTVRLWNLLAGQKASVNKLGREGEIILWNSSGEQYAILMAREIEIYSTSDA-  197

Query  913   RTVLEFNNAK-RVLCAAPGE----GGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVK  1077
             + +  F +   R LC    E    G +L  G ED+ I  ++ KSG     +   H  R+K
Sbjct  198   QILQRFQSGNSRFLCMQYYEHEHLGDLLIVGSEDKAIRVYEVKSGNCLITL-LGHKNRIK  256

Query  1078  GIVVLS----NNDGEYPYLVASASSDGNICVWDVRMGM--GGKEKPN-----PLAMANTK  1224
              I ++     NN   +  L++S SSDG I VW++   +    KE  N     PLA  +TK
Sbjct  257   DISIIQSIPPNNSAPFT-LLSSISSDGVINVWNLNKVLPHNYKEGNNPIFNLPLATYDTK  315

Query  1225  SRLTCLAGSS  1254
             SRLTC+  S 
Sbjct  316   SRLTCVVLSQ  325



>gb|EMC80779.1| p21-activated protein kinase-interacting protein 1-like protein, 
partial [Columba livia]
Length=348

 Score =   119 bits (297),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 147/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYQLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLIFVTDSILAIAGDDEMIRFYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  274



>gb|KFR09188.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Nipponia nippon]
Length=348

 Score =   119 bits (297),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 148/286 (52%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTVVPDFTHHAHSASLSAVAVNSRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  ++SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGVICIWNTKRWECLKSIKAHKGHVSSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGEKYVTVITNKVDIYKLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  274



>ref|XP_008333099.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Cynoglossus semilaevis]
Length=359

 Score =   118 bits (296),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 100/309 (32%), Positives = 159/309 (51%), Gaps = 15/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + LIAGSY+  ++GY++K+  D +       F+  +H ++I     S    V+G  D+TI
Sbjct  5     LELIAGSYEQIVFGYRVKT--DEKEWTSKANFTHHAHTASISAVATSERFVVTGSKDETI  62

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YD+   +E GSL H   TI+ L FY         +L+S  ++G + ++ T  +  LK+
Sbjct  63    QLYDMKKRTEHGSLLHHDGTISCLEFYGSS------HLLSGGEDGLLCVWSTKKWECLKS  116

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLS+HPSG L  SVG D+ L   +L  GR +F  ++ +   I++++  G  
Sbjct  117   IKAHQGHVTSLSVHPSGKLALSVGTDKTLRTWNLINGRSAFIKNIKQNALIVRWSPDGDK  176

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               +V+D+KV + +L     T     N KR+         +L   G+D  +  +D +  K 
Sbjct  177   YVVVVDDKVDIYDLKTASVTGT-LTNPKRISSIKFLNNSLLAVAGDDDTVRFYDMEKEKW  235

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  RVK I   +  D  Y  LV +AS+DG I +W V +     E P  L   N
Sbjct  236   VCEF-KAHETRVKAIDSFNMED--YCVLV-TASNDGFIKMWKVHLK-EDLEPPTLLGEVN  290

Query  1219  TKSRLTCLA  1245
             T +RLTCLA
Sbjct  291   TTARLTCLA  299



>gb|KFV55899.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Gavia stellata]
Length=348

 Score =   118 bits (296),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 147/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERFVTVITNKVDIYKLDTASITGTI  174

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  175   ITE-KRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLGEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   ERQHIIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  274



>emb|CDH53501.1| wd40 repeat-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=390

 Score =   119 bits (297),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 88/315 (28%), Positives = 152/315 (48%), Gaps = 21/315 (7%)
 Frame = +1

Query  328   LIAGSYDHFIWGYKLKSPKD--LQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             +I G+Y+  ++G      K+     + + P+F  P+H   IK   V G    SG +D+ I
Sbjct  50    IITGTYERILYGINAYWEKENGSTKIKMQPVFIVPAHTGCIKTVAVGGQFLASGSTDEII  109

Query  502   KIYDLSTCSEIGSL--HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLK  675
             ++YD+    E GSL    S  +  + F       F   +++A+D+ ++ I+    + +LK
Sbjct  110   RLYDVKKRKEYGSLGGQHSGDLTDIQF-------FGRYMLTASDDKTICIWRKKDWEYLK  162

Query  676   TVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGK  855
             T+K H+  +NSL+IHPSG +  SV  D    + +L   R++    LG+E   +++N++G 
Sbjct  163   TLKGHKGRVNSLAIHPSGKIALSVSADRTAIVWNLMTARKASQNKLGQEGLCVRWNKSGD  222

Query  856   TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLC----AAPGEGGILFTGGEDRNITAWDT  1023
                ++ D ++++  +      V   +   R LC     +      L TG EDR    WD 
Sbjct  223   HYAIMFDRQINIYNVTDAEVAV-SISQRSRFLCMEYYTSKAGKEYLITGSEDRIARIWDA  281

Query  1024  KSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY---LVASASSDGNICVWDVRMGMGGKEK  1194
              +GK    +   H  RVK + V+ +   E      ++ + SSDG I  WD+   + G + 
Sbjct  282   STGKSVVEL-KGHKLRVKTLAVIESKPEESDEAIGVLVTVSSDGMIKCWDIEAALAGDDN  340

Query  1195  PNPLAMANTKSRLTC  1239
             P      +TKSR+TC
Sbjct  341   P-LFGDYDTKSRVTC  354



>ref|XP_006004484.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
isoform X2 [Latimeria chalumnae]
Length=364

 Score =   118 bits (296),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 88/310 (28%), Positives = 159/310 (51%), Gaps = 22/310 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M ++AGSY+  ++GY+++     +  +L+P F+  +H  ++    V+     +G  D+TI
Sbjct  1     MEVLAGSYEQILFGYRVRPGG--EKWELVPDFTHHAHSGSVSAVAVNDRYVATGSKDETI  58

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YD+    E G L H + TI+ L FY   SL     L+S  ++G + ++ T  +  LK+
Sbjct  59    QLYDMKKKVEHGVLLHHNGTISCLEFY--GSL----RLLSGGEDGLICVWDTKKWECLKS  112

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLS+HPSG L  SVG D+ L   +L  GR +F  +L +   I++++ +G+ 
Sbjct  113   IKAHKGHVTSLSVHPSGKLALSVGTDKTLRTWNLIEGRSAFIKNLKQNAHIIQWSPSGEK  172

Query  859   LYMVMDEKVSV--LELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
               +V++ +V +  LE      T++   N KR+         ++   G++  +  +D K+ 
Sbjct  173   YIVVVNNRVDIYNLETASVTGTIV---NQKRISSVKFVTDSMIAVAGDEETVRIYDCKTQ  229

Query  1033  KVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAM  1212
                     AH  RVK I        E  +++ +AS+DG I +W     +  K  P  L  
Sbjct  230   TCRCEF-KAHENRVKSIDCFQM---ENHHIIVTASNDGYIKMWQ----LDNKNVPTLLGE  281

Query  1213  ANTKSRLTCL  1242
              N+ +RLT +
Sbjct  282   VNSTARLTSM  291



>gb|KFZ56831.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Caprimulgus carolinensis]
Length=348

 Score =   118 bits (296),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 93/286 (33%), Positives = 147/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  +IP F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTVIPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGEKYVTVITNKVDIYKLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLD-KIKDAPSLLCEVNTKARLTCLA  274



>gb|KFZ60045.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Podiceps cristatus]
Length=345

 Score =   118 bits (295),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 92/282 (33%), Positives = 145/282 (51%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  L FY
Sbjct  3     VVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITCLEFY  62

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  63    GTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGQVTSLSIHPSGKLALSVGTDK  116

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T       
Sbjct  117   TLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTASITGT-ITTE  175

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR+         IL   G+D  I  +   S K       AH  R+K I      + E  Y
Sbjct  176   KRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---EREGQY  231

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             ++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  232   VIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  272



>gb|KFV07234.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Pterocles gutturalis]
Length=347

 Score =   118 bits (296),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 147/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVLTNKVDIYKLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLNK-IKDVPSLLCEVNTKARLTCLA  274



>ref|XP_007234941.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
isoform X1 [Astyanax mexicanus]
Length=362

 Score =   118 bits (296),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 90/311 (29%), Positives = 162/311 (52%), Gaps = 21/311 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + ++AGSY+  ++GY++  P++ ++  + P+F+  +H +++     S     +G  D+TI
Sbjct  5     VEVVAGSYEQVVFGYRV-FPEE-KDWTVKPVFTHHAHTASLSTVAASKQFIATGSKDETI  62

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YD+++ +E GSL H   T++ L FY         +L+S  ++G + ++ T  +  LKT
Sbjct  63    QLYDMTSKTEHGSLLHHEGTVSCLEFYGTS------HLLSGGEDGLLCVWSTKTWECLKT  116

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  ++S+S+HPSG L  SVG D+ L   +L  GR +F   + +   +++++  G  
Sbjct  117   IKAHKGHVSSMSVHPSGKLALSVGTDKKLRTWNLIDGRSAFCKIIKENAHLVQWSPEGDK  176

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               + +++K+ V  L      +      KR+         +L   G+D N+  +D  S K 
Sbjct  177   YVVAVNDKLDVYSLE-SASIISTLTYRKRISSIKFLNNTLLAVAGDDENVQIYDLDSEKC  235

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNP--LAM  1212
                   AH  RVK +  L    GE   ++ +AS+DG I +W   M     EKP    L  
Sbjct  236   ICEF-KAHEIRVKAVESLMM--GELCVII-TASNDGFIKLWKFNM-----EKPEVCLLGQ  286

Query  1213  ANTKSRLTCLA  1245
              NT +RLTCL+
Sbjct  287   VNTTARLTCLS  297



>ref|XP_005355130.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X2 [Microtus ochrogaster]
Length=382

 Score =   118 bits (296),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 93/315 (30%), Positives = 160/315 (51%), Gaps = 22/315 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL-KSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AGSY+  ++G+++ + P    D +    +  F+  +H +++     +    V+G  
Sbjct  1     MELVAGSYEQVLFGFRVHREPATSGDRETWTPVADFTHHAHTASLSAVAANNRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYDL    E G+L H S T+  L FY         +LIS A++G + ++    + 
Sbjct  61    DETIHIYDLKKKIEHGALLHHSGTVTCLKFYGT------RHLISGAEDGLICVWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGHVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G+   +V+  KV V +L     +     N KR+         +L   G++  +  +D  
Sbjct  175   SGEKYIVVVLNKVDVYQLDTASVSGT-ITNGKRISSVTFLSDSVLAVAGDEEVVRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S +       AH  RVKGI+       E P  +++ +AS+DG I +W ++     K+ P+
Sbjct  234   SLECLCEF-KAHENRVKGILSF-----EIPGHHVLVTASNDGFIKMWTLKQDK--KDPPS  285

Query  1201  PLAMANTKSRLTCLA  1245
              L   +T +RLTCL 
Sbjct  286   LLCEVDTGARLTCLG  300



>ref|XP_007971916.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X2 [Chlorocebus sabaeus]
Length=392

 Score =   118 bits (296),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 94/314 (30%), Positives = 156/314 (50%), Gaps = 22/314 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    ++  D Q   L+  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFAVHPESEACGDHQQWTLVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D  
Sbjct  175   RGEQYVVIIQNKIDIYQLDTASISGT-ITNEKRISSVKFLSESVLAVAGDEEVIRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S         AH  RVK +        E P  +++ +ASSDG I +W  ++    K  P+
Sbjct  234   SLVCLCEF-KAHENRVKDMFSF-----EIPEQHVIVTASSDGFIKMW--KLEQDKKVPPS  285

Query  1201  PLAMANTKSRLTCL  1242
              L   NTK+RLTCL
Sbjct  286   LLCEVNTKARLTCL  299



>ref|XP_005355129.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X1 [Microtus ochrogaster]
Length=385

 Score =   118 bits (296),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 93/315 (30%), Positives = 160/315 (51%), Gaps = 22/315 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL-KSPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AGSY+  ++G+++ + P    D +    +  F+  +H +++     +    V+G  
Sbjct  1     MELVAGSYEQVLFGFRVHREPATSGDRETWTPVADFTHHAHTASLSAVAANNRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYDL    E G+L H S T+  L FY         +LIS A++G + ++    + 
Sbjct  61    DETIHIYDLKKKIEHGALLHHSGTVTCLKFYGT------RHLISGAEDGLICVWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGHVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G+   +V+  KV V +L     +     N KR+         +L   G++  +  +D  
Sbjct  175   SGEKYIVVVLNKVDVYQLDTASVSGT-ITNGKRISSVTFLSDSVLAVAGDEEVVRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S +       AH  RVKGI+       E P  +++ +AS+DG I +W ++     K+ P+
Sbjct  234   SLECLCEF-KAHENRVKGILSF-----EIPGHHVLVTASNDGFIKMWTLKQDK--KDPPS  285

Query  1201  PLAMANTKSRLTCLA  1245
              L   +T +RLTCL 
Sbjct  286   LLCEVDTGARLTCLG  300



>gb|KFP93277.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Haliaeetus albicilla]
Length=346

 Score =   118 bits (295),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 146/282 (52%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P+F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  L FY
Sbjct  3     VVPVFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITCLEFY  62

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  63    GTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSVGTDK  116

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T       
Sbjct  117   TLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTASITGT-ITTE  175

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR+         IL   G+D  I  +   S K       AH  R+K I      + E  +
Sbjct  176   KRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---EREGQH  231

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             ++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  232   VIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  272



>gb|KFP32385.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Colius striatus]
Length=348

 Score =   118 bits (295),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 93/285 (33%), Positives = 146/285 (51%), Gaps = 13/285 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q   ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QPWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKVEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKKWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFVKNLKQNAHIIKWSPDGEKYVTVIMNKVDIYKLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +  +S K       AH  RVK I      + 
Sbjct  174   ITTEKRISSLRFITDSILAIAGDDEMIRFYSCESQKCLCEF-KAHQNRVKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCL  1242
             E  +++ +ASSDG I VW++ +    K+ P+ L   NTK+RLTCL
Sbjct  230   EGQHVIVTASSDGYIKVWNLDLNK-IKDVPSLLCEVNTKARLTCL  273



>ref|XP_010355459.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Rhinopithecus roxellana]
Length=392

 Score =   118 bits (296),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 92/314 (29%), Positives = 157/314 (50%), Gaps = 22/314 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    ++  D +   L+  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFAVHPESEACGDHEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D  
Sbjct  175   SGEQYVVIIQNKIDIYQLDTASMSGT-ITNQKRISSVKFLSESVLAVAGDEEVIRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S         AH  R+K +        E P  +++ +ASSDG I +W  ++    K  P+
Sbjct  234   SLVCLCEF-KAHENRIKDMFSF-----EIPEQHVIVTASSDGFIKMW--KLEQDKKVPPS  285

Query  1201  PLAMANTKSRLTCL  1242
              L   NTK+RLTCL
Sbjct  286   LLCEVNTKARLTCL  299



>ref|XP_010201839.1| PREDICTED: p21-activated protein kinase-interacting protein 1, 
partial [Colius striatus]
Length=347

 Score =   117 bits (294),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 92/281 (33%), Positives = 145/281 (52%), Gaps = 13/281 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  L FY
Sbjct  4     VVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKVEHGALLQHNGTITCLEFY  63

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  64    GTA------HLLSGAEDGLICIWNTKKWECLKSIKAHKGHVTSLSIHPSGKLALSVGTDK  117

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T       
Sbjct  118   TLRTWNLVEGRSAFVKNLKQNAHIIKWSPDGEKYVTVIMNKVDIYKLDTASITGT-ITTE  176

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR+         IL   G+D  I  +  +S K       AH  RVK I      + E  +
Sbjct  177   KRISSLRFITDSILAIAGDDEMIRFYSCESQKCLCEF-KAHQNRVKDIYSF---EREGQH  232

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCL  1242
             ++ +ASSDG I VW++ +    K+ P+ L   NTK+RLTCL
Sbjct  233   VIVTASSDGYIKVWNLDLNK-IKDVPSLLCEVNTKARLTCL  272



>emb|CDS12298.1| hypothetical protein LRAMOSA04493 [Absidia idahoensis var. thermophila]
Length=390

 Score =   117 bits (294),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 87/316 (28%), Positives = 155/316 (49%), Gaps = 23/316 (7%)
 Frame = +1

Query  328   LIAGSYDHFIWGYKLKSPKD--LQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             +I G+Y+  ++G      K+     + + P+F  P+H   I+   + G    SG +D+ I
Sbjct  50    IITGTYERILYGINAYWEKENGSTKIRMQPVFIVPAHTGCIRTVAIGGQFLASGSTDEII  109

Query  502   KIYDLSTCSEIGSL--HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLK  675
             ++YD+    E GSL    S  +  + F       F   ++SA+D+ ++ I+    + +LK
Sbjct  110   RLYDVKKRKEYGSLGGQHSGDLTDIQF-------FGRYMLSASDDKTICIWRKKDWEYLK  162

Query  676   TVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGK  855
             T+K H+  +NSL+IHPSG +  SV  D+   + +L   R++    LG+E   +++N++G 
Sbjct  163   TLKGHKGRVNSLAIHPSGKIALSVSADKSAIVWNLMTARKASQNKLGQEGLCVRWNKSGD  222

Query  856   TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLC----AAPGEGGILFTGGEDRNITAWDT  1023
                ++ D ++++  +       +  +   R LC     +      L TG EDR    WD 
Sbjct  223   HYAIMFDRQINIYNVTDAE-VAVSISQRSRFLCMQYYTSKAGKEYLITGSEDRVARIWDV  281

Query  1024  KSGKVAHRIDDAHSARVKGIVVLSN----NDGEYPYLVASASSDGNICVWDVRMGMGGKE  1191
              +G+    +   H  RVK + V+ +    +D +   LV + SSDG I  WD+   + G++
Sbjct  282   STGESVVEL-KGHKLRVKALSVIESKPEGSDQDVGVLV-TVSSDGMIKCWDIEAALAGQD  339

Query  1192  KPNPLAMANTKSRLTC  1239
              P      +TKSR TC
Sbjct  340   DP-LFGEYDTKSRATC  354



>gb|KFO56988.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Corvus brachyrhynchos]
Length=347

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 146/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVASLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV +  L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGEKYVTVITNKVDIYRLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLRFITDSILAIAGDDEMIRFYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLDK-IKDGPSLLCEVNTKARLTCLA  274



>gb|KFP15201.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Egretta garzetta]
Length=348

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 146/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q   ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QPWTVVPDFTHHAHSASLSAVAVNSRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGEKYVTVITNKVDIYQLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  274



>ref|XP_009813237.1| PREDICTED: p21-activated protein kinase-interacting protein 1, 
partial [Gavia stellata]
Length=347

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 145/282 (51%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  L FY
Sbjct  4     VVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITCLEFY  63

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  64    GTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSVGTDK  117

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T       
Sbjct  118   TLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERFVTVITNKVDIYKLDTASITGTIITE-  176

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR+         IL   G+D  I  +   S K       AH  R+K I      + E  +
Sbjct  177   KRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLGEF-KAHENRIKDIYSF---ERERQH  232

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             ++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  233   IIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  273



>gb|KFM03774.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Aptenodytes forsteri]
Length=348

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 146/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR          IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRFSSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLN-KIKDMPSLLCEVNTKARLTCLA  274



>gb|KFP54443.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Cathartes aura]
Length=348

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 90/286 (31%), Positives = 147/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWAVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         +L   G+D  +  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLRFITDSVLAIAGDDEIVRFYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   ERQHVIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  274



>gb|KFP65638.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Cariama cristata]
Length=299

 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 90/282 (32%), Positives = 144/282 (51%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P F+  +H +++    V+    V+G  D+TI+IYD+   +E G+L   + T+  L FY
Sbjct  5     IVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKAEHGALLQHNGTVTCLEFY  64

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  65    GAA------HLLSGAEDGIICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSVGTDK  118

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV +  L     T       
Sbjct  119   TLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYRLDTASITGT-ITTE  177

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR+         IL   G+D  I  +   S K       AH  R+K I      + E   
Sbjct  178   KRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---EREGQR  233

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             ++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  234   VIVTASSDGYIKMWNLDLNK-IKDVPSLLCEVNTKARLTCLA  274



>ref|XP_010164824.1| PREDICTED: p21-activated protein kinase-interacting protein 1, 
partial [Caprimulgus carolinensis]
Length=347

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/282 (33%), Positives = 145/282 (51%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             +IP F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  L FY
Sbjct  4     VIPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITCLEFY  63

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  64    GTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSVGTDK  117

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T       
Sbjct  118   TLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGEKYVTVITNKVDIYKLDTASITGT-ITTE  176

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR+         IL   G+D  I  +   S K       AH  R+K I      + E  +
Sbjct  177   KRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---EREGQH  232

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             ++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  233   VIVTASSDGYIKMWNLDLDK-IKDAPSLLCEVNTKARLTCLA  273



>gb|KFO10520.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Balearica regulorum gibbericeps]
Length=348

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 90/286 (31%), Positives = 147/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTIVPDFTHHAHSASLSAVSVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK+++ H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIRAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L      +  
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTAS-IIGT  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  274



>ref|XP_006972855.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Peromyscus maniculatus bairdii]
Length=387

 Score =   117 bits (293),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/312 (29%), Positives = 156/312 (50%), Gaps = 18/312 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK----SPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AGSY+  ++G+ ++    +  D +    +  F+  +H +++     +    V+G  
Sbjct  1     MELVAGSYEQVLFGFTVRREPATSGDRETWTPVADFTHHAHTASLSAVAANSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + ++    + 
Sbjct  61    DETIHIYDMKKKIEHGALVHHSGTITCLKFYGS------RHLISGAEDGLICVWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGHVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G+   +V+  KV V +L     +     N KR+         IL   G++  +  +D  
Sbjct  175   SGEKYIVVVLNKVDVYQLDTAAVSGT-ITNGKRISAVTFLSDSILAVAGDEEVVRFFDCN  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             S         AH  RVK I+     D    +++ +AS+DG I +W ++     K+ P+ L
Sbjct  234   SLVCLCEF-KAHENRVKDILSFEIPDH---HVLVTASNDGFIKMWALKQNK--KDPPSLL  287

Query  1207  AMANTKSRLTCL  1242
                NT +RLTCL
Sbjct  288   CEVNTGARLTCL  299



>emb|CAG07115.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=293

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 91/314 (29%), Positives = 153/314 (49%), Gaps = 36/314 (11%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK------SPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsg  483
             + L+AGSY+   +GY++K      SPK          F+  +H + I     S    V+G
Sbjct  5     LELVAGSYEQITFGYRVKTDGKVWSPK--------ADFTHHAHTAAITSVTASERFVVTG  56

Query  484   gsddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDP  660
               D+TI++YD+    E G+L H + TI  L FY         +L+S  ++G + +++T  
Sbjct  57    SKDETIQLYDMKKRVEHGALLHHNGTITCLEFYGSS------HLLSGGEDGLLCVWNTKK  110

Query  661   FVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKF  840
             +  LK++K H+  + SLS+HPSG L  +VG D+ L   +L  GR +F  ++ +   I+++
Sbjct  111   WQCLKSIKAHKGSVMSLSVHPSGKLALTVGADQTLRTWNLINGRSAFVKNIKQNSHIVRW  170

Query  841   NETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWD  1020
             +  G +  +V+++KV + EL     T     N KR+         IL   G+D  +   D
Sbjct  171   SPDGDSYAVVINDKVDIYELETASVTA-TITNPKRISSLQFLNNAILAIAGDDDIVRLHD  229

Query  1021  TKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPN  1200
             T   K+  +  D+                E   ++ +AS+DG I +W + +     E P+
Sbjct  230   TGKKKMVLKALDSFMM-------------EDCCVLVTASNDGFIKMWKLHLNQQA-ETPS  275

Query  1201  PLAMANTKSRLTCL  1242
              L   NT +RLTCL
Sbjct  276   LLGEVNTSARLTCL  289



>gb|EFA80892.1| hypothetical protein PPL_06127 [Polysphondylium pallidum PN500]
Length=556

 Score =   119 bits (298),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 95/326 (29%), Positives = 172/326 (53%), Gaps = 34/326 (10%)
 Frame = +1

Query  328   LIAGSYDHFIWGYK---------LKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavs  480
             +  G Y++ I+GY+         +K P+ L+ +    LF++ SH   +K     G   VS
Sbjct  128   VTVGCYENSIFGYEAILLSDYPEMKHPEGLE-VHFEKLFAYASHTGCVKAVGSGGPFMVS  186

Query  481   ggsddTIKIYDLSTCSEIGSL--HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHT  654
               +D+T+K+Y L    E G+L  HE   I  L F+         ++++A+ + ++S++  
Sbjct  187   SSTDETMKVYRLDKREEFGTLSKHE-GFITDLQFFNDT------HMVAASRDHTLSVWRV  239

Query  655   DPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSIL  834
               +  LK +K H+  +NS+SIHPSG +  SVG+D  + + D+ RG  + Y  L KE  ++
Sbjct  240   RDWECLKQLKGHKDCVNSVSIHPSGKVALSVGKDRRIFLWDMLRGVAAHYQKLPKEGLLV  299

Query  835   KFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITA  1014
             +++  G +  +V  +++ VL      +    F+  +++L     +  +L  GGED+ I+ 
Sbjct  300   EWSPAGDSYAVVFADRL-VLYTAES-KEKFSFDFKQQLLAIKYIDEELLAVGGEDKTISI  357

Query  1015  WDTKSGKVAHRIDDAHSARVKGIVVLSNNDGE----YPYLVASASSDGNICVWDVRMGMG  1182
              + K+GK+  +++ + + R+KG+ +L     E     PY+V S SSDG + VW+V +   
Sbjct  358   VNHKTGKIVKQLEGSET-RIKGLELLRFKSRESQSLTPYVV-SISSDGLMTVWNVDLEF-  414

Query  1183  GKEKPNPLAMANTKSRLTCLAGSSIK  1260
                   P+ MA T +RLTC+  S I+
Sbjct  415   ------PVGMAETDARLTCITVSKIR  434



>gb|KFW79616.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Manacus vitellinus]
Length=347

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 144/286 (50%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTIVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S  ++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGGEDGLICIWNTKRWECLKSIKAHKGQVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV +  L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVVTNKVDIYRLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYTF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +L+ +ASSDG I +W++ +    K  P+ L   NTK+RLTCLA
Sbjct  230   EGQHLIVTASSDGYIKMWNLDLD-KIKNVPSLLCEVNTKARLTCLA  274



>gb|KFW68827.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Pygoscelis adeliae]
Length=348

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 147/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KRV         IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRVSSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NT++RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTEARLTCLA  274



>gb|KFP03452.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Calypte anna]
Length=341

 Score =   116 bits (291),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 88/286 (31%), Positives = 147/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI IYD+   +E G+L   + TI  
Sbjct  1     QSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIHIYDMKKKTEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  L++++ H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLQSIRAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L      +  
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPKGEKYVTVITNKVDIYKLDTAS-IIGT  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  +  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLRFITDSILAIAGDDEMVRLYSCDSQKCLSEF-KAHENRIKDIYGF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  274



>ref|XP_003897095.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X1 [Papio anubis]
Length=392

 Score =   117 bits (293),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 93/314 (30%), Positives = 156/314 (50%), Gaps = 22/314 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    ++  D +   L+  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFAVHPESEACGDHEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D  
Sbjct  175   RGEQYVVIIQNKIDIYQLDTASISGT-ITNEKRISSVKFLSESVLAVAGDEEVIRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S         AH  RVK +        E P  +++ +ASSDG I +W  ++    K  P+
Sbjct  234   SLVCLCEF-KAHENRVKDMFSF-----EIPEQHVIVTASSDGFIKMW--KLEQDKKVPPS  285

Query  1201  PLAMANTKSRLTCL  1242
              L   NTK+RLTCL
Sbjct  286   LLCEVNTKARLTCL  299



>ref|XP_003219807.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X1 [Anolis carolinensis]
Length=363

 Score =   117 bits (292),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 92/311 (30%), Positives = 161/311 (52%), Gaps = 20/311 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M ++ G Y+  ++G+ ++     +  + +P F+  +H +++     +    V+G  D+TI
Sbjct  1     MEVLGGCYEQVLFGFAVRPG---EKWEAVPDFTHHAHSASLSALATNDRYVVTGSRDETI  57

Query  502   KIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             +IYD+    E G+L + + T+  L FY         +L+S  ++G + I++T  +  LK+
Sbjct  58    QIYDMKKKVEHGALMQHNGTVTCLEFYGNA------HLLSGGEDGFMCIWNTKRWECLKS  111

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   ++K++  G+ 
Sbjct  112   IKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHLVKWSPNGEI  171

Query  859   LYMVMDEKVSVLELGYC--PRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
               +V+  KV + +L       T+L     KR+         IL   G+D  +  +D +S 
Sbjct  172   YVVVIANKVDIYKLATASISGTIL---MEKRISSVKFLTDRILAIVGDDEFVRLYDCESQ  228

Query  1033  KVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAM  1212
                +    AH  RVK I   ++ + E   ++ +ASSDG I +W + +    K  P+ L  
Sbjct  229   NCLYEF-KAHENRVKEI---NSFEREGACVLMTASSDGYIKMWSLDLDQ-IKNAPSLLCE  283

Query  1213  ANTKSRLTCLA  1245
              NTK+RLTCLA
Sbjct  284   VNTKARLTCLA  294



>ref|NP_001244344.1| PAK1 interacting protein 1 [Macaca mulatta]
 ref|XP_005554122.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X1 [Macaca fascicularis]
 gb|EHH52704.1| PAK1-interacting protein 1 [Macaca fascicularis]
Length=392

 Score =   117 bits (293),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 93/314 (30%), Positives = 156/314 (50%), Gaps = 22/314 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    ++  D +   L+  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFAVHPESEACGDHEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D  
Sbjct  175   RGEQYVVIIQNKIDIYQLDTASISGT-ITNEKRISSVKFLSESVLAVAGDEEVIRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S         AH  RVK +        E P  +++ +ASSDG I +W  ++    K  P+
Sbjct  234   SLVCLCEF-KAHENRVKDMFSF-----EIPEQHVIVTASSDGFIKMW--KLEQDKKVPPS  285

Query  1201  PLAMANTKSRLTCL  1242
              L   NTK+RLTCL
Sbjct  286   LLCEVNTKARLTCL  299



>ref|XP_010072150.1| PREDICTED: p21-activated protein kinase-interacting protein 1, 
partial [Pterocles gutturalis]
Length=347

 Score =   116 bits (291),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 145/282 (51%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  L FY
Sbjct  4     VVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITCLEFY  63

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  64    GTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSVGTDK  117

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T       
Sbjct  118   TLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVLTNKVDIYKLDTASITGT-ITTE  176

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR+         IL   G+D  I  +   S K       AH  R+K I      + E  +
Sbjct  177   KRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---EREGQH  232

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             ++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  233   VIVTASSDGYIKMWNLDLNK-IKDVPSLLCEVNTKARLTCLA  273



>dbj|BAA91296.1| unnamed protein product [Homo sapiens]
Length=391

 Score =   117 bits (292),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 94/314 (30%), Positives = 155/314 (49%), Gaps = 22/314 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    K+  D +   L+  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFAVHPEPKACGDHEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D  
Sbjct  175   RGEQYVVIIQNKIDIYQLDTASISGT-ITNEKRISSVKFLSESVLAVAGDEEVIRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S         AH  RVK +        E P  +++ SASSDG I +W  ++    K  P+
Sbjct  234   SLVCLCEF-KAHENRVKDMFSF-----EIPEHHVIVSASSDGFIKMW--KLKQDKKVPPS  285

Query  1201  PLAMANTKSRLTCL  1242
              L   NT +RLTCL
Sbjct  286   LLCEINTNARLTCL  299



>ref|XP_004477017.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Dasypus novemcinctus]
Length=421

 Score =   117 bits (293),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 99/313 (32%), Positives = 159/313 (51%), Gaps = 19/313 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL-KSPKD----LQNLDLIPLFSFPSHLSTIKCadvsgsvavsgg  486
             M L+AG Y+  ++G+ + + P++     Q    +  F+  +H +++    V+    V+G 
Sbjct  1     MELVAGCYEQVLFGFDVQREPEESGGHQQKWTPVADFTHHAHTASLSVVAVNSRFVVTGS  60

Query  487   sddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
              D+TI IYD+    E G+L H + T+  L FY         +LIS A++G + ++    +
Sbjct  61    KDETIHIYDMKKKIEHGALVHHNGTVTCLKFYGN------RHLISGAEDGLICVWDVKKW  114

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
               LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++
Sbjct  115   ECLKSIKAHKGRVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWS  174

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDT  1023
               G+   +V+  K+ V +L     T     N KR+   A     +L   G++  +  +D 
Sbjct  175   PKGEKYIVVIMNKLDVYQLDTASITGT-ITNEKRISSVAFLSESVLAVAGDEEVVRFFDC  233

Query  1024  KSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
              S K       AH  RVK I  LS    E+  LV SASSDG I +W  ++    K  P+ 
Sbjct  234   DSLKCLCEF-KAHENRVKDI--LSFEIPEHHVLV-SASSDGFIKMW--KLKEDKKVPPSL  287

Query  1204  LAMANTKSRLTCL  1242
             L   NTK+RLTCL
Sbjct  288   LCEINTKARLTCL  300



>ref|XP_007971915.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X1 [Chlorocebus sabaeus]
Length=393

 Score =   117 bits (292),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 93/315 (30%), Positives = 154/315 (49%), Gaps = 23/315 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDL-----QNLDLIPLFSFPSHLSTIKCadvsgsvavsgg  486
             M L+AG Y+  ++G+ +    +      Q   L+  F+  +H +++    V+    V+G 
Sbjct  1     MELVAGCYEQVLFGFAVHPESEACGDHQQQWTLVADFTHHAHTASLSAVAVNSRFVVTGS  60

Query  487   sddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
              D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    +
Sbjct  61    KDETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKW  114

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
               LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++
Sbjct  115   ECLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWS  174

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDT  1023
               G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D 
Sbjct  175   PRGEQYVVIIQNKIDIYQLDTASISGT-ITNEKRISSVKFLSESVLAVAGDEEVIRFFDC  233

Query  1024  KSGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKP  1197
              S         AH  RVK +        E P  +++ +ASSDG I +W  ++    K  P
Sbjct  234   DSLVCLCEF-KAHENRVKDMFSF-----EIPEQHVIVTASSDGFIKMW--KLEQDKKVPP  285

Query  1198  NPLAMANTKSRLTCL  1242
             + L   NTK+RLTCL
Sbjct  286   SLLCEVNTKARLTCL  300



>ref|XP_006004483.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
isoform X1 [Latimeria chalumnae]
Length=366

 Score =   116 bits (291),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 87/310 (28%), Positives = 160/310 (52%), Gaps = 20/310 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M ++AGSY+  ++GY+++     +  +L+P F+  +H  ++    V+     +G  D+TI
Sbjct  1     MEVLAGSYEQILFGYRVRPGG--EKWELVPDFTHHAHSGSVSAVAVNDRYVATGSKDETI  58

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YD+    E G L H + TI+ L FY   SL     L+S  ++G + ++ T  +  LK+
Sbjct  59    QLYDMKKKVEHGVLLHHNGTISCLEFY--GSL----RLLSGGEDGLICVWDTKKWECLKS  112

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLS+HPSG L  SVG D+ L   +L  GR +F  +L +   I++++ +G+ 
Sbjct  113   IKAHKGHVTSLSVHPSGKLALSVGTDKTLRTWNLIEGRSAFIKNLKQNAHIIQWSPSGEK  172

Query  859   LYMVMDEKVSV--LELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
               +V++ +V +  LE      T++   N KR+         ++   G++  +  +D K+ 
Sbjct  173   YIVVVNNRVDIYNLETASVTGTIV---NQKRISSVKFVTDSMIAVAGDEETVRIYDCKTQ  229

Query  1033  KVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAM  1212
                     AH  RVK I        E  +++ +AS+DG I +W +   +  +  P  L  
Sbjct  230   TCRCEF-KAHENRVKSIDCFQM---ENHHIIVTASNDGYIKMWQLDNKV--QNVPTLLGE  283

Query  1213  ANTKSRLTCL  1242
              N+ +RLT +
Sbjct  284   VNSTARLTSM  293



>ref|XP_005481879.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Zonotrichia albicollis]
Length=367

 Score =   116 bits (291),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 90/287 (31%), Positives = 147/287 (51%), Gaps = 13/287 (5%)
 Frame = +1

Query  388   LQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATIN  564
             L +  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI 
Sbjct  19    LSSWTVVPDFTHHAHTASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTIT  78

Query  565   SLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCS  744
             SL FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  S
Sbjct  79    SLEFYGTS------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALS  132

Query  745   VGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVL  924
             VG D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV +  L     T  
Sbjct  133   VGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGEKYVTVIANKVDIYRLDTASITGT  192

Query  925   EFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNND  1104
                  +R+         +L   G+D  I  +   S K       AH  R+K I      +
Sbjct  193   -ITTERRISSLRFITDSVLAIAGDDEMIRFYSCDSQKCLCEF-KAHENRIKDIYSF---E  247

Query  1105  GEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
              E  +++ +ASSDG I +W++ +    ++ P+ L   NTK+RLTCLA
Sbjct  248   REGQHVIVTASSDGYIKMWNLDLD-KIRDGPSLLCEVNTKARLTCLA  293



>gb|KFW07618.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Fulmarus glacialis]
Length=348

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 91/286 (32%), Positives = 147/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVIINKVDIYKLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         +L   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLRFITDSVLAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  274



>ref|XP_003468779.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X1 [Cavia porcellus]
Length=387

 Score =   116 bits (291),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 91/312 (29%), Positives = 159/312 (51%), Gaps = 18/312 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AGSY+  ++G+ +    K+  D +    +  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGSYEQVLFGFTVHPDRKANGDPEKWTSVADFTHHAHTASLSAVAVNNRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+   +E G+L H + TI  L FY         +LIS A++G + ++ T  + 
Sbjct  61    DETIHIYDMKKKTEHGALVHHNGTITCLKFYGS------RHLISGAEDGLICVWDTKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK+++ H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIRAHKGHVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQSAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G+   +V+  K+ V +L +         N KRV   A     +L   G++  +  +D +
Sbjct  175   SGEKYVVVILNKIDVYQL-HTAAVSGTITNEKRVSSIAFLSDSVLAVAGDEEVVRCFDCE  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             S         AH  RVK +      D    +++ +ASSDG I +W ++        P+ L
Sbjct  234   SLACLCEF-KAHENRVKDMFSFEIPDH---HVLVTASSDGFIKMWKLKHDKS--VPPSLL  287

Query  1207  AMANTKSRLTCL  1242
                +T++RLTCL
Sbjct  288   CAVSTQARLTCL  299



>ref|XP_005003323.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X2 [Cavia porcellus]
Length=383

 Score =   116 bits (291),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 91/312 (29%), Positives = 159/312 (51%), Gaps = 18/312 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AGSY+  ++G+ +    K+  D +    +  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGSYEQVLFGFTVHPDRKANGDPEKWTSVADFTHHAHTASLSAVAVNNRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+   +E G+L H + TI  L FY         +LIS A++G + ++ T  + 
Sbjct  61    DETIHIYDMKKKTEHGALVHHNGTITCLKFYGS------RHLISGAEDGLICVWDTKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK+++ H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIRAHKGHVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQSAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G+   +V+  K+ V +L +         N KRV   A     +L   G++  +  +D +
Sbjct  175   SGEKYVVVILNKIDVYQL-HTAAVSGTITNEKRVSSIAFLSDSVLAVAGDEEVVRCFDCE  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             S         AH  RVK +      D    +++ +ASSDG I +W ++        P+ L
Sbjct  234   SLACLCEF-KAHENRVKDMFSFEIPDH---HVLVTASSDGFIKMWKLKHDKS--VPPSLL  287

Query  1207  AMANTKSRLTCL  1242
                +T++RLTCL
Sbjct  288   CAVSTQARLTCL  299



>gb|KFQ78722.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Phoenicopterus ruber ruber]
Length=345

 Score =   116 bits (290),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 145/282 (51%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  L FY
Sbjct  3     VVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITCLEFY  62

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  63    GTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSVGTDK  116

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T       
Sbjct  117   TLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTASITGT-ITTE  175

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR+         IL   G+D  I  +   S K       AH  R+K I      + E  +
Sbjct  176   KRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---EREGQH  231

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             ++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  232   VIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  272



>gb|KGL77869.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Tinamus guttatus]
Length=345

 Score =   115 bits (289),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 90/286 (31%), Positives = 147/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI IYD+    E G+L   + T+  
Sbjct  1     QSWAVVPDFTHHAHTASLSAIAVNSRYVVTGSKDETIHIYDMKKKIEHGALLQHNGTVTC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTS------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++ +G+    V+  KV V +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPSGEKYVTVITNKVDVYKLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  +  ++  S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLTFITDSILALAGDDEIVRLFNCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K  P+ L   +TK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDINK-IKNLPSLLGKVDTKARLTCLA  274



>ref|NP_001139979.1| p21-activated protein kinase-interacting protein 1-like [Salmo 
salar]
 gb|ACM09000.1| p21-activated protein kinase-interacting protein 1-like [Salmo 
salar]
Length=363

 Score =   115 bits (289),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 159/314 (51%), Gaps = 20/314 (6%)
 Frame = +1

Query  313   GKSMSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             G  + LIAGSY+   +GY+L + +  Q       F+  +H +++     S     +G  D
Sbjct  2     GPVIKLIAGSYEQIAFGYRLSTGE--QEWTATADFTHHAHTASVSAVATSERYIATGSRD  59

Query  493   dTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             +TI+IYD+    E G+L H   TI+ L FY         +L+S   +G + ++ T  +  
Sbjct  60    ETIQIYDMKKRVEHGALLHHDGTISCLEFYGTS------HLLSGGQDGLLCVWSTRNWEC  113

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNET  849
             LK+++ H+  + SLS+HPSG L  +VG D+ L   +L  GR +F  ++ +   I+K++  
Sbjct  114   LKSIRAHKGQVTSLSVHPSGKLALTVGTDKTLRTWNLIDGRSAFIKNIKQNAVIVKWSPE  173

Query  850   GKTLYMVMDEKVSV--LELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDT  1023
             G    +V+ +KV V  LE      T++   N KR+         IL   G+D  +   D 
Sbjct  174   GDKYVVVVSDKVDVYNLETATLTSTII---NPKRISSIKFLTNYILAVAGDDETVRLCDV  230

Query  1024  KSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNP  1203
              + KV     +AH  RVK +   + +D  +  LV +AS+DG I +W  ++ +   E P  
Sbjct  231   NTQKVLCEF-EAHETRVKSVDSFTMDD--FCVLV-TASNDGFIKMW--KLNLESLEPPVL  284

Query  1204  LAMANTKSRLTCLA  1245
             L   NT +RLTCLA
Sbjct  285   LGKVNTTARLTCLA  298



>gb|KFW08264.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Eurypyga helias]
Length=349

 Score =   115 bits (289),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 145/282 (51%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  L FY
Sbjct  5     VVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITCLEFY  64

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  65    GTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSVGTDK  118

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T       
Sbjct  119   TLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTASITGT-ITTD  177

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR+         IL   G+D  I  +   S K       AH  R+K I      + E  +
Sbjct  178   KRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---EREGQH  233

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             ++ +ASSDG I +W++ +    K++P  L   NTK+RLTCLA
Sbjct  234   VIVTASSDGYIKMWNLDL-TKIKDEPYLLCEVNTKARLTCLA  274



>ref|XP_010122274.1| PREDICTED: p21-activated protein kinase-interacting protein 1, 
partial [Chlamydotis macqueenii]
Length=347

 Score =   115 bits (289),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 89/282 (32%), Positives = 144/282 (51%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  L FY
Sbjct  4     VVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKVEHGALLQHNGTITCLEFY  63

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK+++ H+  + SLSIHPSG L  SVG D+
Sbjct  64    GTT------HLLSGAEDGLICIWNTKRWECLKSIRAHKGHVTSLSIHPSGKLALSVGTDK  117

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T       
Sbjct  118   TLRTWNLVEGRSAFIKNLKQNAQIIKWSPDGERYVTVITNKVDIYKLDTASITGT-ITTE  176

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR+         IL   G+D  I  +   S K       AH  R+K        + E  +
Sbjct  177   KRISSLKFITDSILAIAGDDEMIRFYSCDSQKCLCEF-KAHENRIKDTYSF---EREGQH  232

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             ++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  233   VIVTASSDGYIKIWNLDLN-KIKDMPSLLCEVNTKARLTCLA  273



>ref|XP_003827592.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X2 [Pan paniscus]
Length=392

 Score =   116 bits (290),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 93/314 (30%), Positives = 155/314 (49%), Gaps = 22/314 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    ++  D +   L+  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFAVHPEPEACGDHEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D  
Sbjct  175   RGEQYVVIIQNKIDIYQLDTASISGT-ITNEKRISSVKFLSESVLAVAGDEEVIRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S         AH  RVK +        E P  +++ SASSDG I +W  ++    K  P+
Sbjct  234   SLVCLCEF-KAHENRVKDMFSF-----EIPEHHVIVSASSDGFIKMW--KLKQDKKVPPS  285

Query  1201  PLAMANTKSRLTCL  1242
              L   NT +RLTCL
Sbjct  286   LLCEVNTNARLTCL  299



>gb|KFW92459.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Phalacrocorax carbo]
Length=348

 Score =   115 bits (289),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 147/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKVEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTASVTGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLRFITDSILAITGDDEIIRFYSCDSQKCLCEF-KAHDNRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I VW++ +    K++ + L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKVWNLDLN-KIKDELSLLCEVNTKARLTCLA  274



>ref|XP_518863.3| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X2 [Pan troglodytes]
Length=392

 Score =   116 bits (290),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 93/314 (30%), Positives = 155/314 (49%), Gaps = 22/314 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    ++  D +   L+  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFAVHPEPEACGDHEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D  
Sbjct  175   RGEQYVVIIQNKIDIYQLDTASISGT-ITNEKRISSVKFLSESVLAVAGDEEVIRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S         AH  RVK +        E P  +++ SASSDG I +W  ++    K  P+
Sbjct  234   SLVCLCEF-KAHENRVKDMFSF-----EIPEHHVIVSASSDGFIKMW--KLKQDKKVPPS  285

Query  1201  PLAMANTKSRLTCL  1242
              L   NT +RLTCL
Sbjct  286   LLCEVNTNARLTCL  299



>gb|KFP98116.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Leptosomus discolor]
Length=348

 Score =   115 bits (288),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 146/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    VS    V+G  D+TI+IYD+    E G+L   + T+  
Sbjct  1     QSWTIVPDFTHHAHSASLSAVAVSNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTVTC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY+        +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYSTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         I    G+D  +  +   S K       AH  R+K +      + 
Sbjct  174   ITTEKRISSLRFITDSIFAIAGDDEIVRFYSCDSQKCLCEF-KAHENRIKDLYSF---EK  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W V +    ++ P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWSVDLN-KIQDVPSLLCEVNTKARLTCLA  274



>gb|KDQ19095.1| hypothetical protein BOTBODRAFT_154019 [Botryobasidium botryosum 
FD-172 SS1]
Length=506

 Score =   117 bits (292),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 98/344 (28%), Positives = 167/344 (49%), Gaps = 48/344 (14%)
 Frame = +1

Query  319   SMSLIAGSYDHFIWGYKLKSPKDLQNL------DLIPLFSFPSHLSTIKCadvsgsvavs  480
             +  +IAGSY+  ++G +   P             L P+F FP+H+  +K    S      
Sbjct  104   TFKIIAGSYEKILYGLEGVFPVTEDGALSPSVPALTPIFIFPAHVGCVKAVAASPGGGKW  163

Query  481   ggsddT---IKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIY  648
               S  T   +K++DL    E+G L     +I  L F   PS +   +L+SA+++G++ ++
Sbjct  164   LASGSTDEIVKVWDLRRRKEVGGLIQHVGSITHLEF---PSRT---HLLSASEDGTLCLF  217

Query  649   HTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVS  828
             HT  +  L+++K H+  IN +++HPSG    SVG+D  L M D  RGR S    LGKE  
Sbjct  218   HTRDWAVLRSLKGHKGRINCVAVHPSGKAALSVGKDRTLRMWDFMRGRGSASTKLGKEGE  277

Query  829   ILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE-FNNAKRVL-----CAAPGEGGILFTG  990
             +++++  G  L +   +  S ++L      +L   N+  R+        + GEG +L  G
Sbjct  278   LVRWSTAGTMLAV---QAQSTIDLYSTDMNLLHSINHLSRIQDIKFSTRSGGEGQVLLVG  334

Query  991   GEDRNITAWDTKSGKVAHRIDD---AHSARVKGIVVLSNNDGEYP----------YLVAS  1131
              ED+ ++ ++ + G+    +      HS RVK +  L+     YP           L+++
Sbjct  335   AEDKKVSVYEMEEGETQFTVIAEFIGHSNRVKALDTLAI---AYPSNSAKPSISTILLST  391

Query  1132  ASSDGNICVWDVR------MGMGGKEKPNPLAMANTK-SRLTCL  1242
             ASSDG I V+++         +   E+  PL   +TK +RLTC+
Sbjct  392   ASSDGKIHVYNLAALPALGQALTAPEQIEPLVAYDTKGTRLTCI  435



>gb|KFU98400.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Tauraco erythrolophus]
Length=348

 Score =   115 bits (288),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 146/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  + P F+  +H +++    V+    V+G  D+TI+IYD+   +E G+L   + T+  
Sbjct  1     QSWTVAPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKTEHGALLQHNGTVTC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK+++ H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGAA------HLLSGAEDGLICIWNTKRWECLKSIRAHKGQVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  +V +  L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNRVDIYRLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLIFITDSILAIAGDDEMIRFYSCDSHKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  274



>ref|XP_009324823.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Pygoscelis adeliae]
Length=354

 Score =   115 bits (288),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 145/282 (51%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  L FY
Sbjct  11    VVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITCLEFY  70

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  71    GTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSVGTDK  124

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T       
Sbjct  125   TLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTASITGT-ITTE  183

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KRV         IL   G+D  I  +   S K       AH  R+K I      + E  +
Sbjct  184   KRVSSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---EREGQH  239

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             ++ +ASSDG I +W++ +    K+ P+ L   NT++RLTCLA
Sbjct  240   VIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTEARLTCLA  280



>ref|NP_060376.2| p21-activated protein kinase-interacting protein 1 [Homo sapiens]
 sp|Q9NWT1.2|PK1IP_HUMAN RecName: Full=p21-activated protein kinase-interacting protein 
1; AltName: Full=PAK/PLC-interacting protein 1; Short=hPIP1; 
AltName: Full=PAK1-interacting protein 1; AltName: Full=WD 
repeat-containing protein 84 [Homo sapiens]
 gb|EAW55270.1| PAK1 interacting protein 1, isoform CRA_d [Homo sapiens]
 dbj|BAI46081.1| PAK1 interacting protein 1 [synthetic construct]
Length=392

 Score =   115 bits (289),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 93/314 (30%), Positives = 155/314 (49%), Gaps = 22/314 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    ++  D +   L+  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFAVHPEPEACGDHEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D  
Sbjct  175   RGEQYVVIIQNKIDIYQLDTASISGT-ITNEKRISSVKFLSESVLAVAGDEEVIRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S         AH  RVK +        E P  +++ SASSDG I +W  ++    K  P+
Sbjct  234   SLVCLCEF-KAHENRVKDMFSF-----EIPEHHVIVSASSDGFIKMW--KLKQDKKVPPS  285

Query  1201  PLAMANTKSRLTCL  1242
              L   NT +RLTCL
Sbjct  286   LLCEINTNARLTCL  299



>ref|XP_009448764.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X1 [Pan troglodytes]
Length=393

 Score =   115 bits (289),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 93/315 (30%), Positives = 153/315 (49%), Gaps = 23/315 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDL-----QNLDLIPLFSFPSHLSTIKCadvsgsvavsgg  486
             M L+AG Y+  ++G+ +    +      Q   L+  F+  +H +++    V+    V+G 
Sbjct  1     MELVAGCYEQVLFGFAVHPEPEACGDHEQQWTLVADFTHHAHTASLSAVAVNSRFVVTGS  60

Query  487   sddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
              D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    +
Sbjct  61    KDETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKW  114

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
               LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++
Sbjct  115   ECLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWS  174

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDT  1023
               G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D 
Sbjct  175   PRGEQYVVIIQNKIDIYQLDTASISGT-ITNEKRISSVKFLSESVLAVAGDEEVIRFFDC  233

Query  1024  KSGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKP  1197
              S         AH  RVK +        E P  +++ SASSDG I +W  ++    K  P
Sbjct  234   DSLVCLCEF-KAHENRVKDMFSF-----EIPEHHVIVSASSDGFIKMW--KLKQDKKVPP  285

Query  1198  NPLAMANTKSRLTCL  1242
             + L   NT +RLTCL
Sbjct  286   SLLCEVNTNARLTCL  300



>ref|XP_008951136.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X1 [Pan paniscus]
Length=393

 Score =   115 bits (289),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 93/315 (30%), Positives = 153/315 (49%), Gaps = 23/315 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDL-----QNLDLIPLFSFPSHLSTIKCadvsgsvavsgg  486
             M L+AG Y+  ++G+ +    +      Q   L+  F+  +H +++    V+    V+G 
Sbjct  1     MELVAGCYEQVLFGFAVHPEPEACGDHEQQWTLVADFTHHAHTASLSAVAVNSRFVVTGS  60

Query  487   sddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
              D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    +
Sbjct  61    KDETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKW  114

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
               LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++
Sbjct  115   ECLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWS  174

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDT  1023
               G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D 
Sbjct  175   PRGEQYVVIIQNKIDIYQLDTASISGT-ITNEKRISSVKFLSESVLAVAGDEEVIRFFDC  233

Query  1024  KSGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKP  1197
              S         AH  RVK +        E P  +++ SASSDG I +W  ++    K  P
Sbjct  234   DSLVCLCEF-KAHENRVKDMFSF-----EIPEHHVIVSASSDGFIKMW--KLKQDKKVPP  285

Query  1198  NPLAMANTKSRLTCL  1242
             + L   NT +RLTCL
Sbjct  286   SLLCEVNTNARLTCL  300



>gb|KFU92118.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Chaetura pelagica]
Length=348

 Score =   115 bits (287),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 91/286 (32%), Positives = 146/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q   ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QAWAVVPDFTHHAHSASLSVVAVNSRYVVTGSRDETIQIYDMKKRVEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK+++ H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIRAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGEKYVTVITNKVDIYKLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITIEKRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIFSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  274



>ref|XP_005716957.1| unnamed protein product [Chondrus crispus]
 emb|CDF37138.1| unnamed protein product [Chondrus crispus]
Length=369

 Score =   115 bits (288),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 98/312 (31%), Positives = 160/312 (51%), Gaps = 22/312 (7%)
 Frame = +1

Query  325   SLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIK  504
             ++  G YD  + G  L+ P     L L   F++ SH++ ++ A +SGS  V+G +D+T++
Sbjct  15    NICVGGYDGSVAGLTLR-PDAEDLLSLQATFAYASHITAVRSAALSGSTLVTGSADETVR  73

Query  505   IYDLSTCSEIGSLHE-SATINSLAFYT--PPSLSFPHNLISAADNGSVSIYHTDPFVHLK  675
             IYDL+   E GSL E S T+N+L F+   P  L     L+SA D+  + ++ T  +  LK
Sbjct  74    IYDLARRVERGSLFEHSGTVNALVFFRDGPRRL-----LMSAGDDALMCVWRTSDWKCLK  128

Query  676   TVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGK  855
              +  H+  +  +++HPS  +  SV +D  L M ++ +G+ +F     +  +       G 
Sbjct  129   RMHGHQAPVLDVAVHPSARVALSVAKDRSLFMWNMVKGKIAFSAKTKETPATTVEWAPGG  188

Query  856   TLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGK  1035
               YM++  K SV       + V  F + + VL AA  + G+L TGGED+ +  WD ++G 
Sbjct  189   ERYMLVAGK-SVKLSNVEGKDVETFVHERPVLAAAFVKEGVLATGGEDKIVRVWDQRTGG  247

Query  1036  VAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMA  1215
                 I   H  RV+G+  +   DG    LV +A S G + +WD RMG   + +     + 
Sbjct  248   CV--IACKHEKRVRGVACV---DG----LVVAADSGGGVKIWDARMGGSARLE---TCLG  295

Query  1216  NTKSRLTCLAGS  1251
                 RLTCLA +
Sbjct  296   GGDMRLTCLAAA  307



>ref|XP_005249261.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X1 [Homo sapiens]
Length=393

 Score =   115 bits (288),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 93/315 (30%), Positives = 153/315 (49%), Gaps = 23/315 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDL-----QNLDLIPLFSFPSHLSTIKCadvsgsvavsgg  486
             M L+AG Y+  ++G+ +    +      Q   L+  F+  +H +++    V+    V+G 
Sbjct  1     MELVAGCYEQVLFGFAVHPEPEACGDHEQQWTLVADFTHHAHTASLSAVAVNSRFVVTGS  60

Query  487   sddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPF  663
              D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    +
Sbjct  61    KDETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKW  114

Query  664   VHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFN  843
               LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++
Sbjct  115   ECLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWS  174

Query  844   ETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDT  1023
               G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D 
Sbjct  175   PRGEQYVVIIQNKIDIYQLDTASISGT-ITNEKRISSVKFLSESVLAVAGDEEVIRFFDC  233

Query  1024  KSGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKP  1197
              S         AH  RVK +        E P  +++ SASSDG I +W  ++    K  P
Sbjct  234   DSLVCLCEF-KAHENRVKDMFSF-----EIPEHHVIVSASSDGFIKMW--KLKQDKKVPP  285

Query  1198  NPLAMANTKSRLTCL  1242
             + L   NT +RLTCL
Sbjct  286   SLLCEINTNARLTCL  300



>gb|ADD39719.1| PAK1 interacting protein 1 [Scylla paramamosain]
Length=387

 Score =   115 bits (288),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 91/312 (29%), Positives = 164/312 (53%), Gaps = 16/312 (5%)
 Frame = +1

Query  316   KSMSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsdd  495
             + + +I G+ + F+ GY +   +D + + L  +F+  SH  +++   V G +  SG +D+
Sbjct  3     RKLQIIVGTNEEFVLGYDVTHKED-RRVSLHQIFADHSHNGSVRQVAVGGKILASGAADE  61

Query  496   TIKIYDLSTCSEIGSLHE-SATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHL  672
              I++++L+T +E+G + E   TI+SL+F+         +L SAA++G++ IY    +   
Sbjct  62    MIRVFNLATRTEVGIIMEHQGTISSLSFHGAT------HLFSAAEDGNICIYKQGKWQCE  115

Query  673   KTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETG  852
             KT++ HR G+  L++HPSG +  S+GRD  L   +L +GR+++   L      + ++  G
Sbjct  116   KTLRGHRGGVVDLAVHPSGKMALSIGRDNTLRTWNLIKGRKAYITKLKGAADSVHWSPKG  175

Query  853   KTLYMVMDEKVSVLEL--GYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
                 +V    V + E+  G+   ++ +F      L     +  I+  GGE +NI  +D  
Sbjct  176   MQYLIVKGSCVDIYEVATGHVEHSI-DFKEHISALTFVTDD--IIAVGGEGKNICLYDIA  232

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             + K+      AH++RVK +  L     E  +LV SASSDG I VW + + +    +P  L
Sbjct  233   T-KIEMGQWTAHASRVKCLCTLPGIAAEELWLV-SASSDGIIKVWSLEL-LSLCSEPKLL  289

Query  1207  AMANTKSRLTCL  1242
                NT  R+ C+
Sbjct  290   GEVNTTCRIICM  301



>ref|XP_010213840.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Tinamus guttatus]
Length=347

 Score =   114 bits (286),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 148/287 (52%), Gaps = 13/287 (5%)
 Frame = +1

Query  388   LQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATIN  564
             +++  ++P F+  +H +++    V+    V+G  D+TI IYD+    E G+L   + T+ 
Sbjct  1     MRSWAVVPDFTHHAHTASLSAIAVNSRYVVTGSKDETIHIYDMKKKIEHGALLQHNGTVT  60

Query  565   SLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCS  744
              L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  S
Sbjct  61    CLEFYGTS------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALS  114

Query  745   VGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVL  924
             VG D+ L   +L  GR +F  +L +   I+K++ +G+    V+  KV V +L     T  
Sbjct  115   VGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPSGEKYVTVITNKVDVYKLDTASITGT  174

Query  925   EFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNND  1104
                  KR+         IL   G+D  +  ++  S K       AH  R+K I      +
Sbjct  175   -ITTEKRISSLTFITDSILALAGDDEIVRLFNCDSQKCLCEF-KAHENRIKDIYSF---E  229

Query  1105  GEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
              E  +++ +ASSDG I +W++ +    K  P+ L   +TK+RLTCLA
Sbjct  230   REGQHVIVTASSDGYIKMWNLDINK-IKNLPSLLGKVDTKARLTCLA  275



>ref|XP_007234942.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
isoform X2 [Astyanax mexicanus]
Length=361

 Score =   115 bits (287),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 87/309 (28%), Positives = 161/309 (52%), Gaps = 18/309 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + ++AGSY+  ++GY++  P++ ++  + P+F+  +H +++     S     +G  D+TI
Sbjct  5     VEVVAGSYEQVVFGYRV-FPEE-KDWTVKPVFTHHAHTASLSTVAASKQFIATGSKDETI  62

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YD+++ +E GSL H   T++ L FY         +L+S  ++G + ++ T  +  LKT
Sbjct  63    QLYDMTSKTEHGSLLHHEGTVSCLEFYGTS------HLLSGGEDGLLCVWSTKTWECLKT  116

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  ++S+S+HPSG L  SVG D+ L   +L  GR +F   + +   +++++  G  
Sbjct  117   IKAHKGHVSSMSVHPSGKLALSVGTDKKLRTWNLIDGRSAFCKIIKENAHLVQWSPEGDK  176

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               + +++K+ V  L      +      KR+         +L   G+D N+  +D  S K 
Sbjct  177   YVVAVNDKLDVYSLE-SASIISTLTYRKRISSIKFLNNTLLAVAGDDENVQIYDLDSEKC  235

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  RVK +  L    GE   ++ +AS+DG I +W   M    + +   L   N
Sbjct  236   ICEF-KAHEIRVKAVESLMM--GELCVII-TASNDGFIKLWKFNM----EPEVCLLGQVN  287

Query  1219  TKSRLTCLA  1245
             T +RLTCL+
Sbjct  288   TTARLTCLS  296



>gb|AEB61011.1| p21-activated protein kinase-interacting protein 1-like protein, 
partial [Equus caballus]
Length=324

 Score =   114 bits (285),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 91/314 (29%), Positives = 156/314 (50%), Gaps = 22/314 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    K+ +D +    +  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFAVRPEPKASEDHEKWTPVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    + G+L H + TI  L FY         +LIS A++G + ++    + 
Sbjct  61    DETIHIYDMKKKIDHGALVHHNGTITCLKFYGNG------HLISGAEDGLICVWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
             +LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   YLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +V+  K+ V  L     +     N KR+         +L   G++  +  +D  
Sbjct  175   RGEKYVVVILNKIDVYHLDTASVSGT-ITNEKRISSVTFLSESVLAVAGDEEVVRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S     +   AH  RVK +        E P  +++ +ASSDG I +W  ++    K  P+
Sbjct  234   SLTCLCQF-KAHENRVKDMFSF-----EIPEHHVIVTASSDGFIKMW--KLQQDKKVPPS  285

Query  1201  PLAMANTKSRLTCL  1242
              L   NT SRLTCL
Sbjct  286   LLCEVNTNSRLTCL  299



>gb|AAH10907.1| PAK1 interacting protein 1 [Homo sapiens]
 gb|ABM83724.1| PAK1 interacting protein 1 [synthetic construct]
 gb|ABM87044.1| PAK1 interacting protein 1 [synthetic construct]
Length=392

 Score =   115 bits (287),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 93/314 (30%), Positives = 155/314 (49%), Gaps = 22/314 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    ++  D +   L+  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFAVHPEPEACGDHEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D  
Sbjct  175   RGEQYVVIIQNKIDIYQLDTASISGT-VTNEKRISSVKFLSESVLAVAGDEEVIRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S         AH  RVK +        E P  +++ SASSDG I +W  ++    K  P+
Sbjct  234   SLVCLCEF-KAHENRVKDMFSF-----EIPEHHVIVSASSDGFIKMW--KLEQDKKVPPS  285

Query  1201  PLAMANTKSRLTCL  1242
              L   NT +RLTCL
Sbjct  286   LLCEINTNARLTCL  299



>gb|AIC62185.1| PAK1IP1, partial [synthetic construct]
Length=392

 Score =   115 bits (287),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 93/314 (30%), Positives = 155/314 (49%), Gaps = 22/314 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    ++  D +   L+  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFAVHPEPEACGDHEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D  
Sbjct  175   RGEQYVVIIQNKIDIYQLDTASISGT-VTNEKRISSVKFLSESVLAVAGDEEVIRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S         AH  RVK +        E P  +++ SASSDG I +W  ++    K  P+
Sbjct  234   SLVCLCEF-KAHENRVKDMFSF-----EIPEHHVIVSASSDGFIKMW--KLEQDKKVPPS  285

Query  1201  PLAMANTKSRLTCL  1242
              L   NT +RLTCL
Sbjct  286   LLCEINTNARLTCL  299



>ref|XP_009272008.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Aptenodytes forsteri]
Length=364

 Score =   114 bits (286),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 144/282 (51%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  L FY
Sbjct  21    VVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITCLEFY  80

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  81    GTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSVGTDK  134

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T       
Sbjct  135   TLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTASITGT-ITTE  193

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR          IL   G+D  I  +   S K       AH  R+K I      + E  +
Sbjct  194   KRFSSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---EREGQH  249

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             ++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  250   VIVTASSDGYIKMWNLDLN-KIKDMPSLLCEVNTKARLTCLA  290



>ref|NP_001026170.1| p21-activated protein kinase-interacting protein 1-like [Gallus 
gallus]
 sp|Q5ZKU8.1|PK1IP_CHICK RecName: Full=p21-activated protein kinase-interacting protein 
1-like; AltName: Full=PAK1-interacting protein 1-like [Gallus 
gallus]
 emb|CAG31645.1| hypothetical protein RCJMB04_9b18 [Gallus gallus]
Length=369

 Score =   114 bits (286),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 93/309 (30%), Positives = 155/309 (50%), Gaps = 16/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             M L+AG Y+  ++G+   + +  +   + P F+  +H +++    V+    V+G  D++I
Sbjct  1     MELVAGCYEQILFGF---AARPGEPWTVTPDFTHHAHTASLSAVAVNSKYVVTGSRDESI  57

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             +IYD+    E G+L   + TI  L FY         +L+S A++G + I++T  +  LK+
Sbjct  58    QIYDMRKKVEHGALLQHNGTITCLEFYGTA------HLLSGAEDGLICIWNTKRWECLKS  111

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++  G+ 
Sbjct  112   IKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGEK  171

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
                V+  KV + +L     T       KR+         +L   G+D  I  +   S K 
Sbjct  172   YVTVITNKVDIYKLDTASITGT-ITIEKRISSIRFITDSVLAIAGDDEIIRFYSCDSQKC  230

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   A   R+K I      + E  +++ +ASSDG I VW++ +       P+ L   +
Sbjct  231   LCEF-KARENRIKDIYSF---EREGQHVIVTASSDGYIKVWNLDLNKIN-NVPSLLCEVS  285

Query  1219  TKSRLTCLA  1245
             TK+RLTCLA
Sbjct  286   TKARLTCLA  294



>gb|AAK57477.1|AF283303_1 PAK/PLC-interacting protein 1 [Homo sapiens]
Length=392

 Score =   115 bits (287),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 91/312 (29%), Positives = 154/312 (49%), Gaps = 18/312 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    ++  D +   L+  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFAVHPEPEACGDHEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H++ +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKRQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +++  K+ + +L     +     N KR+         +L   G++  I  +D  
Sbjct  175   RGEQYVVIIQNKIDIYQLDTASISGT-ITNEKRISSVKFLSESVLAVAGDEEVIRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             S         AH  RVK +      +    +++ SASSDG I  W  ++    K  P+ L
Sbjct  234   SLVCLCEF-KAHENRVKDMFSFEILEH---HVIVSASSDGFIKRW--KLKQDKKVPPSLL  287

Query  1207  AMANTKSRLTCL  1242
                NT +RLTCL
Sbjct  288   CEINTNARLTCL  299



>ref|XP_003055007.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60259.1| predicted protein [Micromonas pusilla CCMP1545]
Length=518

 Score =   116 bits (290),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 95/344 (28%), Positives = 163/344 (47%), Gaps = 43/344 (13%)
 Frame = +1

Query  328   LIAGSYDHFIWGYKLKS------------PKDLQNLDLIPLFSFPSHLSTIKCadvsgsv  471
             ++AGSY+ F++GY++                      +   F+  +HL+  K     G  
Sbjct  4     VVAGSYERFVFGYRVDGLPSSSSSSSSARESGAAAAAVNHAFTLDAHLTQCKSVAARGGF  63

Query  472   avsggsddTIKIYDLS---TCSEIGSL--HESATINSLAFYTPPSLSFPHNLISAADNGS  636
               SGG+DD +++Y  +     +++G+L  HE  T+  +  + P S + P  L++   +G+
Sbjct  64    IASGGADDLVRVYHHNPDGALADLGTLAGHE-GTVQCMELHGPSSSTEPTRLVTGGQDGT  122

Query  637   VSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLG  816
             + ++  + +  LKT+K HR G+ ++S+H SG +  S G D C+AM D++RGR +    L 
Sbjct  123   IIVWSVNAWDALKTLKAHRGGVQNVSVHKSGAVALSSGADGCVAMWDMKRGRVAHKTKLK  182

Query  817   KEVSILKFNETGKTLYMVMDEKVSVL--ELGYCPRTVLEFNNAKRVLCAA-PGEGGILFT  987
              +  +L F  +G   Y     + ++   E G        F+   RV+CA   G   +   
Sbjct  183   VKPELLSFTPSGTKYYACAQSRTTITSAETGA---VCGVFDAPSRVMCATMAGSDALAVL  239

Query  988   GGEDRNITAWDTKSGKVAH--RIDDAHSARVKGIVV----------LSNNDGEYPYLVAS  1131
             G E  ++  +DT++    H  RI  AH  RVKG+VV          +    G    LV +
Sbjct  240   GLEGGDVVGYDTRAPPTKHALRITKAHPTRVKGVVVPYDDHDAGVAMGGPAGGATSLV-T  298

Query  1132  ASSDGNICVWDVRM------GMGGKEKPNPLAMANTKSRLTCLA  1245
             ASS+G + +WD+R+          ++   P+A A    R TCLA
Sbjct  299   ASSEGVVRLWDLRVAGKGGGAASARDIDEPVAEAEGGGRFTCLA  342



>ref|XP_009505636.1| PREDICTED: p21-activated protein kinase-interacting protein 1, 
partial [Phalacrocorax carbo]
Length=347

 Score =   114 bits (285),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 145/282 (51%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  L FY
Sbjct  4     VVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKVEHGALLQHNGTITCLEFY  63

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  64    GTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSVGTDK  117

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T       
Sbjct  118   TLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTASVTGT-ITTE  176

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR+         IL   G+D  I  +   S K       AH  R+K I      + E  +
Sbjct  177   KRISSLRFITDSILAITGDDEIIRFYSCDSQKCLCEF-KAHDNRIKDIYSF---EREGQH  232

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             ++ +ASSDG I VW++ +    K++ + L   NTK+RLTCLA
Sbjct  233   VIVTASSDGYIKVWNLDLN-KIKDELSLLCEVNTKARLTCLA  273



>gb|KFQ71823.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Phaethon lepturus]
Length=346

 Score =   114 bits (284),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 90/282 (32%), Positives = 144/282 (51%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P F+  +H +++    V+    V+G  D+TI+IYD+   +E G+L   + TI  L FY
Sbjct  3     VVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKTEHGALLQHNGTITCLEFY  62

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  63    GTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSVGTDK  116

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV V +L     T       
Sbjct  117   TLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDVYKLDTASITGT-ITTE  175

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR+         IL   G+D  I  +   S K       AH  R+K I      + E  +
Sbjct  176   KRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---EREGQH  231

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             ++ +ASSD  I +W++ +     + P+ L   NTK+RLTCLA
Sbjct  232   VIVTASSDSYIKMWNLDLNKIN-DVPSLLCEVNTKARLTCLA  272



>ref|XP_008920547.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Manacus vitellinus]
Length=423

 Score =   114 bits (286),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 142/282 (50%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  L FY
Sbjct  80    IVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITCLEFY  139

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S  ++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  140   GTA------HLLSGGEDGLICIWNTKRWECLKSIKAHKGQVTSLSIHPSGKLALSVGTDK  193

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV +  L     T       
Sbjct  194   TLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVVTNKVDIYRLDTASITGT-ITTE  252

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR+         IL   G+D  I  +   S K       AH  R+K I      + E  +
Sbjct  253   KRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYTF---EREGQH  308

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             L+ +ASSDG I +W++ +    K  P+ L   NTK+RLTCLA
Sbjct  309   LIVTASSDGYIKMWNLDLDK-IKNVPSLLCEVNTKARLTCLA  349



>ref|XP_007488023.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X1 [Monodelphis domestica]
Length=387

 Score =   114 bits (285),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 95/312 (30%), Positives = 153/312 (49%), Gaps = 18/312 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL-KSP-KDLQNLDLIPL--FSFPSHLSTIKCadvsgsvavsggs  489
             M L+ G Y+  ++G+ + + P    QN    P+  F+   H +++    V+    V+G  
Sbjct  1     MELVCGCYEQVLFGFAVHREPGASGQNEKWTPVANFTHHGHAASLSAVAVNNRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H + TIN L F+         +LIS  D+G + ++    + 
Sbjct  61    DETIHIYDMKKKVEHGALLHHNGTINCLKFFGNG------HLISGGDDGLICVWDAKKWD  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  + SLS+HPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGHVTSLSVHPSGKLALSVGTDKTLRTWNLIEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +V   K+ + +L     T       KR+   A     IL   G++  +  +D  
Sbjct  175   GGEKYIVVTMNKIDIYQLETASITGT-ITTGKRISSVAFISDSILAVAGDEEIVRLFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             S K       AH  RVK I      +    +++ +ASSDG I +W  R     K  P+ L
Sbjct  234   SLKCLCEF-KAHENRVKDICSFEVAEH---HVIVTASSDGFIKMW--RHNPNKKTPPSLL  287

Query  1207  AMANTKSRLTCL  1242
                NTK+RLTCL
Sbjct  288   CEVNTKARLTCL  299



>gb|KFV40338.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Tyto alba]
Length=348

 Score =   114 bits (284),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 91/286 (32%), Positives = 147/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    VS    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTVVPDFTHHAHSASLSAVAVSSRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR  F  +L +   I+K++  G+T   V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSVFIKNLKQNAHIIKWSPDGETYVTVITNKVDIYKLDTASITGTI  174

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         +L   G+D  I  +   S K       AH  R+K I      + 
Sbjct  175   ITE-KRISSLRFITDSVLAIAGDDEIIRLYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    ++ P+ L   +TK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLN-KIEDVPSLLCEVSTKARLTCLA  274



>ref|XP_008038028.1| WD40 repeat-like protein [Trametes versicolor FP-101664 SS1]
 gb|EIW59855.1| WD40 repeat-like protein [Trametes versicolor FP-101664 SS1]
Length=467

 Score =   115 bits (287),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 97/335 (29%), Positives = 173/335 (52%), Gaps = 36/335 (11%)
 Frame = +1

Query  319   SMSLIAGSYDHFIWGYK--LKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsv---avsg  483
             S  ++ GSY+  ++G +  +   +   +  + P+F FP+H+S IK    S        +G
Sbjct  91    SFKIVCGSYEKLLYGLEGTVSCEESAYSFQIAPIFIFPAHVSCIKSVAASPQGGKWLATG  150

Query  484   gsddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDP  660
              +D+ IK++DL    EIG L H   +I  L F   PS S   +L+SA+++G++S++    
Sbjct  151   SADEIIKVWDLRRRKEIGGLMHHEGSITHLEF---PSRS---HLLSASEDGTLSLFRARD  204

Query  661   FVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKF  840
             +  L+++K H+  +NS+++H S  +  SVG+D  L M DL RG+ S    LGKE  ++++
Sbjct  205   WAVLRSLKGHKGRVNSVAVHQSCKVALSVGKDRTLRMWDLMRGKGSASTKLGKEAELVRW  264

Query  841   NETGKTLYMVMDEKVSV----LELGYC---PRTVLEFNNAKRVLCAAPGEGGILFTGGED  999
             +  G    +     + +    +EL +    P  + +    KRV     G+G +L  GGED
Sbjct  265   STDGSLFAVQAQNTIDIYSTDMELLHTLTHPSRLHDIKFCKRV----DGDGELLLAGGED  320

Query  1000  RNITAWDTKSG--KVAHRIDD--AHSARVKGIVVL-----SNNDGEYPYLVASASSDGNI  1152
             + ++ +D      KV   I D   H+ RVK + ++              +V + SSDG +
Sbjct  321   KKLSIYDVPKDHEKVPTIIADMVGHANRVKAVDIIRVALPEGASRSSTTVVCTISSDGKV  380

Query  1153  CVWDV-RMGMGGKEKPN--PLAMANTK-SRLTCLA  1245
              ++D+  + +  +E+    P+A  +TK +RLTC+A
Sbjct  381   RLFDLAALPVSSEERTQLEPVAEYDTKGTRLTCVA  415



>ref|XP_003033479.1| hypothetical protein SCHCODRAFT_67600 [Schizophyllum commune 
H4-8]
 gb|EFI98576.1| hypothetical protein SCHCODRAFT_67600 [Schizophyllum commune 
H4-8]
Length=498

 Score =   115 bits (288),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 96/335 (29%), Positives = 165/335 (49%), Gaps = 51/335 (15%)
 Frame = +1

Query  319   SMSLIAGSYDHFIWGYK--------------LKSPKDLQNLDLIPLFSFPSHLSTIKCad  456
             S  ++AGSY+  ++G +               +S       DL PLF FP+H+S IK   
Sbjct  70    SFKVVAGSYEKLLYGLEGTVSLADSGSSSADPESSTKKYKFDLKPLFIFPAHVSCIKAVA  129

Query  457   vsgsva---vsggsddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAA  624
              S        +G +D+ IK++DL    EIG L H   ++  L+F   PS S   +L+SA+
Sbjct  130   ASPQGGKWLATGSADEIIKVWDLRRRKEIGGLMHHEGSVTHLSF---PSRS---HLLSAS  183

Query  625   DNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFY  804
             ++G+++++ +  +V L+ ++ H+  +NS++ HPSG +  SVG+D  L M DL RG+    
Sbjct  184   EDGTLALFRSRDWVVLRALRGHKGRVNSVAAHPSGKVALSVGKDRTLRMWDLMRGKGRAS  243

Query  805   YSLGKEVSILKFNETGKTLYMVMDEKVSVLELG-------YCPRTVLEFNNAKRVLCAAP  963
               +GKE  +++++  GK   +     ++V  L        + P  V + +   RV     
Sbjct  244   TKMGKEGEVVRWSIDGKLFIVQSGSDINVYTLDMTLIHTIHHPSRVHDVHFCTRVH----  299

Query  964   GEGGILFTGGEDRNITAW------DTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLV  1125
             GEG +L  G ED+ ++ +      D++   VA  +  A+  +    + L+  DG    +V
Sbjct  300   GEGEVLLVGAEDKTLSIYSISSNPDSRPKIVAKMVGHANRVKAFQTLALALPDGTQTTVV  359

Query  1126  ASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSR  1230
              + SSDG +  +D+       E P P    +TKSR
Sbjct  360   CTVSSDGKLHAYDL------GELPAP----STKSR  384



>ref|XP_009699666.1| PREDICTED: p21-activated protein kinase-interacting protein 1, 
partial [Cariama cristata]
Length=383

 Score =   114 bits (285),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 90/282 (32%), Positives = 144/282 (51%), Gaps = 13/282 (5%)
 Frame = +1

Query  403   LIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFY  579
             ++P F+  +H +++    V+    V+G  D+TI+IYD+   +E G+L   + T+  L FY
Sbjct  59    IVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKAEHGALLQHNGTVTCLEFY  118

Query  580   TPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDE  759
                      +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG D+
Sbjct  119   GAA------HLLSGAEDGIICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSVGTDK  172

Query  760   CLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNA  939
              L   +L  GR +F  +L +   I+K++  G+    V+  KV +  L     T       
Sbjct  173   TLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYRLDTASITGT-ITTE  231

Query  940   KRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPY  1119
             KR+         IL   G+D  I  +   S K       AH  R+K I      + E   
Sbjct  232   KRISSLRFITDSILAIAGDDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---EREGQR  287

Query  1120  LVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             ++ +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  288   VIVTASSDGYIKMWNLDLNK-IKDVPSLLCEVNTKARLTCLA  328



>ref|XP_010752181.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Larimichthys crocea]
Length=357

 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 156/309 (50%), Gaps = 15/309 (5%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTI  501
             + L+AGSY+   +GY++K+  D +     P F+  +H ++I     S    V+G  D+TI
Sbjct  5     LELVAGSYEQIAFGYRVKT--DEKEWTAKPNFTHHAHTASISAVAASERFVVTGSKDETI  62

Query  502   KIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKT  678
             ++YD+   +E G+L H + +I  L FY         +L+S  ++G V ++ T  +  LK+
Sbjct  63    QLYDMKKKTEHGALLHHNGSITCLEFYGSS------HLLSGGEDGLVCVWSTKKWECLKS  116

Query  679   VKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKT  858
             +K H+  + SLS+HPSG L  +VG D+ L   +L  GR +F  ++ +   I++++  G  
Sbjct  117   IKAHKGTVTSLSVHPSGKLALTVGTDKTLRTWNLINGRSAFIKNIKQNAHIVRWSPDGDK  176

Query  859   LYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKV  1038
               +V+D+KV +  L     T     N KR+         IL   G+D  +   D +  K 
Sbjct  177   YVVVVDDKVIIYNLETASVTGT-ITNPKRISSVKFLNNSILAVAGDDEIVRLCDVEKEKW  235

Query  1039  AHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMAN  1218
                   AH  RVK +      D  Y  +V +AS+DG I +W + +     E P  L   N
Sbjct  236   VCEF-KAHETRVKAVDSFITED--YCVMV-TASNDGFIKMWKLHLK-EELESPTLLGEVN  290

Query  1219  TKSRLTCLA  1245
             T +RLTCLA
Sbjct  291   TTARLTCLA  299



>ref|XP_009937720.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Opisthocomus hoazin]
Length=374

 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 91/287 (32%), Positives = 145/287 (51%), Gaps = 13/287 (5%)
 Frame = +1

Query  388   LQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATIN  564
             L++  ++  F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI 
Sbjct  26    LRSWAVVADFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTIT  85

Query  565   SLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCS  744
              L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  S
Sbjct  86    CLEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALS  139

Query  745   VGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVL  924
             VG D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV +  L     T  
Sbjct  140   VGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYRLDTASITGT  199

Query  925   EFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNND  1104
                  KR+         IL   G+D  I  +   S K       AH  R+K I      +
Sbjct  200   -ITAEKRISSLIFITDYILAIAGDDEMIRLYSCDSQKCVCEF-KAHENRIKDIYSF---E  254

Query  1105  GEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
              E  +++ +ASSDG I +W + +    K+ P+ L   NTK+RLTCLA
Sbjct  255   REEQHVIVTASSDGYIKMWSLDLN-KTKDVPSLLCEVNTKARLTCLA  300



>ref|XP_003263546.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Nomascus leucogenys]
Length=392

 Score =   114 bits (285),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 92/314 (29%), Positives = 154/314 (49%), Gaps = 22/314 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    ++  D +   L+  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFAVHPEPEACGDYEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H S TI  L FY         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKKKIEHGALVHHSGTITCLKFYGN------RHLISGAEDGLICIWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +++  K+ + +L     +     N KR+          L   G++  I  +D  
Sbjct  175   RGEQYVVIIQNKIDIYQLDTASISGT-ITNEKRISSVKFLSESALAVAGDEEVIRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S         AH  RVK +        E P  +++ +ASSDG I +W  ++    K  P+
Sbjct  234   SLVCLCEF-KAHENRVKDMFSF-----EIPEHHVIVTASSDGFIKMW--KLKQDKKVPPS  285

Query  1201  PLAMANTKSRLTCL  1242
              L   NT +RLTCL
Sbjct  286   LLCEVNTNARLTCL  299



>ref|XP_009979903.1| PREDICTED: p21-activated protein kinase-interacting protein 1, 
partial [Tauraco erythrolophus]
Length=347

 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 143/280 (51%), Gaps = 13/280 (5%)
 Frame = +1

Query  409   PLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSLAFYTP  585
             P F+  +H +++    V+    V+G  D+TI+IYD+   +E G+L   + T+  L FY  
Sbjct  6     PDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKTEHGALLQHNGTVTCLEFYGA  65

Query  586   PSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECL  765
                    +L+S A++G + I++T  +  LK+++ H+  + SLSIHPSG L  SVG D+ L
Sbjct  66    A------HLLSGAEDGLICIWNTKRWECLKSIRAHKGQVTSLSIHPSGKLALSVGTDKTL  119

Query  766   AMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKR  945
                +L  GR +F  +L +   I+K++  G+    V+  +V +  L     T       KR
Sbjct  120   RTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNRVDIYRLDTASITGT-ITTEKR  178

Query  946   VLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLV  1125
             +         IL   G+D  I  +   S K       AH  R+K I      + E  +++
Sbjct  179   ISSLIFITDSILAIAGDDEMIRFYSCDSHKCLCEF-KAHENRIKDIYSF---EREGQHVI  234

Query  1126  ASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
              +ASSDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  235   VTASSDGYIKMWNLDLN-KIKDVPSLLCEVNTKARLTCLA  273



>ref|XP_005435017.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like 
[Falco cherrug]
Length=487

 Score =   115 bits (287),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 93/287 (32%), Positives = 145/287 (51%), Gaps = 13/287 (5%)
 Frame = +1

Query  388   LQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATIN  564
             LQ+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI 
Sbjct  54    LQSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTIT  113

Query  565   SLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCS  744
              L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  S
Sbjct  114   CLEFYGTT------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALS  167

Query  745   VGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVL  924
             VG D+ L   +L  GR +F  +L +   I+K+   G+    V   KV + +L     T  
Sbjct  168   VGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWAPDGERYVTVKTNKVDIYKLDTASITG-  226

Query  925   EFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNND  1104
                  KR+         IL   G+D  I  +   S K       AH  RVK I      +
Sbjct  227   TITTEKRISSLRFVTDSILAIAGDDEIIRLYSCDSQKCLCEF-KAHENRVKDIYSF---E  282

Query  1105  GEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
              E  +++ +ASSDG I +W++ +    +  P+ L   NTK+RLTCLA
Sbjct  283   REGQHIIVTASSDGYIKMWNLNLNK-IEGVPSLLCEVNTKARLTCLA  328



>gb|KFQ55350.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Pelecanus crispus]
Length=349

 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 91/286 (32%), Positives = 145/286 (51%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + +I  
Sbjct  1     QSWTVVPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGSITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H   + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHEGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKKLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYKLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G+D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLRFITDSILAIAGDDEMIRFYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W++ +    K  P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTASSDGYIKMWNLDLN-KIKGVPSLLCEVNTKARLTCLA  274



>gb|KFP84229.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Apaloderma vittatum]
Length=347

 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 91/286 (32%), Positives = 143/286 (50%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  + P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTVAPDFTHHAHSASLSAVAVNNRYVVTGSRDETIQIYDMKKKVEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LQFYGSA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V   KV V +L     +   
Sbjct  115   GTDKTLRTWNLVEGRSAFVKNLKQNAHIVKWSPDGERYLTVTTNKVDVYQLDTASVSGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         +L   G+D  +  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLRFITDSVLAIAGDDEMVRFYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +ASSDG I +W +      KE P+ L   NTK+RLTCLA
Sbjct  230   EGQHVLVTASSDGYIKMWSLDPN-KMKETPSLLCEVNTKARLTCLA  274



>gb|ETE69891.1| p21-activated protein kinase-interacting protein 1-like protein, 
partial [Ophiophagus hannah]
Length=345

 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 90/287 (31%), Positives = 148/287 (52%), Gaps = 17/287 (6%)
 Frame = +1

Query  394   NLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINSL  570
             N ++ P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L H + T+  L
Sbjct  1     NWEVAPNFTHHAHSASLSAVAVNERYVVTGSKDETIQIYDMKKKVEHGALVHHNGTVTCL  60

Query  571   AFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSVG  750
              FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SVG
Sbjct  61    EFYGNG------HLLSGAEDGLICIWNTKKWECLKSIKAHKGHVTSLSIHPSGKLALSVG  114

Query  751   RDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSV--LELGYCPRTVL  924
              D  L   +L  GR +F  ++ +   ++K++ +G+   + +  KV +  LE      T+ 
Sbjct  115   TDRTLRTWNLVEGRSAFIKNIKQNAHLVKWSPSGEIYVVAVANKVDIYDLETASISGTIA  174

Query  925   EFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNND  1104
                  KR+         IL   G++  I  +D +S K       AH  R+K    L N  
Sbjct  175   ---TEKRISSIKFITDSILAIAGDEEFIRLFDCESQKCLCEF-KAHENRIKA---LYNFK  227

Query  1105  GEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
              E  +++ +ASSDG I  W++ +    +  P+ L   NTK+RLTCLA
Sbjct  228   MEGLHILVTASSDGYIKAWNLDIDK-IENAPSLLCEVNTKARLTCLA  273



>ref|XP_002714216.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X2 [Oryctolagus cuniculus]
Length=394

 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 90/312 (29%), Positives = 153/312 (49%), Gaps = 18/312 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    K+  D +    +  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFTVQPERKASDDHEKWTAVAHFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H + TI  L F+         +LIS A++G + ++    + 
Sbjct  61    DETIHIYDMRKKIEHGALVHHNGTITCLKFHGS------RHLISGAEDGLICVWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGHVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +V+  K+ V +L     +     N KR+         +L   G++  I  +D  
Sbjct  175   KGEKYIVVILNKIDVYQLSTASVSGT-ITNEKRISSVTFLSDSVLAVAGDEEIIRFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             S         AH  RVK +      +    ++V +ASSDG I +W  ++    K  P+ L
Sbjct  234   SLTCLCEF-KAHENRVKDMFSFETPEH---HVVVTASSDGFIKMW--KLKQDKKAPPSLL  287

Query  1207  AMANTKSRLTCL  1242
                NT +RLTCL
Sbjct  288   CEVNTSARLTCL  299



>gb|KFQ46849.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Nestor notabilis]
Length=348

 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 91/286 (32%), Positives = 144/286 (50%), Gaps = 13/286 (5%)
 Frame = +1

Query  391   QNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATINS  567
             Q+  + P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI  
Sbjct  1     QSWTVAPHFTHHAHTASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTITC  60

Query  568   LAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCSV  747
             L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  SV
Sbjct  61    LEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLCLSV  114

Query  748   GRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVLE  927
             G D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV + +L     T   
Sbjct  115   GTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGEKYVTVITNKVDIYKLDTASITGT-  173

Query  928   FNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNNDG  1107
                 KR+         IL   G D  I  +   S K       AH  R+K I      + 
Sbjct  174   ITTEKRISSLRFITDSILAIAGGDEIIRFYSCDSQKCLCEF-KAHENRIKDIYSF---ER  229

Query  1108  EYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
             E  +++ +A SDG I +W++ +    K+ P+ L   NTK+RLTCLA
Sbjct  230   EGQHVIVTACSDGYIKMWNLDLNK-IKDGPSLLCEVNTKARLTCLA  274



>ref|XP_009525739.1| hypothetical protein PHYSODRAFT_503339 [Phytophthora sojae]
 gb|EGZ16681.1| hypothetical protein PHYSODRAFT_503339 [Phytophthora sojae]
Length=410

 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 160/334 (48%), Gaps = 38/334 (11%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd---  492
             + ++AG+Y+  ++G++  +    ++  +   F + +H   IK   +  +           
Sbjct  2     IRVVAGTYEGLLYGWECPTVASGESTKMKLTFGYAAHSECIKSVALMAAKQGKTLLSGGS  61

Query  493   -dTIKIYDLSTCSEIGSLHES-ATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
              + IKIY++    E+GSL E    I SL F+        H L  +ADN S+ I+ T  + 
Sbjct  62    DEMIKIYNVDKRVEVGSLMEQHGAITSLEFFGQS-----HVLSGSADN-SICIWRTSDWN  115

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              L  +  H+  INS+++HPSG L  SV RD  L M +L +GR +F   L KE  ++  ++
Sbjct  116   CLHILGGHKGEINSIAVHPSGKLCFSVARDRTLRMWNLVKGRIAFIRRLEKEAELVMISQ  175

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G    +   + +SV  +      V    ++K++ CAA      +  GG+D+NI  W T 
Sbjct  176   KGTHYALGFGKDLSVFNMN--AELVGTLEHSKKIHCAAFATDEYIVCGGDDKNIYIWKTN  233

Query  1027  S-----------GKVAHRIDDAHSARVKGI-VVLSNNDGEYPYLVASASSDGNICVWD--  1164
                         GKV H+  D   AR++ I VV  + + + P++V  A+SDG   +WD  
Sbjct  234   GTYVLQQLSNLVGKVTHKDID---ARIRCIQVVYPHGEDKLPWIVL-ATSDGAFQIWDFA  289

Query  1165  -VRMGMGGKEKPN----PLA--MANTKSRLTCLA  1245
                +     E+ N    P+A  +  TK R+TCL+
Sbjct  290   SFTLDASSPEEANKSVQPMASTVLLTKPRVTCLS  323



>ref|XP_007327256.1| hypothetical protein AGABI1DRAFT_69942, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKM81619.1| hypothetical protein AGABI1DRAFT_69942, partial [Agaricus bisporus 
var. burnettii JB137-S8]
Length=447

 Score =   114 bits (285),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 102/338 (30%), Positives = 173/338 (51%), Gaps = 43/338 (13%)
 Frame = +1

Query  319   SMSLIAGSYDHFIWGYKLKSP----KDLQNLDLIPLFSFPSHLSTIKCadvsgsv---av  477
             +  ++AGSY+  ++G + K+     K+LQ   L  +F+FP+H+S IK    S        
Sbjct  71    TFKIVAGSYEKLLYGLEGKTTYSEDKNLQ-FHLKAIFAFPAHVSCIKAVAASPQGGKWLA  129

Query  478   sggsddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHT  654
             SG +D+ IK++DL    EIG L H   +I  L F   PS S   +L SA+++G++ ++H 
Sbjct  130   SGSADEIIKVWDLRRRKEIGGLMHHEGSITHLVF---PSRS---HLFSASEDGTLCLFHA  183

Query  655   DPFVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSIL  834
               +  L+T+K H+  +NS+++HPSG +  SVG+D  L M DL RG+      LGKE   +
Sbjct  184   RDWTVLRTLKGHKGRVNSIAVHPSGKVALSVGKDRALRMWDLMRGKGVASTKLGKEGETV  243

Query  835   KFNETGKTL-------YMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGG  993
             +++  GK         + + + ++++L     P  + +    KRV     G+G +L    
Sbjct  244   RWSVDGKLFVVQSGLTFDIYNTEMALLHTVQHPSRLHDVTFCKRV----SGDGEVLLVAA  299

Query  994   EDRNITAWDTKSGK------VAHRIDDAHSARVKGIVVLS-----NNDGEYPYLVASASS  1140
             ED+ ++ +D           +A  +   H  RVK I  L      ++  +   +V + SS
Sbjct  300   EDKKLSVYDIPEDSSRPPIIIAQMV--GHENRVKAIQTLKIALPVDSGRKSTTVVTTVSS  357

Query  1141  DGNICVWDVRMGMGGKE---KPNPLAMANTK-SRLTCL  1242
             DG I ++D+      KE   +  P+A  +TK +RLTC+
Sbjct  358   DGKIRLYDMNSVPETKETVAEIKPVAEYDTKGTRLTCV  395



>ref|XP_535884.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Canis lupus familiaris]
Length=391

 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 91/314 (29%), Positives = 155/314 (49%), Gaps = 20/314 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKSPKDL------QNLDLIPLFSFPSHLSTIKCadvsgsvavsg  483
             M L+AG Y+  ++G+ ++   D       Q    +  F+  +H +++    V+    V+G
Sbjct  1     MELVAGCYEQVLFGFAIRREPDAGGEHREQKWTAVADFTHHAHTASLSAVAVNSRFVVTG  60

Query  484   gsddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDP  660
               D+TI IYD+    + G+L H + TI  L FY         +LIS A++G + ++    
Sbjct  61    SKDETIHIYDMKKKIDHGALVHHNGTITCLKFYGN------RHLISGAEDGLICVWDAKK  114

Query  661   FVHLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKF  840
             +  LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I+++
Sbjct  115   WECLKSIKAHKGHVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEW  174

Query  841   NETGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWD  1020
             +  G+   +V+  K++V +L     +     N KR+         +L   G++  +  +D
Sbjct  175   SPRGERYIVVILNKINVYQLDTASVSGT-ITNEKRISSVTFLSESVLAVAGDEEVVRFFD  233

Query  1021  TKSGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPN  1200
               S         AH  RVK I   S  D E+ +++ +ASSDG I +W  ++    K  P+
Sbjct  234   CDSLTCVCEF-KAHENRVKDI--FSFEDPEH-HIIVTASSDGFIKMW--KLKQDKKVPPS  287

Query  1201  PLAMANTKSRLTCL  1242
              L    T +RLTCL
Sbjct  288   LLCEVKTNARLTCL  301



>gb|KFR14547.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Opisthocomus hoazin]
Length=346

 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 126/251 (50%), Gaps = 13/251 (5%)
 Frame = +1

Query  496   TIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHL  672
             TI+IYD+    E G+L   + TI  L FY         +L+S A++G + I++T  +  L
Sbjct  34    TIQIYDMKKKIEHGALLQHNGTITCLEFYGTA------HLLSGAEDGLICIWNTKRWECL  87

Query  673   KTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETG  852
             K++K H+  + SLSIHPSG L  SVG D+ L   +L  GR +F  +L +   I+K++  G
Sbjct  88    KSIKAHKGHVTSLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDG  147

Query  853   KTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSG  1032
             +    V+  KV +  L     T       KR+         IL   G+D  I  +   S 
Sbjct  148   ERYVTVITNKVDIYRLDTASITGT-ITAEKRISSLIFITDYILAIAGDDEMIRLYSCDSQ  206

Query  1033  KVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAM  1212
             K       AH  R+K I      + E  +++ +ASSDG I +W + +    K+ P+ L  
Sbjct  207   KCVCEF-KAHENRIKDIYSF---EREEQHVIVTASSDGYIKMWSLDLN-KTKDVPSLLCE  261

Query  1213  ANTKSRLTCLA  1245
              NTK+RLTCLA
Sbjct  262   VNTKARLTCLA  272



>gb|AAL40652.1|AF386076_1 p21-activated protein kinase-interacting protein 1 [Mus musculus]
 dbj|BAB22407.1| unnamed protein product [Mus musculus]
Length=414

 Score =   114 bits (284),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 95/312 (30%), Positives = 152/312 (49%), Gaps = 18/312 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKS--PKDLQNLDLIPL--FSFPSHLSTIKCadvsgsvavsggs  489
             M L+AGSY+  ++G+ ++    K        P+  F+  SH +++     +    VSG  
Sbjct  1     MELVAGSYEQVLFGFTVQRGPAKSGHQETWTPVADFTHHSHTASLSVLASNSRYVVSGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H + T+  L F+         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKRKVEHGALVHHAGTVTCLKFHGN------QHLISGAEDGHICIWDVKRWK  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LKT K HR  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKTFKAHRGHVTFLSIHPSGKLALSVGTDKTLRTWNLIEGRSAFIKNIKENAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G    +V+  KV V  LG    +     N KR+         +L   G++  +  +D  
Sbjct  175   SGGKYIVVVQNKVDVYRLGTASVSGT-ITNGKRISSVTFLSDSVLAVAGDEEVVRIFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             S +       AH  RVK +V     D    +++ +AS+DG I +W   +    K  P+ L
Sbjct  234   SLECLCEF-RAHENRVKDMVSFEVPDH---HVLVTASNDGFIKMWT--LPQDKKVPPSLL  287

Query  1207  AMANTKSRLTCL  1242
               A T +RLTCL
Sbjct  288   CEAKTGARLTCL  299



>ref|XP_004346604.1| p21activated protein kinase-interacting protein 1, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR21659.1| p21activated protein kinase-interacting protein 1, putative [Acanthamoeba 
castellanii str. Neff]
Length=542

 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 83/330 (25%), Positives = 160/330 (48%), Gaps = 29/330 (9%)
 Frame = +1

Query  328   LIAGSYDHFIWGY-----KLKSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsd  492
             ++AG+Y+H ++G+          K    L L P+F + SHL+ I C     ++  SG +D
Sbjct  5     VVAGTYEHILYGFYCLENDKADTKQKMELRLDPMFIYSSHLNGITCLANHKNLLASGSAD  64

Query  493   dTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVH  669
             +T+KIYDL    E+G+L   +  +N+  FY         +++S   +G++ I+    +  
Sbjct  65    ETVKIYDLKKRVEVGTLIQHNGAVNATEFYGV-------HMLSGGQDGTICIWDAKRWEC  117

Query  670   LKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNET  849
             L T+K H+ G+   S+HPSG +  S+G+D+ + M DL  G+ +F   L +   +++++  
Sbjct  118   LVTLKAHKGGVIDFSVHPSGKVALSIGKDKSMKMWDLVLGKSAFKSRLVRAPQMVRWS-P  176

Query  850   GKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKS  1029
             G  +Y ++DE    +               ++++  A     ++  G E+  +  WD  +
Sbjct  177   GGDVYCLVDETKFTIYTADDNTVTHTIETPRKIVSLAFITPKLVALGCEEGFLQVWDIVT  236

Query  1030  GKVAHRIDDAHSARVKGI----------VVLSNNDGEYPYLVASASSDGNICVWDVRMGM  1179
             G++ H +   H  RV+G+           V      +  + + S SS+G + VW+V +  
Sbjct  237   GEMTHNL-IGHKVRVRGLSVTHLPLVEDAVEGKQATKLRHFLVSGSSEGVVKVWEVPLPE  295

Query  1180  GGKEKP----NPLAMANTKSRLTCLAGSSI  1257
              G+ +P     P A  N  +R+T +A + +
Sbjct  296   EGQLQPIVLKQPKAEVNVDARITSVASALV  325



>ref|NP_080826.2| p21-activated protein kinase-interacting protein 1 [Mus musculus]
 sp|Q9DCE5.2|PK1IP_MOUSE RecName: Full=p21-activated protein kinase-interacting protein 
1; AltName: Full=PAK1-interacting protein 1; AltName: Full=Putative 
PAK inhibitor Skb15 [Mus musculus]
 dbj|BAC37076.1| unnamed protein product [Mus musculus]
 dbj|BAE29818.1| unnamed protein product [Mus musculus]
 dbj|BAE29957.1| unnamed protein product [Mus musculus]
 gb|EDL40960.1| PAK1 interacting protein 1, isoform CRA_a [Mus musculus]
Length=382

 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 95/312 (30%), Positives = 152/312 (49%), Gaps = 18/312 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKS--PKDLQNLDLIPL--FSFPSHLSTIKCadvsgsvavsggs  489
             M L+AGSY+  ++G+ ++    K        P+  F+  SH +++     +    VSG  
Sbjct  1     MELVAGSYEQVLFGFTVQRGPAKSGHQETWTPVADFTHHSHTASLSVLASNSRYVVSGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H + T+  L F+         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKRKVEHGALVHHAGTVTCLKFHGN------QHLISGAEDGHICIWDVKRWK  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LKT K HR  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKTFKAHRGHVTFLSIHPSGKLALSVGTDKTLRTWNLIEGRSAFIKNIKENAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G    +V+  KV V  LG    +     N KR+         +L   G++  +  +D  
Sbjct  175   SGGKYIVVVQNKVDVYRLGTASVSGT-ITNGKRISSVTFLSDSVLAVAGDEEVVRIFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             S +       AH  RVK +V     D    +++ +AS+DG I +W   +    K  P+ L
Sbjct  234   SLECLCEF-RAHENRVKDMVSFEVPDH---HVLVTASNDGFIKMWT--LPQDKKVPPSLL  287

Query  1207  AMANTKSRLTCL  1242
               A T +RLTCL
Sbjct  288   CEAKTGARLTCL  299



>ref|XP_010621142.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X2 [Fukomys damarensis]
Length=388

 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 97/315 (31%), Positives = 159/315 (50%), Gaps = 24/315 (8%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AGSY+  ++G+ +    K+  D +    +  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGSYEQVLFGFTVHPGPKANGDHEKWTSVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H + TI  L FY         +LIS A++G + ++    + 
Sbjct  61    DETIHIYDMKKKVEHGALVHHNGTITCLKFYGN------RHLISGAEDGLICVWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGHVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G+   +V+  KV V +L +         N KRV         +L   G++  +  +D +
Sbjct  175   SGEKYVVVILNKVDVYQL-HTASISGTITNEKRVSSVTFLSDSVLAVAGDEEVVRFFDCE  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEK---P  1197
             S         AH  RVK +   S    E+  LV +ASSDG I +W ++     +EK   P
Sbjct  234   SLACLCEF-RAHENRVKDM--FSFEIPEHRVLV-TASSDGFIKMWKLK-----QEKTVPP  284

Query  1198  NPLAMANTKSRLTCL  1242
             + L   NT +RLTCL
Sbjct  285   SLLCGVNTHARLTCL  299



>ref|XP_008163555.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X3 [Chrysemys picta bellii]
Length=371

 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 93/290 (32%), Positives = 148/290 (51%), Gaps = 13/290 (4%)
 Frame = +1

Query  379   PKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESA  555
             P  + N   IP F+  +H +++    V+    V+G  D+TI+IYD+    E G+L H + 
Sbjct  9     PNHMLNWTPIPDFTHHAHTASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLHHNG  68

Query  556   TINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGL  735
             TI  L FY         +L+S A++G + I+ T  +  LK++K H+  + SLSIHPSG L
Sbjct  69    TITCLEFYGNA------HLLSGAEDGLICIWDTKKWECLKSIKAHKGHVTSLSIHPSGKL  122

Query  736   VCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPR  915
               SVG D+ L   +L  GR +F  +L +   I+K++ +G+   +V+  KV V +L     
Sbjct  123   ALSVGTDKTLRTWNLVEGRSAFIKNLKQNAHIVKWSPSGEKYVVVVTNKVDVYKLETASV  182

Query  916   TVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLS  1095
             +       KR+         +L   G+D  I  +D  S K       AH  R+K I    
Sbjct  183   SG-AITTEKRISSVRFITDSVLAIAGDDEVIRLYDCDSQKCLCEF-KAHENRIKDIYSFE  240

Query  1096  NNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
                 +   ++ +ASSDG I +W + +    +++P+ L   NTK+RLTCLA
Sbjct  241   KQGLQ---VIVTASSDGYIKLWSLELD-KIQDRPSLLCEVNTKARLTCLA  286



>ref|XP_004432185.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Ceratotherium simum simum]
Length=389

 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 92/312 (29%), Positives = 155/312 (50%), Gaps = 18/312 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    K+  D +    +  F+  +H +++    V+    V+G  
Sbjct  1     MELVAGCYEQVLFGFAVHPEPKASGDHEKWTAVADFTHHAHTASLSAVAVNSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    + G+L H + T+  L FY         +LIS A++G + ++    + 
Sbjct  61    DETIHIYDMKKKVDHGALVHHNGTVTCLKFYGN------RHLISGAEDGLICVWDARKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGHVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +V+  K+ V +L     +     N KRV         +L   G++  +  +D  
Sbjct  175   RGEKYVVVILNKIDVYQLDTASVSGT-ITNEKRVSSVTFLSETVLAVAGDEEVVKFFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             S         AH  RVK I   S    E+ ++V +ASSDG I +W  ++    K  P+ L
Sbjct  234   SLMCLCEF-KAHENRVKDI--FSFEIAEH-HVVVTASSDGFIKMW--KLKQDKKAPPSLL  287

Query  1207  AMANTKSRLTCL  1242
                NT +RLTCL
Sbjct  288   CAVNTNARLTCL  299



>gb|KFP70400.1| p21-activated protein kinase-interacting protein 1-like, partial 
[Acanthisitta chloris]
Length=354

 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 144/287 (50%), Gaps = 13/287 (5%)
 Frame = +1

Query  388   LQNLDLIPLFSFPSHLSTIKCadvsgsvavsggsddTIKIYDLSTCSEIGSL-HESATIN  564
             LQ   ++P F+  +H +++    V+    V+G  D+TI+IYD+    E G+L   + TI 
Sbjct  2     LQPWTVVPDFTHHAHTASLSAVAVNNRYVVTGSRDETIQIYDMKKKIEHGALLQHNGTIT  61

Query  565   SLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFVHLKTVKVHRKGINSLSIHPSGGLVCS  744
              L FY         +L+S A++G + I++T  +  LK++K H+  + SLSIHPSG L  S
Sbjct  62    CLEFYGTA------HLLSGAEDGLICIWNTKRWECLKSIKAHKGHVTSLSIHPSGKLALS  115

Query  745   VGRDECLAMVDLERGRRSFYYSLGKEVSILKFNETGKTLYMVMDEKVSVLELGYCPRTVL  924
             VG D+ L   +L  GR +F  +L +   I+K++  G+    V+  KV +  L     T  
Sbjct  116   VGTDKTLRTWNLVEGRSAFIKNLKQNAHIIKWSPDGERYVTVITNKVDIYRLDTASITGT  175

Query  925   EFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTKSGKVAHRIDDAHSARVKGIVVLSNND  1104
                  KR+         IL   G+D  +  +   S K       AH  R+K I       
Sbjct  176   -ITTEKRISSLRFLTDSILAIAGDDEIVRFYSCDSQKCLCEF-KAHENRIKDIYSFERGG  233

Query  1105  GEYPYLVASASSDGNICVWDVRMGMGGKEKPNPLAMANTKSRLTCLA  1245
                 +++ +ASSDG I +W++ +    ++ P+ L   NT++RLTCLA
Sbjct  234   ---QHVIVTASSDGYIKMWNLDLN-KIEDVPSLLCEVNTQARLTCLA  276



>ref|XP_008144340.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
[Eptesicus fuscus]
Length=392

 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 92/314 (29%), Positives = 153/314 (49%), Gaps = 22/314 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKL----KSPKDLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ +    K+  D Q    +  F+  +H +++     +    V+G  
Sbjct  1     MELVAGCYEQVLFGFSVHPEPKASGDHQKWTPVADFTHHAHTASLSAVAANSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    + G+L H + TI  L F+         +LIS A++G + ++    + 
Sbjct  61    DETIHIYDMKKKIDHGALVHHNGTITCLKFHGN------RHLISGAEDGLICVWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGHVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +V+  K+ V  L     +     N KRV         +L   G++  +  +DT 
Sbjct  175   RGEKYVVVILNKIDVYHLDTAAVSGT-ITNEKRVSSVTFLSESVLAVAGDEEVVRFFDTD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S         AH  RVK +        E P  +++ +ASSDG I +W  R+    K  P+
Sbjct  234   SLMCLCEF-KAHENRVKDMFSF-----EIPEHHVIVTASSDGFIKMW--RLAQDKKIPPS  285

Query  1201  PLAMANTKSRLTCL  1242
              L   NT +RLTCL
Sbjct  286   LLCEVNTNARLTCL  299



>dbj|BAE22737.1| unnamed protein product [Mus musculus]
Length=374

 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 95/312 (30%), Positives = 152/312 (49%), Gaps = 18/312 (6%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLKS--PKDLQNLDLIPL--FSFPSHLSTIKCadvsgsvavsggs  489
             M L+AGSY+  ++G+ ++    K        P+  F+  SH +++     +    VSG  
Sbjct  1     MELVAGSYEQVLFGFTVQRGPAKSGHQETWTPVADFTHHSHTASLSVLASNSRYVVSGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    E G+L H + T+  L F+         +LIS A++G + I+    + 
Sbjct  61    DETIHIYDMKRKVEHGALVHHAGTVTCLKFHGN------QHLISGAEDGHICIWDVKRWK  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LKT K HR  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKTFKAHRGHVTFLSIHPSGKLALSVGTDKTLRTWNLIEGRSAFIKNIKENAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
             +G    +V+  KV V  LG    +     N KR+         +L   G++  +  +D  
Sbjct  175   SGGKYIVVVQNKVDVYRLGTASVSGT-ITNGKRISSVTFLSDSVLAVAGDEEVVRIFDCD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYPYLVASASSDGNICVWDVRMGMGGKEKPNPL  1206
             S +       AH  RVK +V     D    +++ +AS+DG I +W   +    K  P+ L
Sbjct  234   SLECLCEF-RAHENRVKDMVSFEVPDH---HVLVTASNDGFIKMW--TLPQDKKVPPSLL  287

Query  1207  AMANTKSRLTCL  1242
               A T +RLTCL
Sbjct  288   CEAKTGARLTCL  299



>ref|XP_006758808.1| PREDICTED: p21-activated protein kinase-interacting protein 1 
isoform X2 [Myotis davidii]
 gb|ELK34035.1| p21-activated protein kinase-interacting protein 1 [Myotis davidii]
Length=392

 Score =   113 bits (282),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 93/314 (30%), Positives = 154/314 (49%), Gaps = 22/314 (7%)
 Frame = +1

Query  322   MSLIAGSYDHFIWGYKLK-SPK---DLQNLDLIPLFSFPSHLSTIKCadvsgsvavsggs  489
             M L+AG Y+  ++G+ ++  PK   D Q    +  F+  +H +++     +    V+G  
Sbjct  1     MELVAGCYEQVLFGFSVRPEPKASGDHQKWTPVADFTHHAHTASLSAVAANSRFVVTGSK  60

Query  490   ddTIKIYDLSTCSEIGSL-HESATINSLAFYTPPSLSFPHNLISAADNGSVSIYHTDPFV  666
             D+TI IYD+    + G+L H + TI  L F+         +LIS A++G + ++    + 
Sbjct  61    DETIHIYDMKKKIDHGALVHHNGTITCLKFHGN------RHLISGAEDGLICVWDAKKWE  114

Query  667   HLKTVKVHRKGINSLSIHPSGGLVCSVGRDECLAMVDLERGRRSFYYSLGKEVSILKFNE  846
              LK++K H+  +  LSIHPSG L  SVG D+ L   +L  GR +F  ++ +   I++++ 
Sbjct  115   CLKSIKAHKGHVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSP  174

Query  847   TGKTLYMVMDEKVSVLELGYCPRTVLEFNNAKRVLCAAPGEGGILFTGGEDRNITAWDTK  1026
              G+   +V  +K+ V  L     +     N KRV         +L   G++  +  +DT 
Sbjct  175   RGEKYVVVTLDKIDVYHLDTAAVSGT-ITNEKRVSSVTFLSESVLAVAGDEEVVRFFDTD  233

Query  1027  SGKVAHRIDDAHSARVKGIVVLSNNDGEYP--YLVASASSDGNICVWDVRMGMGGKEKPN  1200
             S         AH  RVK +        E P  +++ +ASSDG I +W +   M  K  P+
Sbjct  234   SLMCLCEF-KAHENRVKDMFSF-----EIPEHHVIVTASSDGFIKMWKLAQDM--KVPPS  285

Query  1201  PLAMANTKSRLTCL  1242
              L   NT +RLTCL
Sbjct  286   LLCEVNTNARLTCL  299



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8967893544918