BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25427_g1_i2 len=1021 path=[6577:0-151 5401:152-190 2897:191-237
6776:238-277 2984:278-362 6727:363-388 3095:389-435 3677:436-449
3156:450-501 6387:502-525 3232:526-593 5884:594-751 3455:752-778
3956:779-1020]

Length=1021
                                                                      Score     E

ref|XP_009597287.1|  PREDICTED: isoflavone 2'-hydroxylase-like          255   3e-76   
ref|XP_009780215.1|  PREDICTED: isoflavone 2'-hydroxylase-like          253   1e-75   
ref|XP_006359732.1|  PREDICTED: isoflavone 2'-hydroxylase-like          248   2e-73   
ref|XP_004242874.1|  PREDICTED: cytochrome P450 81D11-like              247   3e-73   
ref|XP_009760136.1|  PREDICTED: isoflavone 2'-hydroxylase-like          243   6e-72   
ref|XP_006367416.1|  PREDICTED: isoflavone 2'-hydroxylase-like          242   2e-71   
ref|XP_011074387.1|  PREDICTED: cytochrome P450 81E8-like               240   8e-71   
dbj|BAH84783.1|  cytochrome P450                                        239   2e-70   Nicotiana tabacum [American tobacco]
ref|XP_009597427.1|  PREDICTED: isoflavone 2'-hydroxylase-like          238   6e-70   
ref|XP_006367415.1|  PREDICTED: isoflavone 2'-hydroxylase-like          238   1e-69   
gb|ABC69379.1|  CYP81C6v2                                               236   3e-69   Nicotiana tabacum [American tobacco]
gb|ABC69380.1|  CYP81C6v2                                               236   3e-69   Nicotiana tabacum [American tobacco]
ref|XP_009785012.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    235   7e-69   
gb|AHK60838.1|  CYP81C13                                                230   5e-67   
emb|CDP01251.1|  unnamed protein product                                226   2e-66   
emb|CDP01250.1|  unnamed protein product                                225   6e-65   
ref|XP_004238119.1|  PREDICTED: cytochrome P450 81E8                    223   3e-64   
ref|XP_011015740.1|  PREDICTED: cytochrome P450 81D11-like              217   4e-62   
emb|CDP01253.1|  unnamed protein product                                217   8e-62   
ref|XP_011017148.1|  PREDICTED: cytochrome P450 81D11-like              216   1e-61   
ref|XP_007018581.1|  Cytochrome P450, family 81, subfamily D, pol...    206   5e-61   
ref|XP_007018579.1|  Cytochrome P450, family 81, subfamily K, pol...    213   2e-60   
ref|XP_006374861.1|  cytochrome P450 family protein                     213   2e-60   
dbj|BAH84784.1|  cytochrome P450                                        212   4e-60   Nicotiana tabacum [American tobacco]
ref|XP_006374863.1|  hypothetical protein POPTR_0014s02170g             210   2e-59   
emb|CDP20410.1|  unnamed protein product                                209   7e-59   
gb|KHG18425.1|  Isoflavone 2'-hydroxylase                               208   9e-59   
ref|XP_002301158.2|  cytochrome P450 family protein                     207   4e-58   Populus trichocarpa [western balsam poplar]
gb|KDP41664.1|  hypothetical protein JCGZ_16071                         206   7e-58   
ref|XP_002510136.1|  cytochrome P450, putative                          201   5e-56   Ricinus communis
ref|XP_002285066.1|  PREDICTED: isoflavone 3'-hydroxylase-like          201   6e-56   Vitis vinifera
ref|XP_010271770.1|  PREDICTED: isoflavone 2'-hydroxylase-like          199   2e-55   
emb|CDP21119.1|  unnamed protein product                                199   4e-55   
ref|XP_010271541.1|  PREDICTED: isoflavone 3'-hydroxylase-like          197   2e-54   
gb|KDO81589.1|  hypothetical protein CISIN_1g020029mg                   192   2e-54   
ref|XP_010556108.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    197   3e-54   
ref|XP_010556107.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    197   3e-54   
emb|CDP15267.1|  unnamed protein product                                194   2e-53   
ref|XP_011029147.1|  PREDICTED: isoflavone 2'-hydroxylase-like          194   2e-53   
ref|XP_006472253.1|  PREDICTED: cytochrome P450 81D1-like               194   3e-53   
ref|XP_010101691.1|  Isoflavone 2'-hydroxylase                          194   4e-53   
ref|XP_010271553.1|  PREDICTED: isoflavone 2'-hydroxylase-like          192   7e-53   
ref|XP_010692652.1|  PREDICTED: cytochrome P450 81E8-like               192   8e-53   
ref|XP_006374862.1|  hypothetical protein POPTR_0014s02160g             192   1e-52   
gb|AAD32570.1|  NT7                                                     186   1e-52   Nicotiana tabacum [American tobacco]
ref|XP_009360167.1|  PREDICTED: isoflavone 2'-hydroxylase-like          192   2e-52   
ref|XP_006433586.1|  hypothetical protein CICLE_v10000895mg             192   2e-52   
ref|XP_006374864.1|  hypothetical protein POPTR_0014s02180g             191   2e-52   
ref|XP_011069758.1|  PREDICTED: isoflavone 2'-hydroxylase-like          190   4e-52   
ref|XP_011029134.1|  PREDICTED: isoflavone 2'-hydroxylase-like          191   5e-52   
gb|AJD25195.1|  cytochrome P450 CYP81C16                                188   3e-51   
emb|CDP19801.1|  unnamed protein product                                180   3e-51   
dbj|BAF98467.1|  cytochrome P450                                        187   1e-50   Coptis japonica var. dissecta
ref|XP_008337049.1|  PREDICTED: cytochrome P450 81D1-like               181   2e-50   
ref|XP_007018555.1|  Cytochrome P450                                    186   2e-50   
ref|XP_008393762.1|  PREDICTED: cytochrome P450 81D1-like               186   3e-50   
ref|XP_006387951.1|  hypothetical protein POPTR_0458s00200g             182   3e-50   
ref|XP_002267485.1|  PREDICTED: isoflavone 3'-hydroxylase-like          185   7e-50   Vitis vinifera
emb|CDP14452.1|  unnamed protein product                                184   8e-50   
ref|XP_010320311.1|  PREDICTED: cytochrome P450 81D1-like               176   9e-50   
emb|CBI33752.3|  unnamed protein product                                180   9e-50   
gb|EYU35841.1|  hypothetical protein MIMGU_mgv1a024949mg                184   9e-50   
ref|XP_004238115.1|  PREDICTED: cytochrome P450 81D1-like               184   1e-49   
ref|XP_010672783.1|  PREDICTED: cytochrome P450 81E8-like               183   2e-49   
ref|XP_006362076.1|  PREDICTED: cytochrome P450 81D1-like               184   2e-49   
ref|XP_009620154.1|  PREDICTED: isoflavone 2'-hydroxylase-like          183   3e-49   
ref|XP_006372852.1|  hypothetical protein POPTR_0017s05680g             183   3e-49   
gb|ABK96123.1|  unknown                                                 183   3e-49   Populus trichocarpa [western balsam poplar]
ref|XP_009760134.1|  PREDICTED: cytochrome P450 81D11-like              182   3e-49   
ref|XP_009380098.1|  PREDICTED: cytochrome P450 81D1                    176   3e-49   
ref|XP_006372853.1|  cytochrome P450 family protein                     183   4e-49   
ref|XP_011029060.1|  PREDICTED: cytochrome P450 81D11-like              182   4e-49   
ref|XP_002320704.2|  cytochrome P450 family protein                     182   4e-49   Populus trichocarpa [western balsam poplar]
ref|XP_006367423.1|  PREDICTED: isoflavone 2'-hydroxylase-like          182   4e-49   
ref|XP_011037157.1|  PREDICTED: cytochrome P450 81D11-like              182   5e-49   
gb|KEH31510.1|  cytochrome P450 family protein                          182   6e-49   
ref|XP_002267599.1|  PREDICTED: isoflavone 2'-hydroxylase-like          182   6e-49   Vitis vinifera
gb|ACJ85868.1|  unknown                                                 182   6e-49   Medicago truncatula
ref|XP_010274363.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    174   8e-49   
ref|XP_006453453.1|  hypothetical protein CICLE_v10008060mg             181   1e-48   
emb|CDX85218.1|  BnaC07g25290D                                          180   1e-48   
gb|AHF22081.1|  CYP81B58                                                181   1e-48   
gb|AFO64617.1|  cytochrome P450 mono-oxygenase                          181   1e-48   
emb|CBI33748.3|  unnamed protein product                                181   1e-48   
emb|CDP14451.1|  unnamed protein product                                181   2e-48   
ref|XP_004238572.1|  PREDICTED: cytochrome P450 81E8-like               180   2e-48   
ref|XP_004141398.1|  PREDICTED: cytochrome P450 81D1-like               181   2e-48   
ref|XP_006387952.1|  hypothetical protein POPTR_0458s00200g             180   2e-48   
ref|XP_002283792.2|  PREDICTED: isoflavone 2'-hydroxylase               180   3e-48   Vitis vinifera
ref|XP_002283500.1|  PREDICTED: isoflavone 3'-hydroxylase               180   3e-48   Vitis vinifera
gb|KGN55250.1|  hypothetical protein Csa_4G642310                       181   3e-48   
ref|XP_006389073.1|  cytochrome P450 family protein                     180   3e-48   
emb|CDP01233.1|  unnamed protein product                                176   3e-48   
ref|XP_007018568.1|  Cytochrome P450, putative                          179   6e-48   
ref|XP_008453068.1|  PREDICTED: cytochrome P450 81D1-like               179   6e-48   
emb|CAA04116.1|  cytochrome P450                                        179   7e-48   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_010277161.1|  PREDICTED: cytochrome P450 81E8-like               179   8e-48   
emb|CDX86416.1|  BnaA06g31330D                                          178   8e-48   
ref|XP_004238116.2|  PREDICTED: isoflavone 2'-hydroxylase-like          179   1e-47   
ref|XP_002283502.1|  PREDICTED: cytochrome P450 81E8-like               179   1e-47   Vitis vinifera
emb|CAA04117.1|  cytochrome P450                                        179   1e-47   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_010446678.1|  PREDICTED: cytochrome P450 81D11-like              174   1e-47   
ref|XP_006362077.1|  PREDICTED: isoflavone 2'-hydroxylase-like          179   1e-47   
ref|XP_009380096.1|  PREDICTED: isoflavone 2'-hydroxylase-like          179   2e-47   
emb|CBI33744.3|  unnamed protein product                                171   2e-47   
ref|XP_010531165.1|  PREDICTED: cytochrome P450 81E8-like               178   3e-47   
ref|XP_008369127.1|  PREDICTED: LOW QUALITY PROTEIN: isoflavone 2...    177   3e-47   
ref|XP_007018567.1|  Cytochrome P450                                    177   3e-47   
gb|ABC69377.1|  CYP81B2v2                                               177   3e-47   Nicotiana tabacum [American tobacco]
ref|XP_009372454.1|  PREDICTED: isoflavone 2'-hydroxylase-like          177   4e-47   
ref|XP_009796225.1|  PREDICTED: isoflavone 2'-hydroxylase-like          177   4e-47   
gb|KDO79057.1|  hypothetical protein CISIN_1g019895mg                   173   4e-47   
ref|XP_011069764.1|  PREDICTED: cytochrome P450 81E8-like isoform X1    177   4e-47   
ref|XP_011069766.1|  PREDICTED: isoflavone 3'-hydroxylase-like          177   5e-47   
ref|XP_009796226.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    177   5e-47   
ref|XP_002456656.1|  hypothetical protein SORBIDRAFT_03g040280          177   5e-47   Sorghum bicolor [broomcorn]
ref|XP_007033007.1|  Cytochrome P450, family 81, subfamily D, pol...    176   6e-47   
ref|XP_004292745.1|  PREDICTED: isoflavone 2'-hydroxylase-like          177   7e-47   
ref|XP_008367651.1|  PREDICTED: cytochrome P450 81D11-like              176   7e-47   
ref|XP_004509096.1|  PREDICTED: isoflavone 2'-hydroxylase-like          176   7e-47   
ref|NP_001269247.1|  isoflavone 2'-hydroxylase-like                     176   7e-47   
ref|XP_009129360.1|  PREDICTED: cytochrome P450 81D11-like              176   7e-47   
ref|XP_007227313.1|  hypothetical protein PRUPE_ppa016513mg             176   8e-47   
gb|ABC69378.1|  CYP81B2v1                                               176   8e-47   Nicotiana tabacum [American tobacco]
emb|CDY47253.1|  BnaA02g29390D                                          176   8e-47   
ref|XP_004231887.1|  PREDICTED: cytochrome P450 81D1-like               176   8e-47   
gb|KGN55242.1|  hypothetical protein Csa_4G641740                       169   9e-47   
ref|XP_009129359.1|  PREDICTED: cytochrome P450 81D11-like              176   9e-47   
ref|XP_009151853.1|  PREDICTED: cytochrome P450 81D11                   176   1e-46   
ref|XP_008220356.1|  PREDICTED: cytochrome P450 81D11-like              176   1e-46   
ref|XP_002302425.2|  cytochrome P450 family protein                     176   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_004290943.1|  PREDICTED: cytochrome P450 81D1-like               176   1e-46   
ref|XP_008220288.1|  PREDICTED: isoflavone 2'-hydroxylase-like          176   1e-46   
gb|KDP45416.1|  hypothetical protein JCGZ_09665                         176   1e-46   
gb|KHG05117.1|  Isoflavone 2'-hydroxylase                               176   1e-46   
ref|XP_009620153.1|  PREDICTED: isoflavone 2'-hydroxylase-like          176   1e-46   
ref|XP_007224527.1|  hypothetical protein PRUPE_ppa024021mg             175   2e-46   
ref|XP_011099312.1|  PREDICTED: cytochrome P450 81E8-like               176   2e-46   
gb|ADD84651.1|  CYP81B36                                                175   2e-46   Scoparia dulcis [escobilla]
gb|AHK60837.1|  CYP81Q32                                                175   2e-46   
emb|CBI33745.3|  unnamed protein product                                174   2e-46   
ref|XP_007018554.1|  Cytochrome P450                                    175   2e-46   
ref|XP_010910128.1|  PREDICTED: cytochrome P450 81E8-like               175   2e-46   
ref|XP_004290944.1|  PREDICTED: cytochrome P450 81D1-like               175   3e-46   
ref|XP_006283601.1|  hypothetical protein CARUB_v10004657mg             175   3e-46   
emb|CBI38503.3|  unnamed protein product                                171   3e-46   
ref|XP_008452620.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    175   3e-46   
ref|XP_004141397.1|  PREDICTED: cytochrome P450 81D1-like               175   3e-46   
ref|XP_010502943.1|  PREDICTED: cytochrome P450 81D11-like isofor...    171   3e-46   
ref|XP_002285061.2|  PREDICTED: cytochrome P450 81E8-like               175   3e-46   Vitis vinifera
ref|XP_010491736.1|  PREDICTED: isoflavone 2'-hydroxylase-like          174   4e-46   
gb|KHN12964.1|  Cytochrome P450 81D1                                    171   4e-46   
gb|ACG29835.1|  cytochrome P450 CYP81A1                                 175   4e-46   Zea mays [maize]
emb|CDY44041.1|  BnaA08g15650D                                          174   4e-46   
ref|XP_002279038.1|  PREDICTED: isoflavone 2'-hydroxylase               174   4e-46   Vitis vinifera
ref|XP_009109368.1|  PREDICTED: cytochrome P450 81F1-like               174   4e-46   
ref|XP_010936572.1|  PREDICTED: cytochrome P450 81D1-like               169   4e-46   
ref|XP_006472256.1|  PREDICTED: isoflavone 2'-hydroxylase-like          174   5e-46   
gb|KFK25349.1|  hypothetical protein AALP_AA8G101100                    174   5e-46   
emb|CAN72520.1|  hypothetical protein VITISV_040350                     174   5e-46   Vitis vinifera
ref|XP_010647303.1|  PREDICTED: cytochrome P450 81E8-like               171   5e-46   
ref|XP_008780931.1|  PREDICTED: isoflavone 2'-hydroxylase-like          174   5e-46   
ref|XP_006425998.1|  hypothetical protein CICLE_v10025370mg             174   5e-46   
ref|XP_009372456.1|  PREDICTED: cytochrome P450 81D11-like              174   5e-46   
ref|XP_006395346.1|  hypothetical protein EUTSA_v10004055mg             174   5e-46   
ref|XP_002524941.1|  cytochrome P450, putative                          174   5e-46   Ricinus communis
ref|XP_007206766.1|  hypothetical protein PRUPE_ppa025296mg             174   6e-46   
ref|XP_010446676.1|  PREDICTED: cytochrome P450 81D11-like              174   6e-46   
ref|XP_010059864.1|  PREDICTED: isoflavone 2'-hydroxylase-like          174   6e-46   
gb|KDP32017.1|  hypothetical protein JCGZ_12478                         174   7e-46   
ref|XP_010692651.1|  PREDICTED: cytochrome P450 81D1-like               171   7e-46   
ref|XP_011099320.1|  PREDICTED: cytochrome P450 81D1-like               174   7e-46   
ref|XP_002510130.1|  cytochrome P450, putative                          174   8e-46   Ricinus communis
emb|CDY04030.1|  BnaC02g37450D                                          174   8e-46   
gb|KDP32013.1|  hypothetical protein JCGZ_12474                         174   8e-46   
emb|CDP01236.1|  unnamed protein product                                174   8e-46   
ref|XP_004290938.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    174   8e-46   
emb|CDY04029.1|  BnaC02g37440D                                          173   9e-46   
ref|NP_189516.1|  cytochrome P450 CYP81D11                              173   9e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008220355.1|  PREDICTED: cytochrome P450 81D11-like              166   1e-45   
gb|KDP41665.1|  hypothetical protein JCGZ_16072                         173   1e-45   
ref|XP_011029079.1|  PREDICTED: cytochrome P450 81D1-like               173   1e-45   
ref|XP_006339843.1|  PREDICTED: cytochrome P450 81D1-like               173   1e-45   
ref|XP_010095334.1|  Cytochrome P450 81D1                               172   1e-45   
emb|CAN60309.1|  hypothetical protein VITISV_015004                     177   1e-45   Vitis vinifera
ref|XP_004292746.1|  PREDICTED: isoflavone 2'-hydroxylase-like          173   1e-45   
ref|XP_010936527.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    173   1e-45   
ref|XP_010502942.1|  PREDICTED: cytochrome P450 81D11-like isofor...    171   1e-45   
ref|XP_006466537.1|  PREDICTED: isoflavone 2'-hydroxylase-like          173   1e-45   
ref|XP_002877127.1|  cytochrome P450 family protein                     173   1e-45   
ref|XP_010059867.1|  PREDICTED: isoflavone 2'-hydroxylase-like          173   2e-45   
emb|CDP12912.1|  unnamed protein product                                175   2e-45   
emb|CDP01241.1|  unnamed protein product                                172   2e-45   
ref|XP_010911513.1|  PREDICTED: cytochrome P450 81D11-like              169   2e-45   
dbj|BAN19900.1|  cytochrome P450                                        173   2e-45   
ref|XP_009406660.1|  PREDICTED: isoflavone 2'-hydroxylase-like          172   2e-45   
gb|AIM45245.1|  flavonoid 3' hydroxylase-like protein                   172   2e-45   
emb|CDX72625.1|  BnaC07g46470D                                          172   2e-45   
ref|XP_010531288.1|  PREDICTED: isoflavone 2'-hydroxylase-like          172   2e-45   
ref|XP_006466538.1|  PREDICTED: isoflavone 2'-hydroxylase-like          172   2e-45   
dbj|BAP46307.1|  cytochrome P450                                        172   2e-45   
ref|XP_009354137.1|  PREDICTED: cytochrome P450 81D11-like              172   3e-45   
gb|KCW54840.1|  hypothetical protein EUGRSUZ_I00783                     168   3e-45   
ref|XP_007207372.1|  hypothetical protein PRUPE_ppa004635mg             172   3e-45   
emb|CDP04571.1|  unnamed protein product                                172   3e-45   
ref|XP_010679549.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    172   3e-45   
ref|XP_008378170.1|  PREDICTED: cytochrome P450 81D1-like               172   3e-45   
gb|AGC29950.1|  CYP81B56                                                169   3e-45   
ref|XP_006399557.1|  hypothetical protein EUTSA_v10016031mg             172   3e-45   
ref|XP_006472258.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    172   3e-45   
ref|XP_011099321.1|  PREDICTED: cytochrome P450 81D1-like               172   3e-45   
ref|XP_010095331.1|  Cytochrome P450 81D1                               172   3e-45   
ref|XP_008787116.1|  PREDICTED: isoflavone 2'-hydroxylase-like          172   3e-45   
ref|XP_009796227.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    172   4e-45   
ref|XP_010437237.1|  PREDICTED: cytochrome P450 81D11-like              172   4e-45   
ref|XP_010936531.1|  PREDICTED: isoflavone 2'-hydroxylase-like          172   4e-45   
ref|XP_010425654.1|  PREDICTED: cytochrome P450 81D11                   172   4e-45   
ref|XP_008365132.1|  PREDICTED: cytochrome P450 81D1-like               172   4e-45   
ref|XP_011097392.1|  PREDICTED: cytochrome P450 81E8-like               171   4e-45   
ref|XP_007018553.1|  Cytochrome P450                                    172   4e-45   
ref|XP_004290939.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    172   4e-45   
emb|CDP19800.1|  unnamed protein product                                171   4e-45   
ref|XP_008238634.1|  PREDICTED: cytochrome P450 81D11-like              171   4e-45   
ref|XP_006433591.1|  hypothetical protein CICLE_v10000934mg             171   4e-45   
ref|XP_002510140.1|  cytochrome P450, putative                          172   4e-45   Ricinus communis
gb|AJD25193.1|  cytochrome P450 CYP81B61                                172   4e-45   
ref|XP_010070610.1|  PREDICTED: isoflavone 2'-hydroxylase-like          172   4e-45   
emb|CBI33746.3|  unnamed protein product                                170   4e-45   
ref|XP_006425999.1|  hypothetical protein CICLE_v10027560mg             171   5e-45   
ref|XP_010437239.1|  PREDICTED: cytochrome P450 81D11-like              171   5e-45   
gb|AFW84519.1|  putative cytochrome P450 superfamily protein            172   5e-45   
ref|XP_004970623.1|  PREDICTED: isoflavone 2'-hydroxylase-like          172   5e-45   
dbj|BAN19901.1|  cytochrome P450                                        172   5e-45   
gb|KCW45256.1|  hypothetical protein EUGRSUZ_L010952                    165   6e-45   
ref|XP_008781034.1|  PREDICTED: cytochrome P450 81D1-like               165   6e-45   
gb|KFK30357.1|  hypothetical protein AALP_AA7G250900                    171   6e-45   
ref|XP_010059866.1|  PREDICTED: isoflavone 2'-hydroxylase-like          171   6e-45   
gb|KDP41666.1|  hypothetical protein JCGZ_16073                         171   6e-45   
ref|XP_007225038.1|  hypothetical protein PRUPE_ppa019886mg             171   6e-45   
ref|XP_009354183.1|  PREDICTED: uncharacterized protein LOC103945350    176   7e-45   
ref|XP_010514586.1|  PREDICTED: cytochrome P450 81D11-like isofor...    171   7e-45   
dbj|BAE48235.1|  cytochrome P450                                        171   7e-45   Sesamum radiatum
ref|XP_010446668.1|  PREDICTED: cytochrome P450 81D11-like              171   7e-45   
ref|XP_008238686.1|  PREDICTED: cytochrome P450 81D11-like              171   8e-45   
ref|XP_006374853.1|  cytochrome P450 family protein                     171   9e-45   
gb|EYU25480.1|  hypothetical protein MIMGU_mgv1a020641mg                172   1e-44   
ref|XP_006590643.1|  PREDICTED: isoflavone 2'-hydroxylase               171   1e-44   
gb|KFK28144.1|  hypothetical protein AALP_AA8G478000                    171   1e-44   
dbj|BAJ09068.1|  cytochrome P450                                        171   1e-44   
gb|KFK33753.1|  hypothetical protein AALP_AA5G055600                    171   1e-44   
gb|KCW66347.1|  hypothetical protein EUGRSUZ_F001732                    163   1e-44   
emb|CDY29547.1|  BnaA03g53920D                                          170   1e-44   
ref|XP_010432066.1|  PREDICTED: cytochrome P450 81D11-like              170   1e-44   
ref|XP_010105470.1|  Cytochrome P450 81D1                               171   1e-44   
ref|XP_010095329.1|  putative receptor-like protein kinase              175   1e-44   
ref|XP_007047420.1|  Cytochrome P450, family 81, subfamily D, pol...    170   1e-44   
gb|KGN63299.1|  hypothetical protein Csa_2G425760                       167   1e-44   
ref|XP_008238660.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    170   1e-44   
emb|CBI33749.3|  unnamed protein product                                164   1e-44   
ref|XP_010531270.1|  PREDICTED: cytochrome P450 81D11-like              170   1e-44   
ref|XP_011017526.1|  PREDICTED: cytochrome P450 81D1-like               171   1e-44   
ref|XP_007206553.1|  hypothetical protein PRUPE_ppa019965mg             170   1e-44   
ref|XP_010432068.1|  PREDICTED: cytochrome P450 81D11-like              170   1e-44   
gb|KDP32012.1|  hypothetical protein JCGZ_12473                         170   1e-44   
ref|XP_007018569.1|  Cytochrome P450, putative                          171   2e-44   
gb|AJD25199.1|  cytochrome P450 CYP81Q43                                170   2e-44   
dbj|BAF00654.1|  cytochrome P450 like protein                           170   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb|KCW66326.1|  hypothetical protein EUGRSUZ_F00151                     168   2e-44   
dbj|BAP46308.1|  cytochrome P450                                        170   2e-44   
ref|XP_010095332.1|  Isoflavone 2'-hydroxylase                          170   2e-44   
ref|XP_002279056.2|  PREDICTED: isoflavone 2'-hydroxylase               171   2e-44   Vitis vinifera
ref|XP_010652757.1|  PREDICTED: isoflavone 2'-hydroxylase-like          170   2e-44   
ref|XP_009380100.1|  PREDICTED: isoflavone 2'-hydroxylase-like          170   2e-44   
ref|XP_011078365.1|  PREDICTED: cytochrome P450 81D11-like              170   2e-44   
ref|XP_010047103.1|  PREDICTED: isoflavone 2'-hydroxylase-like          170   2e-44   
ref|XP_010432067.1|  PREDICTED: cytochrome P450 81D11-like              169   2e-44   
ref|XP_010688240.1|  PREDICTED: isoflavone 3'-hydroxylase-like          169   2e-44   
ref|NP_196622.2|  cytochrome P450, family 81, subfamily K, polype...    169   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424701.1|  PREDICTED: cytochrome P450 81D1-like               168   3e-44   
dbj|BAF96951.1|  flavone synthase II                                    169   3e-44   
ref|XP_007156755.1|  hypothetical protein PHAVU_002G014700g             169   3e-44   
gb|KDO81584.1|  hypothetical protein CISIN_1g015593mg                   167   3e-44   
ref|XP_010095335.1|  Isoflavone 2'-hydroxylase                          169   3e-44   
ref|XP_010548442.1|  PREDICTED: cytochrome P450 81D11-like              169   3e-44   
emb|CDY00119.1|  BnaC09g01820D                                          169   3e-44   
gb|KFK30358.1|  hypothetical protein AALP_AA7G251000                    169   3e-44   
ref|XP_008812892.1|  PREDICTED: isoflavone 2'-hydroxylase-like          169   4e-44   
ref|XP_006466536.1|  PREDICTED: isoflavone 2'-hydroxylase-like          169   4e-44   
ref|XP_007033004.1|  Cytochrome P450, family 81, subfamily D, pol...    169   4e-44   
gb|KDO79056.1|  hypothetical protein CISIN_1g020899mg                   165   4e-44   
emb|CDY22431.1|  BnaC03g61440D                                          168   4e-44   
ref|XP_006289488.1|  hypothetical protein CARUB_v10003021mg             169   4e-44   
dbj|BAN19899.1|  cytochrome P450                                        169   5e-44   
emb|CBI33753.3|  unnamed protein product                                162   5e-44   
ref|NP_001117558.1|  cytochrome P450 superfamily protein                165   5e-44   
emb|CAN69522.1|  hypothetical protein VITISV_018333                     168   5e-44   
gb|KDP32014.1|  hypothetical protein JCGZ_12475                         169   5e-44   
ref|XP_010906241.1|  PREDICTED: isoflavone 2'-hydroxylase-like          169   5e-44   
ref|XP_010911255.1|  PREDICTED: isoflavone 2'-hydroxylase-like          169   5e-44   
dbj|BAJ34200.1|  unnamed protein product                                168   6e-44   
ref|XP_002871428.1|  CYP81K1                                            168   6e-44   
ref|XP_006411898.1|  hypothetical protein EUTSA_v10024985mg             168   6e-44   
ref|XP_008393761.1|  PREDICTED: cytochrome P450 81D11-like              169   6e-44   
gb|AAL69519.1|  AT4g37430/F6G17_80                                      168   7e-44   
ref|XP_010040392.1|  PREDICTED: cytochrome P450 81F1-like               167   7e-44   
gb|AAM67324.1|  cytochrome P450 monooxygenase CYP91A2                   168   7e-44   
ref|NP_195459.1|  cytochrome P450 81F1                                  168   7e-44   
dbj|BAE48236.1|  cytochrome P450                                        168   8e-44   
ref|XP_002866952.1|  CYP81D8                                            168   8e-44   
gb|KDP32016.1|  hypothetical protein JCGZ_12477                         168   8e-44   
emb|CBI33755.3|  unnamed protein product                                162   8e-44   
ref|XP_004287988.1|  PREDICTED: isoflavone 2'-hydroxylase-like          168   8e-44   
ref|XP_008378166.1|  PREDICTED: isoflavone 2'-hydroxylase-like          168   8e-44   
emb|CDP21125.1|  unnamed protein product                                165   9e-44   
ref|XP_010059880.1|  PREDICTED: isoflavone 2'-hydroxylase-like          168   9e-44   
ref|XP_004141393.1|  PREDICTED: isoflavone 2'-hydroxylase-like          168   9e-44   
dbj|BAJ09386.1|  cytochrome P450                                        168   9e-44   
ref|XP_004163249.1|  PREDICTED: isoflavone 2'-hydroxylase-like          168   9e-44   
ref|XP_009111606.1|  PREDICTED: cytochrome P450 81D11                   168   1e-43   
ref|XP_006386494.1|  cytochrome P450 family protein                     168   1e-43   
gb|AGO03791.1|  cytochrome P450-like protein                            167   1e-43   
ref|NP_196623.1|  cytochrome P450, family 81, subfamily K, polype...    167   1e-43   
ref|XP_002285105.1|  PREDICTED: isoflavone 2'-hydroxylase-like          167   1e-43   
dbj|BAA28539.1|  cytochrome P450 monooxygenase                          167   1e-43   
gb|KDP41669.1|  hypothetical protein JCGZ_16076                         168   1e-43   
ref|XP_006290401.1|  hypothetical protein CARUB_v10018682mg             167   1e-43   
ref|XP_006283585.1|  hypothetical protein CARUB_v10004642mg             167   1e-43   
ref|XP_008812889.1|  PREDICTED: isoflavone 2'-hydroxylase-like          167   1e-43   
emb|CDP01240.1|  unnamed protein product                                169   1e-43   
ref|XP_006433592.1|  hypothetical protein CICLE_v10000926mg             167   1e-43   
ref|XP_006472257.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    167   1e-43   
ref|XP_009354182.1|  PREDICTED: cytochrome P450 81D11-like              167   1e-43   
ref|XP_006433590.1|  hypothetical protein CICLE_v10000918mg             167   1e-43   
ref|XP_004151868.1|  PREDICTED: isoflavone 2'-hydroxylase-like          167   1e-43   
ref|XP_010686532.1|  PREDICTED: isoflavone 2'-hydroxylase-like          167   1e-43   
ref|XP_009380101.1|  PREDICTED: isoflavone 2'-hydroxylase-like          168   1e-43   
ref|XP_008444122.1|  PREDICTED: cytochrome P450 81D1-like               167   1e-43   
ref|XP_010548438.1|  PREDICTED: cytochrome P450 81D11-like              167   1e-43   
gb|KGN63298.1|  hypothetical protein Csa_2G425750                       167   1e-43   
ref|XP_004287985.1|  PREDICTED: isoflavone 2'-hydroxylase-like          167   1e-43   
gb|AGC29952.1|  CYP81B57                                                167   2e-43   
ref|XP_010105471.1|  Isoflavone 2'-hydroxylase                          167   2e-43   
ref|XP_004164236.1|  PREDICTED: isoflavone 2'-hydroxylase-like          167   2e-43   
ref|XP_006411892.1|  hypothetical protein EUTSA_v10024981mg             167   2e-43   
ref|XP_004151920.1|  PREDICTED: cytochrome P450 81D1-like               167   2e-43   
ref|XP_010695902.1|  PREDICTED: cytochrome P450 81D11-like              164   2e-43   
ref|XP_009380099.1|  PREDICTED: isoflavone 2'-hydroxylase-like          167   2e-43   
emb|CBI19438.3|  unnamed protein product                                166   2e-43   
ref|XP_008238612.1|  PREDICTED: cytochrome P450 81D11                   167   2e-43   
ref|XP_007208229.1|  hypothetical protein PRUPE_ppa017987mg             167   2e-43   
ref|XP_009122037.1|  PREDICTED: cytochrome P450 81D1                    167   2e-43   
ref|NP_176827.2|  cytochrome P450 superfamily protein                   164   2e-43   
ref|XP_002283235.1|  PREDICTED: isoflavone 2'-hydroxylase               167   3e-43   
ref|XP_003635481.1|  PREDICTED: isoflavone 2'-hydroxylase-like          167   3e-43   
gb|KGN48562.1|  Cytochrome P450                                         166   3e-43   
ref|XP_010659889.1|  PREDICTED: cytochrome P450 81E8-like               166   3e-43   
ref|XP_010059863.1|  PREDICTED: isoflavone 2'-hydroxylase-like          167   3e-43   
ref|XP_010669387.1|  PREDICTED: cytochrome P450 81E8-like               167   3e-43   
ref|XP_010059714.1|  PREDICTED: isoflavone 2'-hydroxylase-like          167   3e-43   
emb|CAN70574.1|  hypothetical protein VITISV_018972                     166   3e-43   
ref|XP_010456472.1|  PREDICTED: cytochrome P450 81E8-like               166   3e-43   
emb|CDP01238.1|  unnamed protein product                                167   3e-43   
emb|CDP01254.1|  unnamed protein product                                160   3e-43   
ref|XP_009630633.1|  PREDICTED: isoflavone 2'-hydroxylase-like          166   4e-43   
ref|XP_002887056.1|  hypothetical protein ARALYDRAFT_475761             164   4e-43   
emb|CBI18830.3|  unnamed protein product                                167   4e-43   
ref|XP_002302426.2|  cytochrome P450 family protein                     166   4e-43   
ref|XP_011099348.1|  PREDICTED: cytochrome P450 81E8-like               166   4e-43   
ref|XP_006285213.1|  hypothetical protein CARUB_v10006572mg             166   4e-43   
ref|XP_010692664.1|  PREDICTED: isoflavone 2'-hydroxylase-like          166   4e-43   
ref|XP_010526705.1|  PREDICTED: cytochrome P450 81D11-like              166   4e-43   
gb|AHG97656.1|  isoflavone-2'-hydroxylase                               166   4e-43   
ref|XP_010435498.1|  PREDICTED: cytochrome P450 81D1-like               166   5e-43   
ref|XP_010652758.1|  PREDICTED: cytochrome P450 81E8 isoform X1         164   5e-43   
emb|CDX69303.1|  BnaC01g01500D                                          166   5e-43   
ref|XP_011070140.1|  PREDICTED: cytochrome P450 81E8-like               165   6e-43   
ref|XP_004141896.1|  PREDICTED: isoflavone 2'-hydroxylase-like          166   6e-43   
emb|CDX69299.1|  BnaC01g01540D                                          166   6e-43   
ref|XP_007207761.1|  hypothetical protein PRUPE_ppa026692mg             166   6e-43   
gb|AAG51161.1|AC074025_11  cytochrome P450, putative                    165   6e-43   
ref|XP_002868988.1|  CYP91A2                                            166   6e-43   
ref|XP_002283222.3|  PREDICTED: cytochrome P450 81E8-like               166   6e-43   
ref|XP_008238642.1|  PREDICTED: isoflavone 2'-hydroxylase-like          166   6e-43   
ref|XP_011029179.1|  PREDICTED: isoflavone 2'-hydroxylase-like          166   6e-43   
gb|AAQ89607.1|  At4g37400                                               162   6e-43   
ref|XP_010440785.1|  PREDICTED: cytochrome P450 81D1-like               166   6e-43   
ref|XP_010548441.1|  PREDICTED: cytochrome P450 81D11-like              166   7e-43   
ref|XP_003611660.1|  Cytochrome P450 81D1                               165   7e-43   
ref|XP_009791128.1|  PREDICTED: cytochrome P450 81D11-like              166   7e-43   
gb|AFK44067.1|  unknown                                                 159   8e-43   
dbj|BAE99553.1|  cytochrome P450 like protein                           165   8e-43   
ref|XP_006472259.1|  PREDICTED: cytochrome P450 81D1-like               165   9e-43   
emb|CDX75645.1|  BnaA01g00570D                                          165   9e-43   
emb|CDP04688.1|  unnamed protein product                                165   9e-43   
ref|XP_006426000.1|  hypothetical protein CICLE_v10025420mg             165   1e-42   
gb|KGN48565.1|  hypothetical protein Csa_6G492250                       165   1e-42   
emb|CDX75640.1|  BnaA01g00620D                                          161   1e-42   
emb|CDX75650.1|  BnaA01g00520D                                          165   1e-42   
ref|XP_010059887.1|  PREDICTED: isoflavone 2'-hydroxylase-like          165   1e-42   
ref|NP_195450.1|  cytochrome P450, family 81, subfamily D, polype...    165   1e-42   
ref|XP_004164241.1|  PREDICTED: cytochrome P450 81D1-like               165   1e-42   
ref|XP_010511484.1|  PREDICTED: cytochrome P450 81D11-like isofor...    165   1e-42   
ref|XP_002888509.1|  hypothetical protein ARALYDRAFT_475755             162   1e-42   
ref|XP_009136438.1|  PREDICTED: cytochrome P450 81F1-like               165   1e-42   
ref|XP_008780951.1|  PREDICTED: isoflavone 2'-hydroxylase-like          165   1e-42   
gb|AJD25197.1|  cytochrome P450 CYP81Q41                                165   1e-42   
ref|XP_009407093.1|  PREDICTED: isoflavone 2'-hydroxylase-like          165   1e-42   
tpg|DAA47255.1|  TPA: putative cytochrome P450 superfamily protein      165   1e-42   
ref|XP_010059888.1|  PREDICTED: isoflavone 2'-hydroxylase-like          165   1e-42   
gb|EYU43431.1|  hypothetical protein MIMGU_mgv1a004884mg                165   1e-42   
emb|CAN76836.1|  hypothetical protein VITISV_029031                     164   1e-42   
ref|XP_007207692.1|  hypothetical protein PRUPE_ppa023786mg             164   1e-42   
emb|CDX69819.1|  BnaA10g21680D                                          164   2e-42   
gb|KCW66315.1|  hypothetical protein EUGRSUZ_F00141                     164   2e-42   
ref|XP_002524937.1|  cytochrome P450, putative                          160   2e-42   
gb|ACG27899.1|  cytochrome P450 CYP81N4                                 165   2e-42   
emb|CAB89383.1|  cytochrome P450-like protein                           165   2e-42   
ref|XP_009796228.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    164   2e-42   
ref|XP_010095333.1|  Isoflavone 2'-hydroxylase                          164   2e-42   
ref|XP_008661335.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    165   2e-42   
ref|XP_010059868.1|  PREDICTED: isoflavone 2'-hydroxylase-like          164   2e-42   
ref|XP_002510131.1|  cytochrome P450, putative                          164   2e-42   
ref|XP_007156756.1|  hypothetical protein PHAVU_002G014800g             165   2e-42   
emb|CAB38207.1|  cytochrome P450 monooxygenase-like protein             161   2e-42   
ref|XP_002524942.1|  cytochrome P450, putative                          163   2e-42   
ref|XP_006411896.1|  hypothetical protein EUTSA_v10027443mg             164   2e-42   
gb|AJD25198.1|  cytochrome P450 CYP81Q42                                164   2e-42   
gb|AGO03794.1|  cytochrome P450-like protein                            164   2e-42   
ref|XP_010070611.1|  PREDICTED: isoflavone 2'-hydroxylase-like          164   2e-42   
ref|XP_009360222.1|  PREDICTED: isoflavone 2'-hydroxylase-like          164   3e-42   
dbj|BAK00283.1|  predicted protein                                      164   3e-42   
ref|XP_008238624.1|  PREDICTED: cytochrome P450 81D11-like              164   3e-42   
ref|XP_002866956.1|  CYP81D5                                            164   3e-42   
ref|XP_004151924.1|  PREDICTED: cytochrome P450 81D1-like               162   3e-42   
ref|XP_011099350.1|  PREDICTED: cytochrome P450 81E8-like               164   3e-42   
ref|XP_010531271.1|  PREDICTED: cytochrome P450 81F1-like               164   3e-42   
ref|XP_004292740.1|  PREDICTED: isoflavone 2'-hydroxylase-like          164   3e-42   
ref|XP_002283523.3|  PREDICTED: cytochrome P450 81E8 isoform X2         164   3e-42   
gb|AAN31933.1|  putative cytochrome P450 monooxygenase (CYP91A2)        163   3e-42   
ref|XP_006411900.1|  hypothetical protein EUTSA_v10025016mg             163   3e-42   
gb|KDP32015.1|  hypothetical protein JCGZ_12476                         164   3e-42   
ref|XP_007018585.1|  Cytochrome P450, putative                          164   3e-42   
ref|XP_004252822.1|  PREDICTED: isoflavone 2'-hydroxylase-like          164   4e-42   
ref|XP_009372457.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    164   4e-42   
gb|ACG37780.1|  cytochrome P450 CYP81A17                                164   4e-42   
ref|XP_002523472.1|  cytochrome P450, putative                          164   4e-42   
ref|XP_008453067.1|  PREDICTED: LOW QUALITY PROTEIN: isoflavone 2...    164   4e-42   
ref|XP_009138491.1|  PREDICTED: cytochrome P450 81D11-like              163   4e-42   
ref|XP_011069765.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    163   5e-42   
ref|XP_004233948.1|  PREDICTED: cytochrome P450 81D11-like              163   5e-42   
ref|XP_011078366.1|  PREDICTED: cytochrome P450 81D11-like              163   6e-42   
ref|XP_008812908.1|  PREDICTED: isoflavone 2'-hydroxylase-like          163   6e-42   
ref|NP_195453.1|  cytochrome P450, family 81, subfamily D, polype...    163   6e-42   
gb|AEM42992.1|  cytochrome P450                                         163   7e-42   
gb|EYU44451.1|  hypothetical protein MIMGU_mgv1a005093mg                162   7e-42   
ref|XP_009136769.1|  PREDICTED: cytochrome P450 81F1                    162   7e-42   
gb|EYU44453.1|  hypothetical protein MIMGU_mgv1a005075mg                162   7e-42   
ref|XP_009622945.1|  PREDICTED: isoflavone 2'-hydroxylase-like          163   8e-42   
gb|KHG06872.1|  Isoflavone 2'-hydroxylase                               162   8e-42   
gb|AJD25194.1|  cytochrome P450 CYP81B62                                162   8e-42   
ref|XP_008455814.1|  PREDICTED: LOW QUALITY PROTEIN: isoflavone 2...    162   8e-42   
ref|XP_004169118.1|  PREDICTED: isoflavone 2'-hydroxylase-like          162   8e-42   
ref|NP_001168824.1|  uncharacterized protein LOC100382629               160   8e-42   
ref|XP_004487888.1|  PREDICTED: isoflavone 2'-hydroxylase-like          162   8e-42   
gb|AFW67560.1|  putative cytochrome P450 superfamily protein            163   8e-42   
ref|XP_010543254.1|  PREDICTED: cytochrome P450 81D1-like               162   1e-41   
ref|XP_007151697.1|  hypothetical protein PHAVU_004G0683001g            159   1e-41   
ref|XP_010419280.1|  PREDICTED: cytochrome P450 81D11-like              162   1e-41   
ref|XP_010437233.1|  PREDICTED: cytochrome P450 81F1-like               162   1e-41   
ref|XP_004141394.1|  PREDICTED: isoflavone 2'-hydroxylase-like          162   1e-41   
ref|XP_010028151.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    162   1e-41   
ref|XP_002866955.1|  CYP81D4                                            162   1e-41   
ref|XP_004156794.1|  PREDICTED: cytochrome P450 81D1-like               166   1e-41   
ref|XP_008644484.1|  PREDICTED: cytochrome P450 81D1-like               162   1e-41   
ref|XP_010059891.1|  PREDICTED: isoflavone 2'-hydroxylase-like          162   1e-41   
ref|NP_195452.1|  cytochrome P450, family 81, subfamily D, polype...    162   1e-41   
ref|XP_009144655.1|  PREDICTED: cytochrome P450 81D1                    162   1e-41   
emb|CDY63574.1|  BnaC06g42070D                                          162   1e-41   
gb|KCW66309.1|  hypothetical protein EUGRSUZ_F00134                     162   1e-41   
ref|XP_006411902.1|  hypothetical protein EUTSA_v10027312mg             162   1e-41   
gb|KHN28917.1|  Isoflavone 2'-hydroxylase                               158   1e-41   
ref|XP_010906301.1|  PREDICTED: cytochrome P450 81E8-like               162   1e-41   
ref|XP_004290937.1|  PREDICTED: isoflavone 2'-hydroxylase-like          162   1e-41   
ref|XP_010451019.1|  PREDICTED: cytochrome P450 81D11-like              162   1e-41   
gb|KDP41658.1|  hypothetical protein JCGZ_16065                         162   1e-41   
ref|XP_008455812.1|  PREDICTED: isoflavone 2'-hydroxylase-like          162   2e-41   
gb|EYU44450.1|  hypothetical protein MIMGU_mgv1a005020mg                162   2e-41   
ref|XP_004963012.1|  PREDICTED: cytochrome P450 81D1-like               162   2e-41   
ref|XP_004163250.1|  PREDICTED: isoflavone 2'-hydroxylase-like          162   2e-41   
ref|XP_004290936.1|  PREDICTED: isoflavone 2'-hydroxylase-like          162   2e-41   
ref|XP_008812907.1|  PREDICTED: cytochrome P450 81D11-like              165   2e-41   
gb|EMT15747.1|  Cytochrome P450 81D1                                    159   2e-41   
ref|XP_003579242.2|  PREDICTED: cytochrome P450 81D11-like              162   2e-41   
gb|KGN63284.1|  hypothetical protein Csa_2G423640                       162   2e-41   
ref|XP_010450431.1|  PREDICTED: cytochrome P450 81D1                    162   2e-41   
gb|KFK30360.1|  hypothetical protein AALP_AA7G251200                    161   2e-41   
ref|XP_009136332.1|  PREDICTED: cytochrome P450 81F1                    161   2e-41   
emb|CAB56742.1|  cytochrome P450 monooxygenase                          155   2e-41   
ref|XP_004956717.1|  PREDICTED: isoflavone 2'-hydroxylase-like          162   2e-41   
ref|XP_002510139.1|  cytochrome P450, putative                          162   2e-41   



>ref|XP_009597287.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nicotiana tomentosiformis]
Length=530

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 176/215 (82%), Gaps = 1/215 (0%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++FVAGTETTS+TI+WAM LLL++P+   KLR EID+ VG++ LLNESDLSKLPYL
Sbjct  316  SLLVVLFVAGTETTSMTIQWAMRLLLAHPQAFTKLRAEIDSKVGNERLLNESDLSKLPYL  375

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            R +INETLRLYPP PLLLPH+S EDC VAGY VPKHT +M+NAWA+H DPK+W+EPEKFK
Sbjct  376  RSVINETLRLYPPVPLLLPHFSSEDCTVAGYQVPKHTILMINAWAIHRDPKLWDEPEKFK  435

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA+   E EGFNYKF+PFG GRRAC   NMGLR VSL LG+ IQ FDWKN +E+  
Sbjct  436  PERFEAMDLGEKEGFNYKFIPFGMGRRACSGANMGLRTVSLMLGSLIQWFDWKNVEEENN  495

Query  684  LCATYLSPSI-LQKDERLEAICTPRKNCLQFLSQL  785
            L A Y++  + L KD+ LE+IC PR+NC+Q LSQL
Sbjct  496  LDACYINSKVNLNKDKPLESICIPRQNCIQLLSQL  530



>ref|XP_009780215.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nicotiana sylvestris]
Length=527

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 171/212 (81%), Gaps = 0/212 (0%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++FVAGTETTS+TI+WAM LLL++P+   KLR EID+ VG+K LLNESDL+KLPYL
Sbjct  316  SLLVVLFVAGTETTSMTIQWAMRLLLAHPQAFQKLRSEIDSKVGNKRLLNESDLAKLPYL  375

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             C+INETLRLYPP PLLLPHYS E+C + GY VPKHT +MVNAWA+H DPK+W+EPEKFK
Sbjct  376  HCVINETLRLYPPVPLLLPHYSSENCTIGGYQVPKHTILMVNAWAIHRDPKLWDEPEKFK  435

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA+   E EGFNYKF+PFG GRRAC   NMGLR VSL LG+ IQ FDWKN +E+  
Sbjct  436  PERFEAMELGEKEGFNYKFIPFGMGRRACSGANMGLRTVSLVLGSLIQWFDWKNVEEENN  495

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLS  779
            L A Y S   L KD+ LEAIC PR+NC+Q LS
Sbjct  496  LDACYNSKVNLSKDKPLEAICIPRQNCIQLLS  527



>ref|XP_006359732.1| PREDICTED: isoflavone 2'-hydroxylase-like [Solanum tuberosum]
Length=513

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 177/214 (83%), Gaps = 3/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +I+ ++FVAGTET+S TI+W M LLL++PEVLHKLR +IDN VG+K L+ ESDL+KLPYL
Sbjct  303  SIMLVIFVAGTETSSSTIQWVMRLLLAHPEVLHKLRADIDNKVGNKRLVRESDLTKLPYL  362

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC++NET+RLYPP PLLLPHYS EDC V GYDVPKHT +++NAWA+H DPKVW++PEKFK
Sbjct  363  RCVVNETMRLYPPVPLLLPHYSTEDCTVGGYDVPKHTMLLINAWAVHRDPKVWDDPEKFK  422

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA  GE  E FNYK +PFG GRRACP  +MGLR VSLALGA +QCFDW+  +E++ 
Sbjct  423  PERFEATEGET-ERFNYKLIPFGMGRRACPGTDMGLRAVSLALGALVQCFDWQ-IEEEES  480

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            L A+Y +   +Q ++ L+A+CTPRK+ ++ LSQL
Sbjct  481  LEASYHARMSMQ-NKPLKAVCTPRKDLVELLSQL  513



>ref|XP_004242874.1| PREDICTED: cytochrome P450 81D11-like [Solanum lycopersicum]
Length=512

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 176/214 (82%), Gaps = 3/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +I+ +VFVAGTET+S TI+W M LLL++PEVLHKLR +IDN VG+K L+ ESDL+KLPYL
Sbjct  302  SIMLVVFVAGTETSSSTIQWVMRLLLAHPEVLHKLRADIDNKVGNKRLVRESDLTKLPYL  361

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC++NET+RLYPP PLLLPHYS EDC V GYDVPKHT +++NAWA+H DPKVW++PEKFK
Sbjct  362  RCVVNETMRLYPPVPLLLPHYSTEDCTVGGYDVPKHTMLLINAWAVHRDPKVWDDPEKFK  421

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA  G E E FNYK +PFG GRRACP  +MGLR VSLALGA IQCF+W+  +E++ 
Sbjct  422  PERFEATQG-ETERFNYKLIPFGMGRRACPGTDMGLRAVSLALGALIQCFEWQ-IEEEES  479

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            L A+Y +   +Q ++ L+AICTPRK+ +  LSQL
Sbjct  480  LEASYHARMSMQ-NKPLKAICTPRKDLVDLLSQL  512



>ref|XP_009760136.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nicotiana sylvestris]
Length=520

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 171/212 (81%), Gaps = 2/212 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++F+AGTETTS+TI+WAM LLL++P+   KLR EID+ VG+  LLNESD+ KLPYL
Sbjct  311  SVLLVLFIAGTETTSMTIQWAMRLLLAHPKAFTKLRAEIDSKVGNDGLLNESDIPKLPYL  370

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             C+INETLRLYPP PLLLPHYSLEDC V GY+VPKHT +MVNAWA+H DPK+W+EPEKFK
Sbjct  371  HCVINETLRLYPPVPLLLPHYSLEDCTVGGYEVPKHTILMVNAWAIHRDPKLWDEPEKFK  430

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA+ GE+ EGFNYK VPFG GRRACP   MGLR VSL LG+ IQ FDWK+ +E+K 
Sbjct  431  PERFEAMEGEK-EGFNYKLVPFGMGRRACPGAAMGLRTVSLVLGSLIQSFDWKSVEEEK-  488

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLS  779
            L A Y S   L KD+ LEA+C PR+N   FLS
Sbjct  489  LDACYNSRITLNKDKPLEAVCIPRQNWRGFLS  520



>ref|XP_006367416.1| PREDICTED: isoflavone 2'-hydroxylase-like [Solanum tuberosum]
Length=510

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 172/214 (80%), Gaps = 2/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +I+ ++F+AGT+T+S +++WAM LLL++PE LHKLR EID+ VG++HLLNESDL+KLPYL
Sbjct  299  SIMLVIFIAGTDTSSTSLQWAMRLLLAHPEALHKLRAEIDSQVGNEHLLNESDLTKLPYL  358

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
              +INETLRLYPP PLLLPHYS EDC V GY+VPKHT ++VN WA+  DP+VW+EP +FK
Sbjct  359  HSVINETLRLYPPVPLLLPHYSSEDCTVGGYNVPKHTILLVNIWAIQRDPQVWKEPNEFK  418

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA+ GE+ EGFNYK +PFG GRR+CP   MG R +SLALGA IQCFDW++  E+  
Sbjct  419  PERFEAMEGEK-EGFNYKLIPFGMGRRSCPGATMGTRAISLALGALIQCFDWQSAGEEN-  476

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            L  +Y S   +QK + LEAICTPR N +Q LSQL
Sbjct  477  LELSYNSRINIQKIKSLEAICTPRSNFVQLLSQL  510



>ref|XP_011074387.1| PREDICTED: cytochrome P450 81E8-like [Sesamum indicum]
Length=506

 Score =   240 bits (613),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 168/214 (79%), Gaps = 3/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +IV ++F+AGTET++VTIEWAMSLLL++PE LHKL+ EIDN++GH HL+N++DL+KLPYL
Sbjct  296  SIVLILFIAGTETSAVTIEWAMSLLLTHPEELHKLKQEIDNHIGHDHLINDADLAKLPYL  355

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINETLRLYPP PLLLPHYS E C V GYDVPK T +MVNAWAMH DP +WEEP+KF 
Sbjct  356  RCIINETLRLYPPVPLLLPHYSSEKCTVGGYDVPKGTILMVNAWAMHRDPNIWEEPDKFN  415

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            P RF+A+   E E   +KFVPFG GRRACP   MGLR +SLALGA++QCF+W+   E + 
Sbjct  416  PRRFQAM---EMEREAWKFVPFGMGRRACPGAAMGLRTISLALGAFVQCFEWEKLLEHED  472

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            + A Y S  +LQK + LEA+C PR      LS++
Sbjct  473  MDANYNSRIMLQKGKPLEAVCVPRDPAADLLSRI  506



>dbj|BAH84783.1| cytochrome P450 [Nicotiana tabacum]
Length=522

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 170/212 (80%), Gaps = 2/212 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++F+AGTETTS+TI+WAM LLL++P+   KLR EID+ VG+  LLNESD+ KLPYL
Sbjct  313  SVLLVLFIAGTETTSMTIQWAMRLLLAHPKAFTKLRAEIDSKVGNDGLLNESDIPKLPYL  372

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
              +INETLRLYPP PLLLPHYSLEDC V GY+VPKHT +MVNAWA+H DPK+W+EPEKFK
Sbjct  373  HRVINETLRLYPPVPLLLPHYSLEDCTVGGYEVPKHTILMVNAWAIHRDPKLWDEPEKFK  432

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA+ GE+ EGFNYK VPFG GRRACP   MGLR VSL LG+ IQ FDWK+ +E+K 
Sbjct  433  PERFEAMEGEK-EGFNYKLVPFGMGRRACPGAAMGLRTVSLVLGSLIQSFDWKSVEEEK-  490

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLS  779
            L A Y S   L KD+ LEA+C PR+N   FLS
Sbjct  491  LDACYNSRITLNKDKPLEAVCIPRQNWRGFLS  522



>ref|XP_009597427.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nicotiana tomentosiformis]
Length=520

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 172/214 (80%), Gaps = 3/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +I+ +VFVAGTET+S TI+W M LL+++PE L+KLR +ID+ VG+K LLNESDL+KLPYL
Sbjct  310  SIMLVVFVAGTETSSTTIQWVMRLLVAHPEALYKLRADIDSKVGNKRLLNESDLNKLPYL  369

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             C++NET+RLY P PLLLPHYS +DC+V GYDVPKHT + VNAWA+H DPKVWEEP+KFK
Sbjct  370  HCVVNETMRLYTPIPLLLPHYSTKDCIVEGYDVPKHTMLFVNAWAIHRDPKVWEEPDKFK  429

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA  G E E FNYK VPFG GRRACP  +MGLR VSLALGA IQCFDW+  +E + 
Sbjct  430  PERFEATEG-ETERFNYKLVPFGIGRRACPGADMGLRAVSLALGALIQCFDWQ-IEEAES  487

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            L  +Y S   +Q ++ L+A+CTPR++  Q LSQL
Sbjct  488  LEESYNSRMTMQ-NKPLKAVCTPREDLGQLLSQL  520



>ref|XP_006367415.1| PREDICTED: isoflavone 2'-hydroxylase-like [Solanum tuberosum]
Length=516

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 166/207 (80%), Gaps = 4/207 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++FVAGTETTS+TI+WAM LLL++P+   KLR EIDNNVG++ LLNESDL+ LPYL
Sbjct  311  SLLMVLFVAGTETTSMTIQWAMRLLLAHPKAFQKLRSEIDNNVGNERLLNESDLTNLPYL  370

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            +C+INETLRLY P PLLLPHYSLEDC V GYDVPK+T +MVNAWA+H DP +W+EPEKF 
Sbjct  371  QCVINETLRLYSPVPLLLPHYSLEDCTVGGYDVPKNTILMVNAWAIHRDPALWDEPEKFM  430

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDK-  680
            PERFEA+ GE+ EGF+YKFVPFG GRRACP +NMG+R VSL LG+ +Q FDWKN + D+ 
Sbjct  431  PERFEAMEGEK-EGFSYKFVPFGMGRRACPGDNMGMRTVSLVLGSLVQWFDWKNVELDEN  489

Query  681  --ILCATYLSPSILQKDERLEAICTPR  755
               +   Y S  I  KD+  EAIC PR
Sbjct  490  YSNMDEYYNSKVISSKDKPFEAICIPR  516



>gb|ABC69379.1| CYP81C6v2 [Nicotiana tabacum]
Length=520

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 171/214 (80%), Gaps = 3/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +I+ +VFVAGTET+S TI+W M LL+++PE L+KLR +ID+ VG+K LLNESDL+KLPYL
Sbjct  310  SIMLVVFVAGTETSSTTIQWVMRLLVAHPEALYKLRADIDSKVGNKRLLNESDLNKLPYL  369

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             C++NET+RLY P PLLLPHYS +DC+V GYDVPKHT + VNAWA+H DPKVWEEP+KFK
Sbjct  370  HCVVNETMRLYTPIPLLLPHYSTKDCIVEGYDVPKHTMLFVNAWAIHRDPKVWEEPDKFK  429

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA  G E E FNYK VPFG GRRACP  +MGLR VSLALGA IQCFDW+  +E + 
Sbjct  430  PERFEATEG-ETERFNYKLVPFGMGRRACPGADMGLRAVSLALGALIQCFDWQ-IEEAES  487

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            L  +Y S   +Q ++ L+ +CTPR++  Q LSQL
Sbjct  488  LEESYNSRMTMQ-NKPLKVVCTPREDLGQLLSQL  520



>gb|ABC69380.1| CYP81C6v2 [Nicotiana tabacum]
Length=520

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 171/214 (80%), Gaps = 3/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +I+ +VFVAGTET+S TI+W M LL+++PE L+KLR +ID+ VG+K LLNESDL+KLPYL
Sbjct  310  SIMLVVFVAGTETSSTTIQWVMRLLVAHPEALYKLRADIDSKVGNKRLLNESDLNKLPYL  369

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             C++NET+RLY P PLLLPHYS +DC+V GYDVPKHT + VNAWA+H DPKVWEEP+KFK
Sbjct  370  HCVVNETMRLYTPIPLLLPHYSTKDCIVEGYDVPKHTMLFVNAWAIHRDPKVWEEPDKFK  429

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA  G E E FNYK VPFG GRRACP  +MGLR VSLALGA IQCFDW+  +E + 
Sbjct  430  PERFEATEG-ETERFNYKLVPFGMGRRACPGADMGLRAVSLALGALIQCFDWQ-IEEAES  487

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            L  +Y S   +Q ++ L+ +CTPR++  Q LSQL
Sbjct  488  LEESYNSRMTMQ-NKPLKVVCTPREDLGQLLSQL  520



>ref|XP_009785012.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X1 [Nicotiana 
sylvestris]
Length=520

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 173/214 (81%), Gaps = 3/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +I+ +VF+AGTET+S TI+W + LL+++P+ L+KLR +IDN VG+K LLNESDL+KLPYL
Sbjct  310  SIMLVVFIAGTETSSTTIQWVIRLLVAHPDTLYKLRADIDNKVGNKRLLNESDLNKLPYL  369

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             C++NET+RLYPP PLLLPH+S EDC+V GYDVPK+T + VNAWA+H DPKVWEEP+KFK
Sbjct  370  YCVVNETMRLYPPVPLLLPHFSTEDCIVGGYDVPKNTLLFVNAWAIHRDPKVWEEPDKFK  429

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA  GE  E FNYKFVPFG GRRACP  +MGLR VSLALGA IQCFDW+   E + 
Sbjct  430  PERFEATEGET-ERFNYKFVPFGMGRRACPGADMGLRAVSLALGALIQCFDWQ-IGETES  487

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            L  +Y S   +Q ++ L+A+CTPR++ +Q LS L
Sbjct  488  LEESYNSRMTMQ-NKPLKAVCTPREDLVQHLSNL  520



>gb|AHK60838.1| CYP81C13 [Catharanthus roseus]
Length=507

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 166/214 (78%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++FVAGTET++V IEWAMSLLLS P+VL+KLR EID  +G+K L+NESD+ KLPYL
Sbjct  298  SVLLIMFVAGTETSAVIIEWAMSLLLSNPDVLNKLRIEIDKQIGNKRLINESDIPKLPYL  357

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINET+RL+PP PLLLPH S EDC +AGYD+PK T + VNAWA H DPK+W+EPEKF 
Sbjct  358  RCIINETMRLFPPVPLLLPHCSSEDCKIAGYDIPKGTVLFVNAWATHRDPKLWDEPEKFI  417

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE +   E E   YKF+PFG GRRACP  +MG+R VSLALGA+IQCFDWK  +E + 
Sbjct  418  PERFENM---EVEKEGYKFIPFGIGRRACPGTSMGIRTVSLALGAFIQCFDWKKVEEYE-  473

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            L  +Y     LQK  +LEA C+PR++    LSQL
Sbjct  474  LNTSYDYRITLQKANQLEASCSPRQDFFPILSQL  507



>emb|CDP01251.1| unnamed protein product [Coffea canephora]
Length=408

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I  ++  AG ET+++T EWAM LLL++P+ L KLR EIDN+VGH  L++ESD+ KLPYL
Sbjct  195  GIALIMLTAGRETSTLTTEWAMLLLLNHPKALQKLRTEIDNSVGHGRLVDESDIPKLPYL  254

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC++NETLRLYP APLL+PH++ EDC V GYD+PK T V+ NAWA+H DPK+WE+PEKF 
Sbjct  255  RCVVNETLRLYPAAPLLIPHHASEDCRVGGYDIPKGTIVLANAWAVHRDPKLWEQPEKFM  314

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA    + E FN KF+PFG GRRACP  N+G+R VSLA+G +IQCFDW   +ED  
Sbjct  315  PERFEAKGLMDKEEFNSKFLPFGIGRRACPGANLGIRNVSLAVGTFIQCFDWDKVEEDGE  374

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            L   + +   L+K   LEAIC+PR+  +Q LSQL
Sbjct  375  LDVNFSNRMSLKKANHLEAICSPRQESIQLLSQL  408



>emb|CDP01250.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   225 bits (574),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 166/214 (78%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +I+ ++FVAGTET+ VT EWAMSLLLS+PE ++KLR EIDNN+GH+ LL+ESDL KLPYL
Sbjct  325  SILMIMFVAGTETSIVTTEWAMSLLLSHPEAMNKLRREIDNNIGHRRLLDESDLPKLPYL  384

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCI+NET+RLYPPAPLLLPH   ED  V GY +PK +T++VNAWAM  DPKVWEEPE FK
Sbjct  385  RCIVNETMRLYPPAPLLLPHCPSEDFTVGGYGIPKGSTLIVNAWAMQRDPKVWEEPEMFK  444

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA+   E E   + FVPFG GRRACP  NMG+R +SLA+G++IQCFDW+  +ED+I
Sbjct  445  PERFEAM---EMERERFNFVPFGVGRRACPGANMGIRNISLAVGSFIQCFDWRKIEEDEI  501

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
               ++ +   L   + LE +C PR+  +Q LSQL
Sbjct  502  -NTSHTTRITLSMAKPLEVMCIPRQESIQLLSQL  534



>ref|XP_004238119.1| PREDICTED: cytochrome P450 81E8 [Solanum lycopersicum]
Length=507

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 167/214 (78%), Gaps = 2/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +I+ ++FV GT+TTS TI+WAM LLL++PE LHKLR EID  VG+  LLNESDL+KLPYL
Sbjct  296  SIMLVIFVTGTDTTSTTIQWAMRLLLAHPEALHKLRAEIDVQVGNTRLLNESDLTKLPYL  355

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
              +INETLRLYP  PLLLPHYS EDC V GY+VPKHT ++VNAWA+  DP+VW++P +FK
Sbjct  356  HSVINETLRLYPTVPLLLPHYSTEDCTVGGYNVPKHTILLVNAWAIQRDPQVWKDPNEFK  415

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEAI G + EG NYKF+PFG GRR+CP   M  R +SLALG+ IQCFDW++  ++  
Sbjct  416  PERFEAIEGGK-EGVNYKFIPFGMGRRSCPGAGMATRAISLALGSLIQCFDWQSVGKEN-  473

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            L  +Y S   +QK++ LEAIC+PR N LQ LSQL
Sbjct  474  LALSYNSRIKIQKNKSLEAICSPRSNFLQLLSQL  507



>ref|XP_011015740.1| PREDICTED: cytochrome P450 81D11-like [Populus euphratica]
Length=507

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 166/214 (78%), Gaps = 11/214 (5%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ M+FVAGTET++VT+EWAM+LLL++P+ + KL+ EID +VGH  LLNESD+ KLPYL
Sbjct  299  SVLLMMFVAGTETSAVTLEWAMALLLNHPKAMQKLKAEIDEHVGHGRLLNESDIVKLPYL  358

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC+I ETLRLYPPAPLLLPH+S   C V G+D+P+ TT+MVNAWAMH DPK+WEE  +FK
Sbjct  359  RCVIKETLRLYPPAPLLLPHFSSGACTVGGFDIPQGTTLMVNAWAMHRDPKLWEESNEFK  418

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA VGE+ EGF Y  +PFGTGRRACP  +MGL++VS ALGA +QCF+W     DK+
Sbjct  419  PERFEAGVGEQ-EGFKY--IPFGTGRRACPGASMGLQIVSFALGAVVQCFEW-----DKV  470

Query  684  LCATYL--SPSI-LQKDERLEAICTPRKNCLQFL  776
              A  +  SP I L K + LEA+C PR++    L
Sbjct  471  APAEDMSHSPGITLSKAKPLEALCCPRRDLTTLL  504



>emb|CDP01253.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   217 bits (552),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 158/214 (74%), Gaps = 0/214 (0%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +I  ++  AG ET+++T EWAM LLL++P+ L KLR EIDN+VGH  L++ESD+ KLPYL
Sbjct  302  SIALIMLTAGRETSTLTTEWAMLLLLNHPKALQKLRTEIDNSVGHGRLVDESDIPKLPYL  361

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC++NETLRLYP APLLLPH + EDC V GYD+ K T V+ NAWA+H DPK+WEEPEKF 
Sbjct  362  RCVVNETLRLYPAAPLLLPHQASEDCRVGGYDIKKGTIVLANAWAVHRDPKLWEEPEKFM  421

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE     + E FN KF+PFG GRRACP  N+G+R VSLA+G +IQCFDW   ++D  
Sbjct  422  PERFEGKGLMDKEEFNSKFLPFGIGRRACPGANLGIRSVSLAVGTFIQCFDWDKVEQDGE  481

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            L   + +   ++K   LEA+C PR+  +Q LSQL
Sbjct  482  LDIDFSNRITMKKSNHLEALCAPRQESIQLLSQL  515



>ref|XP_011017148.1| PREDICTED: cytochrome P450 81D11-like [Populus euphratica]
Length=507

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 166/214 (78%), Gaps = 11/214 (5%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ M+FVAGTET++VT+EWAM+LLL++P+ + KL+ EID +VGH  LLNESD+ KLPYL
Sbjct  299  SVLLMMFVAGTETSAVTLEWAMALLLNHPKAMQKLKAEIDEHVGHGRLLNESDIVKLPYL  358

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC+I ETLRLYPPAPLLLPH+S   C V G+D+P+ TT+MVNAWAMH DPK+WEE  +FK
Sbjct  359  RCVIKETLRLYPPAPLLLPHFSSGACTVGGFDIPQGTTLMVNAWAMHRDPKLWEESNEFK  418

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA +GE+ EGF Y  +PFGTGRRACP  +MGL++VS ALGA +QCF+W     DK+
Sbjct  419  PERFEAGLGEQ-EGFKY--IPFGTGRRACPGASMGLQIVSFALGAVVQCFEW-----DKV  470

Query  684  LCATYL--SPSI-LQKDERLEAICTPRKNCLQFL  776
              A  +  SP I L K + LEA+C PR++    L
Sbjct  471  APAEDMSHSPGITLSKAKPLEALCCPRRDLTTLL  504



>ref|XP_007018581.1| Cytochrome P450, family 81, subfamily D, polypeptide 2, putative 
[Theobroma cacao]
 gb|EOY15806.1| Cytochrome P450, family 81, subfamily D, polypeptide 2, putative 
[Theobroma cacao]
Length=210

 Score =   206 bits (523),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 158/214 (74%), Gaps = 4/214 (2%)
 Frame = +3

Query  138  MYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLP  317
            M  + Q +F AGTETT+  +EWAMSLLL++PE + K+R EID +VGH  LL++SDL+ LP
Sbjct  1    MRYLHQTMFNAGTETTAAIMEWAMSLLLNHPESMQKVRAEIDAHVGHGRLLHDSDLANLP  60

Query  318  YLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepek  497
            YLRC+ NETL LYPP+PLLLPH+S EDCVV GY++P+ T +MVN WA+H DP +WE P K
Sbjct  61   YLRCVANETLGLYPPSPLLLPHFSSEDCVVGGYEIPRGTMLMVNVWAIHRDPSLWEGPSK  120

Query  498  fkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  677
            FKPERFEA  GE+ EGF Y  +PFG GRR CP   MG+RL+ LALGA IQCF W+N  + 
Sbjct  121  FKPERFEASFGEK-EGFRY--LPFGLGRRDCPGAAMGMRLIFLALGAAIQCFVWENVGQG  177

Query  678  KILCATYLSPSILQKDERLEAICTPRKNCLQFLS  779
            K+  ++    ++L K   LEA C PR+N ++ LS
Sbjct  178  KVDMSSGSGITLL-KARPLEARCCPRRNSIKLLS  210



>ref|XP_007018579.1| Cytochrome P450, family 81, subfamily K, polypeptide 2, putative 
[Theobroma cacao]
 gb|EOY15804.1| Cytochrome P450, family 81, subfamily K, polypeptide 2, putative 
[Theobroma cacao]
Length=511

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 170/222 (77%), Gaps = 12/222 (5%)
 Frame = +3

Query  132  KQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSK  311
            K + ++  M+FVAGTETT+VT+EWAMSLLL++PE L K+R EI ++VGH+ LLNESDL+K
Sbjct  298  KVIKSMALMMFVAGTETTAVTMEWAMSLLLNHPEALQKVRAEIVSHVGHERLLNESDLAK  357

Query  312  LPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeep  491
            LPYLRC+++ETLRLYPPAP+LLPH S EDC+V GY++PK T ++VNAWA+H DP +WEEP
Sbjct  358  LPYLRCVVSETLRLYPPAPVLLPHCSSEDCMVGGYEIPKGTQLLVNAWAIHRDPSIWEEP  417

Query  492  ekfkperfe-AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNT  668
             KFKPERFE A V +EG     K++PFG GRRACP   MG+RLV LALGA +QCF+W+  
Sbjct  418  TKFKPERFEGAFVEKEG----LKYLPFGLGRRACPGATMGMRLVLLALGAAVQCFEWEKE  473

Query  669  KEDKILCATYLSP---SILQKDERLEAICTPRKNCLQFLSQL  785
              +K+     +SP   +++ +   LEA+C PR + ++ LSQ 
Sbjct  474  GPEKV----DMSPGTGTVMSRARPLEALCCPRPDLIKLLSQF  511



>ref|XP_006374861.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52658.1| cytochrome P450 family protein [Populus trichocarpa]
Length=510

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 166/216 (77%), Gaps = 9/216 (4%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            + V M+F+AGTET+++T+EWAM+LLL++P+V+ K++ EID +VGH  LLNESD+ KLPYL
Sbjct  302  STVLMMFIAGTETSAITLEWAMTLLLNHPKVMQKVKAEIDEHVGHGRLLNESDIVKLPYL  361

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC+INETLRLYPPAPLLLPH+S E C   G+D+P+ T ++VNAW MH DPK+WEEP +FK
Sbjct  362  RCVINETLRLYPPAPLLLPHFSSEACTAGGFDIPQGTMLVVNAWTMHRDPKLWEEPNEFK  421

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN--TKED  677
            PERFEA +G EG+GF Y  +PFG GRR CP  +MGL++VSLALG  +QCF+W    T ED
Sbjct  422  PERFEAGLG-EGDGFKY--IPFGIGRRVCPGASMGLQIVSLALGVLVQCFEWDKVGTVED  478

Query  678  KILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                 ++    IL K + LEA+C+PR++ +  LS L
Sbjct  479  ----TSHGLGMILSKAKPLEALCSPRRDLITLLSHL  510



>dbj|BAH84784.1| cytochrome P450 [Nicotiana tabacum]
Length=496

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++F+AGTETTS+TI+WAM LLL++P+   KLR EID+ V +  LLNESD+ KLPYL
Sbjct  308  SVLLVLFIAGTETTSMTIQWAMRLLLAHPKAFTKLRAEIDSKVENDRLLNESDIPKLPYL  367

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             C+INETLRLYPP PLLLPHYSLEDC V GY+VPKHT +M+NAWA+H DPK+W+EPEKFK
Sbjct  368  YCVINETLRLYPPVPLLLPHYSLEDCTVGGYEVPKHTILMINAWAIHRDPKLWDEPEKFK  427

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKE  674
            PERFEA+   E EGFNYKFVPFG GRRACP   MGLR VSL LG+ IQ FDW++ ++
Sbjct  428  PERFEAMDLGEKEGFNYKFVPFGMGRRACPGATMGLRTVSLVLGSLIQWFDWESVEK  484



>ref|XP_006374863.1| hypothetical protein POPTR_0014s02170g [Populus trichocarpa]
 gb|ERP52660.1| hypothetical protein POPTR_0014s02170g [Populus trichocarpa]
Length=506

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 168/221 (76%), Gaps = 15/221 (7%)
 Frame = +3

Query  138  MYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLP  317
            + + V M+FVAGTET+++T+EWA++LLL++P+V+ K++ EID +VGH  LLNESD+ KLP
Sbjct  296  IKSTVLMMFVAGTETSAITLEWALTLLLNHPKVMQKVKAEIDEHVGHGRLLNESDIVKLP  355

Query  318  YLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepek  497
            YL C+INETLRLYPPAPLLLPH+S E C   G+D+P+ T ++VNAW MH DPK+WEEP +
Sbjct  356  YLSCVINETLRLYPPAPLLLPHFSSEACNAGGFDIPQGTMLVVNAWTMHRDPKLWEEPNE  415

Query  498  fkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  677
            FKPERFEA +G EG+GF  K++PFG GRR CP  +MGL++VSLALG  +QCF+W     D
Sbjct  416  FKPERFEAGLG-EGDGF--KYIPFGIGRRVCPGASMGLQIVSLALGVLVQCFEW-----D  467

Query  678  KILCATYLSPS-----ILQKDERLEAICTPRKNCLQFLSQL  785
            K+   T   PS     IL K + LEA+C+PR++ +  LS L
Sbjct  468  KV--GTVEDPSHGLGMILSKAKPLEALCSPRRDLITLLSHL  506


 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +3

Query  207  MSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIINETlrlyppaplllpHY  386
            MSLLL+ PE + K   EID  VG +H+L+E D++KL YL+ I+NET RL+PPAPLLLPH 
Sbjct  1    MSLLLNNPETMQKASEEIDAIVGTEHILDEVDVTKLSYLQNILNETFRLFPPAPLLLPHE  60

Query  387  SLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVW  482
            S EDC ++G+ VP+ T ++VN W++H D K+W
Sbjct  61   SSEDCTISGFHVPRGTMLLVNTWSIHRDTKLW  92



>emb|CDP20410.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   209 bits (531),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 150/210 (71%), Gaps = 0/210 (0%)
 Frame = +3

Query  156  MVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCII  335
            ++F AG ET+++TIEWAM LLL+    L KLR EID N+GH  LL ESD+ KLPYL C++
Sbjct  302  IMFTAGRETSTLTIEWAMLLLLNNRTALQKLRTEIDINIGHGRLLRESDIPKLPYLHCVV  361

Query  336  NETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  515
            NET+RLYP APLL PHY+ EDC V  YD+PK T V+ NAWA+H DPK+WEEPEKF PERF
Sbjct  362  NETMRLYPAAPLLQPHYASEDCKVGMYDIPKGTIVLANAWAVHRDPKLWEEPEKFMPERF  421

Query  516  eAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  695
            E     + E FN KF+PFG GRRACP  N+ +R VSLA+G  IQCFDW   ++D  L   
Sbjct  422  EVKKLMDKEEFNSKFLPFGMGRRACPGANLAIRSVSLAIGTIIQCFDWDKVEQDGDLDIN  481

Query  696  YLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            + +   LQK + LEA+C PR+  +  LSQL
Sbjct  482  FSNRITLQKAKHLEALCVPRQESILLLSQL  511



>gb|KHG18425.1| Isoflavone 2'-hydroxylase [Gossypium arboreum]
Length=500

 Score =   208 bits (530),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 156/214 (73%), Gaps = 2/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +V M+F+AGTE+T++T+EW M+LLLS+PE L K R EI  +VG++ LLNESDL KLPYL
Sbjct  289  TMVLMMFIAGTESTAITMEWTMALLLSHPEALQKARDEIIRHVGNERLLNESDLPKLPYL  348

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC++NETLRLYP APLLLPH   EDCVV GY++PK T ++V+AWA+  DP +WEEP KFK
Sbjct  349  RCVVNETLRLYPAAPLLLPHCPSEDCVVDGYEIPKGTMLLVHAWAIQRDPSIWEEPTKFK  408

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E+ EG   K++PFG GRRACP  NMGLR V LA+G +IQCF+W+N   DK+
Sbjct  409  PERFYEGTLEDKEGL--KYLPFGLGRRACPGRNMGLRSVLLAIGVFIQCFEWENVGSDKV  466

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                      + K   LEA+C PR + ++ LSQL
Sbjct  467  DMTPNTIGLTIHKARPLEALCRPRPDVIKLLSQL  500



>ref|XP_002301158.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE80431.2| cytochrome P450 family protein [Populus trichocarpa]
Length=510

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 164/213 (77%), Gaps = 11/213 (5%)
 Frame = +3

Query  147  IVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLR  326
            ++ M+FVAGTET++VT+EWAM+LLL++P+ + KL+ EID +VGH  LLNES++ KLPYLR
Sbjct  303  VLVMMFVAGTETSAVTLEWAMALLLNHPKAMQKLKAEIDEHVGHGRLLNESNIVKLPYLR  362

Query  327  CIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkp  506
            C+I ETLRLYPPAPLLLPH+S   C V G+D+P+ TT++VNAWAMH DPK+WEE  +FKP
Sbjct  363  CVIKETLRLYPPAPLLLPHFSSGACTVGGFDIPQGTTLVVNAWAMHRDPKLWEESNEFKP  422

Query  507  erfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKIL  686
            ERFEA +GE+ EGF  K++PFGTGRR CP  +MGL++VS+ALGA +QCF+W     DK+ 
Sbjct  423  ERFEAGLGEQ-EGF--KYIPFGTGRRVCPGASMGLQMVSIALGALVQCFEW-----DKVA  474

Query  687  CATYL--SPSI-LQKDERLEAICTPRKNCLQFL  776
                +  SP I L K + LEA+C PR +    L
Sbjct  475  PVEDMSHSPGISLSKVKPLEALCCPRGDLTTLL  507



>gb|KDP41664.1| hypothetical protein JCGZ_16071 [Jatropha curcas]
Length=506

 Score =   206 bits (524),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 160/214 (75%), Gaps = 2/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ +  +AG ET++VT+EW +SLLL+ PEVL K++ EIDN+VG++HLLNE DL KLPYL
Sbjct  295  TIMLITLIAGAETSAVTLEWVISLLLNNPEVLKKVKAEIDNHVGNRHLLNELDLVKLPYL  354

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC+INETLRLYP  P+LLPH S E+C V G+++P  T ++VN  AMH DPKVWEEP +FK
Sbjct  355  RCVINETLRLYPAGPVLLPHLSSENCTVGGFEIPGGTMLLVNVLAMHRDPKVWEEPYEFK  414

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE  +GE  +   ++F+PFG GRRACP   MG+R+VS+ALGA IQCF+W+N   +++
Sbjct  415  PERFEGDLGEHSQQ-GFRFIPFGMGRRACPGAGMGIRMVSVALGALIQCFEWENPGLEEV  473

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              +     S L K + L A+C+PR+  ++ LSQL
Sbjct  474  DMSQTFGIS-LSKTKPLVALCSPRQELVELLSQL  506



>ref|XP_002510136.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52323.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 153/214 (71%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +I+ M+F+AG ET++V +EWAMSLLL +PE+L KLR EIDN VGH  LLN+ DL KLPYL
Sbjct  296  SIMVMMFIAGVETSAVALEWAMSLLLIHPEILQKLRAEIDNCVGHGRLLNDLDLVKLPYL  355

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC++NETLRLYPP PL+LPH S E C V G+++ K T +MVN WAMH DP VWEEP +FK
Sbjct  356  RCVVNETLRLYPPGPLMLPHLSSEICTVGGFEIQKGTLLMVNLWAMHRDPNVWEEPTEFK  415

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE  +GEE     +KF+PFG GRRACP   MG R+VSLALGA IQ F+W+    +K+
Sbjct  416  PERFEGDLGEE---HAFKFMPFGMGRRACPGAGMGTRMVSLALGALIQSFEWEKDGLEKV  472

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                    S L K + L  +C PR   ++ LSQL
Sbjct  473  DMNPRFGMS-LSKAKPLVVLCCPRPEMVEVLSQL  505



>ref|XP_002285066.1| PREDICTED: isoflavone 3'-hydroxylase-like [Vitis vinifera]
Length=507

 Score =   201 bits (511),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 155/217 (71%), Gaps = 9/217 (4%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ +V  AGT+T+SVT+EWAMSLLL++PE L K R EID++V   HLL++SDL+KLPYL
Sbjct  297  GLMLVVISAGTDTSSVTLEWAMSLLLNHPEALEKARAEIDSHVKPGHLLDDSDLAKLPYL  356

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            R ++NETLRLYP APLLLPH S EDC V G+D+P+ TTVMVN WA+H DP+VWEE  KFK
Sbjct  357  RSVVNETLRLYPTAPLLLPHLSSEDCSVGGFDIPRGTTVMVNVWALHRDPRVWEEATKFK  416

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE +  EE E F  KF PFG GRRACP   + +++VSLALG  IQCF+W+  + +K+
Sbjct  417  PERFEGMENEEKEAF--KFAPFGIGRRACPGAALAMKIVSLALGGLIQCFEWERVEAEKV  474

Query  684  LCATYLSPS---ILQKDERLEAICTPRKNCLQFLSQL  785
                 +SP     + K + LE I  PR      LSQL
Sbjct  475  ----DMSPGSGITMPKAKPLEIIFRPRPTMTSLLSQL  507



>ref|XP_010271770.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nelumbo nucifera]
Length=511

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 150/213 (70%), Gaps = 3/213 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            ++V  +  AGT+T+S T+EWA+SLLL++P+VL K + E+DN+VG   LL+ESDLSKLPYL
Sbjct  301  SLVLDMIAAGTDTSSGTMEWALSLLLNHPDVLKKAQDEVDNHVGQGRLLDESDLSKLPYL  360

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINETLR+YP  PLLLPH S EDCV+ G+D+P+ T ++VN WA+H+DPK+WEEP KFK
Sbjct  361  RCIINETLRMYPAGPLLLPHESSEDCVIGGFDIPRGTMLLVNLWAIHNDPKIWEEPRKFK  420

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PER     G EG    +K +PFG+GRR CP   +  R+V LALG+ IQCFDW+   +D +
Sbjct  421  PER---FEGLEGRRDGFKLMPFGSGRRGCPGGGLAERVVGLALGSLIQCFDWERVGDDLV  477

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQ  782
                      L K + L+A C PR   +  LSQ
Sbjct  478  DMTEGAGGLTLPKAQALKAKCKPRPKMMNLLSQ  510



>emb|CDP21119.1| unnamed protein product [Coffea canephora]
Length=502

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 158/222 (71%), Gaps = 5/222 (2%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHK-HLLNESD  302
            T + +  I+ ++F AG  T+++T+EWAMSL+L++P+VL K R EIDNNV     L+ +SD
Sbjct  284  TDETVKGIILIMFTAGVHTSALTMEWAMSLMLNHPQVLKKARSEIDNNVTQSGQLIEDSD  343

Query  303  LSKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVW  482
            LSKLPYLRCII ETLRL+P AP LLPHYS EDC + G+ VPK TT++VNAWA+H DPKVW
Sbjct  344  LSKLPYLRCIIKETLRLFPAAPTLLPHYSSEDCTIGGFKVPKGTTLLVNAWAIHRDPKVW  403

Query  483  eepekfkperfeAI-VGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDW  659
            EEP KFKPERFE I  G   EGF  KF+PFG GRRACP   +G+R +SL LG  +QCFDW
Sbjct  404  EEPAKFKPERFEGINEGACDEGF--KFIPFGKGRRACPGAALGMRFISLTLGTMLQCFDW  461

Query  660  KNTKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +     +++     S   L K + LEA+  PR + ++ +SQL
Sbjct  462  ERVGP-QLVDLEEKSGITLDKAKPLEALFRPRSSMIELVSQL  502



>ref|XP_010271541.1| PREDICTED: isoflavone 3'-hydroxylase-like [Nelumbo nucifera]
Length=512

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 151/219 (69%), Gaps = 3/219 (1%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T K +  +V  +  AGT+T++ T+EWAMSLLL+ P+VL K + E+DN+VG   LL+ESDL
Sbjct  296  TDKIIKGLVLGLLSAGTDTSAGTMEWAMSLLLNNPDVLKKAQDEVDNHVGQGRLLDESDL  355

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            SKLPYLRCIINETLR+YP  PLL+PH S EDCV+ G+D+P+ T ++VN WA+H+DPK+WE
Sbjct  356  SKLPYLRCIINETLRMYPAGPLLVPHESSEDCVIGGFDIPRGTMLLVNLWAIHNDPKIWE  415

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
            EP KF+PER     G EG    +K +PFG+GRR CP   +  R+V LALG+ IQCF+W+ 
Sbjct  416  EPGKFEPER---FEGLEGRRDGFKLMPFGSGRRGCPGEGLAERVVGLALGSLIQCFEWER  472

Query  666  TKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQ  782
              +D +          L K + L+A C PR   +  LSQ
Sbjct  473  VGDDLVDMTEGAGGLTLPKAQALKAKCKPRPKMMNLLSQ  511



>gb|KDO81589.1| hypothetical protein CISIN_1g020029mg [Citrus sinensis]
Length=332

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 158/216 (73%), Gaps = 7/216 (3%)
 Frame = +3

Query  138  MYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLP  317
            + +++ ++F+AG ETT+V +EWAMSLLL+ P+VL K+R EID NV +  +LN+ DL  LP
Sbjct  121  LKSVIVLMFIAGVETTAVVLEWAMSLLLNNPDVLQKVRAEIDCNVANGRMLNDEDLVNLP  180

Query  318  YLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepek  497
            YL C+I ETLRLYPPAPLLLPH+S E+C+V GY +P+ TT+MVNAWAMH D KVWEEP K
Sbjct  181  YLCCVIKETLRLYPPAPLLLPHFSSENCIVGGYHIPRGTTIMVNAWAMHRDSKVWEEPNK  240

Query  498  fkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  677
            FKPERFE I  E  EGF  K +PFG GRRACP   M +R +S ALG+ IQCF+W+    +
Sbjct  241  FKPERFEGIHSER-EGF--KHIPFGMGRRACPGAAMAIRTISFALGSLIQCFEWEKIGPE  297

Query  678  KILCATY-LSPSILQKDERLEAICTPRKNCLQFLSQ  782
              + A+Y LS   L K   L A+C+PR++ +  L++
Sbjct  298  VDMTASYGLS---LSKTVPLVAMCSPRQDMIGMLNR  330



>ref|XP_010556108.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X2 [Tarenaya 
hassleriana]
Length=513

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 152/211 (72%), Gaps = 5/211 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +IV ++F AG +T +VT+EW MSLLLS PE L KLR EID NVG   L+ ++DL+KLPYL
Sbjct  296  SIVLVMFTAGADTVAVTLEWVMSLLLSNPEALLKLREEIDENVGPNRLVTDADLAKLPYL  355

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC+INETLRLYPP PLLLPH S E C + GY VPK TT++VN+WAMH DP VWE+PE+F 
Sbjct  356  RCVINETLRLYPPTPLLLPHSSSESCHIGGYTVPKGTTLIVNSWAMHRDPDVWEDPERFS  415

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF+ +VGE  +GF  +F+PFGTGRRACP  NM +RL SLA+G  +QCFDW+  + +  
Sbjct  416  PERFQGVVGER-DGF--RFIPFGTGRRACPGANMAIRLASLAIGMLVQCFDWEKAEPE--  470

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFL  776
            +    ++   L +   LEA   PR+   + L
Sbjct  471  IDMKGVAGLTLSRARPLEARFLPRQGIDKLL  501



>ref|XP_010556107.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X1 [Tarenaya 
hassleriana]
Length=524

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 152/211 (72%), Gaps = 5/211 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +IV ++F AG +T +VT+EW MSLLLS PE L KLR EID NVG   L+ ++DL+KLPYL
Sbjct  296  SIVLVMFTAGADTVAVTLEWVMSLLLSNPEALLKLREEIDENVGPNRLVTDADLAKLPYL  355

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC+INETLRLYPP PLLLPH S E C + GY VPK TT++VN+WAMH DP VWE+PE+F 
Sbjct  356  RCVINETLRLYPPTPLLLPHSSSESCHIGGYTVPKGTTLIVNSWAMHRDPDVWEDPERFS  415

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF+ +VGE  +GF  +F+PFGTGRRACP  NM +RL SLA+G  +QCFDW+  + +  
Sbjct  416  PERFQGVVGER-DGF--RFIPFGTGRRACPGANMAIRLASLAIGMLVQCFDWEKAEPE--  470

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFL  776
            +    ++   L +   LEA   PR+   + L
Sbjct  471  IDMKGVAGLTLSRARPLEARFLPRQGIDKLL  501



>emb|CDP15267.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = +3

Query  156  MVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCII  335
            ++F AG ET+++TIEWAM LLL+ P+ L KLR EID N+GH  LL ESD+ KLPYLRC++
Sbjct  302  IMFTAGRETSTLTIEWAMLLLLNNPKALQKLRTEIDINIGHGRLLRESDIPKLPYLRCVV  361

Query  336  NETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  515
            NET+RLYP APLLLPHY+ EDC V  YD+PK T V+ NAWA+H DPK+WEEPEKF PERF
Sbjct  362  NETMRLYPAAPLLLPHYASEDCKVGMYDIPKGTIVLANAWAVHRDPKLWEEPEKFMPERF  421

Query  516  eAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  677
            EA    + E FN KF+PFG GRRACP  N+G+R VSLA+G +IQ FDW   ++D
Sbjct  422  EAKKLMDKEEFNSKFLPFGMGRRACPGVNLGVRSVSLAIGTFIQSFDWDKVEQD  475



>ref|XP_011029147.1| PREDICTED: isoflavone 2'-hydroxylase-like [Populus euphratica]
 ref|XP_011029154.1| PREDICTED: isoflavone 2'-hydroxylase-like [Populus euphratica]
Length=512

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 152/214 (71%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +V  +F AGT+T +VT+EWAMSLLL++PE+L K+R EID+ VGH  L+ E DL KL YL
Sbjct  303  GLVLAIFAAGTDTVAVTMEWAMSLLLNHPEILQKVREEIDSQVGHTRLVEELDLPKLNYL  362

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC+INETLRLYP  PLLLP    EDC VAGY VPK T ++VNA+AMH DPK+WE+P++FK
Sbjct  363  RCVINETLRLYPVVPLLLPRCPSEDCTVAGYTVPKGTILLVNAFAMHRDPKMWEQPDRFK  422

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA   EE EG   KF+PFG GRRACP +NMGLR + LA+ A  QCF+W+ T  + +
Sbjct  423  PERFEA-TEEEKEGI--KFIPFGMGRRACPGSNMGLRAIMLAMAALFQCFEWERTGPEMV  479

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                  + S++ K + LEA C P  +     SQL
Sbjct  480  DMTVAAAISMV-KAKPLEAFCKPYHSMANLFSQL  512



>ref|XP_006472253.1| PREDICTED: cytochrome P450 81D1-like [Citrus sinensis]
Length=517

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 157/214 (73%), Gaps = 7/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +I+ ++F+AG ETT+V +EWAMSLLL+ P+VL K+R EID NV +  +LN+ DL  LPYL
Sbjct  308  SIIVIMFIAGVETTAVALEWAMSLLLNNPDVLQKVRAEIDCNVANGRMLNDVDLVNLPYL  367

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             C+I ETLRLYPPAPLLLPH+S E+C+V GY +P+ TT+MVNAWAMH D KVWEEP KFK
Sbjct  368  CCVIKETLRLYPPAPLLLPHFSSENCIVGGYHIPRGTTIMVNAWAMHRDSKVWEEPNKFK  427

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE I  E  EGF  K +PFG GRRACP   M +R +S ALG+ IQCF+W+    +  
Sbjct  428  PERFEGIHSER-EGF--KHIPFGMGRRACPGAAMAIRTISFALGSLIQCFEWEKIGAEVD  484

Query  684  LCATY-LSPSILQKDERLEAICTPRKNCLQFLSQ  782
            + A+Y LS   L K   L A+C+PR+N +  L++
Sbjct  485  MTASYGLS---LSKTVPLVAMCSPRQNMIGMLNR  515



>ref|XP_010101691.1| Isoflavone 2'-hydroxylase [Morus notabilis]
 gb|EXB89257.1| Isoflavone 2'-hydroxylase [Morus notabilis]
Length=567

 Score =   194 bits (494),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = +3

Query  138  MYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLP  317
            + +IV ++FVAGT+T++ TIEW +SLLL++P+VL KLR EID+NVGH  L+ ESDL KLP
Sbjct  295  IRSIVLIMFVAGTDTSANTIEWCISLLLNHPQVLQKLRNEIDSNVGHGRLVKESDLPKLP  354

Query  318  YLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepek  497
            YLRC+I+ETLRLYP  PLLLPH+S EDC + GY +P+ TT++VNAWA+H D  VW+EP  
Sbjct  355  YLRCVIHETLRLYPIVPLLLPHFSSEDCTLGGYQIPQGTTLLVNAWAIHRDSNVWDEPNT  414

Query  498  fkperfeA--IVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTK  671
            FKPERFE   ++  E EG N++F+PFG GRRACP   MG+R  SLA+G  +QCFDW+   
Sbjct  415  FKPERFEEHHMLEGEREGNNFRFIPFGIGRRACPGEGMGIRTASLAVGTLLQCFDWERVG  474

Query  672  EDKILCATY  698
            ++  +   Y
Sbjct  475  KELDMSQGY  483



>ref|XP_010271553.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nelumbo nucifera]
Length=511

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 150/214 (70%), Gaps = 3/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            ++V  +  AGT+T+S T+EWAMSLLL++P+VL K + EIDN+VG   L +ESDLSKLPYL
Sbjct  301  SLVLDLIAAGTDTSSGTMEWAMSLLLNHPDVLKKAQAEIDNHVGQGRLFHESDLSKLPYL  360

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINETLR+YP APLL+PH S EDCVV G+D+P  T ++VN WA+H+DPK+WEEP KFK
Sbjct  361  RCIINETLRMYPAAPLLVPHESSEDCVVGGFDIPHGTLLLVNMWAIHNDPKIWEEPRKFK  420

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PER     G EG    +K +PFG+GRR+CP   +  R+V LALG+ IQCF+W+   +D +
Sbjct  421  PER---FEGLEGRRDGFKLLPFGSGRRSCPVEGLAERMVGLALGSLIQCFEWEMVGDDLV  477

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              +       L K   L+A   PR   +  LSQL
Sbjct  478  DMSEGAGGLTLPKARVLKAKRKPRPTMVDLLSQL  511



>ref|XP_010692652.1| PREDICTED: cytochrome P450 81E8-like [Beta vulgaris subsp. vulgaris]
Length=506

 Score =   192 bits (489),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 155/221 (70%), Gaps = 5/221 (2%)
 Frame = +3

Query  123  STLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESD  302
            ST   +  ++Q++F+ GTET+S T+EWA +LLL +PE+  K+R EI   VGH  L+ E D
Sbjct  291  STNDIIKGLIQILFLTGTETSSSTVEWATALLLKHPEIQDKVRKEIIEQVGHDRLIEEHD  350

Query  303  LSKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVW  482
            L  LPYL CIINETLR+YP AP++ PH S EDCVV GY +PK T + VN WA+ +DPKVW
Sbjct  351  LQHLPYLHCIINETLRMYPVAPIVPPHESSEDCVVGGYHIPKGTMLNVNLWAIQNDPKVW  410

Query  483  eepekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK  662
            +EP +FKPERFE +   EGE   YKF+PFG+GRR+CP  NM  R+V LALG+ IQCF+W+
Sbjct  411  DEPRQFKPERFENV---EGERIGYKFMPFGSGRRSCPGENMAKRVVGLALGSLIQCFEWE  467

Query  663  NTKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
               E++I     +S S+ + +  L+A   PRK  ++ LSQ+
Sbjct  468  GG-EEEIDMEEQVSVSMWKANP-LQAKFKPRKQMIKLLSQI  506



>ref|XP_006374862.1| hypothetical protein POPTR_0014s02160g [Populus trichocarpa]
 gb|ERP52659.1| hypothetical protein POPTR_0014s02160g [Populus trichocarpa]
Length=512

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 140/214 (65%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +V  +F AGT+T +VT+EWAMSLLL++PE+L K+R EID+ VGH  L+ E DL KL YL
Sbjct  303  GLVVAIFAAGTDTVAVTMEWAMSLLLNHPEILQKVREEIDSEVGHTRLVEELDLPKLKYL  362

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC+INETLRLYP  PLLLP    EDC VAGY VPK T ++VNA+AMH DPK+W E     
Sbjct  363  RCVINETLRLYPVVPLLLPRCPSEDCTVAGYKVPKGTILLVNAFAMHRDPKMW-EQPDRF  421

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
                  +  EE EG   KF+PFG GRRACP +NMG+R + LA+ A  QCF+W+ T  + +
Sbjct  422  KPERFEVTEEEKEGI--KFIPFGMGRRACPGSNMGMRAIMLAMAALFQCFEWERTGPEMV  479

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                  + S++ K   LEA C P  +     SQL
Sbjct  480  DMTVAAAISMV-KATPLEAFCKPYHSMANLFSQL  512



>gb|AAD32570.1| NT7 [Nicotiana tabacum]
Length=275

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 151/217 (70%), Gaps = 9/217 (4%)
 Frame = +3

Query  189  VTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIINETlrlyppap  368
            VTI+WAM LLL++P+   KLR  I   V +  LLN SD+ KLPYL C+INETLRLYPP P
Sbjct  3    VTIQWAMRLLLAHPQAFTKLRAAIACKVENDRLLNVSDIPKLPYLYCVINETLRLYPPVP  62

Query  369  lllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfeAIVGEEGEGF  548
            LLLPHYSLEDC V GY VPKHT +M+ AWA+H DPK+W+EP KF PERF A+   E EGF
Sbjct  63   LLLPHYSLEDCTVGGYAVPKHTILMIIAWAIHRDPKLWDEPAKFTPERFAAMDLGEKEGF  122

Query  549  NYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSPSILQKDE  728
             YKFVPFG GRRACP   MGLR VSL LG+ +Q FDW++ +++K L A Y S   L KD+
Sbjct  123  LYKFVPFGMGRRACPGATMGLRTVSLVLGSLLQWFDWESVEKEK-LDACYNSRITLHKDK  181

Query  729  ---RLEAICTPRKNC-LQFL--SQL*IVFAYVFNVYF  821
               RL  I  PR NC L FL      IV   +++V+F
Sbjct  182  PSRRLFGI--PRHNCSLVFLPHEHRTIVLCSMYSVFF  216



>ref|XP_009360167.1| PREDICTED: isoflavone 2'-hydroxylase-like [Pyrus x bretschneideri]
Length=508

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 150/204 (74%), Gaps = 3/204 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ VAGT+T+S +++WAM+LLL++PE + K+R EID NVG +  L E DL KL YL
Sbjct  301  GIIMVLLVAGTDTSSSSLDWAMALLLNHPEEMEKVRAEIDTNVGQERPLEEQDLPKLKYL  360

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + +I+ET RLYPP PLL+PH + EDCVV GYDVP+HT +++NAWA+H DP++WE+P KFK
Sbjct  361  QNVIHETHRLYPPVPLLVPHEASEDCVVGGYDVPRHTMLVINAWAIHRDPEIWEDPTKFK  420

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE   GE  +G  YK +PFG GRR CP   +G RLV LALG+ IQ F+W+   E+K+
Sbjct  421  PERFEGWSGEGSQG--YKLIPFGNGRRGCPGAGLGNRLVGLALGSLIQSFEWERVGEEKV  478

Query  684  LCATYLSPSILQKDERLEAICTPR  755
              +  L   ++Q+ E LEAIC PR
Sbjct  479  DMSEGLG-LVMQRVEPLEAICKPR  501



>ref|XP_006433586.1| hypothetical protein CICLE_v10000895mg [Citrus clementina]
 gb|ESR46826.1| hypothetical protein CICLE_v10000895mg [Citrus clementina]
Length=514

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 157/214 (73%), Gaps = 7/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++F+AG ETT+V +EWAMSLLL+ P+VL K+R EID NV +  +LN+ DL  LPYL
Sbjct  305  SVIVLMFIAGVETTAVVLEWAMSLLLNNPDVLQKVRAEIDCNVANGRMLNDEDLVNLPYL  364

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             C+I ETLRLYPPAPLLLPH+S E+C+V GY +P+ TT+MVNAWAMH D KVWEEP KFK
Sbjct  365  CCVIKETLRLYPPAPLLLPHFSSENCIVGGYHIPQGTTIMVNAWAMHRDSKVWEEPNKFK  424

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE I  E  EGF  K +PFG GRRACP   M +R +S ALG+ IQCF+W+    +  
Sbjct  425  PERFEGIHSER-EGF--KHIPFGMGRRACPGAAMAIRTISFALGSLIQCFEWEKIGPEVD  481

Query  684  LCATY-LSPSILQKDERLEAICTPRKNCLQFLSQ  782
            + A+Y LS   L K   L A+C+PR++ +  L++
Sbjct  482  MTASYGLS---LSKTVPLVAMCSPRQDMIGMLNR  512



>ref|XP_006374864.1| hypothetical protein POPTR_0014s02180g [Populus trichocarpa]
 gb|ERP52661.1| hypothetical protein POPTR_0014s02180g [Populus trichocarpa]
Length=506

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 154/214 (72%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +V  +F AGT+T +VT+EWAM+LLL++PE+L K+R EID+ VGH  L+ E DL KL YL
Sbjct  297  GLVVAMFSAGTDTVAVTMEWAMALLLNHPEILQKVRVEIDSQVGHTRLVEEVDLPKLKYL  356

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC+INETLRLYP  PLLLP    EDC VAGY+VPK T ++VNA+AMH DPK+WE+P++FK
Sbjct  357  RCVINETLRLYPVVPLLLPRCPSEDCTVAGYNVPKGTILLVNAFAMHRDPKMWEQPDRFK  416

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA V EE EG   KF+PFG GRRACP +NMG+R + LA+ A  QCF+ + T ++ +
Sbjct  417  PERFEATV-EEKEGI--KFIPFGMGRRACPGSNMGMRAIMLAMAALFQCFECERTGQEMV  473

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                  + S++ K + LEA C P  +     SQL
Sbjct  474  DMTVAAAISMV-KAKPLEAFCKPYHSMANLFSQL  506



>ref|XP_011069758.1| PREDICTED: isoflavone 2'-hydroxylase-like [Sesamum indicum]
Length=492

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 144/221 (65%), Gaps = 14/221 (6%)
 Frame = +3

Query  138  MYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLP  317
            +  ++  +F AGT TT++T+EWAMSLLL++P  L K+R EID+ V    LL++SDL KLP
Sbjct  281  LKGLILPMFTAGTHTTAITMEWAMSLLLNHPNELGKVREEIDSIVAPGKLLDDSDLQKLP  340

Query  318  YLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepek  497
            YLRC+INETLRLYP  PLL+PH S +DC V G+DVP  TT++VNAWA+  DPK+W     
Sbjct  341  YLRCVINETLRLYPVGPLLVPHLSSKDCTVGGFDVPAGTTLLVNAWAIQRDPKLW-----  395

Query  498  fkperfeAIVGEEGEGFN-----YKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK  662
               E   A   E   GF+     +KF+PFG GRRACP + M +RL+ LALG +IQCF+WK
Sbjct  396  ---EEPGAFKPERFRGFDGGYDGFKFLPFGIGRRACPGSGMAMRLMGLALGTFIQCFEWK  452

Query  663  NTKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                + +    +   + L K + LEA+  PR +    LSQL
Sbjct  453  REGHNLVDLDEFTGIT-LSKVKPLEALYRPRSSVTSLLSQL  492



>ref|XP_011029134.1| PREDICTED: isoflavone 2'-hydroxylase-like [Populus euphratica]
Length=512

 Score =   191 bits (484),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 147/203 (72%), Gaps = 4/203 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +V  +F AGT+T +VT+EWAMSLLL++PE+L K+R EID+ VGH  L+ E DL KL YL
Sbjct  303  GLVLAIFAAGTDTVAVTMEWAMSLLLNHPEILQKVREEIDSQVGHTRLVEELDLPKLKYL  362

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC+INETLRLYP  PLLLP    EDC VAGY VPK T + VNA+AMH DPK+WE+P++FK
Sbjct  363  RCVINETLRLYPVVPLLLPRCPSEDCTVAGYKVPKGTILQVNAFAMHRDPKMWEQPDRFK  422

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFEA   EE EG   KF+PFG GRRACP +NMG+R + LA+ A  QCF+W+ T  + +
Sbjct  423  PERFEA-TEEEKEGI--KFIPFGMGRRACPGSNMGMRAIMLAMAALFQCFEWERTGPEMV  479

Query  684  LCATYLSPSILQKDERLEAICTP  752
                  + S++ K + LEA C P
Sbjct  480  DMTVAAAISMV-KAKPLEAFCKP  501



>gb|AJD25195.1| cytochrome P450 CYP81C16 [Salvia miltiorrhiza]
Length=498

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 143/214 (67%), Gaps = 9/214 (4%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++  AGT+T+++T EWAMS L+S PEVL KLR EID NVGH HLL+E+DL  LPYL
Sbjct  291  SLLVVMLTAGTDTSALTTEWAMSNLVSQPEVLQKLRQEIDANVGHDHLLSEADLPNLPYL  350

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWee-pekf  500
              ++ ETLRL+P APLLLPH S +DC V GY +PK T ++VNAWA+HHDP +W+E  +  
Sbjct  351  GRVVKETLRLHPAAPLLLPHLSSQDCRVGGYKIPKGTILLVNAWAVHHDPGLWDEPEKFD  410

Query  501  kperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED-  677
                  A+  E G   N++F+PFG GRRACP   M LR VSLALGA++QCF+W++ + D 
Sbjct  411  PERFEGAVEMEMGRDGNHRFLPFGIGRRACPGAGMALRTVSLALGAFVQCFEWEHVEMDF  470

Query  678  -KILCATYLSPSILQKDERLEAICTPRKNCLQFL  776
               L  T      L K + LEA+C  R      L
Sbjct  471  GANLGVT------LHKAKPLEAVCLVRNQAAHLL  498



>emb|CDP19801.1| unnamed protein product [Coffea canephora]
Length=203

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 148/210 (70%), Gaps = 8/210 (4%)
 Frame = +3

Query  159  VFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHK-HLLNESDLSKLPYLRCII  335
            +F AGT T++ T+E AMS LL++P++L K + EID+ V +   LL +SDLSKLPYLRCII
Sbjct  1    MFTAGTHTSAFTMERAMSCLLNHPDILQKAKNEIDDQVTYSGRLLEDSDLSKLPYLRCII  60

Query  336  NETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  515
            NETLR++PPAP L+PHYS EDC++ GY V K TT+ VNAWA+H DP +WEEP +FKPERF
Sbjct  61   NETLRIFPPAPTLVPHYSSEDCIIGGYKVAKDTTLFVNAWAIHRDPNLWEEPSEFKPERF  120

Query  516  eAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  695
                  EG    +KF+PFG GRRACP   M +RLV LA+G  +QCF+W++  E +++   
Sbjct  121  ------EGLDEGFKFLPFGKGRRACPGAAMAMRLVGLAVGTLVQCFEWESA-ESQMVEFD  173

Query  696  YLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              S   L K + LEA+  PR + +  +SQL
Sbjct  174  EKSGVTLGKTKPLEALYKPRLSMISLVSQL  203



>dbj|BAF98467.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=503

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 150/221 (68%), Gaps = 6/221 (3%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + +  I+ ++  AGT+T++VT+EWAMSLLL+ P+V+ K + EIDNN+    L+NESD+
Sbjct  288  TDEMILGIIWVLLAAGTDTSAVTMEWAMSLLLNNPQVIKKAQAEIDNNLEQGRLINESDV  347

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            +KLPYL  II ETLR+YP  PLL+PH S E+C+V GY VP  T ++VN WA+  DP +W 
Sbjct  348  NKLPYLHSIITETLRIYPAGPLLVPHESSEECIVGGYKVPSGTMLLVNVWAIQQDPNIWV  407

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
            EP KFKPERF+   G EG    +K +PFG+GRR CP   + +R+V+LALGA IQCFDW+ 
Sbjct  408  EPTKFKPERFD---GFEGTRDGFKLMPFGSGRRGCPGEGLAMRVVALALGALIQCFDWER  464

Query  666  TKEDKILCATYLSPSI-LQKDERLEAICTPRKNCLQFLSQL  785
              E+ +  +    P + L K   LEA C PR   L F+SQ 
Sbjct  465  VGEEMVDMSE--GPGLTLPKVHPLEAKCRPRSTALNFISQF  503



>ref|XP_008337049.1| PREDICTED: cytochrome P450 81D1-like [Malus domestica]
Length=304

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 148/218 (68%), Gaps = 3/218 (1%)
 Frame = +3

Query  102  GTSNGINSTLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHK  281
            G    I+  L+ +    ++V VAGT+TTS T++WAMSLLL++PE + K+R EID NVG +
Sbjct  83   GMMAKIDKFLQGLVDERRVVLVAGTDTTSTTLDWAMSLLLNHPEAMEKVRTEIDTNVGRE  142

Query  282  HLLNESDLSKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAM  461
             LL E DL KL Y+  +INET RLYP  PLL+PH + EDCVV G+DVP+HT V++NAWA+
Sbjct  143  RLLEEQDLPKLKYMENVINETHRLYPAVPLLVPHEASEDCVVGGFDVPRHTIVVINAWAI  202

Query  462  HHDPKVWeepekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAY  641
            H DP+VWE+P+KFKPERF+    E  E   YK +PFG GRR CP + +  RL+ L LG+ 
Sbjct  203  HRDPEVWEDPDKFKPERFQGWSAEGAE--RYKLIPFGGGRRGCPGDVIANRLIGLTLGSL  260

Query  642  IQCFDWKNTKEDKILCATYLSPSILQKDERLEAICTPR  755
            +Q F+W     + +  +  L  S + + + LEA+C PR
Sbjct  261  VQSFEWGRIGVEDVDMSEGLGRS-MPRVKPLEAMCKPR  297



>ref|XP_007018555.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY15780.1| Cytochrome P450 [Theobroma cacao]
Length=499

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 153/214 (71%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++ +AGTET+  T+EWA+SLLL+ PEVL K + EI N VGH+HL++ESDL++LPYL
Sbjct  290  GLMLILLMAGTETSINTMEWALSLLLNNPEVLKKAQIEIVNTVGHEHLIDESDLAQLPYL  349

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            R II+ETLR+YPP PLL+PH S E+C+V G+ VP  T ++VNAWA+ +DP +WE+P  FK
Sbjct  350  RSIISETLRMYPPVPLLVPHESSEECIVEGFRVPSGTMLLVNAWAIQNDPSIWEDPASFK  409

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE   G EG    +K++PFG+GRR CP   +GLR+V L LG+ IQCF+W     D +
Sbjct  410  PERFE---GVEGARDGFKWMPFGSGRRGCPGEGLGLRIVGLTLGSLIQCFEWSRVG-DNM  465

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +     +   + K + L+A+C PR   L+ LSQL
Sbjct  466  VDMRAGTGFTMPKAQPLQAVCRPRTTVLELLSQL  499



>ref|XP_008393762.1| PREDICTED: cytochrome P450 81D1-like [Malus domestica]
 ref|XP_008393763.1| PREDICTED: cytochrome P450 81D1-like [Malus domestica]
 ref|XP_008393764.1| PREDICTED: cytochrome P450 81D1-like [Malus domestica]
 ref|XP_008367653.1| PREDICTED: cytochrome P450 81D1-like [Malus domestica]
 ref|XP_008367654.1| PREDICTED: cytochrome P450 81D1-like [Malus domestica]
Length=508

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 148/204 (73%), Gaps = 3/204 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ VAGT+T+S +++W+M+LLL++PE + K+R EID N+G +  L E DL KL YL
Sbjct  301  GIILVLLVAGTDTSSSSLDWSMALLLNHPEEMEKVRAEIDTNIGQERPLEEQDLPKLKYL  360

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + +I+ET RLYPP PLL+PH + EDCVV GYDVP+HT +++NAWA+H DP++WE+P KFK
Sbjct  361  QNVIHETHRLYPPVPLLVPHEASEDCVVGGYDVPRHTMLVINAWAIHRDPEIWEDPTKFK  420

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE   GE  +G  YK +PFG GRR CP   +G RLV LALG+ IQ F+W+   E+K+
Sbjct  421  PERFEGWSGEGSQG--YKLIPFGNGRRGCPGAGLGNRLVGLALGSLIQSFEWERVGEEKV  478

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                 L  + + + E LEAIC PR
Sbjct  479  DMGEGLGLA-MPRVEPLEAICKPR  501



>ref|XP_006387951.1| hypothetical protein POPTR_0458s00200g [Populus trichocarpa]
 gb|ERP46865.1| hypothetical protein POPTR_0458s00200g [Populus trichocarpa]
Length=360

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 146/215 (68%), Gaps = 6/215 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +V ++  AGT T+S T+EWA+SLLL++PEVL K + EID  +GH  L++E+DL++LPYL
Sbjct  151  GLVVVILFAGTHTSSTTMEWALSLLLNHPEVLEKAKREIDEQIGHDRLMDEADLAQLPYL  210

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWee-pekf  500
            R ++NETLR+YP APLL+PH S E+C+V G+ +P+ T + VN WA+ +DPK+W +  +  
Sbjct  211  RSVLNETLRMYPAAPLLVPHESSEECLVGGFRIPRGTMLSVNVWAIQNDPKIWRDPTKFR  270

Query  501  kperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDK  680
                    V  +G    +K +PFG GRR+CP  +M LR++ LALG+ +QCF+W+    DK
Sbjct  271  PERFDNPEVARDG----FKLMPFGYGRRSCPGESMALRVMGLALGSLLQCFEWQKIG-DK  325

Query  681  ILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            ++  T  S   + K + L+ IC PR + L+ LSQ+
Sbjct  326  MVDMTEASGFTIPKAKPLKVICRPRPDMLRHLSQI  360



>ref|XP_002267485.1| PREDICTED: isoflavone 3'-hydroxylase-like [Vitis vinifera]
Length=507

 Score =   185 bits (469),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 141/206 (68%), Gaps = 4/206 (2%)
 Frame = +3

Query  168  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIINETl  347
            AGT+TTS T+EWAMSLLL+ PEVL K + E+DN +G  HL+ ESDLS+LPYL CII ET 
Sbjct  306  AGTDTTSATLEWAMSLLLNNPEVLKKAQMEMDNQLGPNHLIEESDLSQLPYLHCIIRET-  364

Query  348  rlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfeAIV  527
            +   PA  ++PH S ++C+V GY +P+ T ++VN W + +DPKVW+EP KF PERFE  V
Sbjct  365  QRMYPAGPIVPHESSKECMVGGYHIPRGTMLLVNIWGIQNDPKVWKEPRKFLPERFE--V  422

Query  528  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  707
            G EGEG   + +PFG+GRR CP   + +R+V L LG+ IQCFDW+   E K+  +  +  
Sbjct  423  GLEGEGHGLRLMPFGSGRRGCPGEGLAIRMVGLVLGSLIQCFDWERVGEGKVDMSEGIGL  482

Query  708  SILQKDERLEAICTPRKNCLQFLSQL  785
            + L K + L A C PR   +  LSQ+
Sbjct  483  T-LPKAQPLLAKCRPRPALINVLSQI  507



>emb|CDP14452.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   184 bits (468),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 148/214 (69%), Gaps = 3/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+Q++  AGT TTS T+EWA+S LL++P VL K R E++  +   HLLN+SDLSKLPYL
Sbjct  288  GIIQIMLSAGTHTTSQTMEWALSSLLNHPNVLQKARDELEK-MQPGHLLNDSDLSKLPYL  346

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINETLRL+P AP L+PH+S EDC + GY+VPK TT++VN WA+H DP VWEEP K+K
Sbjct  347  RCIINETLRLFPAAPTLVPHFSSEDCTIGGYEVPKGTTLLVNVWAIHRDPNVWEEPNKYK  406

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE +  E G    +KF+PFG GRR CP   M +RLV L LG  IQCF+W+    + +
Sbjct  407  PERFEGM-DEGGWNEGFKFLPFGKGRRICPGAAMAIRLVGLTLGTLIQCFEWERAGPEMV  465

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                    + L K + LEA   PR + ++ +SQL
Sbjct  466  DLEENQG-ATLGKAKPLEASYKPRPSMIKTISQL  498



>ref|XP_010320311.1| PREDICTED: cytochrome P450 81D1-like [Solanum lycopersicum]
Length=203

 Score =   176 bits (447),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 141/202 (70%), Gaps = 3/202 (1%)
 Frame = +3

Query  147  IVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLR  326
            ++ ++  AG++T+++T+EWA S LL  PE+L   + EIDN VG   L++ESDL++LPY+R
Sbjct  5    LLLILLQAGSDTSAITLEWAFSRLLDNPEILKTAQTEIDNQVGQDRLIDESDLAQLPYIR  64

Query  327  CIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkp  506
            CIINETLR++P APLLLPH S E+C VAGY VP+ T ++VNAW +HHDPKVWE+PEKF P
Sbjct  65   CIINETLRMHPAAPLLLPHLSSEECKVAGYRVPRGTILLVNAWGIHHDPKVWEDPEKFNP  124

Query  507  erfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKIL  686
            +R    +G E      KF+PFG+GRR CP  N+ + ++ LALG+ +QCF+W     + I 
Sbjct  125  DR---FIGFESVKEGCKFIPFGSGRRGCPGENLAIHVIGLALGSLLQCFEWDKPNSETID  181

Query  687  CATYLSPSILQKDERLEAICTP  752
             +     +I  K + L A C+P
Sbjct  182  MSEGTGFTISPKVQPLLAKCSP  203



>emb|CBI33752.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   180 bits (456),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 145/208 (70%), Gaps = 12/208 (6%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +VQ++ +AGT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YL
Sbjct  110  GLVQVLILAGTDTSAATMEWAMTLLLNHPDVLEKAKAELDMHVGKDRLIEESDLPKLRYL  169

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            R II+ETLR++P APLLLPH S +DC + G+D+P+ T ++VN WA+H DP+VWE+P  FK
Sbjct  170  RSIISETLRVFPVAPLLLPHMSSDDCQIGGFDIPRGTLLLVNVWALHRDPQVWEDPTSFK  229

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK---NTKE  674
            PERF     E GE  NYK VPFG GRRACP   +  R+V LALG+ IQC+DWK   NT  
Sbjct  230  PERF-----ENGERENYKLVPFGIGRRACPGAGLAQRVVGLALGSLIQCYDWKKISNTAI  284

Query  675  DKILCATYLSPSILQKDERLEAICTPRK  758
            D I       P +    + LEA+C  R+
Sbjct  285  DTIEGKGLTMPKL----QPLEAMCKARE  308



>gb|EYU35841.1| hypothetical protein MIMGU_mgv1a024949mg [Erythranthe guttata]
Length=467

 Score =   184 bits (466),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 139/214 (65%), Gaps = 15/214 (7%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++FVAGTET+   +E AMSL+LS+PE L KL  EID NVGH  LL +SDL+KLPYL
Sbjct  269  SVLMVMFVAGTETSVTAMERAMSLILSHPEKLQKLSDEIDENVGHDRLLADSDLAKLPYL  328

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINETLRLYPP P +LPH S EDC V G+ +PK T ++VN WAMH DP+ W+ PE+F 
Sbjct  329  RCIINETLRLYPPTPTVLPHVSSEDCTVGGHSIPKGTILLVNVWAMHRDPEQWDRPEEFV  388

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF+    E      +KF+PFG GRR CP + M LR VSL L A +QCFDW+    D  
Sbjct  389  PERFQF---ESERELGHKFLPFGMGRRGCPGSGMALRTVSLGLAALVQCFDWETLSGD--  443

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                      +   + LEA+C  R+       QL
Sbjct  444  ----------VAAAKPLEAVCFAREQAAHIFEQL  467



>ref|XP_004238115.1| PREDICTED: cytochrome P450 81D1-like [Solanum lycopersicum]
Length=513

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/220 (47%), Positives = 154/220 (70%), Gaps = 3/220 (1%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + + +++ ++  AG++T++VT+EWA S LL  PE+L   + EIDN VG   L++ESDL
Sbjct  297  TDETIRSLMLVLLQAGSDTSAVTLEWAFSHLLDNPEILKTAQTEIDNKVGQDRLIDESDL  356

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            ++LPY+RCIINETLR++P APLL+PH S E+C VAGY VP+ T ++VNAW +HHDPKVW+
Sbjct  357  AQLPYIRCIINETLRMHPAAPLLVPHLSSEECKVAGYRVPRGTVLLVNAWGIHHDPKVWK  416

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
            EP+KF P+R    +G EG     KF+PFG+GRR CP  N+ + ++ LALG+ +QCF+W  
Sbjct  417  EPQKFNPDR---FLGFEGVKEGCKFIPFGSGRRGCPGENLAIHVIGLALGSLLQCFEWDK  473

Query  666  TKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
               + I  +     ++  K + L A C+PR + ++ LS++
Sbjct  474  PNREIIDMSEGTGFTLSPKVQPLLAKCSPRPHMVKLLSEI  513



>ref|XP_010672783.1| PREDICTED: cytochrome P450 81E8-like [Beta vulgaris subsp. vulgaris]
Length=498

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 147/210 (70%), Gaps = 8/210 (4%)
 Frame = +3

Query  138  MYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLP  317
            +  I+ ++ +AG+ETT+ T+EWAMS L+++P V  K R EID NVG   L+ + DLSKL 
Sbjct  281  LKGIILVLILAGSETTARTLEWAMSNLINHPAVFAKARAEIDVNVGKGRLVEDCDLSKLS  340

Query  318  YLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepek  497
            Y+RCII ETLRL+PPAPLL+PHYS +DC + GYDVPK T + VNAWA+H DP  W++P +
Sbjct  341  YIRCIIYETLRLFPPAPLLVPHYSSQDCNIGGYDVPKGTILFVNAWALHRDPNQWDDPTE  400

Query  498  fkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  677
            FKPERFE    +E EGF  KF+PFG GRRACP NN  LR VSL L   IQCFDW+ T+  
Sbjct  401  FKPERFE----KEKEGF--KFMPFGIGRRACPGNNFALRNVSLTLATLIQCFDWEATEAG  454

Query  678  KILCATYLSPS--ILQKDERLEAICTPRKN  761
            K+      S    I+ K++ LEA C PR +
Sbjct  455  KVDLTEKCSAGAVIVPKEKPLEATCCPRSS  484



>ref|XP_006362076.1| PREDICTED: cytochrome P450 81D1-like [Solanum tuberosum]
Length=513

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 153/220 (70%), Gaps = 3/220 (1%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + + +++ ++  AG++T++VT+EWA S LL  PE+L   + EIDN VG   L++ESDL
Sbjct  297  TDETIRSLMLVLLQAGSDTSAVTLEWAFSHLLDNPEILKTAQTEIDNQVGQDRLIDESDL  356

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            ++LPY+RCIINETLR++P APLL+PH S E+C VAGY VP+ T ++VNAW +HHDPKVWE
Sbjct  357  AQLPYIRCIINETLRMHPAAPLLVPHLSSEECKVAGYRVPRGTVLLVNAWGIHHDPKVWE  416

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
            EP+KF P R    +G EG     KF+PFG+GRR CP  N+ + ++ LALG+ +QCF+W  
Sbjct  417  EPQKFNPGR---FLGFEGVKEGCKFIPFGSGRRGCPGENLAIHVIGLALGSLLQCFEWDK  473

Query  666  TKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
               + I  +     ++  K + L A C+PR + ++ LS++
Sbjct  474  PNREIIDMSEGTGFTLSPKVQPLLAKCSPRLHMVKLLSEI  513



>ref|XP_009620154.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nicotiana tomentosiformis]
Length=513

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 147/206 (71%), Gaps = 3/206 (1%)
 Frame = +3

Query  168  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIINETl  347
            AG++T++VT+EWA S LL   E+L K + EIDN+VG   L++ESDL++LPY+RCIINETL
Sbjct  311  AGSDTSAVTLEWAFSHLLDNLEILKKAQAEIDNHVGQDRLIDESDLAQLPYIRCIINETL  370

Query  348  rlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfeAIV  527
            R++P APLL+PH+S ++C VAGY VP+ T ++VNAW +HHDPKVWE+PEKF P+R    +
Sbjct  371  RMHPAAPLLVPHFSSKECKVAGYRVPRGTVLLVNAWGIHHDPKVWEDPEKFNPDR---FI  427

Query  528  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  707
            G EG     KF+PFG+GRR CP  N+   ++ LALG+ +QCF+W+      I  +     
Sbjct  428  GFEGVKEGCKFIPFGSGRRGCPGENLAFHVIGLALGSLLQCFEWEKPNRGIIDMSEGTGF  487

Query  708  SILQKDERLEAICTPRKNCLQFLSQL  785
            ++  K + L A C+PR N ++ LS++
Sbjct  488  TLSPKVQPLLAKCSPRPNMVKLLSKI  513



>ref|XP_006372852.1| hypothetical protein POPTR_0017s05680g [Populus trichocarpa]
 gb|ERP50649.1| hypothetical protein POPTR_0017s05680g [Populus trichocarpa]
Length=521

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = +3

Query  159  VFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIIN  338
            +++AG +T   T EWAM+ LL++PE L +++ EID  VGH+ L+ ESDL KL Y+RC++N
Sbjct  316  LYLAGVDTVDFTTEWAMTFLLNHPERLERVKAEIDREVGHERLVQESDLPKLRYVRCVVN  375

Query  339  ETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfe  518
            ETLRLYPPAPLLLPH   EDC+V GY +P+ T VMVNAWA+H DPK+WE+PE FKPERFE
Sbjct  376  ETLRLYPPAPLLLPHAPSEDCIVGGYKIPRGTIVMVNAWAIHRDPKLWEDPESFKPERFE  435

Query  519  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  698
               G   EG    F+PFG GRRACP N+M +R V LAL A IQCF+W+   ++ +  +  
Sbjct  436  ---GLNNEGEKQGFIPFGIGRRACPGNHMAMRRVMLALAALIQCFEWERVGKELVDMSIV  492

Query  699  LSPSILQKDERLEAICTPR  755
             +   +QK + LEAICTPR
Sbjct  493  DALISVQKAKPLEAICTPR  511



>gb|ABK96123.1| unknown [Populus trichocarpa]
Length=521

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = +3

Query  159  VFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIIN  338
            +++AG +T   T EWAM+ LL++PE L +++ EID  VGH+ L+ ESDL KL Y+RC++N
Sbjct  316  LYLAGVDTVDFTTEWAMTFLLNHPERLERVKAEIDREVGHERLVQESDLPKLRYVRCVVN  375

Query  339  ETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfe  518
            ETLRLYPPAPLLLPH   EDC+V GY +P+ T VMVNAWA+H DPK+WE+PE FKPERFE
Sbjct  376  ETLRLYPPAPLLLPHAPSEDCIVGGYKIPRGTIVMVNAWAIHRDPKLWEDPESFKPERFE  435

Query  519  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  698
               G   EG    F+PFG GRRACP N+M +R V LAL A IQCF+W+   ++ +  +  
Sbjct  436  ---GLNNEGEKQGFIPFGIGRRACPGNHMAMRRVMLALAALIQCFEWERVGKELVDMSIV  492

Query  699  LSPSILQKDERLEAICTPR  755
             +   +QK + LEAICTPR
Sbjct  493  DALISVQKAKPLEAICTPR  511



>ref|XP_009760134.1| PREDICTED: cytochrome P450 81D11-like [Nicotiana sylvestris]
Length=494

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 149/214 (70%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++F AGT T++VT+EW M+LLL++PEV+ K + EI+N VG   LL ESD+ KLPYL
Sbjct  285  GVIMVMFTAGTHTSAVTMEWTMTLLLNHPEVMKKAKLEINNLVGEGRLLEESDILKLPYL  344

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINETLRL+P  PLL+PH+S +DC++ GY +PK T + VN W +  DPK+WEEP KFK
Sbjct  345  RCIINETLRLFPAGPLLVPHFSSQDCIIEGYGIPKGTILFVNVWEIQRDPKLWEEPNKFK  404

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE   G EG     KF+PFG GRRACP + + +RL+ L LG +IQCF+W++     +
Sbjct  405  PERFE---GMEGGIEGCKFIPFGMGRRACPGSGLAMRLIGLVLGLFIQCFEWQSVGPALV  461

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                     +L+K + LEA+  PR++    LSQL
Sbjct  462  GLDESFG-LMLKKRDPLEALYRPRESMAVSLSQL  494



>ref|XP_009380098.1| PREDICTED: cytochrome P450 81D1 [Musa acuminata subsp. malaccensis]
Length=229

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 141/214 (66%), Gaps = 3/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++  +  AGT+T++VTIEWAM LLL +PEVLH  R E+D  +G   ++ E D+  LPYL
Sbjct  19   GLIVELMAAGTDTSAVTIEWAMCLLLIHPEVLHTARAELDARIGQGRMVEEEDIPNLPYL  78

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CIINETLRLY   PLL+PH S +DC V GYDVP  T ++ NAWA+H DP +W+EPE+FK
Sbjct  79   NCIINETLRLYHAVPLLVPHESSQDCTVGGYDVPCGTMLLTNAWAIHRDPNIWDEPEEFK  138

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF+   G+E  G   + +PFG+GRR CP   + +RL+ LAL   I CF+W+    +++
Sbjct  139  PERFQCEGGKEETGL--RMLPFGSGRRKCPGEGLAIRLIGLALAILIHCFEWEKLPGEEV  196

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                    S + K + LE +CTPR+  L  LSQL
Sbjct  197  DMTEGQGLS-MPKVKPLEVVCTPRRTMLHALSQL  229



>ref|XP_006372853.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP50650.1| cytochrome P450 family protein [Populus trichocarpa]
Length=521

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = +3

Query  159  VFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIIN  338
            +++AG +T   T EWAM+ LL++PE L +++ EID  VGH+ L+ ESDL KL Y+RC++N
Sbjct  316  LYLAGVDTVDFTAEWAMTFLLNHPERLERVKAEIDREVGHERLVQESDLPKLRYVRCVVN  375

Query  339  ETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfe  518
            ETLRLYPPAPLLLPH   EDC+V GY +P+ T VMVNAWA+H DPK+WE+PE FKPERFE
Sbjct  376  ETLRLYPPAPLLLPHAPSEDCIVGGYKIPRGTIVMVNAWAIHRDPKLWEDPESFKPERFE  435

Query  519  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  698
               G   EG    F+PFG GRRACP N+M +R V LAL A IQCF+W+   ++ +  +  
Sbjct  436  ---GLNNEGEKQGFIPFGIGRRACPGNHMAMRRVMLALAALIQCFEWERVGKELVDMSIV  492

Query  699  LSPSILQKDERLEAICTPR  755
             +   +QK + LEAICTPR
Sbjct  493  DALISVQKAKPLEAICTPR  511



>ref|XP_011029060.1| PREDICTED: cytochrome P450 81D11-like [Populus euphratica]
Length=499

 Score =   182 bits (463),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 153/214 (71%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             IV ++ +AGT+T+S T+EWA+SLLL++PEVL K + EID ++GH  L++E+DL++LPYL
Sbjct  290  GIVLVLLLAGTDTSSTTMEWALSLLLNHPEVLEKAQREIDEHIGHDRLMDEADLAQLPYL  349

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            R I+NETLR+YPPAPLL+PH S E+C+V G+ +P+ T + VN WA+ +DPK+W +P KF+
Sbjct  350  RSILNETLRMYPPAPLLVPHESSEECLVGGFRIPRGTMLSVNMWAIQNDPKIWPDPTKFR  409

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF+     EG    +K +PFG GRR+CP   + LR+V LALG+ +QCF+W+    DK+
Sbjct  410  PERFD---NPEGGRDEFKLMPFGHGRRSCPGEGLALRVVGLALGSLLQCFEWQKIG-DKM  465

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +  T      L K + LEAIC  R   L  LSQ+
Sbjct  466  VDMTESPGFTLPKAKPLEAICRARPRMLTHLSQI  499



>ref|XP_002320704.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE99019.2| cytochrome P450 family protein [Populus trichocarpa]
Length=499

 Score =   182 bits (463),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 154/214 (72%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT+T+S T+EWA+SLLL++PEVL K + EID ++GH  L++E DL++LPYL
Sbjct  290  GIMLVLLLAGTDTSSTTMEWALSLLLNHPEVLEKAQREIDEHIGHDRLMDEGDLAQLPYL  349

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            R I+NETLR+YPPAPLL+PH S E+C+V G+ +P+ T + VN WA+ +DPK+W +P KF+
Sbjct  350  RSILNETLRMYPPAPLLVPHESSEECLVGGFRIPRGTMLSVNMWAIQNDPKIWRDPTKFR  409

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF+     EG  + +K +PFG GRR+CP   + L++V LALG+ +QCF+W+    DK+
Sbjct  410  PERFD---NPEGGRYEFKLMPFGHGRRSCPGEGLALKVVGLALGSLLQCFEWQKIG-DKM  465

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +  T      + K ++LEAIC  R   L  LSQ+
Sbjct  466  VDMTESPGFTVPKAKQLEAICRARPRMLTLLSQI  499



>ref|XP_006367423.1| PREDICTED: isoflavone 2'-hydroxylase-like [Solanum tuberosum]
Length=484

 Score =   182 bits (462),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 146/214 (68%), Gaps = 7/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++F AGT T++VT+EWAMSLLL++PEV+ K R EIDN +G    L E D+ KLPYL
Sbjct  278  GVIMVMFTAGTHTSAVTMEWAMSLLLNHPEVMKKARLEIDNLIGETRPLEEPDILKLPYL  337

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINETLRL+P  PLL+PH+S +DC + GY +PK T + VN W +  D K+WEE  +FK
Sbjct  338  RCIINETLRLFPAGPLLVPHFSTQDCTIEGYHIPKGTILFVNIWEIQRDRKIWEEANEFK  397

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF    G EG     KF+PFG GRRACP + + +RL+ L LG +IQCF+W+    D++
Sbjct  398  PERFVG--GIEG----CKFIPFGMGRRACPGSGLAMRLIGLVLGLFIQCFEWERIG-DEL  450

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +        +L K E LEA+  PR++ +  LSQL
Sbjct  451  VGLDESCGLMLSKLEPLEALYRPRESMVTLLSQL  484



>ref|XP_011037157.1| PREDICTED: cytochrome P450 81D11-like [Populus euphratica]
Length=527

 Score =   182 bits (463),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = +3

Query  159  VFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIIN  338
            +++AG +T   T EWAM+ LL++PE L +++ EID  VGH+ L+ ESDL KL Y+RC++N
Sbjct  322  LYLAGVDTVDFTTEWAMTFLLNHPERLERVKAEIDREVGHERLVQESDLPKLRYVRCVVN  381

Query  339  ETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfe  518
            ETLRLYPPAPLLLPH   EDC++ GY +P+ T VMVNAWA+H DPK+WE+PE FKPERFE
Sbjct  382  ETLRLYPPAPLLLPHAPSEDCIIGGYKIPRGTIVMVNAWAIHRDPKLWEDPESFKPERFE  441

Query  519  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  698
               G   EG    F+PFG GRRACP N+M +R V LAL A IQCF+W+   ++ +  +  
Sbjct  442  ---GLNNEGEKQGFIPFGIGRRACPGNHMAMRRVMLALAALIQCFEWERVGKELVDMSIV  498

Query  699  LSPSILQKDERLEAICTPR  755
             +   +QK + LEAICTPR
Sbjct  499  DALISVQKAKPLEAICTPR  517



>gb|KEH31510.1| cytochrome P450 family protein [Medicago truncatula]
Length=509

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 140/208 (67%), Gaps = 7/208 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             IV ++ + GTET++ T+EWAMS LL++PEVL K R EID N+G  HL+ ESD+SKLPYL
Sbjct  298  GIVLVMILGGTETSATTLEWAMSALLNHPEVLKKARDEIDTNIGQDHLVEESDISKLPYL  357

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ET RL+P   LL PH+S +DC + GY VPK+T ++VNAWA+H D ++W +P +FK
Sbjct  358  QNIIHETFRLHPAFALLAPHFSSQDCTIGGYIVPKNTILLVNAWAIHRDSQLWSDPTQFK  417

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      + EG   K +PFG GRRACP  N+G R VSL L   IQCFDWK   E++I
Sbjct  418  PERF------DKEGEADKLIPFGLGRRACPGANLGQRTVSLTLALLIQCFDWKRISEEEI  471

Query  684  LCATYLSPSILQKDERLEAICTPRKNCL  767
               T    +   K   LEA+C  R N +
Sbjct  472  -DMTEGKGATTPKLIPLEAMCKARSNVI  498



>ref|XP_002267599.1| PREDICTED: isoflavone 2'-hydroxylase-like [Vitis vinifera]
Length=508

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 140/206 (68%), Gaps = 4/206 (2%)
 Frame = +3

Query  168  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIINETl  347
            AG +TTS T+EWAMSLLL+ PEVL K + E+DN +G  HL+ ESDLS+LPYL CII ET 
Sbjct  307  AGIDTTSATLEWAMSLLLNNPEVLKKAQMEMDNQLGPNHLIEESDLSQLPYLHCIIRET-  365

Query  348  rlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfeAIV  527
            +   PA  ++PH S ++C+V GY +P+ T ++VN W + +DP+VW+EP KF PERFE  V
Sbjct  366  QRMYPAGPIVPHESSKECMVGGYHIPRGTMLLVNIWGIQNDPEVWKEPRKFLPERFE--V  423

Query  528  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  707
            G EGEG   + +PFG+GRR CP   + +R+V L LG+ IQCFDWK   E K+  +  +  
Sbjct  424  GLEGEGHGLRLMPFGSGRRGCPGEGLAIRMVGLVLGSLIQCFDWKRVGEGKVDMSEGIGL  483

Query  708  SILQKDERLEAICTPRKNCLQFLSQL  785
            + L + + L A C PR   +  LSQ+
Sbjct  484  T-LPRAQPLLAKCRPRPALINLLSQI  508



>gb|ACJ85868.1| unknown [Medicago truncatula]
 gb|AFK47557.1| unknown [Medicago truncatula]
Length=509

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 140/208 (67%), Gaps = 7/208 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             IV ++ + GTET++ T+EWAMS LL++PEVL K R EID N+G  HL+ ESD+SKLPYL
Sbjct  298  GIVLVMILGGTETSATTLEWAMSALLNHPEVLKKARDEIDTNIGQDHLVEESDISKLPYL  357

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ET RL+P   LL PH+S +DC + GY VPK+T ++VNAWA+H D ++W +P +FK
Sbjct  358  QNIIHETFRLHPAFALLAPHFSSQDCTIGGYIVPKNTILLVNAWAIHRDSQLWSDPTQFK  417

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      + EG   K +PFG GRRACP  N+G R VSL L   IQCFDWK   E++I
Sbjct  418  PERF------DKEGEADKLIPFGLGRRACPGANLGQRTVSLTLALLIQCFDWKRISEEEI  471

Query  684  LCATYLSPSILQKDERLEAICTPRKNCL  767
               T    +   K   LEA+C  R N +
Sbjct  472  -DMTEGKGATTPKLIPLEAMCKARSNVI  498



>ref|XP_010274363.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 81D1-like [Nelumbo 
nucifera]
Length=197

 Score =   174 bits (440),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 139/205 (68%), Gaps = 9/205 (4%)
 Frame = +3

Query  171  GTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIINETlr  350
            GT+T+++T+EWA SLLL++P  L K R EIDNN+G   LL+ESD++KLPYL CIINETLR
Sbjct  2    GTDTSALTMEWATSLLLNHPGTLLKAREEIDNNIGEGRLLDESDIAKLPYLNCIINETLR  61

Query  351  lyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfeAIVG  530
            LYP +  L+PH S EDC + G+++P  T  + NAWA+H DP +W +P  FKPERF  +  
Sbjct  62   LYPASSDLVPHVSSEDCTIGGFEIPSRTIPLANAWAVHRDPNLWVDPTSFKPERFHGVEW  121

Query  531  EEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSPS  710
            E+G    +KF+PFG GRR      +G+R+V+  +GA IQCFDWK    D +  +     +
Sbjct  122  EKG---GFKFMPFGLGRRX-----LGMRVVAETVGALIQCFDWKRVGHDLVDVSEGRGLT  173

Query  711  ILQKDERLEAICTPRKNCLQFLSQL  785
            I  K + LEA+  PR N ++ LSQL
Sbjct  174  I-PKAKPLEAMYRPRSNMMKLLSQL  197



>ref|XP_006453453.1| hypothetical protein CICLE_v10008060mg [Citrus clementina]
 ref|XP_006474131.1| PREDICTED: cytochrome P450 81D1-like [Citrus sinensis]
 gb|ESR66693.1| hypothetical protein CICLE_v10008060mg [Citrus clementina]
Length=506

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 145/214 (68%), Gaps = 3/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ +  VA  +T+  TIEWAMSLLL+ P++L K R EIDN +G    ++E DL+KLPYL
Sbjct  296  SLMLVFLVAANDTSLGTIEWAMSLLLNNPDILEKARSEIDNQIGFDRFVDELDLTKLPYL  355

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCII ETLRLYP  P LLPH S E+C V G+ +P+ T ++VN WA+ +DPK+WE P KF 
Sbjct  356  RCIILETLRLYPAGPFLLPHESSEECTVGGFRIPRGTMLLVNIWAIQNDPKIWENPTKFN  415

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE I G    GF  KF+PFG+GRR+CP   + +R+V L LG+ IQCF+W+   E K+
Sbjct  416  PERFEGIEGARDHGF--KFMPFGSGRRSCPGEALSMRIVGLTLGSLIQCFEWERVGE-KM  472

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                  S  +L K + L+A C PR   L+ LSQ+
Sbjct  473  EDMAEASGLVLAKVQPLQAKCRPRPAMLKLLSQI  506



>emb|CDX85218.1| BnaC07g25290D [Brassica napus]
Length=453

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 147/204 (72%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT+T++ T++WAMS LL++P+VL K + EID  +G   L+ E D+ KLPYL
Sbjct  243  GIIVVMILAGTDTSAATLDWAMSNLLNHPDVLKKAKTEIDEQIGSDRLIEEQDIVKLPYL  302

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I++ETLRLYP  P+L+PH + EDC+VAGYDVP+ TT++VN WA+H DPK+WEEPEKFK
Sbjct  303  QSIVSETLRLYPVVPMLVPHMASEDCMVAGYDVPRGTTLLVNVWAIHRDPKMWEEPEKFK  362

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG + K +PFG GRRACP   + LRLV+LALG+ +QCF+W+   E+ +
Sbjct  363  PERF------EKEGEDKKLMPFGMGRRACPGLGLALRLVTLALGSLVQCFEWERAGEEYV  416

Query  684  LCATYLSPSILQKDERLEAICTPR  755
              +       L++   LEA+C PR
Sbjct  417  DMSEDEKGITLRRATLLEAMCRPR  440



>gb|AHF22081.1| CYP81B58 [Artemisia annua]
Length=500

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 138/214 (64%), Gaps = 5/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++Q++  AGT+T+S T+EW +S LL+ PE L K   EID  VG   L+NESDL  LPYL
Sbjct  292  GLMQVLLSAGTDTSSGTMEWMLSHLLNNPEALKKAHAEIDCYVGDNRLINESDLPNLPYL  351

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINET     P   L+ H S +DC+V GY +P  T +++N WAMH+DPK WE+P+KFK
Sbjct  352  RCIINET-MRINPPGPLVFHESAKDCIVGGYHIPSGTMLLMNLWAMHNDPKNWEDPKKFK  410

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PER    VG EG    YK +PFG GRR CPA NM +R+V LALG  IQCF+W+ T  D++
Sbjct  411  PER---FVGLEGSRDGYKLMPFGAGRRRCPAENMAMRMVGLALGTLIQCFEWETT-SDEM  466

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +  T      + K + L A C PR    + +SQL
Sbjct  467  IDMTEGKGLTMPKAKPLVAKCRPRGKMAKLISQL  500



>gb|AFO64617.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=502

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 151/220 (69%), Gaps = 4/220 (2%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + + + V ++  AGT+T++ T+EWAMSLLL++P+VL K + EID  VG+  L++ESD+
Sbjct  287  TDEMIRSFVLVLLSAGTDTSAGTMEWAMSLLLNHPQVLKKAQNEIDRVVGNDRLVDESDV  346

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
              LPYLRCIINETLR+ PP PLL+PH S EDCV+ GY++P+ T ++VN WA+HHDPK+W 
Sbjct  347  VNLPYLRCIINETLRICPPGPLLVPHESSEDCVIGGYNIPRGTMLLVNQWAIHHDPKLWT  406

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
            +PE FKPERFE   G EG    +K +PFG+GRR+CP   + +R++   LG  IQCFDW+ 
Sbjct  407  DPEMFKPERFE---GLEGTRDGFKLMPFGSGRRSCPGEGLAVRVIGSTLGLLIQCFDWER  463

Query  666  TKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              E K++  +      + K E L A C PR      LS+L
Sbjct  464  LSE-KMVDMSEAPGLTMPKAEPLVAKCKPRLEIQTLLSEL  502



>emb|CBI33748.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 145/208 (70%), Gaps = 12/208 (6%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +VQ++ +AGT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YL
Sbjct  276  GLVQVLILAGTDTSASTMEWAMTLLLNHPDVLEKAKAELDMHVGKDRLIEESDLPKLRYL  335

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ETLR++P  PLLLPH S +DC + G+D+P+ T ++VNAWA+H DP+VW +P  FK
Sbjct  336  QSIISETLRVFPVTPLLLPHMSSDDCQIGGFDIPRGTLLLVNAWALHRDPQVWVDPTSFK  395

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK---NTKE  674
            PERF     E GE  NYK VPFG GRRACP + +  R+V LALG+ IQC+DWK   NT  
Sbjct  396  PERF-----ENGERENYKLVPFGIGRRACPGSGLAQRVVGLALGSLIQCYDWKKISNTAI  450

Query  675  DKILCATYLSPSILQKDERLEAICTPRK  758
            D I       P +    + LEA+C  R+
Sbjct  451  DTIEGKGLTMPKL----QPLEAMCKARE  474



>emb|CDP14451.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 146/214 (68%), Gaps = 3/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+Q++   GT TTS T+EWA+S LL++P VL K R E++  +   HLLN+SD+SKLPYL
Sbjct  288  GIIQIMLSGGTHTTSQTMEWALSSLLNHPNVLQKARDELEK-MQPGHLLNDSDISKLPYL  346

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINETLRL+P AP L+PH+S EDC + GY+VPK TT++VN WA+H DP +WEEP KFK
Sbjct  347  RCIINETLRLFPAAPTLVPHFSSEDCTIGGYEVPKGTTLLVNVWAIHRDPNLWEEPNKFK  406

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE +  E G    +KF+PFG GRR CP   M +RLV L LG  IQ FDW+    + +
Sbjct  407  PERFEGM-DERGWNEGFKFLPFGKGRRICPGAAMAIRLVGLTLGTLIQFFDWERVGPEMV  465

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                    S L K + LEA   PR + ++ +SQL
Sbjct  466  DLEENQG-STLGKAKPLEACYKPRPSMIKTISQL  498



>ref|XP_004238572.1| PREDICTED: cytochrome P450 81E8-like [Solanum lycopersicum]
Length=484

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 146/214 (68%), Gaps = 7/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++F AGT T++VT+EWAMSLLL++PEV+ K R EIDN +G    L E D+ KLPYL
Sbjct  278  GVIMVMFTAGTHTSAVTMEWAMSLLLNHPEVMKKARLEIDNLIGETRPLEEPDILKLPYL  337

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINETLRL+P  PLL+PH+S ++C + GY +PK T + VN W +  D K+WE+  +FK
Sbjct  338  RCIINETLRLFPAGPLLVPHFSTQECTIEGYHIPKSTILFVNIWEIQRDSKIWEDANEFK  397

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE   G EG     KF+PFG GRRACP   + +RL+ L LG +IQCF+W+    D++
Sbjct  398  PERFEG--GIEG----CKFIPFGMGRRACPGYGLAIRLIGLVLGLFIQCFEWERIG-DEL  450

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +        +L K E LEA+  PR++ +  LSQL
Sbjct  451  VSLDESCGLMLSKLEPLEALYRPRESMVALLSQL  484



>ref|XP_004141398.1| PREDICTED: cytochrome P450 81D1-like [Cucumis sativus]
 ref|XP_004164032.1| PREDICTED: cytochrome P450 81D1-like [Cucumis sativus]
Length=512

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 148/219 (68%), Gaps = 4/219 (2%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + + A++ ++ VAGTET+   +EWA+SLLL++PE+L K + EIDN VGHK L+ ESD+
Sbjct  291  TDETIRALMLLMLVAGTETSGSIMEWALSLLLNHPEILKKAQTEIDNQVGHKRLMEESDM  350

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            ++LPYLR IINETLR+YPPAPLL+PH S +DC V GY VP+ T + +N WA+ +DPK W 
Sbjct  351  ARLPYLRGIINETLRMYPPAPLLVPHESSQDCSVGGYHVPRGTMLYINIWAIQNDPKFWT  410

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
             P KF PERF  +   E E + +  + FG GRR CP   +GLR++ L LG+ IQCF+W+ 
Sbjct  411  HPRKFDPERFNDV---ESENYKFNLMAFGLGRRGCPGEGLGLRMIGLVLGSLIQCFEWER  467

Query  666  TKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQ  782
              E+ +     ++ + + K + L A C PR   +  LSQ
Sbjct  468  PTEELVDLTEGIAIT-MPKAQNLHAKCRPRPMVVDILSQ  505



>ref|XP_006387952.1| hypothetical protein POPTR_0458s00200g [Populus trichocarpa]
 gb|ERP46866.1| hypothetical protein POPTR_0458s00200g [Populus trichocarpa]
Length=498

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 144/211 (68%), Gaps = 6/211 (3%)
 Frame = +3

Query  156  MVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCII  335
            ++  AGT T+S T+EWA+SLLL++PEVL K + EID  +GH  L++E+DL++LPYLR ++
Sbjct  293  VILFAGTHTSSTTMEWALSLLLNHPEVLEKAKREIDEQIGHDRLMDEADLAQLPYLRSVL  352

Query  336  NETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWee-pekfkper  512
            NETLR+YP APLL+PH S E+C+V G+ +P+ T + VN WA+ +DPK+W +  +      
Sbjct  353  NETLRMYPAAPLLVPHESSEECLVGGFRIPRGTMLSVNVWAIQNDPKIWRDPTKFRPERF  412

Query  513  feAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  692
                V  +G    +K +PFG GRR+CP  +M LR++ LALG+ +QCF+W+    DK++  
Sbjct  413  DNPEVARDG----FKLMPFGYGRRSCPGESMALRVMGLALGSLLQCFEWQKIG-DKMVDM  467

Query  693  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            T  S   + K + L+ IC PR + L+ LSQ+
Sbjct  468  TEASGFTIPKAKPLKVICRPRPDMLRHLSQI  498



>ref|XP_002283792.2| PREDICTED: isoflavone 2'-hydroxylase [Vitis vinifera]
Length=504

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 145/208 (70%), Gaps = 12/208 (6%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +VQ++ +AGT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YL
Sbjct  298  GLVQVLILAGTDTSASTMEWAMTLLLNHPDVLEKAKAELDMHVGKDRLIEESDLPKLRYL  357

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ETLR++P  PLLLPH S +DC + G+D+P+ T ++VNAWA+H DP+VW +P  FK
Sbjct  358  QSIISETLRVFPVTPLLLPHMSSDDCQIGGFDIPRGTLLLVNAWALHRDPQVWVDPTSFK  417

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK---NTKE  674
            PERF     E GE  NYK VPFG GRRACP + +  R+V LALG+ IQC+DWK   NT  
Sbjct  418  PERF-----ENGERENYKLVPFGIGRRACPGSGLAQRVVGLALGSLIQCYDWKKISNTAI  472

Query  675  DKILCATYLSPSILQKDERLEAICTPRK  758
            D I       P +    + LEA+C  R+
Sbjct  473  DTIEGKGLTMPKL----QPLEAMCKARE  496



>ref|XP_002283500.1| PREDICTED: isoflavone 3'-hydroxylase [Vitis vinifera]
Length=504

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 145/208 (70%), Gaps = 12/208 (6%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +VQ++ +AGT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YL
Sbjct  298  GLVQVLILAGTDTSAATMEWAMTLLLNHPDVLEKAKAELDMHVGKDRLIEESDLPKLRYL  357

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            R II+ETLR++P APLLLPH S +DC + G+D+P+ T ++VN WA+H DP+VWE+P  FK
Sbjct  358  RSIISETLRVFPVAPLLLPHMSSDDCQIGGFDIPRGTLLLVNVWALHRDPQVWEDPTSFK  417

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK---NTKE  674
            PERF     E GE  NYK VPFG GRRACP   +  R+V LALG+ IQC+DWK   NT  
Sbjct  418  PERF-----ENGERENYKLVPFGIGRRACPGAGLAQRVVGLALGSLIQCYDWKKISNTAI  472

Query  675  DKILCATYLSPSILQKDERLEAICTPRK  758
            D I       P +    + LEA+C  R+
Sbjct  473  DTIEGKGLTMPKL----QPLEAMCKARE  496



>gb|KGN55250.1| hypothetical protein Csa_4G642310 [Cucumis sativus]
Length=520

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 148/219 (68%), Gaps = 4/219 (2%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + + A++ ++ VAGTET+   +EWA+SLLL++PE+L K + EIDN VGHK L+ ESD+
Sbjct  299  TDETIRALMLLMLVAGTETSGSIMEWALSLLLNHPEILKKAQTEIDNQVGHKRLMEESDM  358

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            ++LPYLR IINETLR+YPPAPLL+PH S +DC V GY VP+ T + +N WA+ +DPK W 
Sbjct  359  ARLPYLRGIINETLRMYPPAPLLVPHESSQDCSVGGYHVPRGTMLYINIWAIQNDPKFWT  418

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
             P KF PERF  +   E E + +  + FG GRR CP   +GLR++ L LG+ IQCF+W+ 
Sbjct  419  HPRKFDPERFNDV---ESENYKFNLMAFGLGRRGCPGEGLGLRMIGLVLGSLIQCFEWER  475

Query  666  TKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQ  782
              E+ +     ++ + + K + L A C PR   +  LSQ
Sbjct  476  PTEELVDLTEGIAIT-MPKAQNLHAKCRPRPMVVDILSQ  513



>ref|XP_006389073.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP47987.1| cytochrome P450 family protein [Populus trichocarpa]
Length=506

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 142/206 (69%), Gaps = 3/206 (1%)
 Frame = +3

Query  162  FVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIINE  341
            ++AG +T   T EWAM+ LL++PE L +++ EID  VGH+ L+ ESDL KL YLRC++NE
Sbjct  302  YLAGVDTVDFTTEWAMTFLLNHPERLERVKAEIDREVGHERLVQESDLPKLRYLRCVVNE  361

Query  342  TlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfeA  521
            TLRLYPPAPLLLPH   EDC + GY++P+ T VMVN WA+H DPK+WE+PE FKPERFE 
Sbjct  362  TLRLYPPAPLLLPHAPSEDCTIGGYEIPRGTIVMVNVWAIHRDPKLWEDPESFKPERFE-  420

Query  522  IVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYL  701
              G   EG    F+PFG GRRACP N+M +R V LAL A  QCF+W+   ++ I  +   
Sbjct  421  --GLNNEGEKQGFIPFGIGRRACPGNHMAMRRVMLALAALFQCFEWERVGQELIDMSIVK  478

Query  702  SPSILQKDERLEAICTPRKNCLQFLS  779
            +   +QK + LEA CTPR      +S
Sbjct  479  ALISVQKAKPLEATCTPRPFTTSLIS  504



>emb|CDP01233.1| unnamed protein product [Coffea canephora]
Length=324

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 144/214 (67%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             IV ++ +AGT+T++VT+EWAMSLLL++PEVL K R E+DN VG   +++ESDL KL Y+
Sbjct  115  GIVLILLMAGTDTSAVTMEWAMSLLLNHPEVLRKARVELDNFVGQDRVVDESDLPKLTYI  174

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I+NETLRL+P  PLL PH S  +C + GY V  +T ++VNAWA+H DP++W++P  FK
Sbjct  175  QAIVNETLRLFPAVPLLSPHESSAECSIGGYYVSSNTMLLVNAWAIHRDPELWDDPTSFK  234

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PER     G E + +  K +PFG GRR CP   +  R+V+LALGA IQCFDW    +D +
Sbjct  235  PER---FEGLEADTYKLKLIPFGMGRRGCPGAGLANRVVTLALGALIQCFDWDRVSQD-L  290

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
               T  S   + K + LEA+C  R+   + L +L
Sbjct  291  EDMTEGSGLTMPKAKPLEAMCRAREKMTKILKEL  324



>ref|XP_007018568.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY15793.1| Cytochrome P450, putative [Theobroma cacao]
Length=499

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 150/213 (70%), Gaps = 4/213 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +I+ ++  AGTET+S T+EWAMSLLL+ PEVL K + EIDN VGH  +++ESDL+KLPYL
Sbjct  290  SIMMVLLNAGTETSSGTMEWAMSLLLNNPEVLKKAQMEIDNVVGHDRMMDESDLAKLPYL  349

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CII ET+R+YP  PLLLPH S ++C+V G+ VP+ TT++VN WA+ +DP +WEEP KFK
Sbjct  350  HCIICETMRMYPVTPLLLPHESSKECMVGGHRVPRGTTLLVNMWAIQNDPNIWEEPTKFK  409

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF    G EG    +K +PFG+GRR+CP   + + +V L LG+ IQCF+W+ T E+ +
Sbjct  410  PERFG---GFEGPRVGFKLLPFGSGRRSCPGEGLAISMVGLTLGSLIQCFEWERTSEE-M  465

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQ  782
            +  T  S   + K+  L A   PR+  +  LS+
Sbjct  466  VDMTQGSGLTMPKERALHAKGRPRQAMMNMLSR  498



>ref|XP_008453068.1| PREDICTED: cytochrome P450 81D1-like [Cucumis melo]
Length=516

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 150/210 (71%), Gaps = 4/210 (2%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + + A++ ++  AGTET+ VT+EWA+SL+L++PE L KL+ EID+ VGH  L++ESD+
Sbjct  296  TDETIRALMLILLAAGTETSVVTMEWALSLMLNHPEFLKKLQNEIDSQVGHDRLIDESDM  355

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            + LP LR IINET R+YPPAPL++PH S +DC+V GY +P+ T + VN WA+H+DPK+W+
Sbjct  356  ANLPSLRGIINETFRMYPPAPLMVPHESSKDCIVGGYHIPRGTILYVNLWAIHNDPKIWD  415

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
             P KF P RFE++   E E F +  +PFG+GRR CP   +GLR++ L LG+ +QCF+W+ 
Sbjct  416  NPRKFNPNRFESL---ESEKFGFNLMPFGSGRRGCPGEGLGLRVIGLVLGSLVQCFEWER  472

Query  666  TKEDKILCATYLSPSILQKDERLEAICTPR  755
              E+ +     ++ + + K   L+A CTPR
Sbjct  473  PGEELVDMTEGIALT-MPKAHCLQAKCTPR  501



>emb|CAA04116.1| cytochrome P450 [Helianthus tuberosus]
Length=505

 Score =   179 bits (454),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 150/217 (69%), Gaps = 6/217 (3%)
 Frame = +3

Query  138  MYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLP  317
            + + V ++  AG++T++ T+EW MSLLL++P+VL K + EID+ +G   L++ESD+  LP
Sbjct  294  IRSFVLVLLAAGSDTSAGTMEWVMSLLLNHPQVLKKAQNEIDSVIGKNCLVDESDIPNLP  353

Query  318  YLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepek  497
            YLRCIINETLRLYP  PLL+PH +  DCVV GY+VP+ T ++VN WA+HHDPKVW+EPE 
Sbjct  354  YLRCIINETLRLYPAGPLLVPHEASSDCVVGGYNVPRGTILIVNQWAIHHDPKVWDEPET  413

Query  498  fkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  677
            FKPERFE   G EG    +K +PFG+GRR+CP   + +R++ + LG+ IQCFDW+ T E+
Sbjct  414  FKPERFE---GLEGTRDGFKLLPFGSGRRSCPGEGLAVRMLGMTLGSIIQCFDWERTSEE  470

Query  678  KILCATYLSPSI-LQKDERLEAICTPRKNCLQFLSQL  785
              L      P + + K   L A C PR      LS+L
Sbjct  471  --LVDMTEGPGLTMPKAIPLVAKCKPRVEMTNLLSEL  505



>ref|XP_010277161.1| PREDICTED: cytochrome P450 81E8-like [Nelumbo nucifera]
Length=515

 Score =   179 bits (454),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 142/215 (66%), Gaps = 4/215 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ M+ +AGTET++ TIEWAM+LL ++PEVL K R E+D  VG   L++E D+ KL YL
Sbjct  300  GIIMMMLIAGTETSATTIEWAMALLFNHPEVLKKARAELDAYVGQDRLMDEQDIPKLHYL  359

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + ++NETLRLYPPAPLL PH S EDC V GYDVP+ T + VNAWA+H DPK+W++P  FK
Sbjct  360  QGVVNETLRLYPPAPLLAPHESSEDCSVGGYDVPRGTMLFVNAWAIHRDPKLWDDPTSFK  419

Query  504  perfeAIVGEEGEGFN-YKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDK  680
            PER     G+EG     +K +PFG GRR CP   +  R+V L LG  IQCF+W+   E  
Sbjct  420  PERHHQ--GDEGVVVEPFKLIPFGLGRRGCPGAGLANRVVGLTLGTLIQCFEWERVSEHM  477

Query  681  ILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +        S + K   LEA+C PR+   + LSQL
Sbjct  478  VDMTEGKGLS-MPKATPLEALCQPRQTMTKVLSQL  511



>emb|CDX86416.1| BnaA06g31330D [Brassica napus]
Length=453

 Score =   178 bits (451),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 146/204 (72%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT+T++ T++WAMS LL++PEVL K + EID  +G   L+ E D+ KLPYL
Sbjct  243  GIIVVMILAGTDTSAATLDWAMSNLLNHPEVLKKAKTEIDEQIGSDRLIEEQDIVKLPYL  302

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I++ETLRLYP  P+L+PH + EDC+VAGYDVP+ T ++VN WA+H DP++WEEPEKFK
Sbjct  303  QSIVSETLRLYPVVPMLVPHMASEDCMVAGYDVPRGTNLLVNVWAIHRDPEMWEEPEKFK  362

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG + K +PFG GRRACP   + LRLV+LALG+ +QCF+W+   ++ +
Sbjct  363  PERF------EKEGEDKKLMPFGMGRRACPGLGLALRLVTLALGSLVQCFEWERAGQEYV  416

Query  684  LCATYLSPSILQKDERLEAICTPR  755
              +       L++   LEA+C PR
Sbjct  417  DMSEDEKGITLRRATLLEAVCRPR  440



>ref|XP_004238116.2| PREDICTED: isoflavone 2'-hydroxylase-like [Solanum lycopersicum]
Length=512

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 149/214 (70%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++  AGT+T+  T+EWA+SL+L++PE L K + EID  +GH+ L++ESD++ LPYL
Sbjct  303  SLMLVLLAAGTDTSVGTMEWALSLMLNHPETLKKAQAEIDERIGHERLIDESDMNNLPYL  362

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCI+NET R+YP  PLL+PH S E+  V GY VP+ T ++VN WA+H+DPK+W+EP KFK
Sbjct  363  RCIVNETFRMYPAGPLLVPHESSEETTVGGYRVPRGTMLLVNLWAIHNDPKLWDEPRKFK  422

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PER     G EG    YK +PFG+GRR+CP   + +R+V+L+LG  IQCFDW+    D++
Sbjct  423  PER---FEGLEGVRDGYKMMPFGSGRRSCPGEGLAVRMVALSLGCIIQCFDWQRIG-DEL  478

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +  T  +   L K + L A C+PR      LSQ+
Sbjct  479  VDMTEGTGLTLPKAQPLVAKCSPRPVMSNLLSQI  512



>ref|XP_002283502.1| PREDICTED: cytochrome P450 81E8-like [Vitis vinifera]
Length=508

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 139/198 (70%), Gaps = 6/198 (3%)
 Frame = +3

Query  165  VAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIINET  344
            V G +TT+VTIEWAMSLLL++PEVL K R E+D ++GH  L++E+DL KL YL+ II+E+
Sbjct  304  VGGADTTAVTIEWAMSLLLNHPEVLKKARDELDTHIGHDCLIDETDLPKLQYLQSIISES  363

Query  345  lrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfeAI  524
            LRL+P  PLL+PH+S EDC + G+DVP  T ++VNAWA+H DPK+W +P  FKPERF   
Sbjct  364  LRLFPSTPLLVPHFSTEDCKLRGFDVPGGTMLLVNAWALHRDPKLWNDPTSFKPERF---  420

Query  525  VGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLS  704
              E GE   YK +PFG GRRACP   +  R++ L LG+ IQCFDWK   E +I  A    
Sbjct  421  --ETGESETYKLLPFGVGRRACPGIGLANRVMGLTLGSLIQCFDWKRVDEKEIDMAEGQG  478

Query  705  PSILQKDERLEAICTPRK  758
             + + K E LEA+C  R+
Sbjct  479  LT-MPKVEPLEAMCKTRQ  495



>emb|CAA04117.1| cytochrome P450 [Helianthus tuberosus]
Length=520

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 149/215 (69%), Gaps = 6/215 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            + V ++  AG++T++ T+EW MSLLL++P+VL K + EID+ +G   L++ESD+  LPYL
Sbjct  311  SFVLVLLAAGSDTSAGTMEWVMSLLLNHPQVLKKAQNEIDSVIGKNCLVDESDIPNLPYL  370

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINETLRLYP  PLL+PH +  DCVV GY+VP+ T ++VN WA+HHDPKVW+EPE FK
Sbjct  371  RCIINETLRLYPAGPLLVPHEASSDCVVGGYNVPRGTILIVNQWAIHHDPKVWDEPETFK  430

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE   G EG    +K +PFG+GRR+CP   + +R++ + LG+ IQCFDW+ T E+  
Sbjct  431  PERFE---GLEGTRDGFKLLPFGSGRRSCPGEGLAVRMLGMTLGSIIQCFDWERTSEE--  485

Query  684  LCATYLSPSI-LQKDERLEAICTPRKNCLQFLSQL  785
            L      P + + K   L A C PR      LS+L
Sbjct  486  LVDMTEGPGLTMPKAIPLVAKCKPRVEMTNLLSEL  520



>ref|XP_010446678.1| PREDICTED: cytochrome P450 81D11-like, partial [Camelina sativa]
Length=331

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 141/204 (69%), Gaps = 7/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+  + VAGTET+ VT+EWAMS LL++PE+L K+R EID+ +G   L+ ESD+  LPYL
Sbjct  128  GIILALVVAGTETSEVTLEWAMSNLLNHPEILEKVRAEIDDKIGSDRLIEESDIVNLPYL  187

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            +  ++ETLRLYP  PLLLPH+S ++C VAGYD+P+ T ++ N WAMH DP +WEEPE+FK
Sbjct  188  QNTVSETLRLYPAVPLLLPHFSSDECKVAGYDMPRGTLLLTNVWAMHRDPDLWEEPERFK  247

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG   K +PFG GRRACP   +G RLV+LALG+ IQCF+W+   E+ +
Sbjct  248  PERF------EKEGEAQKLIPFGMGRRACPGAELGKRLVTLALGSLIQCFEWERVGEE-L  300

Query  684  LCATYLSPSILQKDERLEAICTPR  755
            L  T      + K   L A+C  R
Sbjct  301  LDMTEAEGITMPKATPLRAMCKTR  324



>ref|XP_006362077.1| PREDICTED: isoflavone 2'-hydroxylase-like [Solanum tuberosum]
Length=539

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 148/214 (69%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++  AGT+T+  T+EWA+SL+L++PE L K + EID  +GH+ L++ESD++ LPYL
Sbjct  330  SLMLVLLAAGTDTSVGTMEWALSLMLNHPETLKKAQAEIDERIGHERLIDESDMNNLPYL  389

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINET R+YP  PLL+PH S E+  V GY VP  T ++VN WA+H+DPK+W+EP KFK
Sbjct  390  RCIINETFRMYPAGPLLVPHESSEETTVGGYRVPGGTMLLVNLWAIHNDPKLWDEPRKFK  449

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PER     G EG    YK +PFG+GRR+CP   + +R+V+L+LG  IQCFDW+    D++
Sbjct  450  PER---FEGLEGVRDGYKMMPFGSGRRSCPGEGLAVRMVALSLGCIIQCFDWRRIG-DEL  505

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +  T  +   L K + L A C+PR      LSQ+
Sbjct  506  VDMTEGTGLTLPKAQPLVAKCSPRPVMANLLSQI  539



>ref|XP_009380096.1| PREDICTED: isoflavone 2'-hydroxylase-like [Musa acuminata subsp. 
malaccensis]
Length=524

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 145/216 (67%), Gaps = 3/216 (1%)
 Frame = +3

Query  138  MYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLP  317
            +  ++  +  AGT+T++VT+EWAM LLL++PEVLH +R E+D  +G   +  E D+  LP
Sbjct  312  IKGLIVSLLAAGTDTSAVTMEWAMCLLLNHPEVLHAVRAELDAKIGQGRMAEEEDIPDLP  371

Query  318  YLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepek  497
            YL C+INETLRLYP  PLL+PH S +DC V GYDVP+ T ++VNAWA+H DP  W+EP++
Sbjct  372  YLNCVINETLRLYPAGPLLVPHESSQDCTVGGYDVPRGTMLLVNAWAIHRDPNTWDEPQE  431

Query  498  fkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  677
            FKPERF+   G+E  G   + +PFG+GRR CP   + +R++ LAL   I CF+W+    +
Sbjct  432  FKPERFQCEGGKEEAGL--RMLPFGSGRRKCPGEGLAMRVIGLALATLIHCFEWEKLPGE  489

Query  678  KILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            ++   T      + K + LEA+CTPR   L  LSQL
Sbjct  490  EV-DMTEGRGLTMPKAKPLEAMCTPRHTMLDALSQL  524



>emb|CBI33744.3| unnamed protein product [Vitis vinifera]
Length=234

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 136/204 (67%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++ +AGTET++ T EWAM+LLL++P  L K   EID+ VG + +++E+DL  LPYL
Sbjct  23   GLIMVLILAGTETSATTTEWAMALLLNHPNSLKKAIAEIDDRVGQERIMDETDLPNLPYL  82

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I+ ETLRLYPP PLL+PH S E+C + GY +PKHT VMVNAWA+  DPK+W +   F+
Sbjct  83   QNIVRETLRLYPPGPLLVPHVSSEECEIGGYHIPKHTMVMVNAWAIQRDPKLWPDATSFR  142

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E G+   YKF+P+G GRRACP  +M  RL+ L LG  IQC+ W+    DK 
Sbjct  143  PERF-----ETGKAETYKFLPYGVGRRACPGASMANRLIGLTLGTLIQCYSWERVS-DKE  196

Query  684  LCATYLSPSILQKDERLEAICTPR  755
            +  +      + K   LEA+C PR
Sbjct  197  VDMSGAEGLTMPKKTPLEAMCKPR  220



>ref|XP_010531165.1| PREDICTED: cytochrome P450 81E8-like [Tarenaya hassleriana]
Length=513

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 150/217 (69%), Gaps = 11/217 (5%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++F AGT+T+  T+EWAM +LL++P+ L KLR EI+ NV H  L+ +SDL  LPYL
Sbjct  305  GIIVLMFNAGTDTSPGTMEWAMFVLLNHPDKLEKLRAEIEANVKHDRLIRDSDLQNLPYL  364

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC+I ETLRLYP APLLLPHY+ +   + GY++P +T V+VNAWA+H D K+W+E E FK
Sbjct  365  RCVIYETLRLYPAAPLLLPHYTSKKFSLDGYEIPANTMVLVNAWAVHRDGKLWDEAEAFK  424

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE  VG+  +GF  +F+PFG GRRACP   MG+R V+L +GA +QCF+W     +KI
Sbjct  425  PERFEGFVGDR-DGF--RFLPFGVGRRACPGAGMGMRTVALTVGAMVQCFEW-----EKI  476

Query  684  LCATYLSPSI---LQKDERLEAICTPRKNCLQFLSQL  785
              A  + P     + K E L A C PR   +Q LSQL
Sbjct  477  GQAVDMRPVFNVAMVKAEPLVARCRPRAEMVQVLSQL  513



>ref|XP_008369127.1| PREDICTED: LOW QUALITY PROTEIN: isoflavone 2'-hydroxylase-like 
[Malus domestica]
Length=499

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 145/204 (71%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ +  +AGT+T++VT+EWAMS LL++P VL K + E+D  VG ++L++E D+SKLPYL
Sbjct  294  GLIMVXLLAGTDTSAVTLEWAMSNLLNHPRVLQKAKSELDAKVGKENLVDEPDISKLPYL  353

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ETLRL P APLLLPH++ +DC++ G+DVP+ T V+VNAWA+H DP++W+EPE FK
Sbjct  354  QSIISETLRLCPAAPLLLPHFTSDDCIIGGFDVPRDTMVLVNAWAVHRDPELWDEPESFK  413

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E GE F++K +PFG GRRACP   +  R+V L LG+ IQCFDW    E+ +
Sbjct  414  PERF-----ESGEDFSHKLIPFGMGRRACPGAGLAQRVVGLTLGSLIQCFDWNRVGEE-M  467

Query  684  LCATYLSPSILQKDERLEAICTPR  755
            +  T        K   LEA+C  R
Sbjct  468  VDMTEGKGLTAPKAIPLEAMCKAR  491



>ref|XP_007018567.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY15792.1| Cytochrome P450 [Theobroma cacao]
Length=498

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 144/205 (70%), Gaps = 4/205 (2%)
 Frame = +3

Query  171  GTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIINETlr  350
            GT+TT  T+EWA SLLL++PEVL K + EI N VGH  L++ESDL++LPYL CIINETLR
Sbjct  298  GTDTTVNTMEWAFSLLLNHPEVLEKAQAEIANRVGHCRLIDESDLAQLPYLHCIINETLR  357

Query  351  lyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfeAIVG  530
            +Y PAPLLLPH S E+CV+ G+ +P+ TT++VN WA+ +DPK+W  P +F PER     G
Sbjct  358  MYSPAPLLLPHESSEECVLGGFRIPRGTTLLVNVWAIQNDPKLWTNPTRFMPER---FEG  414

Query  531  EEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSPS  710
             EG    ++ +PFG+GRR CP  ++GLR+V L LG+ IQCF+W    +D ++  T  +  
Sbjct  415  LEGTRDGFRLMPFGSGRRGCPGESLGLRMVGLTLGSLIQCFEWSRISDD-LVDMTDATGF  473

Query  711  ILQKDERLEAICTPRKNCLQFLSQL  785
             ++K + L+A C P    L+ +S++
Sbjct  474  TMRKAQLLQAKCKPCPAMLKLVSRI  498



>gb|ABC69377.1| CYP81B2v2 [Nicotiana tabacum]
Length=511

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 149/214 (70%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++  AGT+T+  T+EWA+SL+L++PE L K + EID ++GH+ L++ESD++ LPYL
Sbjct  302  SLMLVLLSAGTDTSVGTMEWALSLMLNHPETLKKAQAEIDEHIGHERLVDESDINNLPYL  361

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINET R+YP  PLL+PH S E+  V GY VP  T ++VN WA+H+DPK+W+EP KFK
Sbjct  362  RCIINETFRMYPAGPLLVPHESSEETTVGGYRVPGGTMLLVNLWAIHNDPKLWDEPRKFK  421

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PER     G +G    YK +PFG+GRR+CP   + +R+V+L+LG  IQCFDW+   E+ +
Sbjct  422  PER---FQGLDGVRDGYKMMPFGSGRRSCPGEGLAVRMVALSLGCIIQCFDWQRIGEE-L  477

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +  T  +   L K + L A C+PR      LSQ+
Sbjct  478  VDMTEGTGLTLPKAQPLVAKCSPRPKMANLLSQI  511



>ref|XP_009372454.1| PREDICTED: isoflavone 2'-hydroxylase-like [Pyrus x bretschneideri]
Length=499

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 147/212 (69%), Gaps = 6/212 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++ +AGT+T++VT+EWAMS LL++P VL K   E+D  VG ++L++E D+SKLPYL
Sbjct  294  GLIMVMLLAGTDTSAVTLEWAMSNLLNHPRVLQKANSELDAKVGRENLVDEPDISKLPYL  353

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ETLRL P AP+L+PH S +DC++ G+DVP+ T V+VNAWA+H DP++W+EPE FK
Sbjct  354  QSIISETLRLCPAAPMLVPHLSSDDCIIGGFDVPRDTMVLVNAWAVHRDPELWDEPESFK  413

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E GE F++K +PFG GRRACP   +  R+V   LG+ IQCFDW    E+ +
Sbjct  414  PERF-----ESGEDFSHKLIPFGMGRRACPGAGLAQRVVGFTLGSLIQCFDWNRVGEE-M  467

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLS  779
            +  T    +   K   LEA+C  R    + LS
Sbjct  468  VDMTEGKGTTTPKAIPLEAMCKARPIVSKVLS  499



>ref|XP_009796225.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nicotiana sylvestris]
Length=518

 Score =   177 bits (450),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 148/214 (69%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++  AGT+T+  T+EWA+SL+L++P+ L K + EID  +GH+ LL+ESD++ LPYL
Sbjct  309  SLMLVLLSAGTDTSVGTMEWALSLMLNHPQTLKKAQAEIDERIGHERLLDESDINNLPYL  368

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINET R+YP  PLL+PH S E+  V GY VP  T ++VN WA+H+DPK+W+EP KFK
Sbjct  369  RCIINETFRMYPAGPLLVPHESSEETTVGGYRVPGGTMLLVNLWAIHNDPKLWDEPRKFK  428

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PER     G +G    YK +PFG+GRR+CP   + +R+V+L+LG  IQCFDW+   E+ +
Sbjct  429  PER---FQGLDGVRDGYKMMPFGSGRRSCPGEGLAVRMVALSLGCIIQCFDWQRIGEE-L  484

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +  T  +   L K + L A C+PR      LSQ+
Sbjct  485  VDMTEGTGLTLPKAQPLVAKCSPRPKMANLLSQI  518



>gb|KDO79057.1| hypothetical protein CISIN_1g019895mg [Citrus sinensis]
Length=334

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 137/186 (74%), Gaps = 5/186 (3%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + + A++  + +AG +T+++T+EWAM+ L+++PEVL   R E++  VG + L++ESDL
Sbjct  113  TDQNIKALMLTLIIAGIDTSAITLEWAMANLVNHPEVLKNARAELNAQVGQECLIDESDL  172

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            SKLPYLR I++ETLRL P APLL+PH S +DC V GYDVP+ TT++VNAWA+H DP++W+
Sbjct  173  SKLPYLRNIVSETLRLNPAAPLLIPHRSSDDCTVGGYDVPRDTTLLVNAWAIHRDPELWD  232

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
            EP  FKPERF     E  +   +K +PFG GRRACP  ++  RLV L LG+ +QCF+WK 
Sbjct  233  EPTCFKPERF-----ESSDSEAHKLMPFGLGRRACPGASLAQRLVGLTLGSLLQCFEWKR  287

Query  666  TKEDKI  683
              EDKI
Sbjct  288  IGEDKI  293



>ref|XP_011069764.1| PREDICTED: cytochrome P450 81E8-like isoform X1 [Sesamum indicum]
Length=510

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 146/214 (68%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++ +AGT+T++ T+EWA+SLLL++P VL K + EIDN++GH  L++ESD+++LPYL
Sbjct  301  SLMLVLLIAGTDTSAGTMEWALSLLLNHPHVLKKAQLEIDNHIGHDRLIDESDIAELPYL  360

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCI+NETLRLYP  PLL+PH S E C V GY VP  T ++VN WA+H+DPK WE+  +FK
Sbjct  361  RCILNETLRLYPAGPLLVPHESSEQCTVGGYRVPAGTMLLVNVWAIHNDPKNWEDAREFK  420

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE   G EG    +K +PFG+GRR CP   + +R+V   L + IQCFDW    ++ I
Sbjct  421  PERFE---GLEGNRDGFKLMPFGSGRRGCPGEALAVRMVGFGLASMIQCFDWGRVGKELI  477

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                 L  S + K E L A C  R    + LSQ+
Sbjct  478  DMTEGLGLS-MPKAEPLLAYCKSRPVAAKLLSQI  510



>ref|XP_011069766.1| PREDICTED: isoflavone 3'-hydroxylase-like [Sesamum indicum]
Length=513

 Score =   177 bits (449),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 144/213 (68%), Gaps = 4/213 (2%)
 Frame = +3

Query  147  IVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLR  326
            ++ ++  AGT+T++ T+EWA+SLLL++P VL K + EIDN++GH  L++ESD++KLPYLR
Sbjct  305  LMLVLLTAGTDTSAGTMEWALSLLLNHPHVLKKAQLEIDNHIGHDRLIDESDIAKLPYLR  364

Query  327  CIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkp  506
            CI+NETLRLYP  PLL+PH S E C V  Y +P  T ++VNAWA+H+DPK WE+  +FKP
Sbjct  365  CIVNETLRLYPAGPLLVPHESSEQCTVGAYRIPAGTMLLVNAWAIHNDPKNWEDAREFKP  424

Query  507  erfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKIL  686
            ERFE   G EG    +K +PFG+GRR CP   + +R+V   L + IQCFDW    ++ I 
Sbjct  425  ERFE---GLEGNRDGFKLMPFGSGRRGCPGEALAVRMVGFGLASMIQCFDWGRVGKELID  481

Query  687  CATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                L  S + K E L A C  R    + LSQ+
Sbjct  482  MTEGLGLS-MPKAEPLTAYCRARPVAAKLLSQI  513



>ref|XP_009796226.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X1 [Nicotiana 
sylvestris]
Length=513

 Score =   177 bits (449),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 144/206 (70%), Gaps = 3/206 (1%)
 Frame = +3

Query  168  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIINETl  347
            AG++T++VT+EWA S LL   E+L K + EIDN+VG   L++ESDL++L Y+RCIINETL
Sbjct  311  AGSDTSAVTLEWAFSHLLDNLEILKKAQAEIDNHVGQDRLIDESDLAQLHYIRCIINETL  370

Query  348  rlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfeAIV  527
            R++P APLL+PH S E+C VA Y VP+ T ++VNAW +HHDPKVWE+PEKF P+R    +
Sbjct  371  RMHPAAPLLVPHLSSEECNVASYRVPRGTVLLVNAWGIHHDPKVWEDPEKFYPDR---FI  427

Query  528  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  707
            G EG     KF+PFG+GRR CP  N+   ++ LALG+ +QCF+W+      I  +     
Sbjct  428  GFEGIKEGCKFIPFGSGRRGCPGENLAFHVIGLALGSLLQCFEWEKPNRGSIDMSEGTGF  487

Query  708  SILQKDERLEAICTPRKNCLQFLSQL  785
            ++  K + L A C+PR N ++ LS++
Sbjct  488  TLSPKVQPLLAKCSPRPNMVKLLSEI  513



>ref|XP_002456656.1| hypothetical protein SORBIDRAFT_03g040280 [Sorghum bicolor]
 gb|EES01776.1| hypothetical protein SORBIDRAFT_03g040280 [Sorghum bicolor]
Length=523

 Score =   177 bits (449),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 146/214 (68%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            A+V  +  AGTETTS T+EWAMSLLL++P+VL K + EID+NVG   LL+++DL +LPYL
Sbjct  316  ALVPNLLGAGTETTSTTMEWAMSLLLNHPDVLKKAQEEIDSNVGEGRLLDKNDLPRLPYL  375

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CII+ETLRLYP AP+LLPH +  DC + GYDVP  + ++VNA+A+H DP  WE+PE+F+
Sbjct  376  HCIISETLRLYPAAPMLLPHEASTDCKIHGYDVPAGSMILVNAYAIHRDPATWEDPEEFR  435

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E G       +PFG GRR CP  N+ +R + L LGA +QCFDW    + ++
Sbjct  436  PERF-----EHGRAEGKFMMPFGMGRRRCPGENLAMRTMGLVLGALLQCFDWTRIGDAEV  490

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              AT  + +I+ K   LEA+C PR N    L ++
Sbjct  491  DMATA-TGTIMSKAVPLEALCKPRANMSAVLQKI  523



>ref|XP_007033007.1| Cytochrome P450, family 81, subfamily D, polypeptide 8 [Theobroma 
cacao]
 gb|EOY03933.1| Cytochrome P450, family 81, subfamily D, polypeptide 8 [Theobroma 
cacao]
Length=501

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 148/206 (72%), Gaps = 6/206 (3%)
 Frame = +3

Query  138  MYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLP  317
            +  ++ ++ +AGT+T++VT+EWAMS LL++PEVL K R EID+ +G ++L++E D+SKL 
Sbjct  290  LKGLMLVMILAGTDTSAVTLEWAMSNLLNHPEVLKKARAEIDSQIGQENLIDEPDVSKLH  349

Query  318  YLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepek  497
            YL+ +I+ETLRLYP  PLLLPH +  DC + GYDVP+ T VMVNAWA+H DPK+W++P  
Sbjct  350  YLQSVISETLRLYPALPLLLPHMASSDCTIGGYDVPRDTIVMVNAWAIHRDPKLWDDPTS  409

Query  498  fkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  677
            FKPERF     E  +G ++K +PFG GRRACP  ++  RLV L LG+ IQCF+W+   + 
Sbjct  410  FKPERF-----ENEKGESHKLMPFGLGRRACPGASLAQRLVGLTLGSLIQCFEWERV-DG  463

Query  678  KILCATYLSPSILQKDERLEAICTPR  755
            K +  T  + S + K + LEA+C  R
Sbjct  464  KEIDMTEGTGSTMPKAQPLEAMCKAR  489



>ref|XP_004292745.1| PREDICTED: isoflavone 2'-hydroxylase-like [Fragaria vesca subsp. 
vesca]
Length=523

 Score =   177 bits (448),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 145/216 (67%), Gaps = 8/216 (4%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++  AG++T+S T+EW +SLLL+ PE L K R EIDN +G   L+ ESDL+ LPYL
Sbjct  314  GLMHIMLTAGSDTSSGTMEWGLSLLLNNPEALAKARTEIDNRIGQSRLIEESDLANLPYL  373

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            +CIINETLR+YP  PLL PH S EDC V GY VP+ T ++VN WA+ +DP++W EPE+FK
Sbjct  374  QCIINETLRMYPATPLLPPHESSEDCTVGGYHVPRGTMLLVNVWAIQNDPRLWAEPEQFK  433

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED--  677
            PERF+ + GE  +GF +  +PFG GRR C    +  R+V LALG+ +QCF+WK   E+  
Sbjct  434  PERFQNVQGER-DGFMW--LPFGAGRRGCAGEGLAYRVVGLALGSLVQCFEWKRPSEEMI  490

Query  678  KILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
             I   T L+   + K + L A C PR   L  LSQL
Sbjct  491  DISVGTGLT---MHKVQPLLAKCRPRPTMLALLSQL  523



>ref|XP_008367651.1| PREDICTED: cytochrome P450 81D11-like [Malus domestica]
Length=508

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 146/205 (71%), Gaps = 4/205 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKH-LLNESDLSKLPY  320
             I+ ++ VAGT+TTS  ++WAM+LLL++P+ + KLR EID  +G  H +L E DL  L Y
Sbjct  300  GIILVLLVAGTDTTSTALQWAMALLLNHPDAMEKLRAEIDTKIGPDHRVLKEQDLPNLSY  359

Query  321  LRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekf  500
            L+ +INET RLYP  P+L+PH + EDCVV G+DVP+HT +++NAWA+H +P++WE+PEKF
Sbjct  360  LQNVINETHRLYPSFPILVPHENSEDCVVGGFDVPRHTMLVINAWAIHRNPEIWEDPEKF  419

Query  501  kperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDK  680
            KPERFE   GE  EG  YK +PFG GRR CP   +  RL+ LALG+ +Q F+W+   E++
Sbjct  420  KPERFEGWSGEGSEG--YKLIPFGAGRRGCPGAGLANRLIGLALGSLVQSFEWERIGEEE  477

Query  681  ILCATYLSPSILQKDERLEAICTPR  755
            +  +  L  + + + + LEAIC PR
Sbjct  478  VDMSEGLGLT-MPRVKPLEAICKPR  501



>ref|XP_004509096.1| PREDICTED: isoflavone 2'-hydroxylase-like [Cicer arietinum]
Length=506

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 139/211 (66%), Gaps = 7/211 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             IV ++ + GTET++ T+EWAMS LL++PE+L+K R EID N+G   L+ ESD+S LPYL
Sbjct  291  GIVLVMLLGGTETSATTLEWAMSALLNHPEILNKAREEIDTNIGLDRLVEESDISNLPYL  350

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + IINET RL+P   LL PH+S +DC + GY+VP+ T ++VNAWA+H D K+W +P +FK
Sbjct  351  QNIINETFRLHPAFALLAPHFSSKDCTIGGYNVPQGTILLVNAWAIHRDSKLWNDPTQFK  410

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG   K +PFG GRRACP  ++G R V L L  +IQCF+WK   E +I
Sbjct  411  PERF------EKEGETDKLIPFGLGRRACPGASLGQRTVGLTLALFIQCFEWKRISEKEI  464

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFL  776
               T    +   K   LEA+C  R N +  L
Sbjct  465  -DMTEGKGATTPKLIPLEAMCKARSNVINKL  494



>ref|NP_001269247.1| isoflavone 2'-hydroxylase-like [Cicer arietinum]
 emb|CAB43505.1| cytochrome P450 [Cicer arietinum]
Length=499

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 144/204 (71%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++  + VAGTET+SVT+EWAMS LL++PE+L K + E+DN++G +HL+ E++ +KL YL
Sbjct  294  GLIMALIVAGTETSSVTLEWAMSNLLNHPEILEKAKIELDNHIGQEHLIEEAEATKLQYL  353

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ETLRL+PP  +LLPH S  DC + GYDVP++T +MVNAWA+H DP +W +P  FK
Sbjct  354  QNIISETLRLHPPVTMLLPHLSSHDCTIGGYDVPRNTMLMVNAWAIHRDPNLWADPMSFK  413

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E G+G    F+PFG GRRACP + + LR + L LG+ IQCF+WK   ++++
Sbjct  414  PERF-----ENGQGDIGGFIPFGMGRRACPGSGLALRTLGLTLGSLIQCFEWKRIGKEEV  468

Query  684  LCATYLSPSILQKDERLEAICTPR  755
              +   S +++ K   LEA C  R
Sbjct  469  DMSEG-SGTVVPKAIPLEAQCKAR  491



>ref|XP_009129360.1| PREDICTED: cytochrome P450 81D11-like [Brassica rapa]
 emb|CDY47252.1| BnaA02g29380D [Brassica napus]
Length=500

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 142/204 (70%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT T+  T+EWAM+ LL++PEVL + R EI+  +G   L+ E D+ KLPYL
Sbjct  291  GIILVMIIAGTNTSGGTLEWAMANLLNHPEVLERARTEIEEQIGSDRLIEEQDIVKLPYL  350

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I +ETLRLYP  P+LLPH + EDC+VAGYDVP+ T VMVNAWA+H DP +WEEPEKFK
Sbjct  351  QNITSETLRLYPVVPMLLPHMASEDCIVAGYDVPRGTMVMVNAWAIHRDPNMWEEPEKFK  410

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG + K + FG GRRACP + +  RLV+LALG+ +QCFDW+   E  +
Sbjct  411  PERF------EKEGEDKKMLSFGMGRRACPGSGLAQRLVTLALGSLVQCFDWERDGEKYV  464

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                    +I++K E L+A+C  R
Sbjct  465  DLTEAEKGTIMRKAEPLKAMCRAR  488



>ref|XP_007227313.1| hypothetical protein PRUPE_ppa016513mg, partial [Prunus persica]
 gb|EMJ28512.1| hypothetical protein PRUPE_ppa016513mg, partial [Prunus persica]
Length=497

 Score =   176 bits (447),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ VAGT+T+S T+EWAM+LLL++PE + K+R EID  VG + LL E DL KL YL
Sbjct  302  GIIMVMLVAGTDTSSATLEWAMALLLNHPEAMEKVRAEIDTKVGQERLLEEQDLPKLTYL  361

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + +INETLRLYPP PLL+PH + EDCVV G+DVP+HT + +NAWA+H DP++WE+P KFK
Sbjct  362  QNVINETLRLYPPTPLLVPHEASEDCVVRGFDVPRHTMLFINAWAIHRDPELWEDPTKFK  421

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE   GE  EG  YK + FG GRR CP   +  RLV LALG+ +Q F+W+   E+ +
Sbjct  422  PERFEGWSGEGSEG--YKLIAFGAGRRGCPGAGLASRLVRLALGSLVQSFEWERIGEENV  479



>gb|ABC69378.1| CYP81B2v1 [Nicotiana tabacum]
 dbj|BAF91366.1| cytochrome P450 [Nicotiana tabacum]
Length=511

 Score =   176 bits (447),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 150/214 (70%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++  AGT+T+  T+EWA+SL+L++PE L K + EID ++GH+ L++ESD++ LPYL
Sbjct  302  SLMLVLLSAGTDTSVGTMEWALSLMLNHPETLKKAQAEIDEHIGHERLVDESDINNLPYL  361

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINET R+YP  PLL+PH S E+  V GY VP  T ++VN WA+H+DPK+W+EP KFK
Sbjct  362  RCIINETFRMYPAGPLLVPHESSEETTVGGYRVPGGTMLLVNLWAIHNDPKLWDEPRKFK  421

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE   G EG    YK +PFG+GRR+CP   + +R+V+L+LG  IQCFDW+   E  +
Sbjct  422  PERFE---GLEGVRDGYKMMPFGSGRRSCPGEGLAIRMVALSLGCIIQCFDWQRLGEG-L  477

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +  T  +   L K + L A C+PR      LSQ+
Sbjct  478  VDKTEGTGLTLPKAQPLVAKCSPRPIMANLLSQI  511



>emb|CDY47253.1| BnaA02g29390D [Brassica napus]
Length=502

 Score =   176 bits (447),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 143/204 (70%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I++++ +AGT+T++ T+EWAMS LL++PEVL K + EID  +G   L+ E D+ KLPYL
Sbjct  291  GIIEVMILAGTDTSAATLEWAMSNLLNHPEVLKKAKTEIDEQIGLDRLIEEQDIVKLPYL  350

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I+ ETLRLYP  P+LLPH + +DC+VAGYDVP+ T ++VN WA+H DPK+WEEPEKFK
Sbjct  351  QSIVAETLRLYPVVPMLLPHMASKDCMVAGYDVPRKTILLVNVWAIHRDPKMWEEPEKFK  410

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG + K + FG GRRACP   +G RLV+LALG+ +QCF+W+ T E+ +
Sbjct  411  PERF------EKEGEDKKLMSFGMGRRACPGLGLGQRLVTLALGSLVQCFEWERTGEEYV  464

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                      + K   LEA+C  R
Sbjct  465  DMTEAAKGITMHKSTSLEAMCRTR  488



>ref|XP_004231887.1| PREDICTED: cytochrome P450 81D1-like [Solanum lycopersicum]
Length=500

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 149/213 (70%), Gaps = 6/213 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             IV ++  AGTET+SVTIEWAMSLLL++PEVL K R EIDN+VG   L++E+DL KL YL
Sbjct  292  GIVLVMLNAGTETSSVTIEWAMSLLLNHPEVLEKARNEIDNHVGKDRLMDEADLPKLKYL  351

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ETLRL+P APLL+PH S EDC VAG+ +P+ T ++VNAW++H DP +WE+PE FK
Sbjct  352  QSIISETLRLFPAAPLLVPHESSEDCKVAGFHIPRGTMLLVNAWSIHRDPLLWEDPESFK  411

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF  +  E     ++K +PFG GRRACP + +  R+V LALG  +QCF+WK   ++K+
Sbjct  412  PERFYGVEVE-----SWKLLPFGMGRRACPGSGLAQRVVGLALGTLVQCFEWKRVSDEKV  466

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQ  782
               T      + K E L A C  R+   + LS+
Sbjct  467  -DLTEGKGLTMPKAEPLMARCKAREIVHKVLSE  498



>gb|KGN55242.1| hypothetical protein Csa_4G641740 [Cucumis sativus]
Length=205

 Score =   169 bits (427),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 139/209 (67%), Gaps = 4/209 (2%)
 Frame = +3

Query  159  VFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIIN  338
            +  AGT+TTS TIEWAMSLLL++P V+ K   EI + +G   ++ E D+SKL YL  II 
Sbjct  1    MLAAGTDTTSGTIEWAMSLLLNHPMVMEKAWIEIRDCIGENQMVEEGDVSKLKYLEAIIY  60

Query  339  ETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfe  518
            ETLR++P APLL+PH   EDC + G+++PK T +MVNAWA+H DPKVWE+P  F+PERF 
Sbjct  61   ETLRMFPAAPLLVPHECSEDCSIEGFEIPKGTMLMVNAWAIHRDPKVWEDPTSFRPERFL  120

Query  519  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  698
               G E    +YK++PFG GRRACP   +  R + L L   IQCF+W+   E++ +  + 
Sbjct  121  NWEGVE----SYKWIPFGMGRRACPGFALAQRSMGLTLATLIQCFEWEKVDENEQIDLSE  176

Query  699  LSPSILQKDERLEAICTPRKNCLQFLSQL  785
             S   + K + LEA+C PR + L  L+QL
Sbjct  177  GSGITMPKAKALEAMCKPRNSMLHLLAQL  205



>ref|XP_009129359.1| PREDICTED: cytochrome P450 81D11-like [Brassica rapa]
Length=511

 Score =   176 bits (447),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 143/204 (70%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I++++ +AGT+T++ T+EWAMS LL++PEVL K + EID  +G   L+ E D+ KLPYL
Sbjct  300  GIIEVMILAGTDTSAATLEWAMSNLLNHPEVLKKAKTEIDEQIGLDRLIEEQDIVKLPYL  359

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I+ ETLRLYP  P+LLPH + +DC+VAGYDVP+ T ++VN WA+H DPK+WEEPEKFK
Sbjct  360  QSIVAETLRLYPVVPMLLPHMASKDCMVAGYDVPRKTILLVNVWAIHRDPKMWEEPEKFK  419

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG + K + FG GRRACP   +G RLV+LALG+ +QCF+W+ T E+ +
Sbjct  420  PERF------EKEGEDKKLMSFGMGRRACPGLGLGQRLVTLALGSLVQCFEWERTGEEYV  473

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                      + K   LEA+C  R
Sbjct  474  DMTEAAKGITMHKSTSLEAMCRTR  497



>ref|XP_009151853.1| PREDICTED: cytochrome P450 81D11 [Brassica rapa]
Length=499

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT+T++ T++WAMS LL++PEVL K + EID  +G   L+   D+ KLPYL
Sbjct  289  GIIVVMILAGTDTSAATLDWAMSNLLNHPEVLKKAKTEIDEQIGSDRLIEGQDIVKLPYL  348

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I++ETLRLYP  P+L+PH + EDC+VAGYDVP+ T ++VN WA+H DP++WEEPEKFK
Sbjct  349  QSIVSETLRLYPVVPMLVPHMASEDCMVAGYDVPRGTNLLVNVWAIHRDPEMWEEPEKFK  408

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG + K +PFG GRRACP   + LRLV+LALG+ +QCF+W+   E+ +
Sbjct  409  PERF------EKEGEDKKLMPFGMGRRACPGLGLALRLVTLALGSLVQCFEWERAGEEYV  462

Query  684  LCATYLSPSILQKDERLEAICTPR  755
              +       L++   LEA+C PR
Sbjct  463  DMSEDEKGITLRRATLLEAVCRPR  486



>ref|XP_008220356.1| PREDICTED: cytochrome P450 81D11-like [Prunus mume]
Length=491

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 145/208 (70%), Gaps = 1/208 (0%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ VAG++T+S T+EWAM+LLL++PE + K+R EI+  VG K  L E DL KL YL
Sbjct  282  GIILLMLVAGSDTSSTTLEWAMALLLNHPEEMEKVRDEIETKVGEKRALEEQDLPKLCYL  341

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + +INETLRLYPP P+L+P  + EDCVV G+DVP+H  ++VNAWA+H DP+VWE+P KFK
Sbjct  342  QNVINETLRLYPPFPILVPREAPEDCVVGGFDVPRHAMLVVNAWAIHRDPEVWEDPTKFK  401

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE  + E G    Y+ +PFG GRR CP   +  RLV LALG+ +Q F+W+   ED +
Sbjct  402  PERFERWISEGGLEGGYRVIPFGAGRRGCPGAGLANRLVELALGSLVQSFEWERIGEDMV  461

Query  684  LCATYLSPSILQKDERLEAICTPRKNCL  767
              +  L   ++ + + LEA+C PR   L
Sbjct  462  DMSEGLG-LMMPRVKPLEAMCKPRPFTL  488



>ref|XP_002302425.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE81698.2| cytochrome P450 family protein [Populus trichocarpa]
Length=484

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 150/213 (70%), Gaps = 4/213 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++  AGT+T+S  +EWA+SLLL++ EVL K + EID  +G   L++E+DL++LPYL
Sbjct  276  GLMLVLLFAGTDTSSSIMEWALSLLLNHSEVLLKAQKEIDEYIGPDRLIDEADLAQLPYL  335

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            R IINETLR+YPPAPLL+PH S E+C+V G+ +P+ T + VN WA+H+DPK+W +P KF+
Sbjct  336  RSIINETLRMYPPAPLLVPHESSEECLVGGFRIPRGTMLFVNMWAIHNDPKIWLDPRKFR  395

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            P+RF    G EG    ++ +PFG GRR+CP   + LR+V LALG+ IQCF+W+   +DK 
Sbjct  396  PDRFN---GLEGARDGFRLMPFGYGRRSCPGEGLALRMVGLALGSLIQCFEWQRI-DDKS  451

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQ  782
            +  T      + K + L+AIC PR + L+  SQ
Sbjct  452  VDMTERPGFTMAKAQPLKAICRPRLSMLKLFSQ  484



>ref|XP_004290943.1| PREDICTED: cytochrome P450 81D1-like [Fragaria vesca subsp. vesca]
Length=505

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 132/214 (62%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++Q++  AGT+T++  +EW +SLLL+ PE L K + EID  +G   L+ ESDL+ LPYL
Sbjct  298  GMMQIMLTAGTDTSAGNMEWTLSLLLNNPEALAKAQTEIDTKIGQSRLIVESDLANLPYL  357

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CII ET  L    P  + H S ED  V G++VP+ T +++NAWA+HHDPK+W E  +  
Sbjct  358  HCIIRET--LRMYPPATILHESSEDSTVGGFNVPRGTMLIMNAWAIHHDPKLW-EQPEQF  414

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
                  I  EE +GF  K++PFGTGRR CP   +  R+V LA+G+ IQCF+W+ + E+ +
Sbjct  415  KPERFQIEQEERDGF--KYMPFGTGRRGCPGEGLANRIVGLAIGSVIQCFEWERSGEEMV  472

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                    +I  K   L A C PR+  L FLSQL
Sbjct  473  DMTEGTGLTIF-KAHPLLAKCRPRQTMLPFLSQL  505



>ref|XP_008220288.1| PREDICTED: isoflavone 2'-hydroxylase-like [Prunus mume]
Length=507

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 145/215 (67%), Gaps = 6/215 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+Q++  AGTET+S T+EWA+SLLL+ PE L K + EID ++G   L+ ESDL KLP+L
Sbjct  298  GIMQVMLAAGTETSSGTMEWALSLLLNNPEALVKAQSEIDIHIGQSRLIEESDLGKLPHL  357

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
              IINETLR+YP  PLL+PH S +DC V G+DVP+ T ++VN WA+ ++PK+W +P +F+
Sbjct  358  HGIINETLRMYPAGPLLVPHESSDDCTVGGFDVPRGTMLLVNIWAIQNNPKLWSQPAQFR  417

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF  + GE  +GF    +PFGTGRR CP   +  R++ LALG+ IQCFDW+   E+ +
Sbjct  418  PERFLNVQGER-DGF--LLLPFGTGRRGCPGEGLANRILGLALGSLIQCFDWERIGEEMV  474

Query  684  LCATYLSPSI-LQKDERLEAICTPRKNCLQFLSQL  785
              +    P + + K   L A C PR   L  LSQL
Sbjct  475  DMSE--GPGLTMPKAHPLLAKCRPRPTMLNLLSQL  507



>gb|KDP45416.1| hypothetical protein JCGZ_09665 [Jatropha curcas]
Length=506

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 142/214 (66%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++  + + GTET+SVT+EWAMSLLL+ PEVL K R E+D  +G   L++ESD SKLPYL
Sbjct  299  GLILNLIIGGTETSSVTMEWAMSLLLNNPEVLKKARAELDEIIGQDRLVDESDFSKLPYL  358

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + IINETLRLYP AP L+PH S +DC + GY VP+ T ++VNAWA+H DP VW +P KFK
Sbjct  359  QSIINETLRLYPVAPFLVPHESSDDCTIGGYYVPRGTMLLVNAWAIHRDPTVWSDPTKFK  418

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE +  E      YK +PFG GRRACP   +  R++ LAL   I CF+W    E+ +
Sbjct  419  PERFEGLGNEA-----YKLIPFGVGRRACPGAGLANRVMGLALAELIHCFEWGRPSEE-L  472

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +  T  +   + K + LEA+C  R++ +  L  L
Sbjct  473  IDMTEGTGGTMPKSQPLEAMCRARESMINILQDL  506



>gb|KHG05117.1| Isoflavone 2'-hydroxylase [Gossypium arboreum]
Length=501

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 140/215 (65%), Gaps = 6/215 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++ +AGT+T+S TIEWAMS LL++P+VL+K R EID  VG   L+ ESDL  LPYL
Sbjct  292  SLMMVLLLAGTDTSSGTIEWAMSFLLNHPQVLNKARIEIDTVVGQNRLIEESDLPNLPYL  351

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CIINET R+ P  PLL+PH S ++C+V GY +P+ T ++VNAWA+ +DP  W   E+  
Sbjct  352  HCIINETFRIKPTGPLLVPHESSKECLVGGYRIPRGTMLLVNAWAIQNDPNNW---EEPN  408

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
              + E   G +   F ++ +PFG GRR CP   + +R+V L LG+ IQCF+W+   E+ +
Sbjct  409  VFKPERFEGLDPSNFAFRLMPFGNGRRRCPGEGLAMRMVGLTLGSLIQCFEWERKGEEMV  468

Query  684  LCATYLSPSI-LQKDERLEAICTPRKNCLQFLSQL  785
              +    P + + K + L+A C PR+  +  LSQ+
Sbjct  469  DMSE--GPGLTMPKAQPLQAKCRPRQPFVPLLSQI  501



>ref|XP_009620153.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nicotiana tomentosiformis]
Length=511

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 150/214 (70%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++  AGT+T+  T+EWA+SL+L++PE L K + EID  +GH+ L++ESD++ LPYL
Sbjct  302  SLMLVLLSAGTDTSVGTMEWALSLMLNHPETLKKAQAEIDERIGHERLVDESDINNLPYL  361

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCIINET R+YP  PLL+PH S E+  V GY VP  T ++VN WA+H+DPK+W+EP KFK
Sbjct  362  RCIINETFRMYPAGPLLVPHESSEETTVGGYRVPGGTMLLVNLWAIHNDPKLWDEPRKFK  421

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE   G EG    YK +PFG+GRR+CP   + +R+V+L+LG  IQCFDW+   ++ +
Sbjct  422  PERFE---GLEGVRDGYKMMPFGSGRRSCPGEGLAIRMVALSLGCIIQCFDWQRMGKE-L  477

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +  T  +   L K + L A C+PR      LSQ+
Sbjct  478  VDMTEGTGLTLPKAQPLVAKCSPRPIMANLLSQI  511



>ref|XP_007224527.1| hypothetical protein PRUPE_ppa024021mg, partial [Prunus persica]
 gb|EMJ25726.1| hypothetical protein PRUPE_ppa024021mg, partial [Prunus persica]
Length=469

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 146/215 (68%), Gaps = 6/215 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++Q++  AGTET++ T+EWA+SLLL+ PE L K + EID  +G   L+ E+D ++LPYL
Sbjct  260  GMIQVMLSAGTETSAGTMEWALSLLLNNPEALAKAQTEIDIEIGQSRLIEEADFARLPYL  319

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
              IINETLR+YP  P+L+PH S E+C V GY VP+ T ++VN WA+ ++PK+W +P++FK
Sbjct  320  HGIINETLRMYPADPMLVPHESSEECTVGGYHVPRGTMLLVNMWAIQNNPKLWSQPKQFK  379

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF  + GE  +GF    +PFGTGRR CP   + +R+V LALG+ +QCF+W+   E+K+
Sbjct  380  PERFLNVQGER-DGF--MLLPFGTGRRGCPGEGLAIRMVGLALGSLVQCFEWERIGEEKV  436

Query  684  LCATYLSPSI-LQKDERLEAICTPRKNCLQFLSQL  785
              +    P + + K   L A C PR   L  LSQL
Sbjct  437  DMSE--GPGLTMPKAHPLLAKCRPRPKMLALLSQL  469



>ref|XP_011099312.1| PREDICTED: cytochrome P450 81E8-like [Sesamum indicum]
 dbj|BAE48234.1| cytochrome P450 [Sesamum indicum]
Length=506

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 142/214 (66%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++  + +AGT+ + VT EWAMSLLL++P+VL K R E+D  VGH+ +++E DL KL YL
Sbjct  296  GLIVALIIAGTDASVVTTEWAMSLLLNHPKVLEKARKELDTLVGHERMVDEHDLPKLRYL  355

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CI+ ETLRL+P  P L+PH   EDC + GY+VPK T V+VNAWA+H DPKVW++P  FK
Sbjct  356  HCIVLETLRLFPSVPTLVPHEPSEDCKIGGYNVPKGTMVLVNAWAIHRDPKVWDDPLSFK  415

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            P+RFE +  E      +K +PFG GRRACP   +  + V LALG+ IQCFDW+ T  +KI
Sbjct  416  PDRFEIMEVE-----THKLLPFGMGRRACPGAGLAQKFVGLALGSLIQCFDWERTSPEKI  470

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                  S   L K + LEA+C PR    + L Q+
Sbjct  471  DLNEG-SGITLPKAKTLEAMCKPRHVMEKVLRQV  503



>gb|ADD84651.1| CYP81B36 [Scoparia dulcis]
Length=502

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/220 (49%), Positives = 152/220 (69%), Gaps = 4/220 (2%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T K + +++  + VAGT+TT+ T+EW +SLLL+ P V+ K + EIDN++GH HL++ESD+
Sbjct  287  TDKLIRSLMLTLLVAGTDTTAGTMEWVVSLLLNNPHVIKKAQVEIDNHIGHGHLIDESDI  346

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            + LPYLRCI+NETLRLYP  PLL+PH S E C+V GY VP  T ++VN WA+  DPK W+
Sbjct  347  TDLPYLRCIVNETLRLYPAGPLLVPHESSEQCIVGGYRVPAGTMLLVNLWAIQRDPKYWD  406

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
            EPEKFKPERFE   G EG    +KF PFG+GRR CP   + +R+++ ++G+ IQCFDW+ 
Sbjct  407  EPEKFKPERFE---GLEGNRDGFKFSPFGSGRRGCPGEGLAVRMLASSIGSIIQCFDWER  463

Query  666  TKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              ++ +  +  +  + L K + L A C  R    + LSQ+
Sbjct  464  VGKELVDMSEGVGLT-LPKAQPLMAYCRARPLAAKLLSQI  502



>gb|AHK60837.1| CYP81Q32 [Catharanthus roseus]
Length=499

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 136/204 (67%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT+T++VT+EWAMSLLL++PE L K R EI+  VG   L+ E DL KL YL
Sbjct  291  GIIMVLLLAGTDTSAVTVEWAMSLLLNHPETLEKARTEIETQVGSNRLIEEQDLPKLTYL  350

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
              II+ET RL P AP+L+PH S +DC V GYDVPK T ++VNAWA+H DP+ W+EP  FK
Sbjct  351  HNIISETFRLCPAAPMLVPHESSDDCKVQGYDVPKGTILLVNAWAIHRDPEFWDEPTLFK  410

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PER   +  E       K +PFG GRR+CP + +  R+V L LGA IQCF+WK   E KI
Sbjct  411  PERHGGVELEPS-----KLMPFGMGRRSCPGSGLAQRVVGLTLGALIQCFEWKRIGEAKI  465

Query  684  LCATYLSPSILQKDERLEAICTPR  755
              A   S   + K + LEA+C PR
Sbjct  466  DMAEG-SGLTMPKAQPLEALCKPR  488



>emb|CBI33745.3| unnamed protein product [Vitis vinifera]
Length=457

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 142/212 (67%), Gaps = 20/212 (9%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +V ++ + GT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YL
Sbjct  253  GLVLVLILGGTDTSAATMEWAMTLLLNHPDVLEKAKVELDMHVGKDRLIEESDLPKLRYL  312

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ET+R +P  PLL+PH S +DC + G+D+P+ T ++VNAWA+H DP+VWE+P  FK
Sbjct  313  QSIISETMRAFPVGPLLVPHMSSDDCQIGGFDIPRGTLLLVNAWALHRDPQVWEDPTSFK  372

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK-------  662
            PERF     E GE  +YK VPFG GRRACP   +  R+V LALG+ IQC+DWK       
Sbjct  373  PERF-----ENGEREDYKLVPFGIGRRACPGAGLAQRVVGLALGSLIQCYDWKKISNTAI  427

Query  663  NTKEDKILCATYLSPSILQKDERLEAICTPRK  758
            +T E K L    L P        LEA+C  R+
Sbjct  428  DTTEGKGLSMPKLEP--------LEAMCKARE  451



>ref|XP_007018554.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY15779.1| Cytochrome P450 [Theobroma cacao]
Length=499

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 144/214 (67%), Gaps = 6/214 (3%)
 Frame = +3

Query  147  IVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLR  326
            ++ ++ +AGT+T++ T+EWAMS LL++PEVL K + E+D  VG   L++ESDL  LPYL 
Sbjct  291  LMMVLLLAGTDTSAGTLEWAMSFLLNHPEVLEKAQTEMDTVVGQARLMDESDLVNLPYLH  350

Query  327  CIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkp  506
            CII ET+R+ P  PLL+PH S +DCVV GY +P  T +MVN WA+H+DP  WEEP KFKP
Sbjct  351  CIIRETMRIKPVGPLLIPHESSKDCVVGGYHIPCGTMLMVNLWAIHNDPNNWEEPTKFKP  410

Query  507  erfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKIL  686
            ER     G EG    +KF+PFG+GRR+CP   + +R+V L LG+ IQCF W+   ++ + 
Sbjct  411  ER---FEGLEGTKVGFKFMPFGSGRRSCPGEGLAMRMVGLTLGSLIQCFHWERIGKEMVD  467

Query  687  CATYLSPSI-LQKDERLEAICTPRKNCLQFLSQL  785
                  P + + K + L+A C PR+  +  LSQ+
Sbjct  468  MTE--GPGLTMPKAQPLQAKCRPRQPMVNLLSQI  499



>ref|XP_010910128.1| PREDICTED: cytochrome P450 81E8-like [Elaeis guineensis]
Length=505

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 145/222 (65%), Gaps = 6/222 (3%)
 Frame = +3

Query  120  NSTLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNES  299
            N T + +  ++  + +AGT+T+S TIEWAMSLLL+ PE L K + EID  VG++ LL ES
Sbjct  290  NYTDETIKGLITSLLLAGTDTSSSTIEWAMSLLLNNPEKLQKAQTEIDERVGNERLLKES  349

Query  300  DLSKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKV  479
            DLS LPYL+CII ETLR+  PAPLL+PH S  DCVV G+DVP+ T ++VNA+ +H DPK+
Sbjct  350  DLSDLPYLQCIIRETLRICSPAPLLVPHESTNDCVVGGFDVPRGTMLLVNAYYIHRDPKI  409

Query  480  WeepekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDW  659
            WEEP KFKPERF     E+G+      +PFG GRR CP   + +  V L LG  IQCFDW
Sbjct  410  WEEPTKFKPERF-----EDGKDEGKLMIPFGMGRRRCPGEGLAMTEVGLTLGTLIQCFDW  464

Query  660  KNTKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            K   E+ +   T  S   + K   LEA+  PR+  +  LS L
Sbjct  465  KRMGEEPV-DMTEGSGLTMPKAVPLEAMYRPRRAMVHVLSGL  505



>ref|XP_004290944.1| PREDICTED: cytochrome P450 81D1-like [Fragaria vesca subsp. vesca]
Length=505

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 146/214 (68%), Gaps = 5/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++Q++  AG++T++ T+EWA+SLLL+ PE L K + EID  +G   L+ ESDL+ LPYL
Sbjct  297  GMMQVMLSAGSDTSAGTMEWALSLLLNNPEALAKAQTEIDEKIGKSRLIEESDLANLPYL  356

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CII+ETLR+  PA L+ PH S EDC V G++VP+ T ++VNAWA+HHDPK+WE PE+FK
Sbjct  357  HCIISETLRMCSPAALIPPHESSEDCTVGGFNVPRGTMLLVNAWAIHHDPKLWEHPEQFK  416

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF+    +E + F Y  +PFG GRR CP   +  R+V LALG+ IQCF+W+   E+ +
Sbjct  417  PERFQN--AQERDVFMY--LPFGIGRRGCPGEGLANRIVGLALGSVIQCFNWERNGEE-M  471

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +  T  +   + K   L A C+PR   L  LSQL
Sbjct  472  VDMTEGTGLAMPKAHPLLAKCSPRPTMLALLSQL  505



>ref|XP_006283601.1| hypothetical protein CARUB_v10004657mg [Capsella rubella]
 gb|EOA16499.1| hypothetical protein CARUB_v10004657mg [Capsella rubella]
Length=495

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 140/204 (69%), Gaps = 7/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+  + VAGT+T+SVT+EWAMS LL++PEVL K+R EID+ +G   L+ ESD+  LPYL
Sbjct  292  GIILALVVAGTDTSSVTLEWAMSNLLNHPEVLEKVRAEIDDKIGSGRLMEESDIVNLPYL  351

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            +  ++ET RL+P  PLLLPHYS ++C VAGYD+P+ T ++ NAWAMH DP +WEEPE FK
Sbjct  352  QNTVSETFRLHPAVPLLLPHYSSDECKVAGYDMPRGTMLLTNAWAMHRDPGLWEEPEMFK  411

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG   K +PFG GRRACP   +G RLV LALG+ IQCF+W+   E+ +
Sbjct  412  PERF------EKEGEAQKLMPFGMGRRACPGAELGKRLVCLALGSLIQCFEWERVGEE-L  464

Query  684  LCATYLSPSILQKDERLEAICTPR  755
            L  T      + K   L A+C  R
Sbjct  465  LDMTEAKGITMPKATPLRAMCKTR  488



>emb|CBI38503.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 141/203 (69%), Gaps = 6/203 (3%)
 Frame = +3

Query  138  MYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLP  317
            +  +V ++ +AGT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL 
Sbjct  108  IKGLVLVLILAGTDTSAATVEWAMTLLLNHPDVLKKAKAELDIHVGKDRLIEESDLPKLR  167

Query  318  YLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepek  497
            YL+ II+ETLRL+P APLL+PH S +DC + G+D+P  T +++NAWA+H DP+VWE+P  
Sbjct  168  YLQSIISETLRLFPVAPLLVPHMSSDDCQIGGFDIPGGTFLLINAWAIHRDPQVWEDPTS  227

Query  498  fkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  677
            F PERF     E G+  NYK +PFG GRRACP   +  R+V LALG+ IQC+DWK   E 
Sbjct  228  FIPERF-----ENGQRENYKLLPFGIGRRACPGAGLAHRVVGLALGSLIQCYDWKRISET  282

Query  678  KILCATYLSPSILQKDERLEAIC  746
             I   T      + K E LEA+C
Sbjct  283  TI-DTTEGKGLTMPKLEPLEAMC  304



>ref|XP_008452620.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 81D1-like [Cucumis 
melo]
Length=516

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 145/213 (68%), Gaps = 4/213 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++ VAGTET+   +EWA+SLLL++PE+L K + EIDN VG++  + ESD+++LPYL
Sbjct  301  GLMLLMLVAGTETSGSIMEWALSLLLNHPEILKKAQIEIDNQVGNQRPIEESDMARLPYL  360

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            R IINETLR+YPPAPLL+PH S +DC V GY VP+ T + +N WA+ +DPK+W  P++F 
Sbjct  361  RGIINETLRMYPPAPLLVPHESSQDCSVGGYHVPRGTMLYINIWAIQNDPKIWAHPKEFD  420

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            P+RF  +   E E + +  +PFG GRR CP   +GLR++ L LG+ IQCF+W+   E+ +
Sbjct  421  PDRFNDV---ESEKYKFNLMPFGLGRRGCPGEGLGLRMIGLVLGSLIQCFEWERPTEELV  477

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQ  782
                 ++ + + K + L A C PR   +  L Q
Sbjct  478  DLTEGIAIT-MPKAQNLHAKCRPRPMIVNILPQ  509



>ref|XP_004141397.1| PREDICTED: cytochrome P450 81D1-like [Cucumis sativus]
 ref|XP_004164033.1| PREDICTED: cytochrome P450 81D1-like [Cucumis sativus]
 gb|KGN55249.1| hypothetical protein Csa_4G642300 [Cucumis sativus]
Length=516

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 147/210 (70%), Gaps = 4/210 (2%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + + A++ ++  AGTET+   +EWA+SL+L++P+ L KL+ EIDN VGH  L++ESD+
Sbjct  296  TDETIRALMLVLLAAGTETSVAAMEWALSLMLNHPKFLKKLQNEIDNQVGHDRLIDESDM  355

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            + LP LR IINETLR+YPPAPL++PH S +DC + GY +P+ T + VN WA+H+DPK+W+
Sbjct  356  ANLPSLRGIINETLRMYPPAPLVVPHESSKDCTIGGYHIPRGTILFVNLWAIHNDPKIWD  415

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
             P KF P RFE++   E E F +  +PFG+GRR CP   + LR++ L LGA +QCF+W+ 
Sbjct  416  NPRKFNPNRFESL---ENEKFGFNLIPFGSGRRGCPGEGLALRVIGLVLGALVQCFEWER  472

Query  666  TKEDKILCATYLSPSILQKDERLEAICTPR  755
              E+ +     ++ + + K   L+A CTPR
Sbjct  473  PGEELVDMTEGVALT-MPKAHCLQAKCTPR  501



>ref|XP_010502943.1| PREDICTED: cytochrome P450 81D11-like isoform X2 [Camelina sativa]
Length=327

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 145/204 (71%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT+T++ T+EWAMS LL++P+VL K + EIDN +G   L+ E D+ KLPYL
Sbjct  119  GIILVMILAGTDTSAGTLEWAMSNLLNHPDVLQKAKTEIDNQIGLDSLIEEQDIVKLPYL  178

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I++ETLRLYP AP+LLPH + EDCV+ GYDVP+ T ++VNAWA+H DPK+WEEP KFK
Sbjct  179  QNIVSETLRLYPVAPMLLPHLASEDCVLDGYDVPRGTIILVNAWAIHRDPKLWEEPGKFK  238

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E +G + K + FG GRRACP + +  RLV+LALG+ IQ F+W+   E+ +
Sbjct  239  PERF------EKKGEDKKLMAFGIGRRACPGSGLAQRLVTLALGSLIQSFEWERVGEEHL  292

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                    + ++K + L+A+C  R
Sbjct  293  DMRESEKGTTMRKAKSLQAMCRAR  316



>ref|XP_002285061.2| PREDICTED: cytochrome P450 81E8-like [Vitis vinifera]
Length=510

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 146/214 (68%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++  +  AGT+T++VT+EWAMSLLL++P VL K++ E+D  +GH+ L+ E DLS LPYL
Sbjct  303  GMILTLLTAGTDTSAVTMEWAMSLLLNHPTVLDKVKTELDCKIGHQRLVEEPDLSDLPYL  362

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            R I+NETLRL+P APLL+ H S +DC + GYDV   T ++VNAWA+H D KVWE+P  F+
Sbjct  363  RAIVNETLRLFPAAPLLVAHESSDDCSIGGYDVRGGTMLLVNAWAIHRDAKVWEDPTSFR  422

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E GEG   +F+PFG GRR CP   +  R++ LAL A +QCF+W+   E ++
Sbjct  423  PERF-----EGGEGEACRFIPFGLGRRGCPGAGLANRVMGLALAALVQCFEWQRVGEVEV  477

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              +     + + K + LEA+C  R + ++ LS+L
Sbjct  478  DMSEGKGLT-MPKAQPLEAMCRARNSMIKVLSEL  510



>ref|XP_010491736.1| PREDICTED: isoflavone 2'-hydroxylase-like [Camelina sativa]
Length=500

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 150/214 (70%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             IV ++F AG++T+ VT+EWAMSLLL++P  L K+R EI +NV HK L+ +SDLS LPYL
Sbjct  291  GIVVLMFNAGSDTSPVTMEWAMSLLLNHPYQLQKVREEIKSNVKHKGLIQDSDLSSLPYL  350

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC+I ETLRLYP APLL PH S +   +  Y++P++T ++VNAWA+H D ++WEE + FK
Sbjct  351  RCVIYETLRLYPAAPLLPPHCSSKKFKLGNYEIPENTVLLVNAWAVHRDSELWEEADVFK  410

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE  VG+  +GF  +F+PFG GRRACPA  + +RLVSL +GA +QCF+WK  + + I
Sbjct  411  PERFEGFVGDR-DGF--RFLPFGVGRRACPAAGLAMRLVSLVVGALVQCFEWKKVENEDI  467

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                  S + + + E L A+  P    +  LSQL
Sbjct  468  DMRPAFSVA-MSRAEPLAALPKPWPEMVPILSQL  500



>gb|KHN12964.1| Cytochrome P450 81D1 [Glycine soja]
Length=343

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 139/210 (66%), Gaps = 6/210 (3%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + +  ++  ++VAGTET++V +EWAMS LL+ PEVL K R E+D  VG   L+ E+D+
Sbjct  133  TDQTIKGLIMALYVAGTETSAVALEWAMSNLLNSPEVLEKARVELDTQVGQDRLIEEADV  192

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            +KL YL+ II+ETLRL+PP  +LLPH S EDC V  YDVP++T +MVNAWA+H DPK+W 
Sbjct  193  TKLQYLQNIISETLRLHPPLSMLLPHLSSEDCTVGSYDVPRNTMLMVNAWAIHRDPKIWA  252

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
            +P  FKPERF     E G    +K + FG GRRACP   M  R + L LG+ IQCF+WK 
Sbjct  253  DPTSFKPERF-----ENGPVDAHKLISFGLGRRACPGAGMAQRTLGLTLGSLIQCFEWKR  307

Query  666  TKEDKILCATYLSPSILQKDERLEAICTPR  755
              E+K+   T    +I+ K   L+A C  R
Sbjct  308  IGEEKV-DMTEGGGTIVPKAIPLDAQCKAR  336



>gb|ACG29835.1| cytochrome P450 CYP81A1 [Zea mays]
Length=520

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 146/214 (68%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            A+V  +  AGTETTS T+EWAMSLLL++P+VL + + EI++NVG   LL+++DL +LPYL
Sbjct  313  ALVSNLLAAGTETTSTTLEWAMSLLLNHPDVLKRAQEEIESNVGRDRLLDKNDLPRLPYL  372

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CII+ETLRLYPP P+LLPH +  DC + GYDVP  + V+VNA+A+H DP +WE+PE+F+
Sbjct  373  HCIISETLRLYPPTPMLLPHEASTDCKIHGYDVPAGSMVLVNAYAIHRDPAMWEDPEEFR  432

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E G       +PFG GRR CP  N+ +R + L LGA +QCFDW    + ++
Sbjct  433  PERF-----ELGRAEGKFMMPFGMGRRRCPGENLAMRTMGLVLGALLQCFDWTRVGDREV  487

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              AT  + +I+ K   LEA C PR N    L ++
Sbjct  488  DMATA-TGTIMSKAVPLEAQCKPRANMSAVLQKI  520



>emb|CDY44041.1| BnaA08g15650D [Brassica napus]
Length=496

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 143/199 (72%), Gaps = 4/199 (2%)
 Frame = +3

Query  159  VFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIIN  338
            + +AGT+T++VT+EWAM+ LL++PE L K + EID  +G + L++E DL KLPYL+ I++
Sbjct  292  MMIAGTDTSAVTLEWAMACLLNHPESLEKAKQEIDEKIGQERLIDEPDLEKLPYLQNIVS  351

Query  339  ETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfe  518
            ET RLYP APLL+P  + +D  V GYDVP+ T VMVNAWA+H DP +W EPEKFKPERF 
Sbjct  352  ETFRLYPAAPLLVPRSTTDDIKVGGYDVPRGTMVMVNAWAIHRDPSLWNEPEKFKPERFN  411

Query  519  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  698
              +GE GE   +K +PFG GRRACP   +G R+V+LALG+ IQCFDW+   ++KI   T 
Sbjct  412  --IGEGGEDV-HKLMPFGNGRRACPGTGLGQRIVTLALGSLIQCFDWEKVNDEKI-DMTE  467

Query  699  LSPSILQKDERLEAICTPR  755
                 ++K E L A+C+ R
Sbjct  468  TPGMAMRKKEPLWALCSSR  486



>ref|XP_002279038.1| PREDICTED: isoflavone 2'-hydroxylase [Vitis vinifera]
Length=502

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 142/212 (67%), Gaps = 20/212 (9%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +V ++ + GT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YL
Sbjct  298  GLVLVLILGGTDTSAATMEWAMTLLLNHPDVLEKAKVELDMHVGKDRLIEESDLPKLRYL  357

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ET+R +P  PLL+PH S +DC + G+D+P+ T ++VNAWA+H DP+VWE+P  FK
Sbjct  358  QSIISETMRAFPVGPLLVPHMSSDDCQIGGFDIPRGTLLLVNAWALHRDPQVWEDPTSFK  417

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK-------  662
            PERF     E GE  +YK VPFG GRRACP   +  R+V LALG+ IQC+DWK       
Sbjct  418  PERF-----ENGEREDYKLVPFGIGRRACPGAGLAQRVVGLALGSLIQCYDWKKISNTAI  472

Query  663  NTKEDKILCATYLSPSILQKDERLEAICTPRK  758
            +T E K L    L P        LEA+C  R+
Sbjct  473  DTTEGKGLSMPKLEP--------LEAMCKARE  496



>ref|XP_009109368.1| PREDICTED: cytochrome P450 81F1-like [Brassica rapa]
Length=496

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 143/199 (72%), Gaps = 4/199 (2%)
 Frame = +3

Query  159  VFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIIN  338
            + +AGT+T++VT+EWAM+ LL++PE L K + EID  +G + L++E DL KLPYL+ I++
Sbjct  292  MMIAGTDTSAVTLEWAMACLLNHPESLEKAKQEIDEKIGQERLIDEPDLEKLPYLQNIVS  351

Query  339  ETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfe  518
            ET RLYP APLL+P  + +D  V GYDVP+ T VMVNAWA+H DP +W EPEKFKPERF 
Sbjct  352  ETFRLYPAAPLLVPRSTTDDIKVGGYDVPRGTMVMVNAWAIHRDPSLWNEPEKFKPERFN  411

Query  519  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  698
              +GE GE   +K +PFG GRRACP   +G R+V+LALG+ IQCFDW+   ++KI   T 
Sbjct  412  --IGEGGEDV-HKLMPFGNGRRACPGTGLGQRIVTLALGSLIQCFDWEKVNDEKI-DMTE  467

Query  699  LSPSILQKDERLEAICTPR  755
                 ++K E L A+C+ R
Sbjct  468  TPGMAMRKKEPLWALCSSR  486



>ref|XP_010936572.1| PREDICTED: cytochrome P450 81D1-like [Elaeis guineensis]
Length=266

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 137/212 (65%), Gaps = 6/212 (3%)
 Frame = +3

Query  150  VQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRC  329
            ++ +FVAGT+T++ T EWAMSLLL+ PE L K R EID  V  K LL E+DL KLPYL  
Sbjct  61   LKTLFVAGTDTSTETTEWAMSLLLNNPEALQKARLEIDACVKEKRLLEENDLPKLPYLNG  120

Query  330  IINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkpe  509
            IINETLRL   APLLLPH S EDCVV GYD+P+ T ++VNA A+H DP VW EP KF PE
Sbjct  121  IINETLRLCSAAPLLLPHESHEDCVVGGYDIPRGTILLVNARAIHRDPNVWVEPTKFMPE  180

Query  510  rfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILC  689
            RF  + G E  G     +PFG GRR CP   + +R++ LALG  IQCF+WK     ++  
Sbjct  181  RF--LDGREEGGMA---LPFGMGRRKCPGEGLAMRVIGLALGTMIQCFEWKWVGGGEVDM  235

Query  690  ATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                S   L K   LEA+C PR+   + L +L
Sbjct  236  REG-SAVTLPKVVPLEAMCRPRERMKEVLVRL  266



>ref|XP_006472256.1| PREDICTED: isoflavone 2'-hydroxylase-like [Citrus sinensis]
Length=507

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 154/235 (66%), Gaps = 17/235 (7%)
 Frame = +3

Query  81   WQNHYIRGTSNGINSTLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEI  260
            + +H IRG              ++Q++  AG++T++ T+EWA+S LL+ PE+L + + EI
Sbjct  290  YTDHIIRG--------------MMQVLLGAGSDTSAATMEWALSSLLNNPEILVQAQSEI  335

Query  261  DNNVGHKHLLNESDLSKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTV  440
            D NVG   L+ ESDL+ LPYL  +I ETLR+YP APLL+PH S E+C + G+ VP+ T +
Sbjct  336  DTNVGQSRLIEESDLTALPYLHGVIKETLRMYPAAPLLVPHESSEECTIGGFKVPRGTML  395

Query  441  MVNAWAMHHDPKVWeepekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLV  620
            +VN+WA+ +DP++WEEP KFKPERF  + G+  +   Y  +PFGTGRR CP   + +RLV
Sbjct  396  LVNSWAIQNDPRIWEEPSKFKPERFREMAGKSDK---YMLLPFGTGRRVCPGEGLAMRLV  452

Query  621  SLALGAYIQCFDWKNTKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
             LALG+ +QCF+W  T  D+++  +  +   + + + L A+C PR   +  LSQL
Sbjct  453  GLALGSLVQCFEWVRTGGDELVDMSEGTGLTMPRSQPLLAMCRPRPAMVTLLSQL  507



>gb|KFK25349.1| hypothetical protein AALP_AA8G101100 [Arabis alpina]
Length=494

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 152/214 (71%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             IV ++F AGT+T+++T+EWAMS+LL++P+ L K+R EI  NV H  ++ +SDLS+LPYL
Sbjct  285  GIVVLMFNAGTDTSALTMEWAMSVLLNHPDKLEKVREEIKANVKHNGIVQDSDLSRLPYL  344

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC+I ETLRLYP APLLLPHYS +   +  Y++P++T ++VNAWA+H D + WE+ + FK
Sbjct  345  RCVIYETLRLYPVAPLLLPHYSSKRFSLGNYEIPENTMLLVNAWAVHRDGEFWEDADVFK  404

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE  VG+  +GF  +F+PFG GRRACPA  +G+R+V+LA+GA +QCF+W+  +E  I
Sbjct  405  PERFEGFVGDR-DGF--RFLPFGVGRRACPAAGLGMRVVALAVGALVQCFEWEKVEEGDI  461

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                      + K E L A+  P    +  LSQL
Sbjct  462  DMRPLFGVG-MSKAEPLVALPKPWPEMVPILSQL  494



>emb|CAN72520.1| hypothetical protein VITISV_040350 [Vitis vinifera]
Length=502

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 142/212 (67%), Gaps = 20/212 (9%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +V ++ + GT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YL
Sbjct  298  GLVLVLILGGTDTSAATMEWAMTLLLNHPDVLEKAKVELDMHVGKDRLIEESDLPKLRYL  357

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ET+R +P  PLL+PH S +DC + G+D+P+ T ++VNAWA+H DP+VWE+P  FK
Sbjct  358  QSIISETMRAFPVGPLLVPHMSSDDCQIGGFDIPRGTLLLVNAWALHRDPQVWEDPTSFK  417

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK-------  662
            PERF     E GE  +YK VPFG GRRACP   +  R+V LALG+ IQC+DWK       
Sbjct  418  PERF-----ENGEREDYKLVPFGIGRRACPGAGLAQRVVGLALGSLIQCYDWKKISNTAI  472

Query  663  NTKEDKILCATYLSPSILQKDERLEAICTPRK  758
            +T E K L    L P        LEA+C  R+
Sbjct  473  DTTEGKGLSMPKLEP--------LEAMCKARE  496



>ref|XP_010647303.1| PREDICTED: cytochrome P450 81E8-like [Vitis vinifera]
Length=365

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 141/203 (69%), Gaps = 6/203 (3%)
 Frame = +3

Query  138  MYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLP  317
            +  +V ++ +AGT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL 
Sbjct  152  IKGLVLVLILAGTDTSAATVEWAMTLLLNHPDVLKKAKAELDIHVGKDRLIEESDLPKLR  211

Query  318  YLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepek  497
            YL+ II+ETLRL+P APLL+PH S +DC + G+D+P  T +++NAWA+H DP+VWE+P  
Sbjct  212  YLQSIISETLRLFPVAPLLVPHMSSDDCQIGGFDIPGGTFLLINAWAIHRDPQVWEDPTS  271

Query  498  fkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  677
            F PERF     E G+  NYK +PFG GRRACP   +  R+V LALG+ IQC+DWK   E 
Sbjct  272  FIPERF-----ENGQRENYKLLPFGIGRRACPGAGLAHRVVGLALGSLIQCYDWKRISET  326

Query  678  KILCATYLSPSILQKDERLEAIC  746
             I   T      + K E LEA+C
Sbjct  327  TI-DTTEGKGLTMPKLEPLEAMC  348



>ref|XP_008780931.1| PREDICTED: isoflavone 2'-hydroxylase-like [Phoenix dactylifera]
Length=505

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 145/222 (65%), Gaps = 6/222 (3%)
 Frame = +3

Query  120  NSTLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNES  299
            N T + +  ++  +F+AGT+T+S TIEWAMSLLL+ PE L K + EID  VG++ LL ES
Sbjct  290  NYTDQTIKGLITSLFLAGTDTSSSTIEWAMSLLLNNPEKLQKAQAEIDERVGNERLLEES  349

Query  300  DLSKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKV  479
            D+S LPYL CII ETLR+ P  PLLLPH S  +CVV G++VP+ T ++VNA  +H DPKV
Sbjct  350  DVSNLPYLHCIIRETLRICPAGPLLLPHESTNECVVGGFNVPRGTMLLVNAHYIHRDPKV  409

Query  480  WeepekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDW  659
            W+EP KFKPERF     E+GE      +PFG GRR CP   + +R V L LG  IQCF+W
Sbjct  410  WQEPTKFKPERF-----EDGEDEGKLMIPFGMGRRRCPGEGLAMREVGLTLGTLIQCFEW  464

Query  660  KNTKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            K   E+++   T  S   + K   LE +  PR+  ++ LS L
Sbjct  465  KRVGEEQV-DMTEGSGLTMPKAVPLEGMYRPRRAMVRVLSGL  505



>ref|XP_006425998.1| hypothetical protein CICLE_v10025370mg [Citrus clementina]
 gb|ESR39238.1| hypothetical protein CICLE_v10025370mg [Citrus clementina]
Length=518

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 144/211 (68%), Gaps = 7/211 (3%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + +  + + + +AGT+TT+VT+EWAMS L+++P+VL K R E+D +VG +HL +E DL
Sbjct  303  TDQTIKGLAKTMLLAGTDTTAVTMEWAMSNLVNHPDVLQKARAELDTHVGQQHLFDEPDL  362

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            SKL YL CII+ETLRLYP APLL+PH S +DCVV G+DVP+ TT++VN WA+H DP +W+
Sbjct  363  SKLKYLHCIISETLRLYPTAPLLVPHRSSDDCVVGGFDVPRDTTLLVNVWAIHRDPGLWD  422

Query  486  epekfkperfeAIVGEEGEGFNYKF-VPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK  662
            EP KF+P RF     E GE    K  +PFG GRR+CP   +  RLV L LG+ IQCF+W+
Sbjct  423  EPTKFEPARF-----ENGESEARKLMMPFGLGRRSCPGMGLAQRLVGLTLGSLIQCFEWE  477

Query  663  NTKEDKILCATYLSPSILQKDERLEAICTPR  755
                 KI   T      + K E LE +C PR
Sbjct  478  RIGCQKI-DMTEGKGITMPKAEALEVLCKPR  507



>ref|XP_009372456.1| PREDICTED: cytochrome P450 81D11-like [Pyrus x bretschneideri]
Length=499

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 143/204 (70%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++ +AGT+T++VT+EWAMS LL++P VL K R E+D  +G +HL+ E D+SKLPYL
Sbjct  293  GLILVMLLAGTDTSAVTLEWAMSNLLNHPRVLKKARSELDAQLGQEHLMEEPDISKLPYL  352

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I++ET RL P APLL+PH S EDC + G+DVP+ T V++NAWA+H DPK+W++PE FK
Sbjct  353  QSIVSETFRLCPAAPLLVPHLSSEDCTIEGFDVPRGTIVLINAWAIHRDPKLWDDPESFK  412

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E GE  ++K + FG+GRRACP   +  R+V L LG+ IQCF+W+   E+++
Sbjct  413  PERF-----ESGEDMSHKLITFGSGRRACPGAGLAQRVVGLTLGSLIQCFEWERVGEEEV  467

Query  684  LCATYLSPSILQKDERLEAICTPR  755
               T      + K   LEA+C  R
Sbjct  468  -DMTEGKGLTMPKAVPLEAMCKTR  490



>ref|XP_006395346.1| hypothetical protein EUTSA_v10004055mg [Eutrema salsugineum]
 gb|ESQ32632.1| hypothetical protein EUTSA_v10004055mg [Eutrema salsugineum]
Length=501

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 144/204 (71%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT+T++ T+EWA+S LL++PEVL K R EID  +G   L+ E D++KLPYL
Sbjct  291  GIILVMILAGTDTSAGTLEWALSNLLNHPEVLKKARSEIDEQIGLDRLIEEQDIAKLPYL  350

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            R I++ETLRLYP AP+LLPH + EDC+VAGYDVP+ T ++VNAWA+H DP  WEEPEKFK
Sbjct  351  RSIMSETLRLYPVAPMLLPHLASEDCMVAGYDVPRGTIILVNAWAIHRDPNTWEEPEKFK  410

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      + EG + K + FG GRRACP + +  RLV+LALG+ +QCF+W+   E+  
Sbjct  411  PERF------DKEGEDKKLMSFGIGRRACPGSGLAQRLVALALGSLVQCFEWERAGEEHA  464

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                    + ++K   L+A+C  R
Sbjct  465  DMRESEKGTTMRKATSLQAMCRAR  488



>ref|XP_002524941.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF37438.1| cytochrome P450, putative [Ricinus communis]
Length=503

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 145/213 (68%), Gaps = 5/213 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +I+  +  AGT+T++VT+EWAM+ LL++P  L K + EID+ VG   LL+E DLS+LPYL
Sbjct  294  SIMINLLFAGTDTSAVTLEWAMTNLLNHPSTLMKAKDEIDSQVGRDSLLDEPDLSRLPYL  353

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            R I+ ETLRLYP APLL+PH S EDC + GY VP+ T V+VNAWA+H DP +W+EP  FK
Sbjct  354  RNIVLETLRLYPVAPLLIPHVSSEDCTIGGYKVPRDTMVLVNAWAIHRDPTLWDEPLSFK  413

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF+   GEE E F  K +PFG GRR+CP   +  R++SL LG+ IQCF+WK   ED++
Sbjct  414  PERFDN--GEESESF--KLLPFGLGRRSCPGAGLAHRVISLTLGSLIQCFEWKRVSEDEV  469

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQ  782
                    + L K E LEA+C       + LSQ
Sbjct  470  DVKEGRGLT-LPKAEPLEALCRSHPIMNKILSQ  501



>ref|XP_007206766.1| hypothetical protein PRUPE_ppa025296mg [Prunus persica]
 gb|EMJ07965.1| hypothetical protein PRUPE_ppa025296mg [Prunus persica]
Length=496

 Score =   174 bits (440),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 147/213 (69%), Gaps = 6/213 (3%)
 Frame = +3

Query  120  NSTLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNES  299
            N + + +  ++ ++ +AGT+T++VT+EWAMS LL++P+VL + R E+D  VG + L+ E 
Sbjct  285  NYSDQTIKGLILVMLLAGTDTSAVTLEWAMSNLLNHPDVLKRARAELDAQVGQERLVEEH  344

Query  300  DLSKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKV  479
            D+SKLPYL+ II+ETLRLYP AP+LL H+S +DC + G+DVP+ T V+VNAWA+H DPK+
Sbjct  345  DISKLPYLQSIISETLRLYPAAPMLLSHFSSDDCTIGGFDVPRGTMVLVNAWAIHRDPKL  404

Query  480  WeepekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDW  659
            W++PE F PERF +     GE  +++ +PFG GRR+CP + +  R V L LG+ IQCFDW
Sbjct  405  WDDPESFIPERFRS-----GEDLSHQLMPFGLGRRSCPGSGLAQRTVGLTLGSLIQCFDW  459

Query  660  KNTKEDKILCATYLSPSILQKDERLEAICTPRK  758
                E +I  A     + + K   LE +C  R+
Sbjct  460  MRVSEKEIDMAEGKGLT-MPKLVPLEVMCKARR  491



>ref|XP_010446676.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
 ref|XP_010446677.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
Length=495

 Score =   174 bits (440),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 141/204 (69%), Gaps = 7/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+  + VAGTET+ VT+EWAMS LL++PE+L K+R EID+ +G   L+ ESD+  LPYL
Sbjct  292  GIILALVVAGTETSEVTLEWAMSNLLNHPEILEKVRAEIDDKIGSDRLIEESDIVNLPYL  351

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            +  ++ETLRLYP  PLLLPH+S ++C VAGYD+P+ T ++ N WAMH DP +WEEPE+FK
Sbjct  352  QNTVSETLRLYPAVPLLLPHFSSDECKVAGYDMPRGTLLLTNVWAMHRDPDLWEEPERFK  411

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG   K +PFG GRRACP   +G RLV+LALG+ IQCF+W+   E+ +
Sbjct  412  PERF------EKEGEAQKLIPFGMGRRACPGAELGKRLVTLALGSLIQCFEWERVGEE-L  464

Query  684  LCATYLSPSILQKDERLEAICTPR  755
            L  T      + K   L A+C  R
Sbjct  465  LDMTEAEGITMPKATPLRAMCKTR  488



>ref|XP_010059864.1| PREDICTED: isoflavone 2'-hydroxylase-like [Eucalyptus grandis]
 gb|KCW66313.1| hypothetical protein EUGRSUZ_F00139 [Eucalyptus grandis]
Length=504

 Score =   174 bits (440),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 142/213 (67%), Gaps = 4/213 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++  AGT+T++ TIEWAMS +L++PE+L K + EID  VGH  L+ ESDL KL YL
Sbjct  295  SLMLVLLSAGTDTSAATIEWAMSAMLNHPEILKKAQAEIDEVVGHNRLITESDLPKLLYL  354

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             C++NET+R+YP  PLL+PH S E+C V GY VP+ T +++N +++ +DPK W +  KFK
Sbjct  355  HCVMNETMRMYPVGPLLVPHESAEECCVGGYRVPQGTMLLINLFSIQNDPKYWPDAAKFK  414

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PER     G EG    YK +PFG+GRR CP  N+ LR+V L LG+ IQCF+W N   D++
Sbjct  415  PER---FQGMEGVRDGYKMMPFGSGRRGCPGENLALRMVGLTLGSLIQCFEW-NRISDEL  470

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQ  782
            +  T  +   + K + L A C PR   L  LSQ
Sbjct  471  IDMTEGTGLTMPKAQPLLAKCRPRSFTLDLLSQ  503



>gb|KDP32017.1| hypothetical protein JCGZ_12478 [Jatropha curcas]
Length=506

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 144/204 (71%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++ +AGT+T+SVT+EWAMS L+++P+ L+K + E+D  +G +HLL ESDLSKLPYL
Sbjct  298  GLIMIMLLAGTDTSSVTLEWAMSNLVNHPDTLNKAKIELDAIIGQEHLLEESDLSKLPYL  357

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
              II+ETLRLYP APLL+PH++ +DC + GY+VP+ T V+VNAWA+H D  VW++P  FK
Sbjct  358  HNIISETLRLYPSAPLLVPHFTSDDCTIGGYNVPRGTIVLVNAWAIHRDSSVWDDPISFK  417

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E+G+   YK++PFG GRRACP   M  R+V L LG+ IQCF+W+   E  +
Sbjct  418  PERF-----EQGQTEAYKYLPFGLGRRACPGATMAQRVVGLTLGSLIQCFEWRRIDEKLV  472

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                 +  S + K E L+ +C  R
Sbjct  473  DMTEGIGIS-MPKAEPLKVMCKSR  495



>ref|XP_010692651.1| PREDICTED: cytochrome P450 81D1-like [Beta vulgaris subsp. vulgaris]
Length=391

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 144/212 (68%), Gaps = 4/212 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +V+ + +AGTET+S T+EWA++LLL+ PEVL+K + EID +     L+ ESDL  LPYL
Sbjct  184  GLVETLLLAGTETSSTTMEWALALLLNNPEVLNKAQKEIDQHTRSDRLIEESDLVHLPYL  243

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CIINETLR+YP AP+L P  S  DCVV GY VP+ T + +N WAM +DP +W+ P KF 
Sbjct  244  HCIINETLRMYPAAPILPPRESSSDCVVGGYHVPQGTMLTLNIWAMQNDPNIWDNPSKFC  303

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE I   +GE   Y+F+PFG+GRRACP  N+ +R++ L LG+ IQCF+W+   ++++
Sbjct  304  PERFENI---KGERIGYQFIPFGSGRRACPGENLAMRIIGLTLGSLIQCFEWEKLGKEEV  360

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLS  779
                 +  + + K   L+A C  R + ++ L+
Sbjct  361  DMKETVGVT-MWKSSPLQAKCRRRSSMIKLLA  391



>ref|XP_011099320.1| PREDICTED: cytochrome P450 81D1-like [Sesamum indicum]
Length=502

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 138/206 (67%), Gaps = 6/206 (3%)
 Frame = +3

Query  165  VAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIINET  344
            +AGT+T++VTIEWAMSLLL++PEVL K + EID+ VGH+ L+ E DL  LPYL  II ET
Sbjct  297  IAGTDTSAVTIEWAMSLLLNHPEVLQKAKLEIDSRVGHQRLVEEQDLPNLPYLHSIIFET  356

Query  345  lrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfeAI  524
             RL+P  PL++P  S  DC V GYD+P  T ++VNAWA+H DPKVW +P  FKPER    
Sbjct  357  FRLFPAGPLVVPRESSADCRVGGYDIPCGTMLLVNAWAIHRDPKVWPQPTSFKPERL---  413

Query  525  VGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLS  704
              +  E   +K +PFG GRRACP   +G R+V LAL ++IQCF+W+    +++     + 
Sbjct  414  --DRREVETHKLMPFGLGRRACPGAGLGQRMVGLALASFIQCFEWERVSSEEVDLTEGVG  471

Query  705  PSILQKDERLEAICTPRKNCLQFLSQ  782
             + + K + LEA C PR+  L+ L +
Sbjct  472  LT-MPKLKPLEAKCRPRQIMLKVLQE  496



>ref|XP_002510130.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52317.1| cytochrome P450, putative [Ricinus communis]
Length=500

 Score =   174 bits (440),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 147/220 (67%), Gaps = 4/220 (2%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + + +++ ++  AGT+T++ T+EWAMSLL++ PE L K + EID+ +GH  L+NESD 
Sbjct  285  TDETIKSLMLVLLAAGTDTSAATMEWAMSLLVNNPEALKKAQTEIDSVIGHDRLINESDT  344

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            SKLPYL CIINE +R+YP  PLL+PH S E+C + GY VP  T ++VN W++ +DP+VWE
Sbjct  345  SKLPYLNCIINEVMRMYPAGPLLVPHESSEECFIGGYRVPAGTMLLVNLWSIQNDPRVWE  404

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
            EP  FKPER     G EG    ++ +PFG+GRR+CP   + LR+V L +G  +QCFDW+ 
Sbjct  405  EPRNFKPER---FEGCEGVRDGFRLMPFGSGRRSCPGEGLALRMVGLGIGTLLQCFDWER  461

Query  666  TKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              ++ I     +  + + K + L   C+PR + +  LSQL
Sbjct  462  VGKEMIDMTEGVGLT-MPKAQPLVVQCSPRPSMVNLLSQL  500



>emb|CDY04030.1| BnaC02g37450D [Brassica napus]
Length=502

 Score =   174 bits (440),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 142/204 (70%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I++++ +AGT+T++ T+EWAMS LL++PEVL K + EID  +G   L+ E D+ KLPYL
Sbjct  291  GIIEVMILAGTDTSAATLEWAMSNLLNHPEVLKKAKTEIDEQIGLDRLIEEQDIVKLPYL  350

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I++ETLRLYP  P+LLPH + +DC+VA YDVP+ T ++VN WA+H DPK+WEEPEKFK
Sbjct  351  QSIVSETLRLYPVVPMLLPHMASKDCMVADYDVPRKTILLVNVWAIHRDPKMWEEPEKFK  410

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG + K + FG GRRACP   +G RLV+LALG  +QCF+W+ T E+ +
Sbjct  411  PERF------EKEGEDKKLMSFGMGRRACPGLGLGQRLVTLALGLLVQCFEWERTGEEYV  464

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                      + K   LEA+C  R
Sbjct  465  DMTEAAKGITMHKSTSLEAMCRAR  488



>gb|KDP32013.1| hypothetical protein JCGZ_12474 [Jatropha curcas]
Length=505

 Score =   174 bits (440),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 149/214 (70%), Gaps = 11/214 (5%)
 Frame = +3

Query  147  IVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLR  326
            ++ M+F AGT+T++VT+EWAMS LL++P +L+K R EI+  +G   LL+ESD SKLPYL+
Sbjct  299  LLNMIF-AGTDTSAVTLEWAMSNLLNHPSILNKARDEIETQIGEDCLLDESDFSKLPYLK  357

Query  327  CIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkp  506
             II+E+LRLYP APLL PH S +DC + GY+VP+ T ++VNAWA+H DP +W++P  FKP
Sbjct  358  NIISESLRLYPAAPLLAPHMSSDDCTIGGYNVPRGTMLLVNAWAIHRDPTLWDDPLSFKP  417

Query  507  erfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI-  683
            ERF     + GEG ++K +PFG GRR+CP   +  R+V LALG  IQCF+WK   E+++ 
Sbjct  418  ERF-----DNGEGESFKLMPFGLGRRSCPGAGLANRVVGLALGTLIQCFEWKRVTEEEVD  472

Query  684  -LCATYLSPSILQKDERLEAICTPRKNCLQFLSQ  782
             +    L+  I    E LEA+C  R    Q LSQ
Sbjct  473  MVEGRGLTMPIA---EPLEAMCKARPIMKQTLSQ  503



>emb|CDP01236.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   174 bits (440),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 147/213 (69%), Gaps = 4/213 (2%)
 Frame = +3

Query  147  IVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLR  326
            ++ ++  AG++TT+ T+EWAM+ LL  PEVL K + EID  VGH   + E DL +LPYL 
Sbjct  295  LMLVLLQAGSDTTASTMEWAMAYLLDNPEVLKKAQAEIDQEVGHGRFIGECDLPQLPYLH  354

Query  327  CIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkp  506
            CIINETLRL P  PLL+PH + +DC+V GY VP+ T + VNAW + H+ + W++P+KF P
Sbjct  355  CIINETLRLQPVTPLLMPHKASQDCIVGGYRVPRGTVLFVNAWDIQHNSRYWDDPDKFMP  414

Query  507  erfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKIL  686
            +RFEA+VG + E   +KF+PFG+GRR CP NN+ + ++ LALG+ +Q F+W+ TK+ K +
Sbjct  415  QRFEALVGGKEE---FKFIPFGSGRRGCPGNNLAIHVLGLALGSLLQSFNWE-TKDGKKM  470

Query  687  CATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              +      + + + L A C PR N L+ LSQ+
Sbjct  471  DMSEGIGVPVHRVQPLVAKCCPRPNMLKLLSQI  503



>ref|XP_004290938.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=543

 Score =   174 bits (441),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 142/204 (70%), Gaps = 3/204 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             IV ++ VAGTET S T+EWAM+LLL++P+ ++K+R EID  VG   L+NE DL KL YL
Sbjct  336  GIVGVLLVAGTETASTTMEWAMALLLNHPDKMNKVRTEIDAKVGEHRLMNEQDLPKLNYL  395

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + +I E LR+YPP PLL+P  + EDCVV G+DVP+ T +M+NAWA+H DP+ WE+P +FK
Sbjct  396  QNVITEALRVYPPVPLLVPREASEDCVVGGFDVPRGTMLMINAWAIHRDPEFWEDPTEFK  455

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE   GE GE   YK VPFG GRR CP + +  R ++LA+G  +Q F+W+   E+K+
Sbjct  456  PERFEGWSGEGGEA--YKIVPFGAGRRGCPGDVLAKRFIALAIGTLVQSFEWERISEEKV  513

Query  684  LCATYLSPSILQKDERLEAICTPR  755
              +  L  S + +   L+A C PR
Sbjct  514  DMSEGLGIS-MPRIHPLDAFCKPR  536



>emb|CDY04029.1| BnaC02g37440D [Brassica napus]
Length=500

 Score =   173 bits (439),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 140/204 (69%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT+T+  T+EWAM+ LL++PEV  K R EI+  +G   L+ E D+ KLPYL
Sbjct  291  GIILVMIIAGTDTSGGTLEWAMANLLNHPEVSKKARTEIEEQIGSDRLIEEQDIVKLPYL  350

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I++ETLRLYP  P+LLPH + EDC+VAGYDVP+ T VMVNAWA H DP  WEEPEKFK
Sbjct  351  QNIMSETLRLYPVVPMLLPHMASEDCIVAGYDVPRGTMVMVNAWAFHRDPNTWEEPEKFK  410

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG + K + FG GRRACP + +  RLV+LALG+ +QCFDW+   E  +
Sbjct  411  PERF------EKEGEDKKMLTFGMGRRACPGSGLAQRLVTLALGSLVQCFDWERADEKYV  464

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                    +I++K   L+A+C  R
Sbjct  465  DMTEAEKGTIMRKATPLKAMCRAR  488



>ref|NP_189516.1| cytochrome P450 CYP81D11 [Arabidopsis thaliana]
 sp|Q9LHA1.1|C8D11_ARATH RecName: Full=Cytochrome P450 81D11 [Arabidopsis thaliana]
 dbj|BAB03171.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAK92784.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAM44917.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE77485.1| cytochrome P450 CYP81D11 [Arabidopsis thaliana]
Length=509

 Score =   173 bits (439),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 147/204 (72%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT+T++ T+EWAMS LL++PEVL K + EID+ +G   L+ E D+ KLPYL
Sbjct  300  GIILVMILAGTDTSAGTLEWAMSNLLNHPEVLRKAKTEIDDQIGVDRLVEEQDIVKLPYL  359

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I++ETLRLYP AP+LLPH + EDC+V GYDVP+ T ++VNAWA+H DPK+WEEPEKFK
Sbjct  360  QHIVSETLRLYPVAPMLLPHLASEDCIVDGYDVPRGTIILVNAWAIHRDPKLWEEPEKFK  419

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E +G + K +PFG GRR+CP + +  RLV+LALG+ +QCF+W+  +E  +
Sbjct  420  PERF------EKKGEDKKLMPFGIGRRSCPGSGLAQRLVTLALGSLVQCFEWERVEEKYL  473

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                    + ++K   L+A+C  R
Sbjct  474  DMRESEKGTTMRKATSLQAMCKAR  497



>ref|XP_008220355.1| PREDICTED: cytochrome P450 81D11-like [Prunus mume]
Length=208

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 136/200 (68%), Gaps = 3/200 (2%)
 Frame = +3

Query  156  MVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCII  335
            +V  AGT+T++ TI WAM+LLL++PE + K+R EI+  VG K  L E D  KL YL+ +I
Sbjct  7    VVLGAGTDTSATTIGWAMALLLNHPEKMQKVRAEIETKVGEKCALEEQDFPKLSYLQNVI  66

Query  336  NETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  515
            NETL LYPP PLLLPH + EDCVV G+DVP+HT + +NAWA+H DP++WE+P +F+PERF
Sbjct  67   NETLLLYPPTPLLLPHEASEDCVVGGFDVPRHTMLFINAWAIHRDPELWEDPTEFRPERF  126

Query  516  eAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  695
            E   G+  EG  YK +  G GRR CP   +  +L+ LALG  IQ FDW+   ED +    
Sbjct  127  EGWSGDGSEG--YKLITLGAGRRGCPGAGLANKLIVLALGNLIQSFDWERIGEDDVDMTE  184

Query  696  YLSPSILQKDERLEAICTPR  755
             L  + + + E LEA+C PR
Sbjct  185  GLGLN-MPRAEPLEAMCKPR  203



>gb|KDP41665.1| hypothetical protein JCGZ_16072 [Jatropha curcas]
Length=508

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 144/210 (69%), Gaps = 4/210 (2%)
 Frame = +3

Query  156  MVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCII  335
            ++ VAGT+T+++T+EWAMSLLL++PE L K R E+D  +G   L++ESD SKLPYL+ II
Sbjct  303  VMIVAGTDTSALTMEWAMSLLLNHPEALKKARAELDKIIGQDRLVDESDYSKLPYLQSII  362

Query  336  NETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  515
            NETLRLYP APLLLPH S  DC+V GY VP+ T ++ NAWA+H DP VW +P KF+PER 
Sbjct  363  NETLRLYPVAPLLLPHESSNDCLVGGYYVPRGTMLLANAWAIHRDPTVWNDPTKFRPER-  421

Query  516  eAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  695
                G + +   YKF+PFG GRR CP   +  R++ LAL A IQCF+W+   E++I  + 
Sbjct  422  --FEGLDKDAHKYKFIPFGLGRRVCPGIPLANRVMGLALAALIQCFEWERPSEEQIDMSE  479

Query  696  YLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                S + K + L+A+C  R++ +  L  L
Sbjct  480  GEGLS-MPKSQPLKAMCRARESTINILRDL  508



>ref|XP_011029079.1| PREDICTED: cytochrome P450 81D1-like [Populus euphratica]
Length=499

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 137/207 (66%), Gaps = 6/207 (3%)
 Frame = +3

Query  168  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIINETl  347
            AGT T+S T+EWA+SLLL+ PEVL K + EID  +GH   ++E+DL+ LPYLR I++ETL
Sbjct  298  AGTHTSSTTMEWALSLLLNNPEVLEKAQREIDEQIGHDRFMDEADLAHLPYLRSILSETL  357

Query  348  rlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWee-pekfkperfeAI  524
            R+YP APLL+PH S E+C+V G+ +P+ T + VNAWA+ +DPK+W +  +          
Sbjct  358  RMYPAAPLLVPHESSEECLVGGFRIPRGTMLFVNAWAIQNDPKIWSDPEKFRPERFDNPE  417

Query  525  VGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLS  704
            V  +G    +K +PFG GRR+CP   M LR++ LALG+ +QCF+W+    DK++  T   
Sbjct  418  VARDG----FKLMPFGYGRRSCPGEAMALRVMGLALGSLLQCFEWQKIG-DKMVDMTEAL  472

Query  705  PSILQKDERLEAICTPRKNCLQFLSQL  785
               + K + LE IC PR   L+ LSQ+
Sbjct  473  GFTVPKAKPLEVICRPRPGMLRHLSQI  499



>ref|XP_006339843.1| PREDICTED: cytochrome P450 81D1-like [Solanum tuberosum]
Length=500

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 137/180 (76%), Gaps = 5/180 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             IV ++  AGTET+SVTIEWAMSLLL++PEVL K R EIDN+VG   L++E+DL KL YL
Sbjct  292  GIVLVMLNAGTETSSVTIEWAMSLLLNHPEVLEKARNEIDNHVGKDRLMDEADLPKLKYL  351

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ETLRL+P APLL+PH S +DC VAG+ +P+ T ++VNAW++H DP +WE+PE FK
Sbjct  352  QSIISETLRLFPAAPLLVPHESSDDCKVAGFHIPRGTMLLVNAWSIHRDPLLWEDPESFK  411

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF+ +  E     ++K +PFG GRRACP + +  R+V LALG  IQCF+WK   E+++
Sbjct  412  PERFDGVEVE-----SWKLLPFGMGRRACPGSGLAQRVVGLALGTMIQCFEWKRVGEEEV  466



>ref|XP_010095334.1| Cytochrome P450 81D1 [Morus notabilis]
 gb|EXB59545.1| Cytochrome P450 81D1 [Morus notabilis]
Length=450

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 138/201 (69%), Gaps = 7/201 (3%)
 Frame = +3

Query  153  QMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCI  332
            +++ +AGT+T+SVT+EWA+S LL++P VL K + E+D  VG +HLL E DLSKL YL+ I
Sbjct  244  RVLLLAGTDTSSVTLEWALSNLLNHPHVLKKAKQELDAQVGEQHLLEEQDLSKLHYLQSI  303

Query  333  INETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  512
            I+ETLRLYP APLLLPHYS +DC + GYDVP+ T V+VNAWA+H DP +W+  E FKPER
Sbjct  304  ISETLRLYPAAPLLLPHYSSDDCTIGGYDVPRDTIVLVNAWAIHRDPNLWDVAESFKPER  363

Query  513  feAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  692
            F     E GEG  +  +PFG GRRACP      R+V L LG+ IQCF+W +T   K +  
Sbjct  364  F-----EMGEGEAHILMPFGIGRRACPGAGFAQRVVGLTLGSLIQCFEWDST--GKKVDM  416

Query  693  TYLSPSILQKDERLEAICTPR  755
            T      + K   LEA+C  R
Sbjct  417  TEGKGLTMPKAVPLEAMCKAR  437



>emb|CAN60309.1| hypothetical protein VITISV_015004 [Vitis vinifera]
Length=990

 Score =   177 bits (449),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 141/205 (69%), Gaps = 6/205 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++  + V G +TT+VTIEWAMSLLL++PEVL K R E+D ++GH  L++E+DL KL YL
Sbjct  779  GLIVAMQVGGADTTAVTIEWAMSLLLNHPEVLKKARDELDTHIGHDCLIDETDLPKLQYL  838

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+E+LRL+P  PLL+PH+S EDC + G+DVP  T ++VNAWA+H DPK+W +P  FK
Sbjct  839  QSIISESLRLFPSTPLLVPHFSTEDCKLGGFDVPGGTMLLVNAWALHRDPKLWNDPTSFK  898

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E GE   YK +PFG GRRACP   +  R++ L LG+ IQCFDWK   E +I
Sbjct  899  PERF-----ETGESETYKLLPFGVGRRACPGIGLANRVMGLTLGSLIQCFDWKRVDEKEI  953

Query  684  LCATYLSPSILQKDERLEAICTPRK  758
                    + + K E LEA+C  R+
Sbjct  954  DMXEGQGLT-MPKVEPLEAMCKTRQ  977


 Score =   160 bits (405),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 142/202 (70%), Gaps = 10/202 (5%)
 Frame = +3

Query  150  VQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRC  329
            + +VF AGT+T +VT+EWAMSLLL++P+VL K + E+D  VG + LL E+DL KL YL+ 
Sbjct  298  MNLVF-AGTDTAAVTMEWAMSLLLNHPDVLKKAKVELDTXVGQERLLEEADLPKLHYLQN  356

Query  330  IINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkpe  509
            II+ET RL PPAPL LPH S  +C + G+D+P+   ++VN+W +H DPK+W++P  FKPE
Sbjct  357  IISETFRLCPPAPLWLPHMSSANCQLGGFDIPRDXMLLVNSWTLHRDPKLWDDPTSFKPE  416

Query  510  rfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI--  683
            RFE   GE GE   YK +PFGTGRRACP + +  ++V L LG+ IQC++W+   E K+  
Sbjct  417  RFEG--GERGE--TYKLLPFGTGRRACPGSGLANKVVGLTLGSLIQCYEWERISEKKVDM  472

Query  684  LCATYLSPSILQKDERLEAICT  749
            +    L+   + K E LEA+C+
Sbjct  473  MEGKGLT---MPKMEPLEAMCS  491



>ref|XP_004292746.1| PREDICTED: isoflavone 2'-hydroxylase-like [Fragaria vesca subsp. 
vesca]
Length=508

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 147/214 (69%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++  AGT+TT+ T+EWA+SLLL+ PE L K + EID  +G   L+ E+DL+KLPYL
Sbjct  299  GLMHVMLSAGTDTTAGTMEWALSLLLNNPEALAKAQNEIDEQIGQSRLVEEADLAKLPYL  358

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CII ETLR+YP APLL PH + EDC V G+ VP+ T ++VNAWA+ +DP++W +PE+FK
Sbjct  359  SCIIYETLRMYPAAPLLPPHEASEDCTVGGFHVPRGTMLLVNAWAIQNDPELWAKPEQFK  418

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF+ + GE  +GF  K++PFGTGRR CP   +  R+V L LG+ IQCF+W+ + E+ +
Sbjct  419  PERFQNVQGER-DGF--KWLPFGTGRRGCPGEGLATRIVGLTLGSLIQCFEWERSGEE-M  474

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +  T  +   + K   L A C PR      LSQL
Sbjct  475  VDMTEGAGLAMPKAHPLLAKCRPRPTMPALLSQL  508



>ref|XP_010936527.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X1 [Elaeis 
guineensis]
Length=528

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 139/214 (65%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            A +  +FVAGT+T++ T EWAMSLLL+ PE LHK R EID  V  K LL E DL KLPYL
Sbjct  321  AFIITLFVAGTDTSTETTEWAMSLLLNNPEALHKARQEIDACVEQKRLLEEYDLPKLPYL  380

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
              IINETLRLYP APLLLPH S EDCV+ GYD+P+ T ++VNAWA+H D  VW EP KF 
Sbjct  381  NGIINETLRLYPAAPLLLPHESHEDCVMGGYDIPRGTILLVNAWAIHRDANVWAEPTKFM  440

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E G       +PFG GRR CP   + +RL+ LALG  IQCF+W+     ++
Sbjct  441  PERFLDGRAEGGMA-----LPFGMGRRKCPGEGLAMRLIGLALGTMIQCFEWERVGGGEV  495

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                  S   L K   LEA+C PR++ ++ L+ L
Sbjct  496  DMREG-SALTLPKFVPLEAMCRPRESMVEVLAWL  528



>ref|XP_010502942.1| PREDICTED: cytochrome P450 81D11-like isoform X1 [Camelina sativa]
Length=391

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 145/204 (71%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT+T++ T+EWAMS LL++P+VL K + EIDN +G   L+ E D+ KLPYL
Sbjct  183  GIILVMILAGTDTSAGTLEWAMSNLLNHPDVLQKAKTEIDNQIGLDSLIEEQDIVKLPYL  242

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I++ETLRLYP AP+LLPH + EDCV+ GYDVP+ T ++VNAWA+H DPK+WEEP KFK
Sbjct  243  QNIVSETLRLYPVAPMLLPHLASEDCVLDGYDVPRGTIILVNAWAIHRDPKLWEEPGKFK  302

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E +G + K + FG GRRACP + +  RLV+LALG+ IQ F+W+   E+ +
Sbjct  303  PERF------EKKGEDKKLMAFGIGRRACPGSGLAQRLVTLALGSLIQSFEWERVGEEHL  356

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                    + ++K + L+A+C  R
Sbjct  357  DMRESEKGTTMRKAKSLQAMCRAR  380



>ref|XP_006466537.1| PREDICTED: isoflavone 2'-hydroxylase-like [Citrus sinensis]
Length=511

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 137/186 (74%), Gaps = 5/186 (3%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + + A++  + +AG +T+++T+EWAM+ L+++PEVL   R E++  VG + L++ESDL
Sbjct  290  TDQNIKALMLTLIIAGIDTSAITLEWAMANLVNHPEVLKNARAELNAQVGQECLIDESDL  349

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            SKLPYLR I++ETLRL P APLL+PH S +DC V GYDVP+ TT++VNAWA+H DP++W+
Sbjct  350  SKLPYLRNIVSETLRLNPAAPLLIPHRSSDDCTVGGYDVPRDTTLLVNAWAIHRDPELWD  409

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
            EP  FKPERF     E  +   +K +PFG GRRACP  ++  RLV L LG+ +QCF+WK 
Sbjct  410  EPTCFKPERF-----ESSDSEAHKLMPFGLGRRACPGASLAQRLVGLTLGSLLQCFEWKR  464

Query  666  TKEDKI  683
              EDKI
Sbjct  465  IGEDKI  470



>ref|XP_002877127.1| cytochrome P450 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53386.1| cytochrome P450 family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 146/204 (72%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT+T++ T+EWAM+ LL++PEVL K + EID+ +G   L+ E D+ KLPYL
Sbjct  292  GIILVMILAGTDTSAGTLEWAMANLLNHPEVLRKAKTEIDDQIGVDRLIEEQDIVKLPYL  351

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I++ETLRLYP AP+LLPH + EDC+VAGYDVP+ T ++VNAWA+H DPK+WEEPEKFK
Sbjct  352  QNIVSETLRLYPVAPMLLPHLASEDCMVAGYDVPRGTIILVNAWAIHRDPKLWEEPEKFK  411

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG + K + FG GRR+CP + +  RLV+LALG+ +QCF+W+   E  +
Sbjct  412  PERF------EKEGEDKKLISFGIGRRSCPGSGLAQRLVTLALGSLVQCFEWERVGEKFV  465

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                    + ++K   L+A+C  R
Sbjct  466  DMRESERGTTMRKATSLQAMCKTR  489



>ref|XP_010059867.1| PREDICTED: isoflavone 2'-hydroxylase-like [Eucalyptus grandis]
 gb|KCW66314.1| hypothetical protein EUGRSUZ_F00140 [Eucalyptus grandis]
Length=503

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 141/213 (66%), Gaps = 4/213 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++ +AGT+T+++T+EWAMS +L+ PE+L K R EID  VGH  L+NESDL KL YL
Sbjct  294  SLMLVLLLAGTDTSALTMEWAMSAMLNQPEILKKARAEIDEVVGHDRLVNESDLPKLSYL  353

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             C++NET+R+YP  PLL+PH S ++C V GY VP+ T +++N +++ +DP  W    KF+
Sbjct  354  HCVVNETMRMYPVLPLLIPHESAKECCVGGYRVPRGTILLINLFSIQNDPNYWPNAAKFR  413

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PER     G EG    YK +PFG+GRR CP  N+ LR++ L LG+ IQCF+W N   D++
Sbjct  414  PER---FTGMEGVRDGYKMMPFGSGRRGCPGENLALRMIGLTLGSLIQCFEW-NRISDEL  469

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQ  782
            +  T  +   + K + L A C PR      LSQ
Sbjct  470  IDMTEGTGLTMPKAQPLLAKCRPRSFTSDLLSQ  502



>emb|CDP12912.1| unnamed protein product [Coffea canephora]
Length=741

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 141/224 (63%), Gaps = 4/224 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
              V ++  AG++T+S TIEWAMSLLL++P+ L + R E+D N+G   L+ E DL KLPYL
Sbjct  407  GFVLILLAAGSDTSSSTIEWAMSLLLNHPKELERARAELDKNIGQNRLVEEEDLPKLPYL  466

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II E+ RL+P AP+LLP  S  DC +  Y +P  TT+MVNAWA+H DP++W   +  +
Sbjct  467  QSIIYESQRLHPAAPILLPRASSSDCTIGNYTIPSKTTLMVNAWAIHRDPQLW---DDPE  523

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
              + E  +G E + + +KF+PFG GRR CP   +  R+V L LG+ IQCF+W+    +++
Sbjct  524  SFKPERFLGLENDAYKHKFIPFGLGRRKCPGAGLANRMVGLTLGSLIQCFEWERI-SNEL  582

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL*IVFAYVFNV  815
            +  +  +   + K   LEAIC PR++ + F       F Y++ +
Sbjct  583  VDLSEGTGITMPKASPLEAICKPRESMMLFFPITYTRFNYIYKI  626



>emb|CDP01241.1| unnamed protein product [Coffea canephora]
Length=505

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 146/212 (69%), Gaps = 5/212 (2%)
 Frame = +3

Query  147  IVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLR  326
            IVQM+  AGT+T+S T+EWA+SLLL+ P+VL K + EID   G   L+N+SDL +LPYL 
Sbjct  298  IVQML-SAGTDTSSGTMEWALSLLLNNPQVLKKAQQEIDAYGGQSRLINDSDLGQLPYLH  356

Query  327  CIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkp  506
             IINETLR+ P AP+L+PH S + C V GY++P  T ++VN WAM +DPKVWEEP KF+P
Sbjct  357  AIINETLRICPVAPILVPHVSSQQCSVGGYNIPGGTLLLVNLWAMQNDPKVWEEPTKFRP  416

Query  507  erfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKIL  686
            ERF ++   EG+   + F+PFG GRR CP  N+ +R+V L LG  IQCF+W+   E+ ++
Sbjct  417  ERFISL---EGQRDGFAFMPFGFGRRGCPGENLAMRVVGLTLGLLIQCFEWERVGEE-LV  472

Query  687  CATYLSPSILQKDERLEAICTPRKNCLQFLSQ  782
              T  +   + + + L A C PR+  ++ LSQ
Sbjct  473  DMTEGAGLTMPRAKELMAKCKPRQEMVKLLSQ  504



>ref|XP_010911513.1| PREDICTED: cytochrome P450 81D11-like [Elaeis guineensis]
Length=358

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 138/206 (67%), Gaps = 5/206 (2%)
 Frame = +3

Query  168  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIINETl  347
            AG  TT+ T EW MSLLL+ PE L K+R EID  VG++ LL ESDLS LP+L+C+I ETL
Sbjct  158  AGVGTTAETTEWVMSLLLNNPEALKKMRDEIDAQVGNERLLEESDLSNLPHLQCVITETL  217

Query  348  rlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfeAIV  527
            R+YP +PLLLPH S +DC V G+ +P+   ++VNA+A+H DPKVWEEP KF PERF    
Sbjct  218  RMYPTSPLLLPHESSQDCSVGGFHIPRGMMLLVNAYAVHRDPKVWEEPTKFMPERF----  273

Query  528  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  707
             E G+G     +PFG GRR CP   + +R+V LALG  IQCF+W+   ++++   T  S 
Sbjct  274  -EGGKGEGKLMLPFGMGRRRCPGEGLAMRVVGLALGTLIQCFEWEGIGKEEVDMTTQGSG  332

Query  708  SILQKDERLEAICTPRKNCLQFLSQL  785
              L K   LEA+  PR++ L  L +L
Sbjct  333  LTLAKAIPLEAMYRPRQSMLDALKKL  358



>dbj|BAN19900.1| cytochrome P450 [Echinochloa phyllopogon]
Length=524

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 143/214 (67%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            A+V  +  AGTETTS T+EW MSLLL++P+VL K + EID+NVG   LL+++D+  LPYL
Sbjct  317  ALVANLLSAGTETTSTTMEWTMSLLLNHPDVLKKAQEEIDSNVGGGRLLDKNDIPHLPYL  376

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CIINETLRLYP  P+LLPH +  DC + GYDVP  + V+VNA+A+H DP +WE+PE+F+
Sbjct  377  HCIINETLRLYPVVPMLLPHEASTDCKIHGYDVPAGSMVLVNAYAIHRDPVIWEDPEEFR  436

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E G       +PFG GRR CP  N+ +R + L LG  +QCFDW    + ++
Sbjct  437  PERF-----EHGRAEGKFIMPFGMGRRKCPGENLAMRTMGLVLGVLLQCFDWSRIGDGEV  491

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              AT  + +I+ K   LEA+C PR N    L ++
Sbjct  492  DMATG-TGAIMFKAVPLEALCKPRANMSALLQEI  524



>ref|XP_009406660.1| PREDICTED: isoflavone 2'-hydroxylase-like [Musa acuminata subsp. 
malaccensis]
Length=512

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 140/214 (65%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++  AGT++T+ TIEWA+SLLL++P  + K R EID  VG+  LL+ESDL  LPYL
Sbjct  305  SLISILLSAGTDSTARTIEWALSLLLNHPNAMDKTRAEIDARVGNGRLLDESDLPNLPYL  364

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             C++ ETLR+YP  PLL+PH S ++CVV G+ VP+ T ++VNA+AMH DPK W+EP +F 
Sbjct  365  HCVVAETLRMYPAGPLLVPHESSDECVVGGFHVPRGTILLVNAYAMHRDPKTWDEPARFM  424

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E G+G   +  PFG GRR CP   +  R++ LALG  IQCF+W    + ++
Sbjct  425  PERF-----EGGKGEGKRMAPFGKGRRKCPGEGLAARMMGLALGTLIQCFEWGRVGDKEV  479

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              A   S   L K   LEA C PR+     LS++
Sbjct  480  DMAEG-SGLTLPKAVPLEATCRPRQTLAHLLSEI  512



>gb|AIM45245.1| flavonoid 3' hydroxylase-like protein [Fagopyrum tataricum]
Length=508

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 143/214 (67%), Gaps = 3/214 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ +++ AGT+T++  +EWAMSLLL++P +L K R EID +V    L+ +SDLS LPYL
Sbjct  298  GILLVMYTAGTDTSARIMEWAMSLLLNHPTILRKARAEIDAHVPTTRLVEDSDLSNLPYL  357

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RCII ETLRLYP   LL+PH+S  +  + GY VPK T ++VNAWA+H +P+VW EP +F+
Sbjct  358  RCIIYETLRLYPVVSLLIPHFSSSETTIDGYRVPKGTVLVVNAWALHRNPEVWPEPLEFR  417

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE   G EG    +KF+PFG GRRACP  N+G+++V+L L   IQ F+W+N +  ++
Sbjct  418  PERFE---GVEGNRDGFKFMPFGVGRRACPGANLGVKMVALTLATMIQGFEWENVEAGEV  474

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                      + K   L+A CTPR   L  LS +
Sbjct  475  DVEEEGGGITMPKRSPLKAFCTPRSCMLDVLSMI  508



>emb|CDX72625.1| BnaC07g46470D [Brassica napus]
Length=498

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 130/173 (75%), Gaps = 6/173 (3%)
 Frame = +3

Query  159  VFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIIN  338
            + +AGT+T+S+T+EWA+S LL++P++L K R EID+ +G   L++ESD+  LPYL+ I++
Sbjct  297  LVIAGTDTSSITLEWALSNLLNHPKILEKARAEIDDKIGSDRLIDESDIENLPYLQYIVS  356

Query  339  ETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfe  518
            ETLRLYPP PLLLPHYS +DC VAGYD+P+ T ++ N WAMH DP VWEE E+FKPERF 
Sbjct  357  ETLRLYPPVPLLLPHYSSDDCKVAGYDMPRGTMLLTNVWAMHRDPGVWEEAERFKPERF-  415

Query  519  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  677
                 E EG   K +PFG GRRACP   +G RLVSLALG  IQCF+W+   E+
Sbjct  416  -----EKEGEAQKLMPFGMGRRACPGVELGKRLVSLALGCLIQCFEWERVGEE  463



>ref|XP_010531288.1| PREDICTED: isoflavone 2'-hydroxylase-like [Tarenaya hassleriana]
Length=500

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 128/180 (71%), Gaps = 4/180 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++Q + +AGT+T+ VT+ WAM+ LL+YP VL K R EID+ VG   L++ESDL  LPYL
Sbjct  291  GLIQAMMLAGTDTSIVTLTWAMANLLNYPHVLDKARQEIDDRVGQTRLIDESDLPNLPYL  350

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ET RL PP P LLPHYS  DC V GY VP+ T ++VN WA+H DP VW +P+ F+
Sbjct  351  QNIISETFRLCPPGPFLLPHYSSADCTVGGYHVPRDTILLVNTWAIHRDPSVWPDPDSFR  410

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE   GEE +   YK +PFG GRRACP   +GLR+V L LG+ +QCF+WK   ++ +
Sbjct  411  PERFEG--GEEVDA--YKLIPFGIGRRACPGGTLGLRIVGLTLGSLVQCFEWKTIGDEPV  466



>ref|XP_006466538.1| PREDICTED: isoflavone 2'-hydroxylase-like [Citrus sinensis]
Length=518

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 144/211 (68%), Gaps = 7/211 (3%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + +  +   + +AGT+TT+VT+EWAMS L+++P+VL K   E+D +VG +HL +E DL
Sbjct  303  TDQTIKGLAMTMLLAGTDTTAVTMEWAMSNLVNHPDVLQKATAELDTHVGQQHLFDEPDL  362

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            SKL YL CII+ETLRLYP APLL+PH S +DCVV G+DVP+ TT++VN WA+H DP +W+
Sbjct  363  SKLKYLHCIISETLRLYPTAPLLVPHRSSDDCVVGGFDVPRDTTLLVNVWAIHRDPGLWD  422

Query  486  epekfkperfeAIVGEEGEGFNYKF-VPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK  662
            EP KFKPERF     E GE   +K  +PFG GRRACP   +  RLV L LG+ IQCF+W+
Sbjct  423  EPTKFKPERF-----ENGESEAHKLMMPFGLGRRACPGMGLAQRLVGLTLGSLIQCFEWE  477

Query  663  NTKEDKILCATYLSPSILQKDERLEAICTPR  755
                 KI   T      + K E LE +C PR
Sbjct  478  RIGCQKI-DMTEGKGITMPKAEALEVMCKPR  507



>dbj|BAP46307.1| cytochrome P450 [Phryma leptostachya]
Length=505

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 138/214 (64%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++  + +AGT+ + VT EW MSLLL++PE++ K R E+D  VGH  L+ E DL KL YL
Sbjct  295  GLIVALIIAGTDASVVTSEWVMSLLLNHPEIMEKARKELDTLVGHDRLVEEHDLQKLRYL  354

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CII ETLRLYP  P L+PH   +DC + GY++PK T ++VNAWA+H DPKVW+EP  FK
Sbjct  355  HCIILETLRLYPSVPTLVPHVPSQDCQIGGYNIPKGTMILVNAWAIHRDPKVWDEPLSFK  414

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE +  E      +K +PFG GRRACP   +  + V LA+ + IQCFDW+    DKI
Sbjct  415  PERFETLEVE-----THKLLPFGMGRRACPGAGLAQKYVGLAVASLIQCFDWERPSADKI  469

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                    + L K + LEA+C PR   ++ L QL
Sbjct  470  DMTEGFG-TTLPKAKTLEALCKPRNVMVKVLHQL  502



>ref|XP_009354137.1| PREDICTED: cytochrome P450 81D11-like [Pyrus x bretschneideri]
Length=507

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 146/215 (68%), Gaps = 5/215 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHK-HLLNESDLSKLPY  320
             I+Q++  AGT+T+S T+EWA+SLLL+ PE L K + EIDN++G    LL ESDL KLPY
Sbjct  297  GIMQVMLTAGTDTSSGTMEWALSLLLNNPEALAKAQTEIDNHIGQSCRLLEESDLPKLPY  356

Query  321  LRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekf  500
            L+ II+ETLR+YP  PLL PH S EDC V G+ VP+ T ++VN WA+ H+PK+W +P++F
Sbjct  357  LQGIISETLRMYPTGPLLAPHESSEDCTVGGFHVPRRTMLLVNIWAIQHNPKLWAQPDQF  416

Query  501  kperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDK  680
            KPERF  +  EE +GF +  +PFG GRR CP   +  R+V LALG+ IQCF+W+   E+ 
Sbjct  417  KPERFHNLQ-EERDGFVW--LPFGAGRRGCPGEGLATRIVGLALGSLIQCFEWERIGEEM  473

Query  681  ILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            +  +     + + + + L A C PR   L  LSQL
Sbjct  474  VDMSEGTGLT-MPRAQPLLAKCRPRPKMLALLSQL  507



>gb|KCW54840.1| hypothetical protein EUGRSUZ_I00783 [Eucalyptus grandis]
Length=321

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 138/204 (68%), Gaps = 4/204 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             +V ++ VAGT+T+SVT+EWAM+ LL+  + + K R EID+ +GH  L+ ESD+SKLPYL
Sbjct  112  GLVNVMLVAGTDTSSVTLEWAMTNLLNNLDKMEKARAEIDSVIGHDRLMEESDVSKLPYL  171

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            +CII+ETLRL    PLL+PH S  DC + GY VP+ T V VNAWA+H DPK+WE+P  F+
Sbjct  172  QCIISETLRLNTTVPLLVPHESSADCTMGGYLVPRGTIVFVNAWAIHRDPKLWEDPTTFR  231

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE   G +GE      +PFG GRRACP  ++  R++ L LG  IQCFDW+   E++I
Sbjct  232  PERFE---GSDGEKCQKLILPFGLGRRACPGASLAQRVMGLTLGLLIQCFDWERVSEEEI  288

Query  684  LCATYLSPSILQKDERLEAICTPR  755
               T    + + K   LE++C  R
Sbjct  289  -DMTEGKGTTMPKLVPLESMCRVR  311



>ref|XP_007207372.1| hypothetical protein PRUPE_ppa004635mg [Prunus persica]
 gb|EMJ08571.1| hypothetical protein PRUPE_ppa004635mg [Prunus persica]
Length=499

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 148/212 (70%), Gaps = 6/212 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++ +AGT+T+++T+EWA+S LL+ P VL K++ E+D  +G ++L++E DLSKLPYL
Sbjct  294  GLILVLLLAGTDTSAMTLEWALSNLLNNPHVLKKVKAELDAQLGQENLVDEPDLSKLPYL  353

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ETLRL P APLL+PH S EDC++ G+DVP+ T V++NAWA+H DP++W++PE F 
Sbjct  354  QSIISETLRLCPAAPLLVPHLSSEDCIIGGFDVPRDTMVLINAWALHRDPQLWDDPESFM  413

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E G+ F++K +PFG GRR+CP   +  R+V L LG+ IQCF+W+   E +I
Sbjct  414  PERF-----ESGDNFSHKLLPFGLGRRSCPGVGLAQRVVGLTLGSLIQCFEWERVSEKEI  468

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLS  779
               T      + K   LEA+C  R    + LS
Sbjct  469  -DMTEDKGLTMPKAVPLEAMCKSRLIARKVLS  499



>emb|CDP04571.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 141/204 (69%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++  AGT+T+SVTIEWA+SLLL++PEVL K R E+D  VG   L+ E DLS LPYL
Sbjct  295  GIILVMLTAGTDTSSVTIEWALSLLLNHPEVLEKARAELDAQVGTDRLIEEHDLSNLPYL  354

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
              II+ETLRLYPP P+L+PH S +DC + GY++P+ T ++VNAWA+H DP VW++P  FK
Sbjct  355  HNIISETLRLYPPTPMLVPHESSDDCKIGGYNIPRGTILLVNAWAVHRDPNVWDDPISFK  414

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            P+RF+ +  E  +      +PFG GRR+CP + +  R+V LALG+ IQ FDWK   +D+I
Sbjct  415  PDRFDGLQVEPSQ-----LIPFGMGRRSCPGSGLARRVVGLALGSLIQSFDWKRISDDEI  469

Query  684  LCATYLSPSILQKDERLEAICTPR  755
              A     S + K + LEA+C  R
Sbjct  470  DLAEGTGVS-MPKAKPLEAMCRAR  492



>ref|XP_010679549.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010679550.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 146/211 (69%), Gaps = 7/211 (3%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + +  ++ ++ VAGT+T+S T+EWAMSLLL+ P V++KL+ EID  +G   L+NE DL
Sbjct  292  TDETIKGLILVLLVAGTDTSSATMEWAMSLLLNNPHVMNKLKSEIDIQIGQDELINELDL  351

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
             K+PYL+ +I ETLRL+P  PLLLPH S ++C + G+D+P  T +MVNAWA+H D   W+
Sbjct  352  PKIPYLQNVILETLRLFPSVPLLLPHMSSDECQIGGFDIPSETMLMVNAWAIHRDTHQWD  411

Query  486  epekfkperfeAIVGEEGEGFN-YKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK  662
            EP +FKPERF     E+G+  + YK +PFG GRRACP  N+G R+V LALG+ IQCFDWK
Sbjct  412  EPTQFKPERF-----EKGDVIDQYKLLPFGVGRRACPGANLGNRMVGLALGSLIQCFDWK  466

Query  663  NTKEDKILCATYLSPSILQKDERLEAICTPR  755
               +D++  A     + + K   LEA+C  R
Sbjct  467  RVGDDEVDMAEGRGLN-MPKAHPLEALCKAR  496



>ref|XP_008378170.1| PREDICTED: cytochrome P450 81D1-like [Malus domestica]
Length=507

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 144/205 (70%), Gaps = 4/205 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKH-LLNESDLSKLPY  320
             I+ ++ VAGT+TTS T+EWAM+LLL++P  + KLR EID   G  H LL E DL  L Y
Sbjct  299  GIILVLLVAGTDTTSTTLEWAMALLLNHPGAMAKLRAEIDTKTGSDHRLLEEQDLPNLNY  358

Query  321  LRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekf  500
            L+ +I ET RLYP  P+L+PH + EDCVV G+DVP HT +++NAWA+H +P++WE+PEKF
Sbjct  359  LQNVITETYRLYPSFPILVPHENSEDCVVGGFDVPHHTMLVINAWAIHRNPEIWEDPEKF  418

Query  501  kperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDK  680
            KPERFE   GE  EG  YK +PFG GRR CP  ++  +LV LALG+ +Q F+W+   E++
Sbjct  419  KPERFEGWSGEGSEG--YKLIPFGAGRRRCPGASLANKLVGLALGSLVQSFEWERIGEEE  476

Query  681  ILCATYLSPSILQKDERLEAICTPR  755
            +  +  L  + + + + LEAIC PR
Sbjct  477  VDMSEGLGLT-MPRVKPLEAICKPR  500



>gb|AGC29950.1| CYP81B56, partial [Sinopodophyllum hexandrum]
Length=344

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 140/209 (67%), Gaps = 4/209 (2%)
 Frame = +3

Query  159  VFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIIN  338
            +  AGT+T++ T+EWAMSLLL+ PEV+ K + E+DNN+    L+ ESD+SKLPYL+CII 
Sbjct  139  MLSAGTDTSAGTMEWAMSLLLNNPEVIKKAQLEMDNNIEPGRLIQESDMSKLPYLQCIIT  198

Query  339  ETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfe  518
            ETLR+YP  PLLLPH S  DCVV GY +P  T ++VN WA+ +DP +W EP KFKPERFE
Sbjct  199  ETLRMYPAGPLLLPHESSHDCVVGGYTIPGGTMLLVNLWAIQNDPSLWNEPTKFKPERFE  258

Query  519  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  698
             +  E  +GF  K +PFG+GRR CP   + + ++ L LG  IQCFDW+   +D ++  T 
Sbjct  259  GLK-ETRDGF--KLMPFGSGRRRCPGEGLAMHVLGLVLGTLIQCFDWERVGDD-LVDMTE  314

Query  699  LSPSILQKDERLEAICTPRKNCLQFLSQL  785
             S   L K + L A C PR      +SQL
Sbjct  315  GSGLTLPKAQPLVAKCMPRAKMANLISQL  343



>ref|XP_006399557.1| hypothetical protein EUTSA_v10016031mg [Eutrema salsugineum]
 gb|ESQ41010.1| hypothetical protein EUTSA_v10016031mg [Eutrema salsugineum]
Length=500

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 149/214 (70%), Gaps = 4/214 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++F AGT+T+ V +EWAMS+LL++P+ L KLR EI +NV H  L+ +SDLS LPYL
Sbjct  291  GIIVLMFNAGTDTSPVVMEWAMSVLLNHPDKLEKLREEIKSNVKHNGLIQDSDLSSLPYL  350

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            RC+I ETLRLYP APLLLPHYS +   +  Y++P++T ++VNAWA+H D K+WE+ + FK
Sbjct  351  RCVIYETLRLYPAAPLLLPHYSSKRFNLGDYEIPENTMLLVNAWAVHRDGKLWEDADVFK  410

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE  VG+  +GF  +F+PFG GRRACP    G+R V+LA+GA +QCF+W+  +E  +
Sbjct  411  PERFEGFVGDR-DGF--RFLPFGVGRRACPGAGFGMRTVALAVGALVQCFEWEKLEEGDV  467

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                    + + K E L A+  P    +  LSQL
Sbjct  468  DMRPVFGVA-MAKAEPLVALPKPWPEMVPILSQL  500



>ref|XP_006472258.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X2 [Citrus 
sinensis]
Length=506

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 155/235 (66%), Gaps = 18/235 (8%)
 Frame = +3

Query  81   WQNHYIRGTSNGINSTLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEI  260
            + +H IRG              ++Q++ +AG++T+S T+EWA+S LL+ PE+L + + EI
Sbjct  290  YTDHIIRG--------------MMQVLLIAGSDTSSATMEWALSSLLNNPEILVQAQSEI  335

Query  261  DNNVGHKHLLNESDLSKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTV  440
            D NVG   L+ ESDL++LPYL  II ETLR+YP APLL+PH S E+C + G+ VP+ T +
Sbjct  336  DTNVGQSRLIEESDLTELPYLHGIIKETLRMYPAAPLLVPHESSEECTIGGFKVPRGTML  395

Query  441  MVNAWAMHHDPKVWeepekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLV  620
            +VN+WA+ +DP++WEEP KFKPERF  + G+  +   Y  +PFGTGRR CP   + +RLV
Sbjct  396  LVNSWAIQNDPRIWEEPSKFKPERFREMAGKSDK---YMLLPFGTGRRVCPGEGLAMRLV  452

Query  621  SLALGAYIQCFDWKNTKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
             LALG+ IQCF+W  T   +++  +  +   + + + L A+C PR   +  LSQL
Sbjct  453  GLALGSLIQCFEWVRTG-GELVDMSEGTGLTMPRAQPLLAMCRPRPAMVTLLSQL  506



>ref|XP_011099321.1| PREDICTED: cytochrome P450 81D1-like [Sesamum indicum]
Length=498

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 144/208 (69%), Gaps = 6/208 (3%)
 Frame = +3

Query  159  VFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIIN  338
            + +AGT+T++VTIEWAMSLLL++P+VL K + E+D+ VGH  L++E DL  L YLR II 
Sbjct  291  MIIAGTDTSTVTIEWAMSLLLNHPQVLQKAKLELDSQVGHHRLVDEQDLPNLHYLRNIIL  350

Query  339  ETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfe  518
            ET RL+P  PL++P  S  DC V GYD+P+ T ++VNAWA+H DP+VW EP  FKPERF+
Sbjct  351  ETFRLFPAGPLVVPRESSADCRVGGYDIPRGTILLVNAWAIHRDPEVWSEPMSFKPERFD  410

Query  519  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  698
               G+E E    K +PFG GRRACP   +G R+V LAL + IQCF+W+    +++  A  
Sbjct  411  ---GKEVE--TQKLMPFGMGRRACPGAGLGQRMVGLALASLIQCFEWERVGLEEVDLAEG  465

Query  699  LSPSILQKDERLEAICTPRKNCLQFLSQ  782
            +  + + K + LEA+C PR+  L+ L +
Sbjct  466  VGLT-MPKFKPLEAVCRPRQVMLKVLQE  492



>ref|XP_010095331.1| Cytochrome P450 81D1 [Morus notabilis]
 gb|EXB59542.1| Cytochrome P450 81D1 [Morus notabilis]
Length=503

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 133/183 (73%), Gaps = 5/183 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
              V ++ +A T+T++VT+EWAMS LL++P +L K + E+D  +G + L+ ESDLSKL YL
Sbjct  292  GFVLILLLAATDTSAVTLEWAMSNLLNHPNILKKAKAELDAQIGQQQLVEESDLSKLNYL  351

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ETLRLYP AP+L+PHYS +DC + GYDVP+ T ++VNAWA+H DPK+W++ E F 
Sbjct  352  QNIISETLRLYPAAPMLVPHYSSDDCTIGGYDVPRGTILLVNAWAIHRDPKLWDDAESFI  411

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E GE  +YK  PFG GRR+CP   +  R+V L LG+ IQCF+W+ T E+++
Sbjct  412  PERF-----ENGESESYKLFPFGLGRRSCPGIGLAQRVVGLTLGSLIQCFEWERTSEEEV  466

Query  684  LCA  692
              A
Sbjct  467  DMA  469



>ref|XP_008787116.1| PREDICTED: isoflavone 2'-hydroxylase-like [Phoenix dactylifera]
Length=512

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 137/214 (64%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            + +  +FVAGT+T++ T+EWAMSLLL+ PE L K R EID  V  K LL E DL KLPYL
Sbjct  305  SFITTLFVAGTDTSTETLEWAMSLLLNNPEALQKARLEIDAWVAEKRLLEEHDLPKLPYL  364

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
              IINETLRL P APLLLPH S ED V+ GYD+P+   ++VNAWA+H DP VW EP KF 
Sbjct  365  NGIINETLRLCPVAPLLLPHESQEDSVLGGYDIPRGAILLVNAWAIHRDPNVWAEPTKFM  424

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E G       +PFG GRR CP   + +R+  LALGA IQCF+W+    +++
Sbjct  425  PERFLGGRAERGMA-----LPFGMGRRKCPGEGLAMRVTGLALGAMIQCFEWERVGGEEV  479

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              +   S   L K   L A+C PR++  + L +L
Sbjct  480  DMSEG-SAVTLPKAIPLVAMCRPRQSTAEVLGRL  512



>ref|XP_009796227.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X2 [Nicotiana 
sylvestris]
Length=508

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 142/205 (69%), Gaps = 3/205 (1%)
 Frame = +3

Query  147  IVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLR  326
            ++ ++  AG++T++VT+EWA S LL   E+L K + EIDN+VG   L++ESDL++L Y+R
Sbjct  304  LMLVLLQAGSDTSAVTLEWAFSHLLDNLEILKKAQAEIDNHVGQDRLIDESDLAQLHYIR  363

Query  327  CIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkp  506
            CIINETLR++P APLL+PH S E+C VA Y VP+ T ++VNAW +HHDPKVWE+PEKF P
Sbjct  364  CIINETLRMHPAAPLLVPHLSSEECNVASYRVPRGTVLLVNAWGIHHDPKVWEDPEKFYP  423

Query  507  erfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKIL  686
            +R    +G EG     KF+PFG+GRR CP  N+   ++ LALG+ +QCF+W+      I 
Sbjct  424  DR---FIGFEGIKEGCKFIPFGSGRRGCPGENLAFHVIGLALGSLLQCFEWEKPNRGSID  480

Query  687  CATYLSPSILQKDERLEAICTPRKN  761
             +     ++  K + L A C+PR N
Sbjct  481  MSEGTGFTLSPKVQPLLAKCSPRPN  505



>ref|XP_010437237.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
Length=498

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 144/208 (69%), Gaps = 7/208 (3%)
 Frame = +3

Query  159  VFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIIN  338
            + +AGT+T++VT+EWA+S LL++PEVL+K R EID  +G   L++ESD+S LPYL+ I++
Sbjct  296  LILAGTDTSAVTLEWALSNLLNHPEVLNKARDEIDRTIGLDRLMDESDISNLPYLQNIVS  355

Query  339  ETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfe  518
            ETLRLYP  P+LLPH + EDC V GYD+P+ T ++ NAWA+H DP++W++P  FKPERF 
Sbjct  356  ETLRLYPAVPMLLPHVASEDCKVGGYDMPQGTILLTNAWAIHRDPQLWDDPTSFKPERF-  414

Query  519  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  698
                 E EG  +K +PFG GRRACP + + LRLVSL LG  IQC +WK   E+++  +  
Sbjct  415  -----EKEGEAHKLMPFGLGRRACPGSVLALRLVSLTLGTLIQCLEWKRIGEEEVDMSES  469

Query  699  LSPSILQKDERLEAICTPRKNCLQFLSQ  782
                 + K + LEA+C  R    +F  +
Sbjct  470  -KGGTMPKAKPLEAMCRSRAFVGKFFHE  496



>ref|XP_010936531.1| PREDICTED: isoflavone 2'-hydroxylase-like [Elaeis guineensis]
Length=514

 Score =   172 bits (436),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 138/214 (64%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            A +  +FVAGT+T++ T EWAMSLLL+ PE L K R EID  V  K LL E+DL KLPYL
Sbjct  307  AFIITLFVAGTDTSTETTEWAMSLLLNNPEALQKARLEIDECVKEKRLLEENDLPKLPYL  366

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
              IINETLRL P APLLLPH S EDCV+ GYD+P+ T ++VNAWA+H DP VW EP KF 
Sbjct  367  NGIINETLRLCPAAPLLLPHESHEDCVMGGYDIPRGTILLVNAWAIHRDPNVWVEPTKFM  426

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E G       +PFG GRR CP   + +R++ LALG  IQCF+W      ++
Sbjct  427  PERFLDGRAEGGMS-----LPFGMGRRKCPGEGLAMRVIGLALGTMIQCFEWARVGGGEV  481

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                  S   L K   LEA+  PR++ ++ L++L
Sbjct  482  DMREG-SALTLPKAVPLEAMYQPRESMMEVLARL  514



>ref|XP_010425654.1| PREDICTED: cytochrome P450 81D11 [Camelina sativa]
Length=501

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 146/204 (72%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT+T++ T+EWAMS LL++PEVL K + EIDN +G   L+ E D+ KLPYL
Sbjct  292  GIILVMILAGTDTSAGTLEWAMSTLLNHPEVLQKAKTEIDNQIGLDSLIEEQDIVKLPYL  351

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I++ETLRLYP AP+LLPH + EDCV+ GYDVP+ T ++VNAWA+H DPK+WEEPEKFK
Sbjct  352  QNIVSETLRLYPVAPMLLPHLASEDCVLDGYDVPRGTIILVNAWAIHKDPKLWEEPEKFK  411

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E +G + K + FG GRRACP + +  RLV+LALG+ IQ F+W+   E+ +
Sbjct  412  PERF------EKKGEDKKLMAFGIGRRACPGSGLAQRLVTLALGSLIQSFEWERLGEEHL  465

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                    + ++K + L+A+C  R
Sbjct  466  DMRESEKGTTMRKAKSLQAMCRAR  489



>ref|XP_008365132.1| PREDICTED: cytochrome P450 81D1-like [Malus domestica]
Length=507

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 144/205 (70%), Gaps = 4/205 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKH-LLNESDLSKLPY  320
             I+ ++ VAGT+TTS T+EWAM+LLL++P  + KLR EID   G  H LL E DL  L Y
Sbjct  299  GIILVLLVAGTDTTSTTLEWAMALLLNHPGAMAKLRAEIDTKTGSDHRLLEEQDLPNLNY  358

Query  321  LRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekf  500
            L+ +I ET RLYP  P+L+PH + EDCVV G+DVP HT +++NAWA+H +P++WE+PEKF
Sbjct  359  LQNVIXETYRLYPSFPILVPHENSEDCVVGGFDVPHHTMLVINAWAIHRNPEIWEDPEKF  418

Query  501  kperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDK  680
            KPERFE   GE  EG  YK +PFG GRR CP  ++  +LV LALG+ +Q F+W+   E++
Sbjct  419  KPERFEGWSGEGSEG--YKLIPFGAGRRRCPGASLANKLVGLALGSLVQSFEWERIGEEE  476

Query  681  ILCATYLSPSILQKDERLEAICTPR  755
            +  +  L  + + + + LEAIC PR
Sbjct  477  VDMSEGLGLT-MPRVKPLEAICKPR  500



>ref|XP_011097392.1| PREDICTED: cytochrome P450 81E8-like [Sesamum indicum]
Length=488

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 144/213 (68%), Gaps = 6/213 (3%)
 Frame = +3

Query  147  IVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLR  326
            ++  + +AGT+ + V  EWAMSLLL++PEVL+K R E+D  +GH  L+ E DL KL YL 
Sbjct  278  LIVALIIAGTDASVVASEWAMSLLLNHPEVLNKARQELDTQIGHDRLVEEQDLPKLNYLH  337

Query  327  CIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkp  506
            CII ETLRL+PP P L+PH S +D  + GYD+P+ T ++VNAWA+H DPK+W++P  F+P
Sbjct  338  CIILETLRLFPPVPTLVPHVSSQDFELGGYDIPRGTMIIVNAWAIHKDPKIWDDPLTFRP  397

Query  507  erfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKIL  686
            ERFE   G + E   +K +PFG GRRACP   +  + V LALG+ IQCFDW+ T  +KI 
Sbjct  398  ERFE---GRQVE--THKLLPFGMGRRACPGAGLAQKFVGLALGSLIQCFDWERTSVEKI-  451

Query  687  CATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              T  +   L K + LEA+C PR    + L+Q+
Sbjct  452  DLTEGTGITLPKAKTLEAMCKPRTVMGKALAQV  484



>ref|XP_007018553.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY15778.1| Cytochrome P450 [Theobroma cacao]
Length=501

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 143/215 (67%), Gaps = 6/215 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++ +AGT+T + T+EWAMS LL++PEVL   + E+D  VG   L++ESDL  LPYL
Sbjct  292  SLMMVLLLAGTDTLAATLEWAMSFLLNHPEVLENAQTEMDAVVGQGRLMDESDLPNLPYL  351

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CII ET+R+ P  PLL+PH S +DCVV GY +P+ T +MVN WA+H+D   WEEP KFK
Sbjct  352  HCIIRETMRIKPVGPLLIPHESSKDCVVGGYHIPRGTMLMVNLWAIHNDSNNWEEPTKFK  411

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PER     G EG    +KF+PFG+GRR+CP   + +R+V L LG+ IQCF W+   ++ +
Sbjct  412  PER---FEGLEGTKDGFKFMPFGSGRRSCPGEGLAMRMVGLTLGSLIQCFHWERIGKEMV  468

Query  684  LCATYLSPSI-LQKDERLEAICTPRKNCLQFLSQL  785
                   P + + K + L+A C PR+  +  LSQ+
Sbjct  469  DMTE--GPGLTMPKAQPLQAKCRPRQPMVNLLSQI  501



>ref|XP_004290939.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=512

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 141/201 (70%), Gaps = 3/201 (1%)
 Frame = +3

Query  153  QMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCI  332
            +++ VAGTET S T+EWAM+LLL++P+ ++K+R EID  VG   L+NE DL KL YL+ +
Sbjct  308  KVLLVAGTETASTTMEWAMALLLNHPDKMNKVRTEIDAKVGEHRLMNEQDLPKLNYLQNV  367

Query  333  INETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  512
            I E LR+YPP PLL+P  + EDCVV G+DVP+ T +M+NAWA+H DP+ WE+P +FKPER
Sbjct  368  ITEALRVYPPVPLLVPREASEDCVVGGFDVPRGTMLMINAWAIHRDPEFWEDPTEFKPER  427

Query  513  feAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  692
            FE   GE GE   YK VPFG GRR CP + +  R ++LA+G  +Q F+W+   E+K+  +
Sbjct  428  FEGWSGEGGEA--YKIVPFGAGRRGCPGDVLAKRFIALAIGTLVQSFEWERISEEKVDMS  485

Query  693  TYLSPSILQKDERLEAICTPR  755
              L  S + +   L+A C PR
Sbjct  486  EGLGIS-MPRIHPLDAFCKPR  505



>emb|CDP19800.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 141/213 (66%), Gaps = 8/213 (4%)
 Frame = +3

Query  150  VQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRC  329
            V ++  AGT TTS T+EWA+S LL++P VL K R E++  +   HLLN+SDLSKLPYLRC
Sbjct  263  VGLMLSAGTHTTSQTMEWALSSLLNHPNVLQKARDELEK-MQPGHLLNDSDLSKLPYLRC  321

Query  330  IINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkpe  509
            IINETLRL+P AP L+PH+S EDC +  Y+VPK TT++VN WA+H DP VWEEP K+KPE
Sbjct  322  IINETLRLFPAAPTLVPHFSSEDCTIGRYEVPKGTTLLVNVWAIHRDPNVWEEPNKYKPE  381

Query  510  rfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILC  689
            RFE +  E G    +KF+PFG GRR CP   M +RL  L LG  IQCF+W+    + +  
Sbjct  382  RFEGM-DEGGWNEGFKFLPFGKGRRICPGAAMAIRLAGLTLGTLIQCFEWQRVGPE-MKT  439

Query  690  ATYLSPSILQ-----KDERLEAICTPRKNCLQF  773
              +  P++ +     K ER E I     N L F
Sbjct  440  GIHGDPNVWEEANKFKPERFEVIYDEGSNFLPF  472



>ref|XP_008238634.1| PREDICTED: cytochrome P450 81D11-like [Prunus mume]
Length=496

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 142/205 (69%), Gaps = 6/205 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++ +AGT+T++VT+EWAMS LL+ P+VL + R E+D  VG + L+ E D+SKLPYL
Sbjct  293  GLILIMLLAGTDTSAVTLEWAMSNLLNRPDVLQRARAELDAQVGQERLVEEHDISKLPYL  352

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ET RLYP AP+LLPH+S +DC + G+DVP+ T V++NAWA+H DPK+W++PE F 
Sbjct  353  QSIISETFRLYPAAPMLLPHFSSDDCTIGGFDVPRGTMVLINAWAIHRDPKLWDDPESFI  412

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF +     GE  +++ +PFG GRR+CP + +  R V L LG+ IQCFDW    E +I
Sbjct  413  PERFRS-----GEDLSHQLMPFGLGRRSCPGSGLAQRTVGLTLGSLIQCFDWVRVSEKEI  467

Query  684  LCATYLSPSILQKDERLEAICTPRK  758
              A     + + K   LE +C  R+
Sbjct  468  DMAEGKGLT-MPKLVPLEVMCKARR  491



>ref|XP_006433591.1| hypothetical protein CICLE_v10000934mg [Citrus clementina]
 gb|ESR46831.1| hypothetical protein CICLE_v10000934mg [Citrus clementina]
Length=499

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 154/235 (66%), Gaps = 18/235 (8%)
 Frame = +3

Query  81   WQNHYIRGTSNGINSTLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEI  260
            + +H IRG              ++Q++ + G++T++ T+EWA+S LL+ PE+L + + EI
Sbjct  283  YTDHIIRG--------------MMQVLLIEGSDTSAATMEWALSSLLNNPEILEQAQSEI  328

Query  261  DNNVGHKHLLNESDLSKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTV  440
            D NVG   L+ ESDL++LPYL  II ETLR+YP APLL+PH S E+C + G+ VP+ T +
Sbjct  329  DTNVGQSRLIEESDLTELPYLHGIIKETLRIYPAAPLLVPHESSEECTIGGFKVPRGTML  388

Query  441  MVNAWAMHHDPKVWeepekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLV  620
            +VN+WA+ +DP++WEEP KFKPERF  + G+  +   Y  +PFGTGRR CP   + +RLV
Sbjct  389  LVNSWAIQNDPRIWEEPSKFKPERFREMAGKSDK---YMLLPFGTGRRGCPGEGLAMRLV  445

Query  621  SLALGAYIQCFDWKNTKEDKILCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
             LALG+ IQCF+W  T   +++  +  +   + + + L A+C PR   +  LSQL
Sbjct  446  GLALGSMIQCFEWVRTG-GELVDMSVGTGLTMPRAQPLLAMCRPRPAMVTLLSQL  499



>ref|XP_002510140.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52327.1| cytochrome P450, putative [Ricinus communis]
Length=504

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 137/212 (65%), Gaps = 14/212 (7%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++  +  AGT+T++VTIEWAMSLLL++P+ L K R E+D +VG   L++E DL KL YL
Sbjct  298  GLIMAMLTAGTDTSAVTIEWAMSLLLNHPKALTKARAELDIHVGQDRLVDEQDLPKLQYL  357

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CIINETLRL+P APLL+PH S +DC + G+D+P+ T + VNAWA+H DPK+W       
Sbjct  358  HCIINETLRLFPAAPLLVPHKSSDDCKIGGFDIPQGTVLSVNAWALHRDPKIW-------  410

Query  504  perfeAIVGEEGEGFNYK---FVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKE  674
             E   +   E  EG  Y+    VPFG GRR+CP   +  R+V LAL A IQCFDW+   E
Sbjct  411  -EDPNSFRPERFEGIKYETCLLVPFGLGRRSCPGAGLANRVVGLALAALIQCFDWERITE  469

Query  675  DKILCATYLSPSI-LQKDERLEAICTPRKNCL  767
            ++I       P + + K + LEA+C  R++ +
Sbjct  470  EEI--DMLEGPGLTMPKVQPLEAMCKIRESMI  499



>gb|AJD25193.1| cytochrome P450 CYP81B61 [Salvia miltiorrhiza]
Length=510

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 139/215 (65%), Gaps = 5/215 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++Q++  AGT+T+S T+EWAMSLLL+ P+ L K R EID  VGH  L+++SDL  LPYL
Sbjct  300  GMMQVMLSAGTDTSSSTMEWAMSLLLNNPDALIKARAEIDRQVGHSRLVDDSDLPHLPYL  359

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            +C+I ET R+ P  P+L+PH S   C V GY VP+ T ++VN WA+  DPKVW+ P +FK
Sbjct  360  QCVIKETFRVCPVGPMLVPHESSAACTVGGYQVPRGTMLLVNTWAIQRDPKVWDHPMEFK  419

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF  I  EE +  ++  +PFG GRR CP  NM LR++ LAL + IQCF+W   + DK 
Sbjct  420  PERFIGI--EEKKEGSFALMPFGYGRRGCPGENMALRVIGLALASLIQCFEW--ARLDKE  475

Query  684  LCATYLSPSI-LQKDERLEAICTPRKNCLQFLSQL  785
            +     SP + + K + L A C PR    + L  +
Sbjct  476  MVDMAGSPGLTMPKTQPLVARCRPRLAVAELLKHI  510



>ref|XP_010070610.1| PREDICTED: isoflavone 2'-hydroxylase-like [Eucalyptus grandis]
 gb|KCW59498.1| hypothetical protein EUGRSUZ_H02246 [Eucalyptus grandis]
Length=506

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 146/212 (69%), Gaps = 5/212 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
              +Q + +AGT+T+SVT+EWA++ LL++  +L K R EID+ +G  HL++E DL+KLPYL
Sbjct  300  GFLQTILIAGTDTSSVTMEWALANLLNHSNILEKARMEIDSQIGQDHLIDELDLAKLPYL  359

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II ETLRL+PP PLL+PH+S +DC + GYDVP+ T VM+NAWA+H DP+ W +P  FK
Sbjct  360  QNIITETLRLHPPVPLLIPHHSSDDCTIGGYDVPRDTIVMINAWAIHRDPEQWPDPTAFK  419

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE+  G+     N   +PFG GRRACP   +  ++V L L + IQCF+WK T E+++
Sbjct  420  PERFESGGGQ----MNRLMLPFGMGRRACPGAPLAHKMVGLTLASLIQCFEWKRTGEEEV  475

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLS  779
                    + + K++ LEA+C  R+   + LS
Sbjct  476  DMGEGEGLT-MPKEKPLEALCKAREILNRVLS  506



>emb|CBI33746.3| unnamed protein product [Vitis vinifera]
Length=408

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 133/196 (68%), Gaps = 6/196 (3%)
 Frame = +3

Query  168  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIINETl  347
            AGT+TT+ TIEWAMSLLL++P+VL K R E+D +VG   L+ ESD  KL YLR II+ETL
Sbjct  212  AGTDTTATTIEWAMSLLLNHPDVLKKARAELDTHVGKDRLMEESDFPKLQYLRSIISETL  271

Query  348  rlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfeAIV  527
            RL+P  PLL+PH S ++C + GYD+P+ T ++VNAWA+H DPK W++   FKPERF    
Sbjct  272  RLFPATPLLIPHISSDNCQIGGYDIPRGTILLVNAWAIHRDPKSWKDATSFKPERF----  327

Query  528  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  707
             E GE   YK +PFG GRRACP   +  R++ L LG  IQC++W+   E ++  A     
Sbjct  328  -ENGESEAYKLLPFGFGRRACPGAGLANRVIGLTLGLLIQCYEWERVSEKEVDMAEGKGV  386

Query  708  SILQKDERLEAICTPR  755
            + + K E LEA+C  R
Sbjct  387  T-MPKLEPLEAMCKAR  401



>ref|XP_006425999.1| hypothetical protein CICLE_v10027560mg, partial [Citrus clementina]
 gb|ESR39239.1| hypothetical protein CICLE_v10027560mg, partial [Citrus clementina]
Length=502

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 136/186 (73%), Gaps = 5/186 (3%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + + A++  + +AG +T+++T+EWAM+ L+++PEVL   R E++  VG + L++ESDL
Sbjct  290  TDQNIKALMLTLIIAGIDTSAITLEWAMANLVNHPEVLKNARAELNAQVGQECLIDESDL  349

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            SKLPYLR I++ETLRL P APLL+PH S +DC V GYDVP+ TT++VNAWA+H DP++W+
Sbjct  350  SKLPYLRNIVSETLRLNPAAPLLIPHRSSDDCTVGGYDVPRDTTLLVNAWAIHRDPELWD  409

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
            EP  FKPERF     E  E   +K +PFG GRRACP  ++  RLV   LG+ +QCF+WK 
Sbjct  410  EPTCFKPERF-----ESSESEAHKLMPFGLGRRACPGASLAQRLVGSTLGSLLQCFEWKR  464

Query  666  TKEDKI  683
              EDKI
Sbjct  465  IGEDKI  470



>ref|XP_010437239.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
Length=495

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 141/204 (69%), Gaps = 7/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+  + VAGTET+ VT+EWAMS LL++PE+L K+R EI++ +G   L+ ESD+  LPYL
Sbjct  292  GIILALVVAGTETSEVTLEWAMSNLLNHPEILEKVRAEINDKIGSDRLIEESDIVNLPYL  351

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            +  ++ETLRLYP  PLLLPH S ++C VAGYD+P+ T ++ NAWAMH DP +WEEPE+FK
Sbjct  352  QNTVSETLRLYPAVPLLLPHLSSDECKVAGYDMPRDTILLTNAWAMHRDPGLWEEPERFK  411

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG   K +PFG GRRACP   +G RLV+LALG+ IQCF+W+   E+ +
Sbjct  412  PERF------EKEGEAQKLIPFGMGRRACPGAELGKRLVTLALGSLIQCFEWERVGEE-L  464

Query  684  LCATYLSPSILQKDERLEAICTPR  755
            L  T      + K   L A+C  R
Sbjct  465  LDMTEAEGITMPKAIPLRAMCKTR  488



>gb|AFW84519.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=520

 Score =   172 bits (435),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 145/214 (68%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            A+V  +  AGTETTS T+EWAMSLLL++P+VL + + EI++NVG   LL+++DL +LPYL
Sbjct  313  ALVSNLLAAGTETTSTTLEWAMSLLLNHPDVLKRAQEEIESNVGRDRLLDKNDLPRLPYL  372

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CII+ETLRLYPP P+LLPH +  DC + GYDVP  + V+VNA+A+H DP +WE+PE+F+
Sbjct  373  HCIISETLRLYPPTPMLLPHEASTDCKIHGYDVPAGSMVLVNAYAIHRDPAMWEDPEEFR  432

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E G       +PFG GRR CP  N+ +R + L LGA +QCFDW    + ++
Sbjct  433  PERF-----ELGRAEGKFMMPFGMGRRRCPGENLAMRTMGLVLGALLQCFDWTRVGDREV  487

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              AT  + +I+     LEA C PR N    L ++
Sbjct  488  DMATA-TGTIMSYAVPLEAQCKPRANMSAVLQKI  520



>ref|XP_004970623.1| PREDICTED: isoflavone 2'-hydroxylase-like [Setaria italica]
Length=521

 Score =   172 bits (435),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 143/214 (67%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            A+V  +  AGTETTS T+EW M+LLL++P+VL K + EID+NVG   LL+++DL  LPYL
Sbjct  314  ALVANILGAGTETTSTTMEWTMTLLLNHPDVLKKAQEEIDSNVGGDRLLDKNDLPHLPYL  373

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CIINETLRLYP AP+LLPH +  DC + GYDVP  + V+VNA+A+H DP +WE PE+F+
Sbjct  374  HCIINETLRLYPAAPMLLPHEASTDCKIHGYDVPVGSMVLVNAYAIHRDPAIWENPEEFR  433

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E G       +PFG GRR CP  N+ +R + L LG  +QCFDW    + ++
Sbjct  434  PERF-----EHGRAEGKFMMPFGMGRRKCPGENLAMRTMGLVLGVLLQCFDWSRIGDGEV  488

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              AT  + +I+ K   LEA+C PR +    L ++
Sbjct  489  DMATG-TGTIMFKAVPLEALCKPRAHMYAVLQKI  521



>dbj|BAN19901.1| cytochrome P450 [Echinochloa phyllopogon]
Length=522

 Score =   172 bits (435),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 142/214 (66%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            A+V  +   GTET+S T+EW M+LLL++PEVL K + EID+NVG   LL+++DL  LPYL
Sbjct  315  ALVANLLGVGTETSSTTMEWTMTLLLNHPEVLKKAQEEIDSNVGRGRLLDKNDLPHLPYL  374

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CIINETLRLYP AP+LLPH +  DC + GYDVP  + V+VNA+A+H DP +WE+PE+F+
Sbjct  375  HCIINETLRLYPAAPMLLPHEASTDCKIHGYDVPAGSMVLVNAYAIHRDPAIWEDPEEFR  434

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E G       +PFG GRR CP  N+ +R + L LG  +QCFDW    + +I
Sbjct  435  PERF-----EHGRAEGKFMMPFGMGRRKCPGENLAMRTMGLVLGVLLQCFDWNRIGDGQI  489

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              AT    +I+ K   LEA+C PR +    L ++
Sbjct  490  DMATGTG-TIMFKAVPLEALCKPRTDMSALLKKI  522



>gb|KCW45256.1| hypothetical protein EUGRSUZ_L010952, partial [Eucalyptus grandis]
Length=239

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 146/218 (67%), Gaps = 15/218 (7%)
 Frame = +3

Query  117  INSTLKQMYA------IVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGH  278
            I++ L + YA       +  +  AGT+T++VTIEWAMSLLL++P+V+ K + E+D+ VG 
Sbjct  27   IDTMLSEGYADDIIKGQINSMSSAGTDTSAVTIEWAMSLLLNHPDVMKKAQAELDDVVGR  86

Query  279  KHLLNESDLSKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWA  458
              L++E D  KLPYL  IINE LRL+PP PLL+PH S EDC V+G+DVP+ T ++VN WA
Sbjct  87   DRLVDEVDTHKLPYLHNIINEALRLFPPGPLLVPHESAEDCTVSGFDVPRGTMILVNVWA  146

Query  459  MHHDPKVWeepekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGA  638
            +  DPKVW++P  FKPER+E + G+      Y+ +PFG GRR+CP   +  R+VSLAL  
Sbjct  147  IQRDPKVWDDPTSFKPERYEGLEGDHA----YRLLPFGMGRRSCPGAGLANRVVSLALAV  202

Query  639  YIQCFDWKNTKEDKILCA--TYLSPSILQKDERLEAIC  746
             IQC +WK   E+ +  +  T L+   + K E LEA+C
Sbjct  203  LIQCLEWKRVSEEPMDLSEGTGLT---MPKREPLEAMC  237



>ref|XP_008781034.1| PREDICTED: cytochrome P450 81D1-like [Phoenix dactylifera]
Length=236

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 140/211 (66%), Gaps = 6/211 (3%)
 Frame = +3

Query  153  QMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCI  332
            Q +  AGT+T+S T+EWAMSLLL+ P+ L K R EID  VG   LL E+D S LPYL+C+
Sbjct  32   QSLLAAGTDTSSDTVEWAMSLLLNNPQTLKKAREEIDACVGKGRLLEEADFSNLPYLQCV  91

Query  333  INETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  512
            I ETLRLYP  PLLLPH S ++C V G+ +P    ++VNA+++H DPKVWEEP +F PER
Sbjct  92   ITETLRLYPTTPLLLPHESSQECSVGGFHIPHGMMMLVNAYSVHRDPKVWEEPTRFMPER  151

Query  513  feAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  692
            F     E G+G     +PFG GRR CP   + +R+VSLALGA IQCF+W+ T ++++   
Sbjct  152  F-----EGGKGEGKLMIPFGMGRRRCPGEGLAVRVVSLALGALIQCFEWERTGKEEV-DM  205

Query  693  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
            T  S   L K   LEA+  P ++ L  L +L
Sbjct  206  TEGSGLTLPKAIPLEAMYRPHQSMLDTLKKL  236



>gb|KFK30357.1| hypothetical protein AALP_AA7G250900 [Arabis alpina]
Length=495

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 141/204 (69%), Gaps = 7/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+  + +AGT+T++VT+EWAMS LL++PE+L K R EID+ +G   L+ ESD+  LPYL
Sbjct  292  GIIIALLIAGTDTSAVTLEWAMSNLLNHPEILQKARTEIDDKIGLDRLVEESDIVNLPYL  351

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I++ETLRLYP  PLLLPH+S EDC V GYD+P+ T ++ NAWAMH DP +WEEPE+FK
Sbjct  352  QNIVSETLRLYPAVPLLLPHFSSEDCKVGGYDMPRGTMLLANAWAMHRDPSLWEEPERFK  411

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG   K +PFG GRRACP   +G +LVSLALG  +QCF+W+   E+ +
Sbjct  412  PERF------EKEGEAQKLMPFGMGRRACPGAELGKKLVSLALGCLVQCFEWERVGEE-L  464

Query  684  LCATYLSPSILQKDERLEAICTPR  755
            +  +      + K   L A+C  R
Sbjct  465  VDMSEDKGITMPKATPLRAMCKAR  488



>ref|XP_010059866.1| PREDICTED: isoflavone 2'-hydroxylase-like [Eucalyptus grandis]
 gb|KCW66311.1| hypothetical protein EUGRSUZ_F00137 [Eucalyptus grandis]
Length=504

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 142/213 (67%), Gaps = 4/213 (2%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            +++ ++  AGT+T++ T+EWAMS +L++PE+L K + EID  VGH  L++ESDL KL YL
Sbjct  295  SLMLVLLSAGTDTSAATMEWAMSAMLNHPEILKKAQAEIDEVVGHNRLISESDLPKLLYL  354

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             C++NET+R+YP  PLL+PH S E+C V GY VP+ T +++N +++ +DPK W +  KFK
Sbjct  355  HCVMNETMRMYPVGPLLVPHESAEECRVGGYRVPQGTMLLINLFSIQNDPKYWPDAAKFK  414

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PER     G EG    YK +PFG+GRR CP  N+ LR+V L LG+ IQCF+W    E+ +
Sbjct  415  PER---FEGMEGVRDGYKMMPFGSGRRGCPGENLALRMVGLTLGSLIQCFEWNRISEE-L  470

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQ  782
            +  T  +   + K + L A C PR   L  LSQ
Sbjct  471  IDMTEGTGLTMPKAQPLLAKCRPRSFALGLLSQ  503



>gb|KDP41666.1| hypothetical protein JCGZ_16073 [Jatropha curcas]
Length=508

 Score =   171 bits (434),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 146/214 (68%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
            A+V ++ VAG+E+++ T+EW MSLLL++PE + K+  EID  VG   LL+E+DLSKL YL
Sbjct  301  AVVLVLLVAGSESSATTMEWTMSLLLNHPETMKKVVTEIDTYVGFNRLLDETDLSKLTYL  360

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + +INET RLYP  PLLLPH S +DC + G+DVPK T ++VN W +H DPK+W EP KF 
Sbjct  361  QNVINETFRLYPTFPLLLPHESSDDCSICGFDVPKGTVLLVNLWTIHRDPKLWVEPTKFL  420

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERFE+   EE +G  YK +PFG GRRACP   +  +++ LALGA IQ F+W     ++I
Sbjct  421  PERFES---EESDG--YKLIPFGIGRRACPGAVLARKVMVLALGALIQAFEWGRINNEEI  475

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
              A   +   + K E LEA+C PR+  +  LS L
Sbjct  476  NMAQG-NGLTMPKAEPLEAMCKPRQARVGLLSAL  508



>ref|XP_007225038.1| hypothetical protein PRUPE_ppa019886mg [Prunus persica]
 gb|EMJ26237.1| hypothetical protein PRUPE_ppa019886mg [Prunus persica]
Length=494

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 147/217 (68%), Gaps = 6/217 (3%)
 Frame = +3

Query  138  MYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLP  317
            +  I+Q++  AGTET+  T+EWA+SLLL+ PE L K + EID ++G   L+ ESDL+KLP
Sbjct  283  IRGIMQVMLAAGTETSFGTMEWALSLLLNNPEALVKAQSEIDIHIGQSRLIEESDLAKLP  342

Query  318  YLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepek  497
            +L  IINETLR+YP  PLL+PH S EDC V G++VP+ T ++VN WA+ ++P +W +PE+
Sbjct  343  HLHGIINETLRMYPAGPLLVPHESSEDCSVGGFNVPRGTMLLVNIWAIQNNPNLWSQPEQ  402

Query  498  fkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  677
            F+PERF  + GE  +GF+   +PFGTGRR CP   +  R++ LALG+ IQCFDW+   E+
Sbjct  403  FRPERFLNVQGER-DGFS--LLPFGTGRRGCPGEGLANRILGLALGSLIQCFDWERIGEE  459

Query  678  KILCATYLSPSI-LQKDERLEAICTPRKNCLQFLSQL  785
             +  +    P + + +   L A C PR   L  LSQL
Sbjct  460  MVDMSE--GPGLTMPRAHPLLAKCRPRPTMLNLLSQL  494



>ref|XP_009354183.1| PREDICTED: uncharacterized protein LOC103945350 [Pyrus x bretschneideri]
Length=1521

 Score =   176 bits (446),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 145/205 (71%), Gaps = 4/205 (2%)
 Frame = +3

Query  144   AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKH-LLNESDLSKLPY  320
              I+ ++ VAGT+TTS T+EWAM+LLL++P  + KLR EID   G  H LL E DL  L Y
Sbjct  1313  GIILVLLVAGTDTTSTTLEWAMALLLNHPGAMAKLRAEIDTKTGSDHRLLEEQDLPNLNY  1372

Query  321   LRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekf  500
             L+ +INET RLYP  P+ +PH + EDCVV G+DVP+HT +++NAW++H +P++WE+PEKF
Sbjct  1373  LQNVINETYRLYPSFPIPVPHENSEDCVVGGFDVPRHTMLVINAWSIHRNPEIWEDPEKF  1432

Query  501   kperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDK  680
             KPERFE   GE  EG  YK +PFG GRR CP  ++  RLV LALG+ +Q F+W+   E++
Sbjct  1433  KPERFEGWSGEGSEG--YKLIPFGAGRRRCPGASLANRLVGLALGSVVQSFEWERIGEEE  1490

Query  681   ILCATYLSPSILQKDERLEAICTPR  755
             +  +  L  + + + + LEAIC PR
Sbjct  1491  VDMSEGLGLT-MPRVKPLEAICKPR  1514



>ref|XP_010514586.1| PREDICTED: cytochrome P450 81D11-like isoform X1 [Camelina sativa]
 ref|XP_010514587.1| PREDICTED: cytochrome P450 81D11-like isoform X2 [Camelina sativa]
Length=501

 Score =   171 bits (433),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT+T++ T+EWAMS LL++PEVL K + EIDN +G   L+ E D+ KLPYL
Sbjct  292  GIILVMILAGTDTSAGTLEWAMSNLLNHPEVLQKAKTEIDNQIGLDSLIEEQDIVKLPYL  351

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I++ETLRLYP AP+LLPH + EDCV+ GYDVP+ T ++VNAWA+H DPK+WEEP KFK
Sbjct  352  QNIVSETLRLYPVAPMLLPHLASEDCVLDGYDVPRGTIILVNAWAIHRDPKLWEEPGKFK  411

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E +G + K + FG GRRACP + +  RLV+LALG+ IQ F+W+   E+ +
Sbjct  412  PERF------EKKGEDKKLMAFGIGRRACPGSGLAQRLVTLALGSLIQSFEWERVGEEHL  465

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                    + ++K + L+A+C  R
Sbjct  466  DMRESEKGTTMRKAKSLQAMCRAR  489



>dbj|BAE48235.1| cytochrome P450 [Sesamum radiatum]
Length=506

 Score =   171 bits (433),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 141/214 (66%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++  + +AGT+ + VT EWAMSL+L++P+VL K R E+D  VGH+ +++E DL KL YL
Sbjct  296  GLIVALIIAGTDASVVTTEWAMSLILNHPQVLEKARKELDTLVGHERMVDEHDLPKLRYL  355

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CI+ ETLRL+P  P L+PH   EDC + GY+VPK T ++VNAWA+H DPKVW++P  FK
Sbjct  356  HCIVLETLRLFPSVPTLVPHEPSEDCKIGGYNVPKGTMILVNAWAIHRDPKVWDDPLSFK  415

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            P+RFE +  E      +K +PFG GRRACP   +  + V LALG+ IQCF+W+    +KI
Sbjct  416  PDRFETMEVE-----THKLLPFGMGRRACPGAGLAQKFVGLALGSLIQCFEWERMSAEKI  470

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                  S   L K + LEA+C PR    + L Q+
Sbjct  471  DLNEG-SGITLPKAKTLEAMCKPRHIMERVLRQV  503



>ref|XP_010446668.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
 ref|XP_010446669.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
 ref|XP_010446670.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
 ref|XP_010446671.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
Length=499

 Score =   171 bits (433),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 144/208 (69%), Gaps = 7/208 (3%)
 Frame = +3

Query  159  VFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCIIN  338
            + +AGT+T++VT+EWA+S LL++PEVL+K R EID  VG   L++ESD+S LPYL+ I++
Sbjct  296  LILAGTDTSAVTLEWALSNLLNHPEVLNKARDEIDRTVGLDRLMDESDISNLPYLQNIVS  355

Query  339  ETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfe  518
            ETLRLYP  P+LLPH + EDC V GYD+P+ T ++ NAWA+H DP++W++P  FKPERF 
Sbjct  356  ETLRLYPAVPMLLPHVASEDCKVGGYDMPQGTILLTNAWAIHRDPQLWDDPTSFKPERF-  414

Query  519  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  698
                 E EG  +K +PFG GRRACP + + LRLV+L LG  IQC +W+   E+K+  +  
Sbjct  415  -----EKEGEAHKLMPFGLGRRACPGSVLALRLVNLTLGTLIQCLEWERIGEEKVDMSES  469

Query  699  LSPSILQKDERLEAICTPRKNCLQFLSQ  782
                 + K + LEA+C  R    +F  +
Sbjct  470  -KGGTMPKAKPLEAMCRSRAFVGKFFHE  496



>ref|XP_008238686.1| PREDICTED: cytochrome P450 81D11-like [Prunus mume]
Length=499

 Score =   171 bits (432),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 146/212 (69%), Gaps = 6/212 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++ ++ +AGT+T++VT+EWA+S LL+ P VL K + E+D  +G ++L++E DLSKLPYL
Sbjct  294  GLILVLLLAGTDTSAVTLEWALSNLLNNPHVLKKAKAELDVQLGQENLVDEPDLSKLPYL  353

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + II+ETLRL P APLL+PH S EDC++ G+DVP+ T V++NAWA+H DP +W++PE F 
Sbjct  354  QSIISETLRLCPAAPLLVPHLSSEDCIIGGFDVPRDTMVLINAWALHRDPGLWDDPESFM  413

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF     E G+ F++K +PFG GRR+CP   +  R+V L LG+ IQCF+W+   E +I
Sbjct  414  PERF-----ESGDNFSHKLLPFGLGRRSCPGVGLAQRVVGLTLGSLIQCFEWERVSEKEI  468

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLS  779
               T      + K   LEA+C  R    + LS
Sbjct  469  -DMTEDKGLTMPKAVPLEAMCKSRLIARKVLS  499



>ref|XP_006374853.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52650.1| cytochrome P450 family protein [Populus trichocarpa]
Length=511

 Score =   171 bits (432),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 144/202 (71%), Gaps = 4/202 (2%)
 Frame = +3

Query  150  VQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRC  329
            V ++ +AGT+T+S T+EWA+SLLL++P VL K + EID ++GH  L++E DL++LPYLR 
Sbjct  303  VWVLLLAGTDTSSATMEWALSLLLNHPRVLEKAQREIDEHIGHDRLMDEGDLAQLPYLRS  362

Query  330  IINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkpe  509
            I+NETLR+YPPAPLL+PH S E+C+V G+ +P+ T + VN WA+ +DPK+W +P KF+PE
Sbjct  363  ILNETLRMYPPAPLLIPHESSEECLVGGFRIPRGTMLSVNMWAIQNDPKIWPDPTKFRPE  422

Query  510  rfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILC  689
            RF+     EG    +K +PFG GRR+CP   + L++V LALG+ +QCF W+    DK++ 
Sbjct  423  RFD---NPEGARDGFKLMPFGHGRRSCPGEGLALKVVGLALGSLLQCFKWQKI-SDKMVD  478

Query  690  ATYLSPSILQKDERLEAICTPR  755
             T        K + LEAIC PR
Sbjct  479  MTEGPGFTSTKAQPLEAICRPR  500



>gb|EYU25480.1| hypothetical protein MIMGU_mgv1a020641mg [Erythranthe guttata]
Length=644

 Score =   172 bits (436),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 143/212 (67%), Gaps = 3/212 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ +V +AGT+T++VT+EW+MSLLL++P+VL+K + E+D  VG   L+NE D++KLPYL
Sbjct  277  GIILVVLMAGTDTSAVTMEWSMSLLLNHPDVLNKAKTELDRYVGESRLVNEHDITKLPYL  336

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            R IINETLRLYP  PLL+P  S  DC +  +DVP  T ++VNAWA+H DP+VW +PE+F 
Sbjct  337  RGIINETLRLYPAIPLLVPRESSHDCKIGPFDVPGQTMLLVNAWAIHRDPRVWVDPERFD  396

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            P+R+    G E E + Y+ VPFG GRR CP + +  R+V+LAL A IQCF+W+     + 
Sbjct  397  PDRY---AGLEDEDYRYRLVPFGAGRRKCPGSGLANRVVALALAALIQCFEWERIGGGEA  453

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLS  779
            +         + K   LEA+C  R++ +   S
Sbjct  454  VDMAEGGGLSMPKAVPLEAMCRAREDMMHLDS  485



>ref|XP_006590643.1| PREDICTED: isoflavone 2'-hydroxylase [Glycine max]
Length=496

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 139/210 (66%), Gaps = 6/210 (3%)
 Frame = +3

Query  126  TLKQMYAIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDL  305
            T + +  ++  ++VAGTET++V +EWAMS LL+ PEVL K R E+D  VG   L+ E+D+
Sbjct  286  TDQTIKGLIMALYVAGTETSAVALEWAMSNLLNSPEVLEKARVELDTQVGQDRLIEEADV  345

Query  306  SKLPYLRCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWe  485
            +KL YL+ II+ETLRL+PP  +LLPH S EDC V  YDVP++T +MVNAWA+H DPK+W 
Sbjct  346  TKLQYLQNIISETLRLHPPLSMLLPHLSSEDCTVGSYDVPRNTMLMVNAWAIHRDPKIWA  405

Query  486  epekfkperfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN  665
            +P  FKPERF     E G    +K + FG GRRACP   M  R + L LG+ IQCF+WK 
Sbjct  406  DPTSFKPERF-----ENGPVDAHKLISFGLGRRACPGAGMAQRTLGLTLGSLIQCFEWKR  460

Query  666  TKEDKILCATYLSPSILQKDERLEAICTPR  755
              E+K+   T    +I+ K   L+A C  R
Sbjct  461  IGEEKV-DMTEGGGTIVPKAIPLDAQCKAR  489



>gb|KFK28144.1| hypothetical protein AALP_AA8G478000 [Arabis alpina]
Length=499

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 143/204 (70%), Gaps = 3/204 (1%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++  + +AGTET++VT+EWAM+ LL +PEVL K R EID  +G   L++E D++ LPYL
Sbjct  291  GLMMAMMLAGTETSAVTLEWAMTNLLKHPEVLKKARLEIDEKIGEDRLIDEPDIAILPYL  350

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
            + I++ET RL+P APLL+P    ED  + GYDVP++T V+VNAWA+H DP++WE+PEKF 
Sbjct  351  QNIVSETFRLFPVAPLLIPRTPTEDMKIGGYDVPRNTIVLVNAWAIHRDPELWEDPEKFD  410

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            P+R++   G   + + +K +PFG GRR CP   +G R+V+LALG+ IQCFDW+N KE +I
Sbjct  411  PDRYDDRCG--SDYYVHKLMPFGNGRRTCPGAGLGQRIVTLALGSLIQCFDWENLKEGEI  468

Query  684  LCATYLSPSILQKDERLEAICTPR  755
              +      + + D  L A+C PR
Sbjct  469  DMSESAGLGMRKMDP-LRAMCRPR  491



>dbj|BAJ09068.1| cytochrome P450 [Sesamum schinzianum]
Length=506

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 140/214 (65%), Gaps = 6/214 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             ++  + +AGT+ + VT EWAMSLLL++P+VL K R E+D  VGH+ +++E DL KL YL
Sbjct  296  GLIVALIIAGTDASVVTTEWAMSLLLNHPQVLEKARNELDTLVGHERMVDEHDLPKLRYL  355

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
             CI+ ETLRL+P  P L+PH   EDC + GY+VPK T ++VNAWA+H DPKVW++P  FK
Sbjct  356  HCIVLETLRLFPSVPTLVPHEPSEDCKIGGYNVPKGTMILVNAWAIHRDPKVWDDPLSFK  415

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            P+RFE +  E      +K +PFG GRRACP   +  + V L LG+ IQCF+W+    +KI
Sbjct  416  PDRFETMEVE-----THKLLPFGMGRRACPGAGLAQKFVGLTLGSLIQCFEWERMSAEKI  470

Query  684  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  785
                  S   L K + LEA+C PR    + L Q+
Sbjct  471  DLNEG-SGITLPKAKTLEAMCKPRHVMEKLLRQV  503



>gb|KFK33753.1| hypothetical protein AALP_AA5G055600 [Arabis alpina]
Length=501

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 140/204 (69%), Gaps = 6/204 (3%)
 Frame = +3

Query  144  AIVQMVFVAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYL  323
             I+ ++ +AGT+T++ T+EWAMS LL++PEVL K + EID  +G   L+ E D+ KLPYL
Sbjct  291  GIILVMILAGTDTSAGTLEWAMSNLLNHPEVLQKAKAEIDTQIGLNRLIEEQDIVKLPYL  350

Query  324  RCIINETlrlyppaplllpHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfk  503
              I++ETLRLYP AP+LLPH + +DC+VAGYDVP+ T ++VNAWA+H DPK WE+ E FK
Sbjct  351  HNIVSETLRLYPVAPMLLPHLASKDCIVAGYDVPRDTIILVNAWAIHRDPKKWEDAEMFK  410

Query  504  perfeAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  683
            PERF      E EG + K + FG GRRACP + +  RLV+LALG+ +QCF+W+   E+  
Sbjct  411  PERF------EKEGEDKKLMAFGIGRRACPGSGLAQRLVTLALGSLVQCFEWERVGEENE  464

Query  684  LCATYLSPSILQKDERLEAICTPR  755
                    + ++K   L A+C  R
Sbjct  465  DMRESEKGTTMRKAMSLRAMCRAR  488



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2314958397494