BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25425_g1_i1 len=1039 path=[2361:0-1038]

Length=1039
                                                                      Score     E

ref|XP_009622088.1|  PREDICTED: fatty acid 2-hydroxylase 2-like         352   7e-118   
ref|XP_009776227.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         346   3e-115   
ref|XP_006360310.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         327   5e-108   
ref|XP_010315630.1|  PREDICTED: fatty acid 2-hydroxylase 1              326   2e-107   
emb|CDP12579.1|  unnamed protein product                                325   3e-107   
gb|EYU43216.1|  hypothetical protein MIMGU_mgv1a012910mg                324   1e-106   
gb|KHN14310.1|  Fatty acid 2-hydroxylase                                324   1e-105   
ref|XP_003546279.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    321   1e-105   
ref|XP_010906220.1|  PREDICTED: fatty acid 2-hydroxylase 1              320   4e-105   
ref|XP_009384024.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         320   4e-105   
ref|XP_011085181.1|  PREDICTED: fatty acid 2-hydroxylase 2-like         320   6e-105   
ref|XP_008793575.1|  PREDICTED: fatty acid 2-hydroxylase 1              319   8e-105   
ref|XP_004486480.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    318   2e-104   
ref|XP_006586857.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    318   3e-104   
ref|XP_007023075.1|  Fatty acid hydroxylase 1 isoform 1                 321   4e-104   
emb|CAN81862.1|  hypothetical protein VITISV_033282                     325   4e-104   Vitis vinifera
ref|XP_007147452.1|  hypothetical protein PHAVU_006G125900g             317   8e-104   
ref|XP_009413130.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         317   1e-103   
ref|XP_010923775.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    315   2e-103   
ref|XP_002267991.1|  PREDICTED: fatty acid 2-hydroxylase 1              315   3e-103   Vitis vinifera
ref|XP_006353000.1|  PREDICTED: fatty acid 2-hydroxylase 2-like         315   4e-103   
ref|XP_007147453.1|  hypothetical protein PHAVU_006G125900g             315   4e-103   
ref|XP_011037722.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         315   5e-103   
gb|KEH37077.1|  fatty acid 2-hydroxylase-like protein                   313   2e-102   
ref|XP_004233153.1|  PREDICTED: fatty acid 2-hydroxylase 1              313   2e-102   
ref|XP_006377936.1|  FATTY ACID HYDROXYLASE 1 family protein            312   5e-102   
gb|ACU24407.1|  unknown                                                 311   7e-102   Glycine max [soybeans]
ref|XP_007023076.1|  Fatty acid hydroxylase 1 isoform 2                 311   1e-101   
ref|XP_011039275.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    312   1e-101   
ref|XP_009362196.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         311   1e-101   
ref|XP_011006013.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         312   2e-101   
ref|XP_003594600.1|  Fatty acid 2-hydroxylase                           310   2e-101   
ref|XP_008787352.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         310   4e-101   
emb|CDP12584.1|  unnamed protein product                                309   9e-101   
ref|XP_007022904.1|  Fatty acid hydroxylase 1 isoform 1                 309   1e-100   
ref|XP_002300560.1|  FATTY ACID HYDROXYLASE 1 family protein            309   1e-100   Populus trichocarpa [western balsam poplar]
gb|KDP34614.1|  hypothetical protein JCGZ_11137                         308   2e-100   
ref|XP_011039276.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    308   2e-100   
ref|XP_003531074.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         308   2e-100   
emb|CBI31058.3|  unnamed protein product                                309   5e-100   
ref|XP_002523169.1|  sphingolipid fatty acid alpha hydroxylase          307   5e-100   Ricinus communis
gb|ACU24572.1|  unknown                                                 307   6e-100   Glycine max [soybeans]
ref|XP_006360318.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         307   8e-100   
ref|XP_009622087.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         306   1e-99    
ref|XP_011096698.1|  PREDICTED: fatty acid 2-hydroxylase 1              306   2e-99    
ref|XP_009389221.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         305   2e-99    
ref|XP_009805026.1|  PREDICTED: fatty acid 2-hydroxylase 1              305   3e-99    
ref|XP_006853317.1|  hypothetical protein AMTR_s00032p00050810          305   3e-99    
ref|XP_008439532.1|  PREDICTED: fatty acid 2-hydroxylase 2-like         305   3e-99    
ref|XP_009623139.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    305   4e-99    
ref|XP_003524783.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         305   4e-99    
ref|XP_009774862.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         305   4e-99    
ref|XP_008225651.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         304   7e-99    
ref|XP_004963262.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    304   8e-99    
ref|XP_006448865.1|  hypothetical protein CICLE_v10016492mg             303   2e-98    
ref|XP_003576810.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         303   2e-98    
emb|CDX84628.1|  BnaA03g16020D                                          303   2e-98    
ref|XP_009133002.1|  PREDICTED: fatty acid 2-hydroxylase 1              303   2e-98    
ref|XP_006468341.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    303   2e-98    
gb|EPS73321.1|  hypothetical protein M569_01435                         302   3e-98    
ref|XP_009623138.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    304   3e-98    
ref|XP_007211938.1|  hypothetical protein PRUPE_ppa010767mg             302   3e-98    
gb|KHN25858.1|  Fatty acid 2-hydroxylase                                302   3e-98    
ref|XP_004134612.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         302   4e-98    
ref|XP_007158989.1|  hypothetical protein PHAVU_002G198700g             302   4e-98    
ref|XP_006650678.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         302   5e-98    
ref|XP_002268031.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         302   6e-98    Vitis vinifera
emb|CDX79577.1|  BnaC03g19130D                                          301   7e-98    
gb|EYU19105.1|  hypothetical protein MIMGU_mgv1a012885mg                301   1e-97    
ref|XP_009353853.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         301   1e-97    
ref|XP_004963263.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    301   1e-97    
ref|XP_010247168.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         300   4e-97    
ref|XP_010687074.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    300   5e-97    
ref|XP_006468337.1|  PREDICTED: fatty acid 2-hydroxylase 2-like         299   5e-97    
ref|XP_008439531.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         298   1e-96    
ref|XP_006448866.1|  hypothetical protein CICLE_v10016504mg             298   1e-96    
ref|XP_010540644.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         298   2e-96    
ref|XP_006294911.1|  hypothetical protein CARUB_v10023963mg             297   3e-96    
gb|EMT29039.1|  Fatty acid 2-hydroxylase                                297   4e-96    
ref|XP_004293705.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         296   7e-96    
ref|XP_010053016.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         296   8e-96    
ref|XP_004981551.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         296   9e-96    
ref|XP_010098539.1|  Fatty acid 2-hydroxylase                           296   1e-95    
emb|CDY46240.1|  BnaCnng13910D                                          296   1e-95    
ref|XP_010516639.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         296   1e-95    
gb|ADE77668.1|  unknown                                                 295   2e-95    
ref|XP_009141398.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         295   2e-95    
ref|XP_002867872.1|  hypothetical protein ARALYDRAFT_914595             295   2e-95    
ref|NP_001051453.1|  Os03g0780800                                       295   2e-95    Oryza sativa Japonica Group [Japonica rice]
gb|AFK47890.1|  unknown                                                 295   2e-95    
ref|XP_010687203.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         295   2e-95    
ref|XP_010509705.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         295   2e-95    
ref|XP_004134610.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         295   2e-95    
ref|XP_010504961.1|  PREDICTED: fatty acid 2-hydroxylase 1              295   2e-95    
gb|EAY92050.1|  hypothetical protein OsI_13744                          295   2e-95    Oryza sativa Indica Group [Indian rice]
ref|NP_193819.1|  fatty acid hydroxylase 2                              295   3e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284450.1|  hypothetical protein CARUB_v10005630mg             295   4e-95    
ref|XP_010538659.1|  PREDICTED: fatty acid 2-hydroxylase 2              294   8e-95    
ref|XP_006664224.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         293   9e-95    
ref|XP_009140305.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         293   1e-94    
emb|CDX84282.1|  BnaC04g10440D                                          293   1e-94    
ref|NP_181023.1|  fatty acid hydroxylase 1                              293   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439556.1|  PREDICTED: fatty acid 2-hydroxylase 2-like         293   2e-94    
ref|NP_001067329.1|  Os12g0628400                                       293   2e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002879514.1|  hypothetical protein ARALYDRAFT_345212             293   2e-94    
ref|XP_010434263.1|  PREDICTED: fatty acid 2-hydroxylase 2              293   2e-94    
ref|XP_009134054.1|  PREDICTED: fatty acid 2-hydroxylase 2              292   2e-94    
ref|XP_010519049.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         293   3e-94    
ref|XP_006413844.1|  hypothetical protein EUTSA_v10026120mg             292   3e-94    
emb|CDY15865.1|  BnaA04g12460D                                          292   3e-94    
dbj|BAJ95608.1|  predicted protein                                      292   4e-94    
ref|XP_010449146.1|  PREDICTED: fatty acid 2-hydroxylase 2-like         292   5e-94    
emb|CDX82786.1|  BnaC01g12360D                                          291   5e-94    
gb|EMT00937.1|  Fatty acid 2-hydroxylase                                291   7e-94    
gb|KDO75197.1|  hypothetical protein CISIN_1g041340mg                   291   8e-94    
ref|NP_001149139.1|  inositolphosphorylceramide-B C-26 hydroxylase      290   3e-93    Zea mays [maize]
ref|XP_008676783.1|  PREDICTED: inositolphosphorylceramide-B C-26...    290   3e-93    
ref|XP_004504720.1|  PREDICTED: fatty acid 2-hydroxylase 2-like         289   5e-93    
ref|XP_003558416.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         289   7e-93    
gb|EMS61991.1|  Fatty acid 2-hydroxylase                                290   8e-93    
dbj|BAK07445.1|  predicted protein                                      288   1e-92    
ref|XP_009143742.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         286   1e-91    
ref|XP_002466355.1|  hypothetical protein SORBIDRAFT_01g006300          285   2e-91    Sorghum bicolor [broomcorn]
ref|XP_004293708.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         284   4e-91    
ref|XP_002442581.1|  hypothetical protein SORBIDRAFT_08g022360          284   5e-91    Sorghum bicolor [broomcorn]
ref|XP_008662191.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         285   1e-90    
ref|NP_001130161.1|  uncharacterized protein LOC100191255               282   3e-90    Zea mays [maize]
ref|XP_008808518.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         282   3e-90    
ref|XP_006597671.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    279   2e-89    
gb|KDO75200.1|  hypothetical protein CISIN_1g023817mg                   281   2e-89    
ref|XP_002976346.1|  hypothetical protein SELMODRAFT_104830             278   8e-89    
ref|XP_002987190.1|  hypothetical protein SELMODRAFT_125528             278   9e-89    
gb|EYU43217.1|  hypothetical protein MIMGU_mgv1a012910mg                278   1e-88    
ref|XP_008807188.1|  PREDICTED: fatty acid 2-hydroxylase 1              278   2e-88    
gb|EYU19104.1|  hypothetical protein MIMGU_mgv1a012885mg                276   6e-88    
ref|XP_010926886.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         274   3e-87    
gb|ACN28214.1|  unknown                                                 266   4e-84    Zea mays [maize]
ref|XP_004293707.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         264   2e-83    
ref|XP_006410630.1|  hypothetical protein EUTSA_v10017638mg             264   5e-82    
ref|XP_010687075.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    257   1e-80    
ref|XP_001769286.1|  predicted protein                                  257   1e-80    
gb|ACJ86272.1|  unknown                                                 248   4e-77    Medicago truncatula
gb|EPS73322.1|  hypothetical protein M569_01436                         246   1e-76    
ref|XP_010923777.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    244   4e-76    
gb|EEE53651.1|  hypothetical protein OsJ_36952                          257   1e-75    Oryza sativa Japonica Group [Japonica rice]
gb|KHG17877.1|  Fatty acid 2-hydroxylase                                233   6e-71    
gb|KDO75201.1|  hypothetical protein CISIN_1g023817mg                   223   5e-68    
emb|CDY31640.1|  BnaA05g09070D                                          221   9e-67    
ref|XP_001757039.1|  predicted protein                                  222   2e-66    
ref|XP_001764590.1|  predicted protein                                  220   5e-66    
ref|XP_001763959.1|  predicted protein                                  219   9e-66    
ref|XP_010923776.1|  PREDICTED: fatty acid 2-hydroxylase 2-like i...    218   1e-65    
gb|EYU19106.1|  hypothetical protein MIMGU_mgv1a015626mg                213   2e-64    
ref|XP_006661481.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         209   3e-62    
ref|XP_006586858.1|  PREDICTED: fatty acid 2-hydroxylase 1-like i...    205   3e-61    
ref|XP_008349164.1|  PREDICTED: fatty acid 2-hydroxylase 1-like         201   2e-59    
ref|XP_001762706.1|  predicted protein                                  199   9e-58    
ref|XP_005838179.1|  hypothetical protein GUITHDRAFT_151008             194   7e-55    
gb|KEH31335.1|  fatty acid 2-hydroxylase-like protein                   189   1e-54    
ref|XP_010098538.1|  hypothetical protein L484_025978                   202   7e-54    
gb|ELK36174.1|  Fatty acid 2-hydroxylase                                176   9e-49    
ref|XP_006755885.1|  PREDICTED: fatty acid 2-hydroxylase                176   2e-48    
ref|XP_006641387.1|  PREDICTED: fatty acid 2-hydroxylase-like           176   4e-48    
ref|XP_006091288.1|  PREDICTED: fatty acid 2-hydroxylase                175   2e-47    
ref|XP_005862777.1|  PREDICTED: fatty acid 2-hydroxylase                176   3e-47    
ref|XP_008137885.1|  PREDICTED: fatty acid 2-hydroxylase                174   7e-47    
ref|XP_004987692.1|  fatty acid 2-hydroxylase                           171   1e-46    
gb|KFO63090.1|  Fatty acid 2-hydroxylase                                169   2e-46    
ref|XP_010395032.1|  PREDICTED: fatty acid 2-hydroxylase                171   2e-46    
ref|XP_002188183.1|  PREDICTED: fatty acid 2-hydroxylase                172   2e-46    Taeniopygia guttata
ref|XP_007938552.1|  PREDICTED: fatty acid 2-hydroxylase                172   2e-46    
gb|KFQ42624.1|  Fatty acid 2-hydroxylase                                169   3e-46    
ref|XP_010013467.1|  PREDICTED: fatty acid 2-hydroxylase                169   3e-46    
ref|XP_008284757.1|  PREDICTED: fatty acid 2-hydroxylase                172   3e-46    
ref|XP_008532332.1|  PREDICTED: fatty acid 2-hydroxylase                171   8e-46    
ref|XP_005490873.1|  PREDICTED: fatty acid 2-hydroxylase                169   1e-45    
ref|XP_008637111.1|  PREDICTED: fatty acid 2-hydroxylase                169   1e-45    
ref|XP_007071299.1|  PREDICTED: fatty acid 2-hydroxylase                171   2e-45    
ref|XP_005152461.1|  PREDICTED: fatty acid 2-hydroxylase                169   2e-45    
ref|XP_005526361.1|  PREDICTED: fatty acid 2-hydroxylase                170   2e-45    
gb|KFP79397.1|  Fatty acid 2-hydroxylase                                166   2e-45    
gb|ELW63012.1|  Fatty acid 2-hydroxylase                                168   3e-45    
ref|XP_005052570.1|  PREDICTED: fatty acid 2-hydroxylase                169   3e-45    
ref|XP_004704850.1|  PREDICTED: fatty acid 2-hydroxylase                171   3e-45    
ref|XP_008571004.1|  PREDICTED: fatty acid 2-hydroxylase isoform X2     167   3e-45    
ref|XP_004387897.1|  PREDICTED: fatty acid 2-hydroxylase                167   3e-45    
emb|CDQ73587.1|  unnamed protein product                                167   3e-45    
gb|KFW77475.1|  Fatty acid 2-hydroxylase                                166   3e-45    
ref|XP_009071914.1|  PREDICTED: fatty acid 2-hydroxylase                167   4e-45    
ref|XP_008309241.1|  PREDICTED: fatty acid 2-hydroxylase                169   4e-45    
gb|KFP06200.1|  Fatty acid 2-hydroxylase                                166   4e-45    
ref|XP_004437173.1|  PREDICTED: fatty acid 2-hydroxylase                169   4e-45    
ref|XP_002594272.1|  hypothetical protein BRAFLDRAFT_65126              168   5e-45    Branchiostoma floridae
ref|XP_001743665.1|  hypothetical protein                               164   6e-45    Monosiga brevicollis MX1
ref|XP_005422872.1|  PREDICTED: fatty acid 2-hydroxylase                169   6e-45    
ref|XP_009089101.1|  PREDICTED: fatty acid 2-hydroxylase                168   7e-45    
ref|XP_006860233.1|  PREDICTED: fatty acid 2-hydroxylase                169   7e-45    
ref|XP_001959617.1|  GF11951                                            168   7e-45    Drosophila ananassae
ref|XP_006878670.1|  PREDICTED: fatty acid 2-hydroxylase                168   7e-45    
emb|CAC20436.1|  fatty acid hydroxylase                                 166   9e-45    Homo sapiens [man]
ref|XP_006908884.1|  PREDICTED: fatty acid 2-hydroxylase                168   9e-45    
ref|XP_008571003.1|  PREDICTED: fatty acid 2-hydroxylase isoform X1     166   9e-45    
gb|EPQ05505.1|  WD repeat-containing protein 59                         176   1e-44    
gb|KFQ11883.1|  Fatty acid 2-hydroxylase                                165   2e-44    
ref|XP_005446869.1|  PREDICTED: fatty acid 2-hydroxylase                166   2e-44    
ref|XP_003939962.1|  PREDICTED: fatty acid 2-hydroxylase                167   2e-44    
gb|KFM02737.1|  Fatty acid 2-hydroxylase                                165   2e-44    
ref|XP_003967047.1|  PREDICTED: fatty acid 2-hydroxylase-like           164   2e-44    
ref|XP_009949957.1|  PREDICTED: fatty acid 2-hydroxylase                166   2e-44    
ref|XP_002826686.2|  PREDICTED: fatty acid 2-hydroxylase                165   2e-44    
ref|XP_005313561.1|  PREDICTED: fatty acid 2-hydroxylase                167   3e-44    
ref|XP_004070153.1|  PREDICTED: fatty acid 2-hydroxylase-like           167   3e-44    
ref|XP_008917941.1|  PREDICTED: fatty acid 2-hydroxylase                166   3e-44    
ref|XP_008498942.1|  PREDICTED: fatty acid 2-hydroxylase                165   3e-44    
ref|XP_008821193.1|  PREDICTED: fatty acid 2-hydroxylase isoform X2     167   3e-44    
ref|XP_009289134.1|  PREDICTED: fatty acid 2-hydroxylase                164   4e-44    
ref|XP_005233698.1|  PREDICTED: fatty acid 2-hydroxylase                165   4e-44    
ref|XP_010749537.1|  PREDICTED: fatty acid 2-hydroxylase                166   5e-44    
ref|XP_005073102.1|  PREDICTED: fatty acid 2-hydroxylase                166   5e-44    
gb|KFO82826.1|  Fatty acid 2-hydroxylase                                164   6e-44    
ref|XP_010882343.1|  PREDICTED: fatty acid 2-hydroxylase                166   6e-44    
gb|KFP19638.1|  Fatty acid 2-hydroxylase                                164   6e-44    
ref|XP_007463004.1|  PREDICTED: fatty acid 2-hydroxylase                166   7e-44    
gb|ERE78277.1|  fatty acid 2-hydroxylase-like protein                   166   7e-44    
ref|XP_003829573.1|  PREDICTED: fatty acid 2-hydroxylase                166   8e-44    
ref|XP_005318484.1|  PREDICTED: fatty acid 2-hydroxylase                166   8e-44    
ref|XP_010716352.1|  PREDICTED: fatty acid 2-hydroxylase                164   9e-44    
ref|XP_002711768.1|  PREDICTED: fatty acid 2-hydroxylase                166   9e-44    Oryctolagus cuniculus [domestic rabbit]
gb|EHH60563.1|  Fatty acid 2-hydroxylase                                163   9e-44    
ref|NP_077282.3|  fatty acid 2-hydroxylase                              166   1e-43    Homo sapiens [man]
gb|EHH31847.1|  Fatty acid 2-hydroxylase                                164   1e-43    
emb|CDQ59509.1|  unnamed protein product                                164   1e-43    
ref|XP_006152802.1|  PREDICTED: fatty acid 2-hydroxylase                165   1e-43    
ref|NP_001082707.1|  fatty acid 2-hydroxylase                           165   1e-43    Xenopus laevis [clawed frog]
ref|XP_003735373.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acid 2...    165   1e-43    
dbj|BAG37893.1|  unnamed protein product                                162   1e-43    Homo sapiens [man]
ref|XP_004517443.1|  PREDICTED: fatty acid 2-hydroxylase-like iso...    166   2e-43    
ref|XP_007991822.1|  PREDICTED: fatty acid 2-hydroxylase isoform X1     165   2e-43    
ref|XP_003126916.2|  PREDICTED: fatty acid 2-hydroxylase                165   2e-43    
ref|XP_004690440.1|  PREDICTED: fatty acid 2-hydroxylase                165   2e-43    
ref|XP_010583512.1|  PREDICTED: fatty acid 2-hydroxylase                164   2e-43    
ref|XP_003917223.1|  PREDICTED: fatty acid 2-hydroxylase isoform X1     164   2e-43    
ref|NP_001181351.1|  fatty acid 2-hydroxylase                           164   2e-43    
ref|XP_002138439.1|  GA24771                                            160   2e-43    Drosophila pseudoobscura pseudoobscura
ref|XP_004663637.1|  PREDICTED: fatty acid 2-hydroxylase                164   2e-43    
gb|ELU11413.1|  hypothetical protein CAPTEDRAFT_171473                  164   2e-43    
ref|XP_010381264.1|  PREDICTED: fatty acid 2-hydroxylase                164   2e-43    
ref|XP_004517438.1|  PREDICTED: fatty acid 2-hydroxylase-like iso...    166   2e-43    
ref|XP_009641612.1|  PREDICTED: fatty acid 2-hydroxylase                163   2e-43    
ref|XP_005608609.1|  PREDICTED: fatty acid 2-hydroxylase                167   3e-43    
emb|CDO93465.1|  unnamed protein product                                164   3e-43    
ref|XP_008065930.1|  PREDICTED: fatty acid 2-hydroxylase                164   4e-43    
tpg|DAA51738.1|  TPA: hypothetical protein ZEAMMB73_391712              157   4e-43    
ref|XP_002016412.1|  GL11562                                            160   4e-43    Drosophila persimilis
ref|XP_009468806.1|  PREDICTED: fatty acid 2-hydroxylase                162   4e-43    
ref|XP_003758940.1|  PREDICTED: fatty acid 2-hydroxylase                161   4e-43    
ref|XP_004058036.1|  PREDICTED: fatty acid 2-hydroxylase                165   4e-43    
ref|XP_007527648.1|  PREDICTED: fatty acid 2-hydroxylase                164   5e-43    
ref|XP_009568268.1|  PREDICTED: fatty acid 2-hydroxylase                162   5e-43    
ref|XP_009996609.1|  PREDICTED: fatty acid 2-hydroxylase                160   5e-43    
gb|KFR03013.1|  Fatty acid 2-hydroxylase                                162   6e-43    
emb|CDH50035.1|  fatty acid-2 hydroxylase                               163   6e-43    
ref|XP_001986080.1|  GH20733                                            163   6e-43    Drosophila grimshawi
ref|XP_003998295.1|  PREDICTED: fatty acid 2-hydroxylase                163   7e-43    
emb|CDS04747.1|  hypothetical protein LRAMOSA07277                      162   8e-43    
ref|XP_004584086.1|  PREDICTED: fatty acid 2-hydroxylase                163   9e-43    
ref|NP_001025677.1|  fatty acid 2-hydroxylase                           163   9e-43    Xenopus tropicalis [western clawed frog]
ref|XP_006974151.1|  PREDICTED: fatty acid 2-hydroxylase                163   1e-42    
gb|AAH54985.1|  LOC398669 protein                                       162   1e-42    Xenopus laevis [clawed frog]
gb|KFU90141.1|  Fatty acid 2-hydroxylase                                160   1e-42    
ref|XP_007558684.1|  PREDICTED: fatty acid 2-hydroxylase-like           160   1e-42    
ref|XP_005796290.1|  PREDICTED: fatty acid 2-hydroxylase-like           162   1e-42    
ref|XP_007902915.1|  PREDICTED: fatty acid 2-hydroxylase                162   1e-42    
ref|XP_005449435.1|  PREDICTED: fatty acid 2-hydroxylase-like           162   2e-42    
dbj|BAB71632.1|  unnamed protein product                                162   2e-42    Homo sapiens [man]
ref|NP_001129055.1|  fatty acid 2-hydroxylase                           162   2e-42    Rattus norvegicus [brown rat]
ref|XP_007102325.1|  PREDICTED: fatty acid 2-hydroxylase                162   2e-42    
ref|XP_005345713.1|  PREDICTED: fatty acid 2-hydroxylase                162   2e-42    
ref|XP_004273315.1|  PREDICTED: fatty acid 2-hydroxylase                162   2e-42    
ref|XP_004310584.1|  PREDICTED: fatty acid 2-hydroxylase                162   2e-42    
gb|ACF74287.1|  putative fatty acid hydroxylase                         154   3e-42    
ref|XP_006179273.1|  PREDICTED: fatty acid 2-hydroxylase                159   3e-42    
gb|KFH73666.1|  hypothetical protein MVEG_00880                         161   3e-42    
ref|XP_007435570.1|  PREDICTED: fatty acid 2-hydroxylase isoform X2     159   3e-42    
gb|AAI11913.1|  Fa2h protein                                            160   3e-42    
ref|XP_002049795.1|  GJ20550                                            161   4e-42    
ref|XP_453142.1|  hypothetical protein                                  161   4e-42    
ref|XP_008409900.1|  PREDICTED: fatty acid 2-hydroxylase isoform X1     161   4e-42    
gb|KFP52778.1|  Fatty acid 2-hydroxylase                                159   4e-42    
ref|XP_008409902.1|  PREDICTED: fatty acid 2-hydroxylase isoform X2     161   4e-42    
ref|NP_835187.2|  fatty acid 2-hydroxylase                              161   5e-42    
ref|XP_006797493.1|  PREDICTED: fatty acid 2-hydroxylase-like           161   5e-42    
ref|XP_002006048.1|  GI20817                                            160   6e-42    
ref|XP_009476635.1|  PREDICTED: fatty acid 2-hydroxylase                158   6e-42    
gb|KFQ59048.1|  Fatty acid 2-hydroxylase                                158   6e-42    
gb|ERL89118.1|  hypothetical protein D910_06495                         159   6e-42    
gb|ENN81003.1|  hypothetical protein YQE_02587                          159   7e-42    
ref|XP_004887462.1|  PREDICTED: fatty acid 2-hydroxylase isoform X5     160   8e-42    
ref|XP_004887461.1|  PREDICTED: fatty acid 2-hydroxylase isoform X4     160   8e-42    
gb|AEE62314.1|  unknown                                                 159   1e-41    
ref|XP_005751576.1|  PREDICTED: fatty acid 2-hydroxylase-like           160   1e-41    
ref|XP_005950974.1|  PREDICTED: fatty acid 2-hydroxylase-like           160   1e-41    
ref|XP_004564686.1|  PREDICTED: fatty acid 2-hydroxylase-like           160   1e-41    
gb|AAH46985.1|  Fa2h protein                                            160   1e-41    
gb|KFO24634.1|  WD repeat-containing protein 59                         167   1e-41    
gb|KFH66749.1|  hypothetical protein MVEG_07274                         159   2e-41    
ref|XP_007558660.1|  PREDICTED: fatty acid 2-hydroxylase isoform X2     160   2e-41    
gb|EPZ33414.1|  Cytochrome b5-like heme/steroid binding domain-co...    158   2e-41    
ref|XP_007558659.1|  PREDICTED: fatty acid 2-hydroxylase isoform X1     159   2e-41    
ref|XP_003791378.1|  PREDICTED: fatty acid 2-hydroxylase                159   2e-41    
gb|EIE78102.1|  hypothetical protein RO3G_02806                         157   2e-41    
ref|XP_006207546.1|  PREDICTED: fatty acid 2-hydroxylase                159   3e-41    
ref|XP_010988463.1|  PREDICTED: fatty acid 2-hydroxylase                158   3e-41    
ref|XP_010965461.1|  PREDICTED: fatty acid 2-hydroxylase                159   4e-41    
ref|XP_005403513.1|  PREDICTED: fatty acid 2-hydroxylase                158   6e-41    
ref|XP_002111586.1|  expressed hypothetical protein                     158   8e-41    
ref|XP_004600581.1|  PREDICTED: fatty acid 2-hydroxylase                157   8e-41    
ref|XP_414053.4|  PREDICTED: fatty acid 2-hydroxylase isoform X3        160   1e-40    
gb|EIE86791.1|  hypothetical protein RO3G_11502                         157   1e-40    
dbj|BAC41174.1|  unnamed protein product                                157   1e-40    
gb|AGO09808.1|  AaceriAAL183Wp                                          157   1e-40    
gb|AAH26629.1|  Fa2h protein                                            153   2e-40    
dbj|BAO38199.1|  inositolphosphorylceramide-B C-26 hydroxylase          157   2e-40    
ref|XP_008199753.1|  PREDICTED: fatty acid 2-hydroxylase isoform X1     155   2e-40    
ref|XP_446117.1|  hypothetical protein                                  157   2e-40    
ref|XP_008199754.1|  PREDICTED: fatty acid 2-hydroxylase isoform X2     155   2e-40    
ref|XP_002063618.1|  GK22010                                            156   3e-40    
ref|XP_002165311.2|  PREDICTED: LOW QUALITY PROTEIN: fatty acid 2...    156   3e-40    
ref|XP_008121394.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acid 2...    156   3e-40    
ref|XP_505342.1|  YALI0F12749p                                          155   4e-40    
ref|XP_006020246.1|  PREDICTED: fatty acid 2-hydroxylase                153   4e-40    
ref|XP_511106.3|  PREDICTED: LOW QUALITY PROTEIN: fatty acid 2-hy...    155   6e-40    
emb|CAF97505.1|  unnamed protein product                                151   6e-40    
ref|XP_002948090.1|  hypothetical protein VOLCADRAFT_79982              152   6e-40    
emb|CCG84267.1|  protein of unknown function                            154   1e-39    
ref|XP_005504953.1|  PREDICTED: fatty acid 2-hydroxylase                153   1e-39    
ref|XP_003472151.1|  PREDICTED: fatty acid 2-hydroxylase                154   1e-39    
gb|KDR20253.1|  Fatty acid 2-hydroxylase                                153   1e-39    
ref|XP_004754063.1|  PREDICTED: fatty acid 2-hydroxylase                156   2e-39    
ref|XP_001639353.1|  predicted protein                                  153   2e-39    
ref|XP_002080426.1|  GD10257                                            154   2e-39    
ref|XP_007648483.1|  PREDICTED: fatty acid 2-hydroxylase isoform X1     154   2e-39    
ref|XP_002032744.1|  GM20795                                            154   2e-39    
emb|CEG64930.1|  hypothetical protein RMATCC62417_01821                 153   2e-39    
ref|XP_005177004.1|  PREDICTED: fatty acid 2-hydroxylase-like           154   2e-39    
ref|XP_010642812.1|  PREDICTED: fatty acid 2-hydroxylase                154   3e-39    
gb|AAC23496.1|  Unknown gene product                                    151   4e-39    
gb|EZA53057.1|  Fatty acid 2-hydroxylase                                152   4e-39    
ref|XP_003700802.1|  PREDICTED: fatty acid 2-hydroxylase-like           152   5e-39    
ref|XP_004361565.1|  Fatty acid hydroxylase                             153   5e-39    
emb|CEJ03412.1|  hypothetical protein RMCBS344292_17397                 152   5e-39    
ref|XP_001657313.1|  fatty acid hydroxylase                             152   5e-39    
ref|XP_006262257.1|  PREDICTED: fatty acid 2-hydroxylase                152   6e-39    
ref|XP_006000200.1|  PREDICTED: fatty acid 2-hydroxylase-like iso...    150   6e-39    
gb|EFZ09262.1|  hypothetical protein SINV_10048                         152   7e-39    
ref|XP_002089468.1|  GE24014                                            152   9e-39    
ref|XP_003645235.1|  hypothetical protein Ecym_2712                     152   9e-39    
ref|NP_982359.1|  AAL183Wp                                              152   1e-38    
ref|XP_008821192.1|  PREDICTED: fatty acid 2-hydroxylase isoform X1     152   1e-38    
gb|EIE84047.1|  hypothetical protein RO3G_08752                         151   1e-38    
emb|CDW51742.1|  Fatty acid hydroxylase family protein                  150   1e-38    
ref|NP_610279.3|  fatty acid 2-hydroylase                               151   1e-38    
ref|XP_005537704.1|  similar to fatty acid hydroxylase                  150   1e-38    
gb|KFM23335.1|  Fatty acid 2-hydroxylase                                147   2e-38    
gb|EIF46773.1|  inositolphosphorylceramide-b c-26 hydroxylase           151   2e-38    
ref|XP_001645624.1|  hypothetical protein Kpol_541p9                    151   3e-38    
ref|XP_008383371.1|  PREDICTED: fatty acid 2-hydroxylase 2-like         144   3e-38    
ref|XP_004625842.1|  PREDICTED: fatty acid 2-hydroxylase                150   3e-38    
gb|EPB89297.1|  hypothetical protein HMPREF1544_03922                   150   3e-38    
ref|XP_006008364.1|  PREDICTED: fatty acid 2-hydroxylase-like           149   4e-38    
ref|XP_002498588.1|  ZYRO0G13948p                                       150   4e-38    
gb|EAW95677.1|  fatty acid 2-hydroxylase, isoform CRA_a                 150   5e-38    
gb|EPY85065.1|  hypothetical protein CB1_000407006                      149   7e-38    
ref|XP_001970629.1|  GG10749                                            149   8e-38    
ref|XP_009062811.1|  hypothetical protein LOTGIDRAFT_195020             149   9e-38    
emb|CCX04388.1|  Similar to Ceramide very long chain fatty acid h...    149   9e-38    
ref|XP_003855280.1|  hypothetical protein MYCGRDRAFT_69093              150   9e-38    
emb|CDR47603.1|  CYFA0S34e00540g1_1                                     149   1e-37    
emb|CEG74755.1|  Putative FMN-dependent dehydrogenase                   149   1e-37    
ref|XP_007006313.1|  hypothetical protein TREMEDRAFT_74429              149   1e-37    
gb|EJT47705.1|  oxidoreductase                                          149   1e-37    
emb|CEI89969.1|  Putative FMN-dependent dehydrogenase                   148   1e-37    
gb|ABC71132.1|  fatty acid 2-hydroxylase                                148   1e-37    
ref|XP_011108209.1|  hypothetical protein H072_2222                     149   1e-37    
gb|EMG48218.1|  Inositolphosphorylceramide-B C-26 hydroxylase           149   1e-37    
ref|XP_007290740.1|  fatty acid hydroxylase                             149   1e-37    
gb|ETN67075.1|  fatty acid hydroxylase                                  149   2e-37    
emb|CEI89203.1|  hypothetical protein RMCBS344292_03569                 149   2e-37    
ref|XP_006567207.1|  PREDICTED: fatty acid 2-hydroxylase-like iso...    148   2e-37    
ref|XP_007777608.1|  fatty acid hydroxylase                             149   2e-37    
gb|KGK36484.1|  hypothetical protein JL09_g4354                         153   2e-37    
ref|XP_003955816.1|  hypothetical protein KAFR_0B03850                  149   2e-37    
gb|ERZ98605.1|  hypothetical protein GLOINDRAFT_70397                   148   2e-37    
gb|EPB83305.1|  hypothetical protein HMPREF1544_09951                   148   3e-37    
ref|XP_006676866.1|  hypothetical protein BATDEDRAFT_36670              147   3e-37    
gb|KFD57979.1|  hypothetical protein M513_01212                         150   3e-37    
gb|EXX75243.1|  fatty acid alpha-hydroxylase                            147   3e-37    
gb|KFB35875.1|  hypothetical protein ZHAS_00002815                      147   5e-37    
ref|XP_009220553.1|  inositolphosphorylceramide-B C-26 hydroxylase      147   5e-37    
ref|XP_010849041.1|  PREDICTED: fatty acid 2-hydroxylase                144   6e-37    
emb|CEI99477.1|  Putative FMN-dependent dehydrogenase                   146   7e-37    
emb|CEG67547.1|  Putative L-lactate dehydrogenase                       147   7e-37    
emb|CDH08526.1|  probable Ceramide very long chain fatty acid hyd...    147   7e-37    
ref|XP_005894382.1|  PREDICTED: fatty acid 2-hydroxylase                144   8e-37    
ref|XP_002420080.1|  fatty acid hydroxylase, putative; inositolph...    147   8e-37    
emb|CDF89558.1|  ZYBA0S04-07184g1_1                                     147   8e-37    
ref|XP_003690049.1|  PREDICTED: fatty acid 2-hydroxylase-like           146   8e-37    
gb|EDL11498.1|  fatty acid 2-hydroxylase, isoform CRA_b                 147   9e-37    
gb|EGA85504.1|  Scs7p                                                   146   9e-37    
gb|EKC36310.1|  Fatty acid 2-hydroxylase                                145   9e-37    
ref|XP_002838676.1|  hypothetical protein                               145   9e-37    
ref|XP_005109613.1|  PREDICTED: fatty acid 2-hydroxylase-like           144   1e-36    
gb|KHN86110.1|  Fatty acid 2-hydroxylase                                145   1e-36    
ref|XP_005848202.1|  hypothetical protein CHLNCDRAFT_144683             144   1e-36    
ref|XP_004464839.1|  PREDICTED: fatty acid 2-hydroxylase                146   1e-36    
emb|CDH13681.1|  probable Ceramide very long chain fatty acid hyd...    146   2e-36    
ref|NP_013999.1|  fatty acid alpha-hydroxylase                          146   2e-36    
gb|ESW98874.1|  Ceramide very long chain fatty acid hydroxylase SCS7    145   2e-36    
ref|XP_010189817.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acid 2...    144   2e-36    
ref|XP_004015528.1|  PREDICTED: fatty acid 2-hydroxylase                144   2e-36    
ref|XP_007372963.1|  hypothetical protein SPAPADRAFT_58779              145   2e-36    
ref|XP_002552404.1|  KLTH0C04114p                                       145   2e-36    
ref|XP_003679408.1|  hypothetical protein TDEL_0B00680                  145   3e-36    
ref|XP_010595122.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acid 2...    145   3e-36    
ref|XP_567631.1|  oxidoreductase                                        147   3e-36    
ref|XP_772910.1|  hypothetical protein CNBK2810                         147   3e-36    
gb|KEQ67336.1|  fatty acid hydroxylase                                  145   3e-36    
gb|ADG21978.1|  fatty acid hydroxylase                                  145   3e-36    
ref|XP_001948157.1|  PREDICTED: fatty acid 2-hydroxylase                144   4e-36    
ref|XP_002927177.1|  PREDICTED: fatty acid 2-hydroxylase-like           145   4e-36    
emb|CCK72115.1|  hypothetical protein KNAG_0J00320                      145   4e-36    
gb|EHN00705.1|  Scs7p                                                   145   4e-36    
ref|XP_008558451.1|  PREDICTED: fatty acid 2-hydroxylase                146   4e-36    
gb|EPS97440.1|  hypothetical protein FOMPIDRAFT_1025049                 145   4e-36    
ref|XP_007435569.1|  PREDICTED: fatty acid 2-hydroxylase isoform X1     143   4e-36    
gb|AFR94115.1|  oxidoreductase                                          145   5e-36    
ref|XP_011103073.1|  scs7p                                              145   5e-36    
ref|XP_007634511.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acid 2...    143   5e-36    
gb|ELR57369.1|  Fatty acid 2-hydroxylase                                143   5e-36    
emb|CBY39416.1|  unnamed protein product                                144   6e-36    
gb|KEQ77547.1|  Inositolphosphorylceramide-B hydroxylase                145   6e-36    
emb|CCH45313.1|  Sphingolipid alpha-hydroxylase                         144   8e-36    
ref|XP_004887460.1|  PREDICTED: fatty acid 2-hydroxylase isoform X3     144   1e-35    
ref|XP_006666873.1|  inositolphosphorylceramide-B C-26 hydroxylase      144   1e-35    
ref|XP_005650830.1|  hypothetical protein COCSUDRAFT_39420              139   1e-35    
ref|XP_006063384.1|  PREDICTED: fatty acid 2-hydroxylase                144   1e-35    
ref|NP_001179384.1|  fatty acid 2-hydroxylase                           143   1e-35    
ref|XP_008041282.1|  oxidoreductase                                     143   1e-35    
gb|KHJ30544.1|  putative fatty acid hydroxylase                         144   1e-35    
ref|XP_004887458.1|  PREDICTED: fatty acid 2-hydroxylase isoform X1     145   1e-35    
ref|XP_008086354.1|  Cytochrome b5-like heme/steroid binding protein    144   1e-35    
gb|EPB89907.1|  hypothetical protein HMPREF1544_03290                   142   2e-35    
ref|XP_005718630.1|  fatty acid hydroxylase                             143   2e-35    
ref|XP_005980217.1|  PREDICTED: fatty acid 2-hydroxylase                142   2e-35    
ref|XP_003672481.1|  hypothetical protein NDAI_0K00470                  143   2e-35    
ref|XP_007099195.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acid 2...    141   2e-35    
ref|XP_003719946.1|  inositolphosphorylceramide-B C-26 hydroxylase      143   2e-35    
ref|XP_002126665.1|  PREDICTED: fatty acid 2-hydroxylase                142   2e-35    
ref|XP_001792999.1|  hypothetical protein SNOG_02392                    143   3e-35    
ref|XP_004944187.1|  PREDICTED: fatty acid 2-hydroxylase isoform X5     144   3e-35    
ref|XP_003685055.1|  hypothetical protein TPHA_0C04710                  142   3e-35    
ref|XP_006690488.1|  Inositolphosphorylceramide-B hydroxylase           142   3e-35    
ref|XP_003486708.1|  PREDICTED: fatty acid 2-hydroxylase-like           141   4e-35    
ref|WP_012383460.1|  fatty acid hydroxylase                             139   4e-35    
ref|XP_004944186.1|  PREDICTED: fatty acid 2-hydroxylase isoform X4     144   4e-35    
ref|XP_005218405.1|  PREDICTED: fatty acid 2-hydroxylase isoform X1     142   5e-35    
emb|CEJ80014.1|  Putative Cytochrome b5-like Heme/Steroid binding...    143   5e-35    
gb|KHC76221.1|  hypothetical protein MGS_03711                          142   5e-35    
gb|EWC43432.1|  hypothetical protein DRE_07618                          142   5e-35    
ref|XP_006008412.1|  PREDICTED: fatty acid 2-hydroxylase-like           142   5e-35    
gb|KHC50989.1|  hypothetical protein MEW_03619                          142   6e-35    
ref|NP_594423.1|  sphingosine hydroxylase Scs7                          141   6e-35    
gb|KFA66626.1|  hypothetical protein S40285_03090                       141   7e-35    
gb|KHC60800.1|  hypothetical protein MGE_03682                          142   7e-35    
ref|XP_717303.1|  likely fatty acid hydroxylase Scs7p                   142   7e-35    
ref|XP_004180337.1|  hypothetical protein TBLA_0D03180                  142   8e-35    
gb|KEY67419.1|  hypothetical protein S7711_05947                        141   8e-35    
ref|XP_006956640.1|  fatty acid-2 hydroxylase                           141   8e-35    
ref|XP_007844403.1|  inositolphosphorylceramide-b c-26 hydroxylase      141   8e-35    
ref|XP_005706581.1|  fatty acid hydroxylase (FAH1)                      140   9e-35    
ref|XP_007198334.1|  PREDICTED: LOW QUALITY PROTEIN: mixed lineag...    144   1e-34    
ref|XP_006744464.1|  PREDICTED: fatty acid 2-hydroxylase                141   1e-34    
emb|CCF50433.1|  probable SCS7-required for hydroxylation of cera...    141   1e-34    
gb|KGQ06740.1|  Ceramide very long chain fatty acid hydroxylase S...    140   1e-34    
ref|XP_002639872.1|  Hypothetical protein CBG12227                      139   1e-34    
gb|KFH73910.1|  hypothetical protein MVEG_01123                         140   1e-34    
ref|XP_008598303.1|  fatty acid hydroxylase                             140   1e-34    
ref|XP_009654218.1|  inositolphosphorylceramide-B C-26 hydroxylase      140   1e-34    
ref|XP_001264167.1|  fatty acid hydroxylase, putative                   140   2e-34    
ref|XP_007418381.1|  hypothetical protein MELLADRAFT_73617              140   2e-34    
ref|XP_004925251.1|  PREDICTED: fatty acid 2-hydroxylase-like           140   2e-34    
ref|NP_492678.1|  Protein C25A1.5                                       139   2e-34    
dbj|GAM18566.1|  hypothetical protein SAMD00019534_017410               140   2e-34    
dbj|GAA96237.1|  hypothetical protein E5Q_02901                         145   2e-34    
ref|XP_011124507.1|  hypothetical protein AOL_s00097g372                140   2e-34    
ref|XP_002492764.1|  Sphingolipid alpha-hydroxylase                     140   2e-34    
emb|CEF65054.1|  Fatty acid 2-hydroxylase                               139   3e-34    
ref|XP_752948.1|  fatty acid hydroxylase                                142   3e-34    
gb|EIE89336.1|  hypothetical protein RO3G_14047                         139   3e-34    
ref|XP_001375316.1|  PREDICTED: fatty acid 2-hydroxylase isoform X1     140   3e-34    



>ref|XP_009622088.1| PREDICTED: fatty acid 2-hydroxylase 2-like [Nicotiana tomentosiformis]
Length=236

 Score =   352 bits (904),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLGDAY+EWVH+PI++KESP+FFANG LEFLTRTPWWAIP+
Sbjct  1    MVAQGFTVDLNKPLVFQVGHLGDAYEEWVHQPIITKESPKFFANGLLEFLTRTPWWAIPS  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +W+PVV W  S S N GLP+P LA +L+A +  WTLLEY+LHRFLFH+K  GYW NT HY
Sbjct  61   VWVPVVGWLVSISANRGLPSPHLAATLVAGIFTWTLLEYSLHRFLFHMKPSGYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+L+PLW LVKLL P  Y  A LGG LLGYI+YDCT
Sbjct  121  LIHGCHHKHPMDGLRLVFPPAATAILLVPLWSLVKLLVPFTYAPAFLGGGLLGYIMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHGKPL GVS SLKR+HMDHHF+ QDKGFGIT+ FWD +FG
Sbjct  181  HYYLHHGKPLKGVSHSLKRYHMDHHFKVQDKGFGITSDFWDKIFG  225



>ref|XP_009776227.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Nicotiana sylvestris]
Length=236

 Score =   346 bits (887),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 191/225 (85%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLGDAY+EW H+PI++KESPRFFANG LE LTRTPWWAIP+
Sbjct  1    MVAQGFTVDLNKPLVFQVGHLGDAYEEWAHQPIITKESPRFFANGLLELLTRTPWWAIPS  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +W+PVV W  S S N GLP+P LA +L+A +  WTLLEY+LHRFLFH+K  GYW NT HY
Sbjct  61   VWVPVVGWLVSISANRGLPSPHLAATLVAGIFTWTLLEYSLHRFLFHMKPSGYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPPAATAI+L+PLW LVKL  P  Y  A LGG LLGYI+YDCT
Sbjct  121  LIHGCHHKHPMDALRLVFPPAATAILLLPLWSLVKLSVPFNYAPAFLGGGLLGYIMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHGKPL GVS SLKR+HMDHHF+ QDKGFGIT+ FWD +FG
Sbjct  181  HYYLHHGKPLKGVSHSLKRYHMDHHFKVQDKGFGITSDFWDKIFG  225



>ref|XP_006360310.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Solanum tuberosum]
Length=236

 Score =   327 bits (839),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLGD+Y+EWVH+PI+SK SPRFF N  LE LTRT WWAIP+
Sbjct  1    MVAQGFTVDLNKPLVFQVGHLGDSYEEWVHQPIISKGSPRFFENDILELLTRTVWWAIPS  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLP+V W   TS+  G    +L ++LL  +  WT LEY+LHRF+FH+K  GYWANT HY
Sbjct  61   VWLPIVGWLVWTSLKRGGGISELFLTLLGGIFLWTFLEYSLHRFVFHMKPSGYWANTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+L+PLW +VKLL P  Y  A LGG LLGYIIYDCT
Sbjct  121  LIHGCHHKHPMDGLRLVFPPAATAILLLPLWSVVKLLLPFTYAPAFLGGGLLGYIIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHGKP  G+S SLKR+HMDHHF+ QDKG+GIT+ FWDI+FG
Sbjct  181  HYYLHHGKPFKGISHSLKRYHMDHHFKLQDKGYGITSKFWDIIFG  225



>ref|XP_010315630.1| PREDICTED: fatty acid 2-hydroxylase 1 [Solanum lycopersicum]
Length=236

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 185/225 (82%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGF VDL+KPL+FQVGHLGD+Y+EWVH+PI+SK SPRFF N  LEFLTRT WWAIP+
Sbjct  1    MVAQGFIVDLNKPLIFQVGHLGDSYEEWVHQPIISKGSPRFFENDILEFLTRTVWWAIPS  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLP+V W    S+  G    +L ++LL  +  WT LEYTLHRF+FH+K  GYWANT HY
Sbjct  61   VWLPIVGWLVWISLKRGGGISELFLTLLGGIFLWTFLEYTLHRFVFHMKPSGYWANTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+L+PLW ++KLL P  Y  A LGG LLGYIIYDCT
Sbjct  121  LIHGCHHKHPMDGLRLVFPPAATAILLLPLWSVIKLLVPFTYAPAFLGGGLLGYIIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHGKP  G+S SLKR+HMDHHF+ QDKG+GIT+ FWDI+FG
Sbjct  181  HYYLHHGKPFKGISHSLKRYHMDHHFKLQDKGYGITSKFWDIIFG  225



>emb|CDP12579.1| unnamed protein product [Coffea canephora]
Length=236

 Score =   325 bits (834),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 189/225 (84%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLG+ Y+EWVH+PIV KESPRFF N  LEFLT   WW IP 
Sbjct  1    MVAQGFTVDLNKPLVFQVGHLGEDYEEWVHQPIVCKESPRFFENDLLEFLTLNTWWVIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLPVV WF  +SVNMG+ + QLA ++ A +  WTLLEYTLHRFLFH+KT+ YW NT HY
Sbjct  61   VWLPVVCWFVKSSVNMGVSSNQLAATIAAGIFIWTLLEYTLHRFLFHIKTKTYWGNTIHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG RLVFPPAATAI+L+P W L+KLL P++Y  A+LGG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGYRLVFPPAATAILLVPFWNLIKLLTPTLYAPALLGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHGKPL GVS  +KR+HM+HHFR QDKGFGIT+TFWD VFG
Sbjct  181  HYYLHHGKPLQGVSSKMKRYHMNHHFRIQDKGFGITSTFWDRVFG  225



>gb|EYU43216.1| hypothetical protein MIMGU_mgv1a012910mg [Erythranthe guttata]
Length=236

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 185/225 (82%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  + F+VDL+KPLVFQVGHLG+ Y+EWVH+PIV+KE+PRFF+NG +EFLTRT WWAIP 
Sbjct  1    MVHREFSVDLNKPLVFQVGHLGEDYEEWVHQPIVTKETPRFFSNGLIEFLTRTRWWAIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S S+  G+P     +++LA +  WT +EY LHRF+FH++T  YW NT HY
Sbjct  61   IWLPVVCWLVSLSLENGVPVNHAPLTVLAGVCLWTFMEYCLHRFVFHIRTTSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+L+P W L+K++ P+ Y +A LGG LLGY++YDCT
Sbjct  121  LVHGCHHKHPMDGLRLVFPPAATAILLVPFWNLIKIVVPAPYSHAFLGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHGKPL GVS  LKR+HM+HHFR QDKGFGIT TFWD VFG
Sbjct  181  HYYLHHGKPLKGVSYQLKRYHMNHHFRIQDKGFGITTTFWDRVFG  225



>gb|KHN14310.1| Fatty acid 2-hydroxylase [Glycine soja]
Length=307

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 184/232 (79%), Gaps = 0/232 (0%)
 Frame = +1

Query  40   SIVTGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRT  219
            S      M  Q F VDL+K LVFQVGHLG+AY+EWVH+PIVSKE PRFF N  LEFLTRT
Sbjct  65   SATASCMMVVQNFVVDLNKALVFQVGHLGEAYEEWVHQPIVSKEGPRFFENEILEFLTRT  124

Query  220  PWWAIPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGY  399
             WWAIP IWLPVV WF   S+ MGL  P LA+ ++  +  WTLLEY+LHRFLFH+KT+ Y
Sbjct  125  VWWAIPVIWLPVVCWFIYKSIRMGLSCPHLALLVVLGIFVWTLLEYSLHRFLFHIKTKTY  184

Query  400  WANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLG  579
            W NT HY++HGCHHKHPMDG+RLVFPPAATAI+LMP W LVKL+A +    A+ GG LLG
Sbjct  185  WGNTLHYLLHGCHHKHPMDGLRLVFPPAATAILLMPFWNLVKLMATTSTAPALFGGGLLG  244

Query  580  YIIYDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            Y++YDCTHYYLHHG+P T V ++LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  245  YVMYDCTHYYLHHGQPRTEVPRNLKKYHLNHHFRIQDKGFGITSSLWDKVFG  296



>ref|XP_003546279.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X1 [Glycine 
max]
 ref|XP_006597670.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Glycine 
max]
Length=237

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 183/225 (81%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q F VDL+K LVFQVGHLG+AY+EWVH+PIVSKE PRFF N  LEFLTRT WWAIP 
Sbjct  2    MVVQNFVVDLNKALVFQVGHLGEAYEEWVHQPIVSKEGPRFFENEILEFLTRTVWWAIPV  61

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV WF   S+ MGL  P LA+ ++  +  WTLLEY+LHRFLFH+KT+ YW NT HY
Sbjct  62   IWLPVVCWFIYKSIRMGLSCPHLALLVVLGIFVWTLLEYSLHRFLFHIKTKTYWGNTLHY  121

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+LMP W LVKL+A +    A+ GG LLGY++YDCT
Sbjct  122  LLHGCHHKHPMDGLRLVFPPAATAILLMPFWNLVKLMATTSTAPALFGGGLLGYVMYDCT  181

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P T V ++LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  182  HYYLHHGQPRTEVPRNLKKYHLNHHFRIQDKGFGITSSLWDKVFG  226



>ref|XP_010906220.1| PREDICTED: fatty acid 2-hydroxylase 1 [Elaeis guineensis]
 ref|XP_010906228.1| PREDICTED: fatty acid 2-hydroxylase 1 [Elaeis guineensis]
Length=237

 Score =   320 bits (820),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 186/224 (83%), Gaps = 0/224 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDLSKPLVFQVGHLG+AY +WVH+PIVSKE PRFFAN FLEFLT T WWAIPT
Sbjct  1    MVAQEFTVDLSKPLVFQVGHLGEAYQDWVHQPIVSKEGPRFFANDFLEFLTCTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV WF + SV MG   P++A+ +++ +  WTL+EYTLHRFLFH+KT+ YWANT HY
Sbjct  61   IWLPVVCWFITMSVRMGHTIPEVALMVMSGVFLWTLIEYTLHRFLFHMKTKTYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+ +P W +VKL+A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILCVPFWNMVKLIATPSTTPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
            HYYLHHG+P   ++++LKR+H++HHFR Q KGFGIT+  WDIVF
Sbjct  181  HYYLHHGQPSKDLARNLKRYHLNHHFRVQSKGFGITSRLWDIVF  224



>ref|XP_009384024.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384025.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=237

 Score =   320 bits (820),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 183/225 (81%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M +Q FTVDL+KPLVFQVGHLG+AY EWVH+PIVSKE PRFFAN FLEFLTRT WWA+PT
Sbjct  1    MVSQEFTVDLNKPLVFQVGHLGEAYQEWVHQPIVSKEGPRFFANDFLEFLTRTVWWAVPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S S+  G   P+LA+   A +  WTL+EYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVCWCLSMSIQRGNTLPRLALMAAAGIFLWTLIEYTLHRFLFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAA AI+ +P W LVKL+A      A+ GG LLGY+IYDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAAAAILCVPFWNLVKLIATPSSAPALFGGGLLGYVIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    +++LKR+H++HHFR Q+KGFGIT++ WDIVFG
Sbjct  181  HYYLHHGQPSKEPAKNLKRYHLNHHFRIQNKGFGITSSLWDIVFG  225



>ref|XP_011085181.1| PREDICTED: fatty acid 2-hydroxylase 2-like [Sesamum indicum]
Length=239

 Score =   320 bits (819),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 183/225 (81%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  QGF+VDL+KPLVFQVGHLG+AY+EWVH+PI++K +PRFFANG +EF TRTPWWA+P 
Sbjct  1    MVNQGFSVDLNKPLVFQVGHLGEAYEEWVHQPIITKHTPRFFANGLMEFFTRTPWWAVPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV  F  +S+N G P   +A +  A +  WTL+EYTLHRF+FH++T  Y  NT HY
Sbjct  61   IWLPVVCCFVLSSINTGTPLHFVAATTAAGVFGWTLMEYTLHRFVFHIQTNTYLGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+LM LW L+KLL P+ Y  A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAIVLMALWNLIKLLLPASYAPAVTGGILLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HY+LHH KP  G+   LKRFHM+HHFRNQDKGFGIT TFWD +FG
Sbjct  181  HYHLHHAKPNGGLHYQLKRFHMNHHFRNQDKGFGITTTFWDRLFG  225



>ref|XP_008793575.1| PREDICTED: fatty acid 2-hydroxylase 1 [Phoenix dactylifera]
 ref|XP_008793576.1| PREDICTED: fatty acid 2-hydroxylase 1 [Phoenix dactylifera]
Length=237

 Score =   319 bits (818),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 187/225 (83%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDLSKPLVFQVGHLG+AY +WVH+PIVSKE P+FFAN FLEFLTRT WWA+PT
Sbjct  1    MVAQEFTVDLSKPLVFQVGHLGEAYQDWVHQPIVSKEGPQFFANDFLEFLTRTVWWAVPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV WF + SV MG   P++A+ ++A +  WTL+EY+LHRFLFH+KT+ YWANT HY
Sbjct  61   IWLPVVCWFITMSVRMGHTIPEVALMVMAGVFLWTLIEYSLHRFLFHMKTKTYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+ +P W +VKL+A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILCVPFWNIVKLMATPSTTPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    +++LKR+H++HHFR Q KGFGIT+  WDI+FG
Sbjct  181  HYYLHHGQPSKDPARNLKRYHLNHHFRVQSKGFGITSKLWDIMFG  225



>ref|XP_004486480.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004486481.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Cicer 
arietinum]
Length=237

 Score =   318 bits (815),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ F VDL+KPLVFQVGHLG+AY+EWVH+PIVSKE PRFF N FLEFLT T WWAIP 
Sbjct  1    MVAQNFVVDLNKPLVFQVGHLGEAYEEWVHQPIVSKEGPRFFQNDFLEFLTLTAWWAIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV  F   S+  GL  P +A+ ++  +  WTLLEY+LHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVCLFVYNSIQKGLSCPHIALMVVLGIFVWTLLEYSLHRFLFHIKTKTYWGNTMHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+L P W LVKLL+      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILLFPFWNLVKLLSTPSTAPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P TGV ++LK++H+ HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPKTGVPRNLKKYHLSHHFRIQDKGFGITSSLWDRVFG  225



>ref|XP_006586857.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X1 [Glycine 
max]
 gb|KHN23028.1| Fatty acid 2-hydroxylase [Glycine soja]
Length=236

 Score =   318 bits (814),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 180/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q F VDL+K LVFQVGHLG AY+EWVH+PIVS E PRFF N  LEFLTRT WWAIP 
Sbjct  1    MVVQNFVVDLNKALVFQVGHLGGAYEEWVHQPIVSNEGPRFFENEILEFLTRTVWWAIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV WF   SV MGL  P LA+ ++  +  WTLLEY+LHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVCWFIHNSVQMGLSCPHLALLVVLGIFVWTLLEYSLHRFLFHIKTKTYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+LMP W LVKL+A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILLMPFWNLVKLMATPSTAPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P T V ++LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPKTEVPRNLKKYHLNHHFRIQDKGFGITSSLWDKVFG  225



>ref|XP_007023075.1| Fatty acid hydroxylase 1 isoform 1 [Theobroma cacao]
 gb|EOY25697.1| Fatty acid hydroxylase 1 isoform 1 [Theobroma cacao]
Length=322

 Score =   321 bits (822),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 186/235 (79%), Gaps = 0/235 (0%)
 Frame = +1

Query  28   ISPSSIVTGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEF  207
            + P+ IV  AKM AQ FTVDL+KPLVFQVGHLG+ Y EWVH+PIVSKE PRFF + F EF
Sbjct  84   LDPTHIVLVAKMVAQEFTVDLNKPLVFQVGHLGETYQEWVHQPIVSKEGPRFFESDFWEF  143

Query  208  LTRTPWWAIPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            LTRT WWAIP IWLPVV W  S S+ MG P PQ+A+ +   +  WT LEYTLHRFLFH++
Sbjct  144  LTRTVWWAIPAIWLPVVCWCISMSIRMGHPLPQIALMVGFGIFVWTFLEYTLHRFLFHIE  203

Query  388  TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGG  567
            T+ YW NT HY++HGCHHKHPMDG+RLVFPPAATA++ +P W LVKLLA      A+ GG
Sbjct  204  TKSYWGNTVHYLLHGCHHKHPMDGLRLVFPPAATAVLCIPFWNLVKLLATPSTTPALFGG  263

Query  568  ALLGYIIYDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             LLGY++YD THYYLHHG+P   V++SLK++H++HHFR Q+KGFGIT+ FWD VF
Sbjct  264  GLLGYVMYDVTHYYLHHGQPTKHVAKSLKKYHLNHHFRIQNKGFGITSAFWDRVF  318



>emb|CAN81862.1| hypothetical protein VITISV_033282 [Vitis vinifera]
Length=468

 Score =   325 bits (834),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 182/228 (80%), Gaps = 0/228 (0%)
 Frame = +1

Query  52   GAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWA  231
            GAKM ++ FTVDL+KPLVFQVGHLG+AY+EWVH+PI+SKE PRFF +  LE  TRT WW 
Sbjct  229  GAKMVSKDFTVDLNKPLVFQVGHLGEAYEEWVHQPIISKEGPRFFGSDILESTTRTVWWV  288

Query  232  IPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANT  411
            IP +WLPVV W  S SV MGLP  QLA ++   +  WT LEYTLHRFLFH+KT+ YW NT
Sbjct  289  IPLVWLPVVCWAVSMSVRMGLPLLQLAAAVAGGIFIWTFLEYTLHRFLFHIKTKSYWGNT  348

Query  412  FHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIY  591
             HY++HGCHHKHPMDG+RLVFPPAA AI+ +P W L+KLL+P      + GG LLGY+IY
Sbjct  349  IHYLLHGCHHKHPMDGLRLVFPPAAAAILCLPFWNLMKLLSPPSVAPTLFGGGLLGYVIY  408

Query  592  DCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            D THYYLHHGKP  G++Q++KR+HM+HHFR  DKGFGIT+TFWD VFG
Sbjct  409  DVTHYYLHHGKPSKGITQNMKRYHMNHHFRIDDKGFGITSTFWDRVFG  456



>ref|XP_007147452.1| hypothetical protein PHAVU_006G125900g [Phaseolus vulgaris]
 gb|ESW19446.1| hypothetical protein PHAVU_006G125900g [Phaseolus vulgaris]
Length=244

 Score =   317 bits (812),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 184/228 (81%), Gaps = 0/228 (0%)
 Frame = +1

Query  52   GAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWA  231
             ++M  Q F VDL+K LVFQVGHLG+AY+EWVH+PIV KE PRFF N  LEFLTRT WWA
Sbjct  5    SSRMVVQNFEVDLNKALVFQVGHLGEAYEEWVHQPIVCKEGPRFFENEILEFLTRTVWWA  64

Query  232  IPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANT  411
            IP IWLPVV +F  +SV MGL  P LA+ ++A +  WT LEY+LHRFLFH+KT+ YW NT
Sbjct  65   IPVIWLPVVCYFVYSSVLMGLSCPHLALMVVAGIFVWTFLEYSLHRFLFHIKTKTYWGNT  124

Query  412  FHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIY  591
             HY++HGCHHKHPMDG+RLVFPPAATAI+LMP W +VKL+A      A+ GG LLGY++Y
Sbjct  125  LHYLLHGCHHKHPMDGLRLVFPPAATAILLMPFWNVVKLMATPSTAPALFGGGLLGYVMY  184

Query  592  DCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            DCTHYYLHHG+P T V ++LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  185  DCTHYYLHHGQPKTEVPRNLKKYHLNHHFRIQDKGFGITSSLWDKVFG  232



>ref|XP_009413130.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=237

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDL+KPLVFQVGHLG+AY EWVH+PIVSKE PRFFAN  LEFLTRT WWA+P 
Sbjct  1    MVAQEFTVDLNKPLVFQVGHLGEAYQEWVHQPIVSKEGPRFFANDLLEFLTRTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  + S+ MG   PQLA+ +   +  WTL+EYTLHRFLFH+KT  YW NT HY
Sbjct  61   IWLPVVGWCLTKSIQMGNTPPQLALMVATGIFLWTLIEYTLHRFLFHIKTESYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+ +P W +VKL+A      A+ GG L GY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILCVPFWNVVKLIATPSTTPALFGGGLFGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    +++LKR+H++HHFR Q+KGFGIT++ WDIVFG
Sbjct  181  HYYLHHGQPSKDPAKNLKRYHLNHHFRIQNKGFGITSSLWDIVFG  225



>ref|XP_010923775.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X1 [Elaeis 
guineensis]
Length=229

 Score =   315 bits (808),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 180/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDLSKPLVFQVGHLG+AY EWVH+PIVSKE PRFFAN FLEFLT T WWAIP 
Sbjct  1    MVAQKFTVDLSKPLVFQVGHLGEAYQEWVHQPIVSKEGPRFFANDFLEFLTCTAWWAIPA  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV WF + S+ MG   P++A+ +   +  WTL+EYT+HRFLFH+KT+ YWANT HY
Sbjct  61   IWLPVVCWFVTMSMRMGHTIPEVAMMVGTGVFVWTLIEYTIHRFLFHMKTQTYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPP A AI+ +PLW LVKL A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPTAAAILCVPLWNLVKLFATPSTAPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    +++LK +HM HHFR Q+KGFGIT+  WDIVFG
Sbjct  181  HYYLHHGQPSKNPARNLKLYHMSHHFRVQNKGFGITSKLWDIVFG  225



>ref|XP_002267991.1| PREDICTED: fatty acid 2-hydroxylase 1 [Vitis vinifera]
 ref|XP_010655769.1| PREDICTED: fatty acid 2-hydroxylase 1 [Vitis vinifera]
 emb|CBI31057.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   315 bits (807),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 179/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M ++ FTVDL+KPLVFQVGHLG+AY+EWVH+PI+SKE PRFF +  LE  TRT WW IP 
Sbjct  1    MVSKDFTVDLNKPLVFQVGHLGEAYEEWVHQPIISKEGPRFFGSDILESTTRTVWWVIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLPVV W  S SV MGLP  QLA ++   L  WT LEYTLHRFLFH+KT+ YW NT HY
Sbjct  61   VWLPVVCWAVSMSVRMGLPLLQLAAAVAGGLFIWTFLEYTLHRFLFHIKTKSYWGNTIHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAA AI+ +P W L+KLL+P      + GG LLGY+IYD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAAAAILCLPFWNLMKLLSPPSVAPTLFGGGLLGYVIYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHGKP  G++Q++KR+HM+HHFR  DKGFGIT+TFWD VFG
Sbjct  181  HYYLHHGKPSKGITQNMKRYHMNHHFRIDDKGFGITSTFWDRVFG  225



>ref|XP_006353000.1| PREDICTED: fatty acid 2-hydroxylase 2-like [Solanum tuberosum]
Length=236

 Score =   315 bits (807),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 183/225 (81%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL KPLV+QVGHLG+AY EWVH+PIVSKE PRFF + F EFLTRT WWAIPT
Sbjct  1    MVAQGFTVDLDKPLVYQVGHLGEAYQEWVHQPIVSKEGPRFFESDFWEFLTRTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S S++MG   P++A+ +   +  WTL+EYTLHRFLFH+ TR YW NT HY
Sbjct  61   IWLPVVCYSISVSIHMGRTVPEVALMVGFGIFIWTLMEYTLHRFLFHINTRSYWGNTIHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+L+P W L+KLLA      A+ GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILLVPFWNLIKLLATPTTAPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P   V ++LK++H++HHFR Q+KGFGIT++FWD VFG
Sbjct  181  HYYLHHGQPTVEVPKNLKKYHLNHHFRIQNKGFGITSSFWDKVFG  225



>ref|XP_007147453.1| hypothetical protein PHAVU_006G125900g [Phaseolus vulgaris]
 ref|XP_007147454.1| hypothetical protein PHAVU_006G125900g [Phaseolus vulgaris]
 gb|ESW19447.1| hypothetical protein PHAVU_006G125900g [Phaseolus vulgaris]
 gb|ESW19448.1| hypothetical protein PHAVU_006G125900g [Phaseolus vulgaris]
Length=237

 Score =   315 bits (807),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 182/225 (81%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q F VDL+K LVFQVGHLG+AY+EWVH+PIV KE PRFF N  LEFLTRT WWAIP 
Sbjct  1    MVVQNFEVDLNKALVFQVGHLGEAYEEWVHQPIVCKEGPRFFENEILEFLTRTVWWAIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +F  +SV MGL  P LA+ ++A +  WT LEY+LHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVCYFVYSSVLMGLSCPHLALMVVAGIFVWTFLEYSLHRFLFHIKTKTYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+LMP W +VKL+A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILLMPFWNVVKLMATPSTAPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P T V ++LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPKTEVPRNLKKYHLNHHFRIQDKGFGITSSLWDKVFG  225



>ref|XP_011037722.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Populus euphratica]
 ref|XP_011013632.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Populus euphratica]
Length=236

 Score =   315 bits (806),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 183/225 (81%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDL KPLVFQVGHLG+AY+EWVH+PIVS+E PRFF + F+E LTRT WWAIP+
Sbjct  1    MVAQEFTVDLDKPLVFQVGHLGEAYEEWVHQPIVSREGPRFFESDFMESLTRTVWWAIPS  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPV+ +F   SV MG   P++A+ ++  +  WTLLEYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVICYFVLKSVRMGHTLPEVALIVVGGVFIWTLLEYTLHRFLFHIKTKSYWGNTMHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+L+P W +VKL +      A+ GG LLGY+IYDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILLVPFWNMVKLFSTPSTTPALFGGGLLGYVIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P   V ++LK++HM+HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPANEVPKNLKKYHMNHHFRVQDKGFGITSSLWDRVFG  225



>gb|KEH37077.1| fatty acid 2-hydroxylase-like protein [Medicago truncatula]
Length=249

 Score =   313 bits (803),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 179/231 (77%), Gaps = 0/231 (0%)
 Frame = +1

Query  43   IVTGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTP  222
            + T  KM AQ F VDL KPLVFQVGHLG+AY+EWVH+PIVSKE PRFF N  LE LT T 
Sbjct  7    VKTITKMVAQNFVVDLDKPLVFQVGHLGEAYEEWVHQPIVSKEGPRFFQNEVLESLTLTV  66

Query  223  WWAIPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYW  402
            WWAIP IWLPVV WF   S+ MGL  P +A+ ++  +  WTLLEYTLHRFLFH+KT+ YW
Sbjct  67   WWAIPVIWLPVVCWFVYNSIQMGLSCPHIALMVVLGIFVWTLLEYTLHRFLFHIKTKTYW  126

Query  403  ANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGY  582
             NT HY++HGCHHKHPMDG+RLVFPP ATAI+L P W  VKL +      A+ GG LLGY
Sbjct  127  GNTIHYLLHGCHHKHPMDGLRLVFPPTATAILLFPFWNAVKLFSTPSTTPALFGGGLLGY  186

Query  583  IIYDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            +IYDCTHYYLHHG+P T   ++LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  187  VIYDCTHYYLHHGQPKTEHPRNLKKYHLNHHFRIQDKGFGITSSLWDKVFG  237



>ref|XP_004233153.1| PREDICTED: fatty acid 2-hydroxylase 1 [Solanum lycopersicum]
Length=236

 Score =   313 bits (801),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 182/225 (81%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL KPLV QVGHLG+AY EWVH+PIVSKE PRFFA+ F EFLTRT WWAIPT
Sbjct  1    MVAQGFTVDLDKPLVHQVGHLGEAYQEWVHQPIVSKEGPRFFASDFWEFLTRTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S S+ MG   P++A+ ++  +  WTL+EYTLHRFLFH+ T  YW NT HY
Sbjct  61   IWLPVVCYSISVSIRMGRTVPEVALLVVFGIFIWTLMEYTLHRFLFHINTTSYWGNTIHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+L+P W L+KLLA      A+ GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILLVPFWNLIKLLATPTTAPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P   V ++LK++H++HHFR Q+KGFGIT++FWD VFG
Sbjct  181  HYYLHHGQPTVEVPKNLKKYHLNHHFRIQNKGFGITSSFWDKVFG  225



>ref|XP_006377936.1| FATTY ACID HYDROXYLASE 1 family protein [Populus trichocarpa]
 gb|ERP55733.1| FATTY ACID HYDROXYLASE 1 family protein [Populus trichocarpa]
Length=236

 Score =   312 bits (799),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 182/225 (81%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDL KPLVFQVGHLG+AY+EWVH+PIVS+E PRFF + F+E LTRT WWAIP+
Sbjct  1    MVAQEFTVDLDKPLVFQVGHLGEAYEEWVHQPIVSREGPRFFESDFMESLTRTVWWAIPS  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPV+ +F   SV MG    ++A+ ++  +  WTLLEYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVICYFVLKSVRMGHTLSEVALIVVGGVFIWTLLEYTLHRFLFHIKTKSYWGNTMHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+L+P W +VKL +      A+ GG LLGY+IYDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILLVPFWNMVKLFSTPSTTPALFGGGLLGYVIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P   V ++LK++HM+HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPANDVPKNLKKYHMNHHFRVQDKGFGITSSLWDRVFG  225



>gb|ACU24407.1| unknown [Glycine max]
Length=236

 Score =   311 bits (798),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 178/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q F VDL+K LVFQVGHLG AY+EWVH+PIVS E PRF  N  LEFLTRT WWAIP 
Sbjct  1    MVVQNFVVDLNKALVFQVGHLGGAYEEWVHQPIVSNEGPRFSENEILEFLTRTVWWAIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV WF   SV MGL  P LA+ ++  +  WTLLEY+LHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVCWFIHNSVQMGLGCPHLALLVVLGIFVWTLLEYSLHRFLFHIKTKTYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+LMP W LVKL+A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILLMPFWNLVKLMATPSTAPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P T V ++LK++H++HHFR  DKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPKTEVPRNLKKYHLNHHFRIHDKGFGITSSLWDKVFG  225



>ref|XP_007023076.1| Fatty acid hydroxylase 1 isoform 2 [Theobroma cacao]
 gb|EOY25698.1| Fatty acid hydroxylase 1 isoform 2 [Theobroma cacao]
Length=228

 Score =   311 bits (796),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 179/224 (80%), Gaps = 0/224 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDL+KPLVFQVGHLG+ Y EWVH+PIVSKE PRFF + F EFLTRT WWAIP 
Sbjct  1    MVAQEFTVDLNKPLVFQVGHLGETYQEWVHQPIVSKEGPRFFESDFWEFLTRTVWWAIPA  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S S+ MG P PQ+A+ +   +  WT LEYTLHRFLFH++T+ YW NT HY
Sbjct  61   IWLPVVCWCISMSIRMGHPLPQIALMVGFGIFVWTFLEYTLHRFLFHIETKSYWGNTVHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++ +P W LVKLLA      A+ GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAVLCIPFWNLVKLLATPSTTPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
            HYYLHHG+P   V++SLK++H++HHFR Q+KGFGIT+ FWD VF
Sbjct  181  HYYLHHGQPTKHVAKSLKKYHLNHHFRIQNKGFGITSAFWDRVF  224



>ref|XP_011039275.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X1 [Populus 
euphratica]
Length=258

 Score =   312 bits (799),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = +1

Query  58   KMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIP  237
            KM AQ F+VDL KPLVFQVGHLG+AY+EWVH+PIVS+E PRFF N F+E LTRT WWAIP
Sbjct  22   KMVAQEFSVDLDKPLVFQVGHLGEAYEEWVHQPIVSREGPRFFENDFMESLTRTVWWAIP  81

Query  238  TIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFH  417
            +IWLPVV +    S  MG   P++A+ ++  +  WTLLEYTLHRFLFH+KT+ YW NT H
Sbjct  82   SIWLPVVCYCVLKSARMGHALPEIALMVVGGVFVWTLLEYTLHRFLFHIKTKSYWGNTVH  141

Query  418  YMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDC  597
            Y++HGCHHKHPMDG+RLVFPPAA AI+L+P W +V L A      A+ GG LLGY++YDC
Sbjct  142  YLLHGCHHKHPMDGLRLVFPPAAAAILLVPFWNMVSLFATPSITPALFGGGLLGYVMYDC  201

Query  598  THYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            THYYLHHG+P   V ++LK++HM+HHFR QDKGFGIT+  WD VFG
Sbjct  202  THYYLHHGQPANDVPKNLKKYHMNHHFRVQDKGFGITSALWDRVFG  247



>ref|XP_009362196.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Pyrus x bretschneideri]
 ref|XP_009362197.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Pyrus x bretschneideri]
Length=237

 Score =   311 bits (797),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 185/225 (82%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ F VDL+K LVFQVGHLG+AY EWVH+PIVSKE PRFF + F EFLTRT WWA+P 
Sbjct  1    MVAQDFQVDLNKALVFQVGHLGEAYQEWVHQPIVSKEGPRFFESEFWEFLTRTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV++  S SV MG   P++A++++A +  WTL+EYTLHRFLFH++T+ YW NT HY
Sbjct  61   IWLPVVFYAISVSVRMGHTFPEVALTVVAGIFVWTLMEYTLHRFLFHIETKSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+ +P W LVKL++   +  A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILCIPFWNLVKLMSSPTFAPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V ++LKR+H++HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPTSEVPRNLKRYHLNHHFRIQDKGFGITSSLWDRVFG  225



>ref|XP_011006013.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Populus euphratica]
Length=268

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/227 (64%), Positives = 181/227 (80%), Gaps = 0/227 (0%)
 Frame = +1

Query  55   AKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAI  234
              +    FTVDL KPLVFQVGHLG+AY+EWVH+PIVS+E PRFF + F+E LTRT WWAI
Sbjct  31   VSLEVNQFTVDLDKPLVFQVGHLGEAYEEWVHQPIVSREGPRFFESDFMESLTRTVWWAI  90

Query  235  PTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTF  414
            P+IWLPV+ +F   SV MG   P++A+ ++  +  WTLLEYTLHRFLFH+KT+ YW NT 
Sbjct  91   PSIWLPVICYFVLKSVRMGHTLPEVALIVVGGVFIWTLLEYTLHRFLFHIKTKSYWGNTM  150

Query  415  HYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYD  594
            HY++HGCHHKHPMDG+RLVFPPAATAI+L+P W +VKL +      A+ GG LLGY+IYD
Sbjct  151  HYLLHGCHHKHPMDGLRLVFPPAATAILLVPFWNMVKLFSTPSTTPALFGGGLLGYVIYD  210

Query  595  CTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            CTHYYLHHG+P   V ++LK++HM+HHFR QDKGFGIT++ WD VFG
Sbjct  211  CTHYYLHHGQPANEVPKNLKKYHMNHHFRVQDKGFGITSSLWDRVFG  257



>ref|XP_003594600.1| Fatty acid 2-hydroxylase [Medicago truncatula]
 gb|AES64851.1| fatty acid 2-hydroxylase-like protein [Medicago truncatula]
Length=237

 Score =   310 bits (795),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 176/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ F VDL KPLVFQVGHLG+AY+EWVH+PIVSKE PRFF N  LE LT T WWAIP 
Sbjct  1    MVAQNFVVDLDKPLVFQVGHLGEAYEEWVHQPIVSKEGPRFFQNEVLESLTLTVWWAIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV WF   S+ MGL  P +A+ ++  +  WTLLEYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVCWFVYNSIQMGLSCPHIALMVVLGIFVWTLLEYTLHRFLFHIKTKTYWGNTIHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPP ATAI+L P W  VKL +      A+ GG LLGY+IYDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPTATAILLFPFWNAVKLFSTPSTTPALFGGGLLGYVIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P T   ++LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPKTEHPRNLKKYHLNHHFRIQDKGFGITSSLWDKVFG  225



>ref|XP_008787352.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Phoenix dactylifera]
Length=237

 Score =   310 bits (793),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 178/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDLSKPLVFQVGHLG+AY EW+H+PIVSKE PRFFAN FLEFLT T WWA+P 
Sbjct  1    MVAQEFTVDLSKPLVFQVGHLGEAYQEWIHQPIVSKEGPRFFANDFLEFLTCTVWWAVPA  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV WF + S+ MG   P++A+ +   +  WTL+EYTLHRFLFH+KT+ YWANT HY
Sbjct  61   IWLPVVCWFVTMSIRMGHTIPEVALMVGTGVFLWTLIEYTLHRFLFHMKTKTYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAA AI+ +  W LVKL A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAAAAILCVLFWNLVKLFATPSTAPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P     ++LK  HM+HHFR Q+KGFGIT+  WDIVFG
Sbjct  181  HYYLHHGQPSKNPVRNLKLDHMNHHFRVQNKGFGITSKLWDIVFG  225



>emb|CDP12584.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   309 bits (791),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 182/225 (81%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLG++Y EWVH+PIVSKE PRFF + F EFLTRT WW IP 
Sbjct  1    MVAQGFTVDLNKPLVFQVGHLGESYQEWVHQPIVSKEGPRFFGSDFWEFLTRTEWWVIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLPVV WF S S+ MG   PQ+A+ ++  +  WTLLEYTLHRFLFH+KT+ YW NT HY
Sbjct  61   VWLPVVCWFVSKSIVMGHTLPQIALMVVTGIGVWTLLEYTLHRFLFHIKTKSYWGNTMHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++  P + L+KL++      A+ GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAVLCFPFYNLIKLISTPSTAPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V ++LK++H++HHFR Q+KGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPTSEVPKNLKKYHLNHHFRIQNKGFGITSSLWDKVFG  225



>ref|XP_007022904.1| Fatty acid hydroxylase 1 isoform 1 [Theobroma cacao]
 ref|XP_007022905.1| Fatty acid hydroxylase 1 isoform 1 [Theobroma cacao]
 gb|EOY25526.1| Fatty acid hydroxylase 1 isoform 1 [Theobroma cacao]
 gb|EOY25527.1| Fatty acid hydroxylase 1 isoform 1 [Theobroma cacao]
Length=237

 Score =   309 bits (791),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  + FTVDL+KPLVFQVGHLG+AYD+WVH+P+VSKE PRFF N F E LTRT WW IP 
Sbjct  1    MVKKPFTVDLNKPLVFQVGHLGEAYDKWVHQPVVSKECPRFFGNDFCELLTRTKWWVIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLPVV WF STS+  GL   Q A ++   +  WTL+EYTLHRFLFH+KT  YW NT H+
Sbjct  61   VWLPVVCWFVSTSIQRGLTPTQAASAVAGGVFIWTLIEYTLHRFLFHMKTTSYWGNTLHF  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATAI+ +P+W L KL +      A+  G LLGY+IYDCT
Sbjct  121  LLHGCHHKHPMDRLRLVFPPVATAILCVPVWSLFKLFSTPSTTPALFAGGLLGYVIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHGKP  G+SQ+LKR+H++HHFR Q KGFGIT++ WD VFG
Sbjct  181  HYYLHHGKPSEGLSQTLKRYHLNHHFRVQSKGFGITSSIWDHVFG  225



>ref|XP_002300560.1| FATTY ACID HYDROXYLASE 1 family protein [Populus trichocarpa]
 gb|ABK93387.1| unknown [Populus trichocarpa]
 gb|EEE85365.1| FATTY ACID HYDROXYLASE 1 family protein [Populus trichocarpa]
Length=236

 Score =   309 bits (791),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 178/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDL KPLVFQVGHLG+ Y+EWVH+PIVS+E PRFF N F+E LTRT WWAIP+
Sbjct  1    MVAQEFTVDLDKPLVFQVGHLGETYEEWVHQPIVSREGPRFFENDFIESLTRTVWWAIPS  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +    S  MG   P++A+ ++  +  WTLLEYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVCYCVLKSAKMGHALPEIALMVVGGVFVWTLLEYTLHRFLFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+L+P W +V L A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILLVPFWNMVSLFATPSITPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P   V ++LK++HM+HHFR QDKGFGIT+  WD VFG
Sbjct  181  HYYLHHGQPANDVPKNLKKYHMNHHFRVQDKGFGITSALWDRVFG  225



>gb|KDP34614.1| hypothetical protein JCGZ_11137 [Jatropha curcas]
Length=237

 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLG+AY+EWVH+PIVSKE PRFF + F EFLTRT WWAIP 
Sbjct  1    MVAQGFTVDLNKPLVFQVGHLGEAYEEWVHQPIVSKEGPRFFESDFWEFLTRTVWWAIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S SV MG    ++A+ + + +  WTLLEY+LHRF+FH+KT+ YW NT HY
Sbjct  61   IWLPVVCWCISMSVRMGHKPSEIALMVASGILIWTLLEYSLHRFVFHIKTKTYWWNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++ +P W LV+L A      A+ GG LLGY++YDCT
Sbjct  121  LIHGCHHKHPMDGLRLVFPPAATAVLCVPFWNLVQLFATPSTAPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P +GV + LK++H++HHFR Q+ GFGIT+  WD VFG
Sbjct  181  HYYLHHGQPSSGVPKDLKKYHLNHHFRIQNMGFGITSALWDRVFG  225



>ref|XP_011039276.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Populus 
euphratica]
 ref|XP_011039277.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Populus 
euphratica]
 ref|XP_011039278.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Populus 
euphratica]
Length=236

 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 178/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ F+VDL KPLVFQVGHLG+AY+EWVH+PIVS+E PRFF N F+E LTRT WWAIP+
Sbjct  1    MVAQEFSVDLDKPLVFQVGHLGEAYEEWVHQPIVSREGPRFFENDFMESLTRTVWWAIPS  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +    S  MG   P++A+ ++  +  WTLLEYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVCYCVLKSARMGHALPEIALMVVGGVFVWTLLEYTLHRFLFHIKTKSYWGNTVHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAA AI+L+P W +V L A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAAAAILLVPFWNMVSLFATPSITPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P   V ++LK++HM+HHFR QDKGFGIT+  WD VFG
Sbjct  181  HYYLHHGQPANDVPKNLKKYHMNHHFRVQDKGFGITSALWDRVFG  225



>ref|XP_003531074.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Glycine max]
 gb|KHN39148.1| Fatty acid 2-hydroxylase [Glycine soja]
Length=239

 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ F VDL+KPLVFQVGHLG+AYDEWVH PIVSKE PRFF NGFLE  TRT WW IPT
Sbjct  1    MVAQKFVVDLNKPLVFQVGHLGEAYDEWVHDPIVSKEGPRFFQNGFLELFTRTAWWVIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +W+PV  WF S SV  GLP+  +A+ +   +  WTL EYTLHRFLFHVKT+ YW NT HY
Sbjct  61   VWVPVASWFISNSVKSGLPSLDVALLVFLGIFVWTLAEYTLHRFLFHVKTKSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD  RLVFPP A AI+ +P+W LVKL+       A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDSYRLVFPPVAAAILALPIWNLVKLICTPSVAPAVFGGILLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V +SLK++H++HH+R Q+ GFGIT+  WD VFG
Sbjct  181  HYYLHHGQPKSDVPKSLKKYHLNHHYRLQNYGFGITSPLWDKVFG  225



>emb|CBI31058.3| unnamed protein product [Vitis vinifera]
Length=295

 Score =   309 bits (792),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 183/237 (77%), Gaps = 2/237 (1%)
 Frame = +1

Query  31   SPSSI--VTGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLE  204
             P+SI  V G KM AQ FTVDLSKPLVFQVGHLG+ Y EWVH+PIVSKE PRFF + F E
Sbjct  47   DPTSIFSVLGPKMVAQDFTVDLSKPLVFQVGHLGEDYQEWVHQPIVSKEGPRFFDSDFWE  106

Query  205  FLTRTPWWAIPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHV  384
             LTRT WWAIP IWLPVV W  S SV MGL  P+L + +   +  WTL+EY+LHRFLFH+
Sbjct  107  ALTRTKWWAIPLIWLPVVTWSISRSVRMGLELPRLVLMMAIGIFVWTLMEYSLHRFLFHI  166

Query  385  KTRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILG  564
            KT+ YW NT HY++HGCHHKHPMDG+RLVFPPA  A++ +PLW L+K L+      A+ G
Sbjct  167  KTKTYWGNTIHYLLHGCHHKHPMDGLRLVFPPAGAAVICVPLWNLIKFLSTPTTAPALFG  226

Query  565  GALLGYIIYDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            G LLGY++YD THYYLHHG+P + V ++LK++H++HHFR QD GFGIT++ WD VFG
Sbjct  227  GGLLGYVMYDVTHYYLHHGQPSSKVPRNLKKYHLNHHFRIQDMGFGITSSLWDRVFG  283



>ref|XP_002523169.1| sphingolipid fatty acid alpha hydroxylase [Ricinus communis]
 gb|EEF39200.1| sphingolipid fatty acid alpha hydroxylase [Ricinus communis]
Length=237

 Score =   307 bits (786),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 178/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLG+AY+EWVH+PIVS+E PRFF + F EFLT T WWA+P 
Sbjct  1    MVAQGFTVDLNKPLVFQVGHLGEAYEEWVHQPIVSREGPRFFESDFWEFLTLTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S SV MG    ++A  +++ +  WTL+EYT+HRFLFH+KT  YW NT HY
Sbjct  61   IWLPVVCWLVSLSVRMGHTPSEIATMVVSGVFIWTLVEYTMHRFLFHIKTSSYWGNTIHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++ +P W L+KL A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAVLCVPFWNLIKLFATPSTAPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P  GV + LK++HM+HHFR Q  GFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSLGVPKDLKKYHMNHHFRLQTMGFGITSSLWDRVFG  225



>gb|ACU24572.1| unknown [Glycine max]
Length=239

 Score =   307 bits (786),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 173/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ F VDL+KPLVFQVGHLG+AYDEWVH PIVSKE PRFF NGFLE  TRT WW IPT
Sbjct  1    MVAQKFVVDLNKPLVFQVGHLGEAYDEWVHDPIVSKEGPRFFQNGFLELFTRTAWWVIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +W+PV  WF S SV  GLP+  +A+ +   +  WTL EYTLHRFLFHVKT+ YW NT HY
Sbjct  61   VWVPVASWFISNSVKSGLPSLDVALLVFLGIFVWTLAEYTLHRFLFHVKTKSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD  RLVFPP A AI+ +P+W LVKL+       A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDSYRLVFPPVAAAILALPIWNLVKLICTPSVAPAVFGGILLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V +SLK++H++HH+R Q+ GFGIT   WD VFG
Sbjct  181  HYYLHHGQPKSDVPKSLKKYHLNHHYRLQNYGFGITPPLWDKVFG  225



>ref|XP_006360318.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Solanum tuberosum]
Length=247

 Score =   307 bits (786),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 180/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL K LVFQVGHLG+AY EWVH+PIV+KE PRFF + F EFLTRT WWAIP 
Sbjct  1    MVAQGFTVDLDKALVFQVGHLGEAYQEWVHQPIVNKEGPRFFESDFWEFLTRTVWWAIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S S+ MG+  P++A  +L  +  WTL+EYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVCYSISVSIQMGVTVPEVASIVLFGIFVWTLMEYTLHRFLFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+ +P W L+KL++      A+ GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILCVPFWNLIKLMSTPSTAPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P + V ++LKR+H++HHFR Q +GFGIT++FWD VFG
Sbjct  181  HYYLHHAQPTSEVPRNLKRYHLNHHFRIQTEGFGITSSFWDNVFG  225



>ref|XP_009622087.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Nicotiana tomentosiformis]
Length=236

 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 182/225 (81%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+K LVFQVGHLG+AY EWVH+PIVSKE PRFF + F EFLTRT WWAIP 
Sbjct  1    MVAQGFTVDLNKALVFQVGHLGEAYQEWVHQPIVSKEGPRFFESDFWEFLTRTVWWAIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S S+ MG   P++A+ ++  +  WTL+EYTLHRFLFH+KT+ YWANT HY
Sbjct  61   IWLPVVCYSISVSIWMGHTVPEVALMVVFGIFVWTLMEYTLHRFLFHIKTKSYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+ +P W L+KL++      A+ GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILCVPFWNLIKLMSTPSTAPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P + V ++LK++H++HHFR Q KGFGIT++FWD VFG
Sbjct  181  HYYLHHAQPTSEVPKNLKKYHLNHHFRIQTKGFGITSSFWDKVFG  225



>ref|XP_011096698.1| PREDICTED: fatty acid 2-hydroxylase 1 [Sesamum indicum]
Length=237

 Score =   306 bits (783),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 179/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLG+ Y EWVH+PIVSKE PRFF + F EFLTR  WW IP 
Sbjct  1    MVAQGFTVDLNKPLVFQVGHLGEDYQEWVHQPIVSKEGPRFFESDFWEFLTRNQWWVIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV    S S+ +G   PQ+A+     + AWTL+EYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVGCSLSRSIYLGHTIPQVAMMTAFGVFAWTLIEYTLHRFLFHIKTKSYWGNTIHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++L P W L+KL++      AI GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAVLLFPFWNLIKLISTPTTAPAIFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYY+HHG+P +G+ +SLK++H++HHFR Q+KGFGIT++ WD VFG
Sbjct  181  HYYVHHGQPTSGIPKSLKKYHLNHHFRVQNKGFGITSSLWDRVFG  225



>ref|XP_009389221.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=237

 Score =   305 bits (782),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 180/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGF+VDL+KPLVFQVGHLG+ Y++WVH+PIV+KE PRFFANGF+E LTRT WW +P 
Sbjct  1    MVAQGFSVDLNKPLVFQVGHLGEDYEDWVHRPIVTKEIPRFFANGFMECLTRTVWWVVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV+W  + S+ MG   PQL   + + +  WT++EY+LHRFLFH+KT+GYW NT HY
Sbjct  61   IWLPVVFWCLTISIRMGNTLPQLVPLVSSGILLWTMIEYSLHRFLFHMKTKGYWGNTIHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            + HGCHHK+PMDG+RLVFPPAATAI+ +P W L+ LL       A+ GG LLGY+IYDCT
Sbjct  121  LFHGCHHKYPMDGLRLVFPPAATAIICVPFWHLLHLLMAPSAAPAVFGGGLLGYVIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG P    ++ LKR+H++HHF+ Q+KGFGIT++ WDI+FG
Sbjct  181  HYYLHHGHPSKHPAKHLKRYHLNHHFKVQNKGFGITSSLWDIIFG  225



>ref|XP_009805026.1| PREDICTED: fatty acid 2-hydroxylase 1 [Nicotiana sylvestris]
Length=236

 Score =   305 bits (781),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 182/225 (81%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+K LVFQVGHLG+AY EWVH+PIVSKE PRFF + F EFLTRT WWAIP 
Sbjct  1    MVAQGFTVDLNKALVFQVGHLGEAYQEWVHQPIVSKEGPRFFESDFWEFLTRTVWWAIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S S+ MG   P++A+ ++  +  WTL+EYTLHRFLFH+KT+ YWANT HY
Sbjct  61   IWLPVVCYSISVSLWMGHTVPEVALMVVFGIFVWTLMEYTLHRFLFHIKTKSYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+ +P W L+KL++      A+ GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILCVPFWNLIKLMSTPSTAPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P + V ++LK++H++HHFR Q KGFGIT++FWD VFG
Sbjct  181  HYYLHHAQPTSEVPKNLKKYHLNHHFRIQTKGFGITSSFWDKVFG  225



>ref|XP_006853317.1| hypothetical protein AMTR_s00032p00050810 [Amborella trichopoda]
 gb|ERN14784.1| hypothetical protein AMTR_s00032p00050810 [Amborella trichopoda]
Length=236

 Score =   305 bits (781),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 177/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDL+KPLVFQVGHLGDAY EWVH+PIVSKE PRFF + F EFLTRT WW IP 
Sbjct  1    MVAQAFTVDLNKPLVFQVGHLGDAYQEWVHQPIVSKEGPRFFESEFWEFLTRTAWWVIPI  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  +TS++  L  PQ A+ +   +  WTL+EYTLHRFLFH+KT  YW NT HY
Sbjct  61   IWLPVVCWSITTSIHRRLSIPQAALCVGFGIFVWTLVEYTLHRFLFHIKTCSYWGNTMHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAA AI+ +P WGL++LL+      A+ GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAAAAILCIPFWGLLRLLSTHSTSPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P   V+++LKR+H++HHFR Q KGFGIT++ WD VF 
Sbjct  181  HYYLHHGQPSKEVARNLKRYHLNHHFRVQTKGFGITSSLWDRVFA  225



>ref|XP_008439532.1| PREDICTED: fatty acid 2-hydroxylase 2-like [Cucumis melo]
 ref|XP_008439533.1| PREDICTED: fatty acid 2-hydroxylase 2-like [Cucumis melo]
Length=237

 Score =   305 bits (781),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 178/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            MA++ FTVDL+KPLVFQVGHLG+AY+EWVH+PI+SKE PRFF N FLE LTRT WW IP 
Sbjct  1    MASKPFTVDLNKPLVFQVGHLGEAYNEWVHQPIISKEGPRFFGNDFLEMLTRTVWWVIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLPV+ W  S S++ GL     A  L   +  WTLLEYTLHRFLFH++TR YWANT HY
Sbjct  61   VWLPVISWLVSVSLSRGLTPSDAASCLAGGIFIWTLLEYTLHRFLFHMETRSYWANTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAAT I+ +PLW +++L +      A+ GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATTILSVPLWIVIRLTSTPAVAPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHGKP  G+SQ+LKR+H++HHFR+Q +GFGIT+  WD  FG
Sbjct  181  HYYLHHGKPSPGLSQNLKRYHLNHHFRDQSEGFGITSPLWDRAFG  225



>ref|XP_009623139.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=236

 Score =   305 bits (780),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 179/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGF VDL+K LVFQVGHLG+AY EW+H+PIVSKE PRFF + F EFLTRT WWAIPT
Sbjct  1    MVAQGFNVDLNKALVFQVGHLGEAYQEWIHQPIVSKEGPRFFESDFWEFLTRTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +   TS++MG   P++A+ +   +  WTL+EYTLHRFLFH+ T  YW NT HY
Sbjct  61   IWLPVVCYSIFTSIHMGHTVPEVALMVALGIFIWTLMEYTLHRFLFHINTTSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++ +P W L+K LA      A+ GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAVLCIPFWNLIKFLATPSTAPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P   V +SLK++H++HHFR Q+KGFGIT++FWD VFG
Sbjct  181  HYYLHHGQPTNEVPKSLKKYHLNHHFRIQNKGFGITSSFWDKVFG  225



>ref|XP_003524783.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Glycine max]
Length=239

 Score =   305 bits (780),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ F VDL+KPLVFQVGHLG+AYD+WVH PIVSKE PRFF +GFLE  TRT WW IPT
Sbjct  1    MVAQKFVVDLNKPLVFQVGHLGEAYDDWVHDPIVSKEGPRFFQSGFLELFTRTAWWVIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +W+PV  WF S SV  GLP+  +A+ +   +  WTL EYTLHRFLFHVKT+ YW NT HY
Sbjct  61   VWVPVASWFISNSVKSGLPSLDVALLVFLGIFVWTLAEYTLHRFLFHVKTKSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD  RLVFPP A AI+ +P+W LVKL+       A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDSYRLVFPPVAAAILALPIWNLVKLICTPSVAPAVFGGILLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V +SLK++H++HH+R Q+ GFGIT+  WD VFG
Sbjct  181  HYYLHHGQPKSDVPKSLKKYHLNHHYRLQNYGFGITSPLWDKVFG  225



>ref|XP_009774862.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Nicotiana sylvestris]
 ref|XP_009774863.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Nicotiana sylvestris]
Length=236

 Score =   305 bits (780),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 178/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGF VDL+K LVFQVGHLG+AY EW+H+PIVSKE PRFF + F EFLTRT WWAIPT
Sbjct  1    MVAQGFNVDLNKALVFQVGHLGEAYQEWIHQPIVSKEGPRFFESDFWEFLTRTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +   TS+ MG   P++A+ +   +  WTL+EYTLHRFLFH+ T  YW NT HY
Sbjct  61   IWLPVVCYSIFTSIRMGHTVPEVALMVAFGIFIWTLMEYTLHRFLFHINTTSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++ +P W L+K LA      A+ GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAVLCIPFWNLIKFLATPSTAPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P   V +SLK++H++HHFR Q+KGFGIT++FWD VFG
Sbjct  181  HYYLHHGQPTNEVPKSLKKYHLNHHFRIQNKGFGITSSFWDKVFG  225



>ref|XP_008225651.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Prunus mume]
 ref|XP_008225652.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Prunus mume]
Length=237

 Score =   304 bits (778),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ F VDL+K LVFQVGHLG+AY EWVH+PIV KE PRFF N F EFLTRT WWA+P 
Sbjct  1    MVAQDFKVDLNKALVFQVGHLGEAYQEWVHQPIVCKEGPRFFENEFWEFLTRTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV++  S SV MG   P++A+ + A +  WTLLEYTLHRFLFH++T+ YW NT HY
Sbjct  61   IWLPVVFYSISMSVRMGHGFPEIALMVFAGIFVWTLLEYTLHRFLFHIETKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++ +P W LVKL++      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAVLCVPFWNLVKLISVPSVTPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V ++LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSSDVPRNLKKYHLNHHFRIQDKGFGITSSIWDRVFG  225



>ref|XP_004963262.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X1 [Setaria 
italica]
Length=247

 Score =   304 bits (779),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 175/234 (75%), Gaps = 0/234 (0%)
 Frame = +1

Query  34   PSSIVTGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLT  213
            P S     KM A  FTVDL KPLVFQVGHL + Y EWVH+PIVSKE PRFF N  LEFLT
Sbjct  2    PYSYHCSKKMVAAAFTVDLDKPLVFQVGHLEEQYQEWVHQPIVSKEGPRFFQNDVLEFLT  61

Query  214  RTPWWAIPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTR  393
            RT WWA+P IWLPVV W  STS+ MG    ++A+ ++  +  WTL+EY LHRFLFH+KT+
Sbjct  62   RTKWWAVPLIWLPVVCWCLSTSIQMGHTITEVAMMVVFGICLWTLIEYVLHRFLFHIKTK  121

Query  394  GYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGAL  573
             YW NT HY++HGCHHKHPMDG+RLVFPPAA AI+  P W L+KL +       I GG L
Sbjct  122  SYWGNTAHYLLHGCHHKHPMDGLRLVFPPAAAAILCFPFWNLIKLFSTPSTTPGIFGGGL  181

Query  574  LGYIIYDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            LGY+IYDCTHYYLHHG+P +  ++ LK++H++HHFR Q KGFGIT+T WD VFG
Sbjct  182  LGYVIYDCTHYYLHHGQPSSDPAKHLKKYHLNHHFRIQTKGFGITSTLWDHVFG  235



>ref|XP_006448865.1| hypothetical protein CICLE_v10016492mg [Citrus clementina]
 gb|ESR62105.1| hypothetical protein CICLE_v10016492mg [Citrus clementina]
Length=238

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 179/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            + AQ FTVDL+KPLVFQVGHLG+AY EWVH+PIVSKE PRFF + F EFLT T WWAIP 
Sbjct  2    VVAQEFTVDLNKPLVFQVGHLGEAYQEWVHQPIVSKEGPRFFESDFWEFLTLTIWWAIPV  61

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S S+ MG   P +A+ +L  +  WTLLEYTLHRFLFH+KTR YW NT HY
Sbjct  62   IWLPVVCWCISMSIRMGQTLPHVALMVLFGIFVWTLLEYTLHRFLFHIKTRSYWGNTIHY  121

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++L P W L+ L++      A+ GG LLGY++YD T
Sbjct  122  LLHGCHHKHPMDGLRLVFPPAATAVLLFPFWKLLSLVSAPTTTPALFGGGLLGYVMYDVT  181

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V ++LK++H++HHFR Q+KGFGIT++ WD VFG
Sbjct  182  HYYLHHGQPSSEVPKNLKKYHLNHHFRIQNKGFGITSSLWDRVFG  226



>ref|XP_003576810.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Brachypodium distachyon]
Length=237

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDL KPLVFQVGHL + Y +WVH+PIVSKE PRFFAN  LEFLTRT WWA+P 
Sbjct  1    MVAQAFTVDLDKPLVFQVGHLEEQYQDWVHQPIVSKEGPRFFANDVLEFLTRTKWWAVPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  +TS+ MG   P++A+ ++  +  WTL+EYTLHR+LFH+ T+ YW NT HY
Sbjct  61   IWLPVVCWCLNTSIQMGHTYPEVALMVVVGMFIWTLIEYTLHRYLFHIDTKSYWTNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPP A AI+  P W LVKL   +     + GG LLGY+IYDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPTAAAILCYPFWNLVKLFTTTSTTPGVFGGGLLGYVIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P +  ++ LK++H++HHFR Q+KGFGIT+T WD VFG
Sbjct  181  HYYLHHGQPSSDPAKHLKKYHLNHHFRIQNKGFGITSTLWDHVFG  225



>emb|CDX84628.1| BnaA03g16020D [Brassica napus]
Length=237

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLG+AY+EWVH+PIV+KE PRFF + F EFLT T WW IP 
Sbjct  1    MVAQGFTVDLNKPLVFQVGHLGEAYEEWVHQPIVTKEGPRFFHSDFWEFLTLTRWWVIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPV  W  S SV+MGL   ++   +   +  WT +EYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVACWCISKSVSMGLSLTEIVPLMALGIFIWTFIEYTLHRFLFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPPAATA++  P W LVKL A      A+ GG +LGY++YD T
Sbjct  121  LLHGCHHKHPMDHLRLVFPPAATAVLCFPFWNLVKLFATPSTTPALFGGGMLGYVMYDIT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P   V+++LK++H++HHFR QDKGFGIT++ WDIVFG
Sbjct  181  HYYLHHAQPTRAVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFG  225



>ref|XP_009133002.1| PREDICTED: fatty acid 2-hydroxylase 1 [Brassica rapa]
Length=237

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLG+AY+EWVH+PIV+KE PRFF + F EFLT T WW IP 
Sbjct  1    MVAQGFTVDLNKPLVFQVGHLGEAYEEWVHQPIVTKEGPRFFHSDFWEFLTLTRWWVIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPV  W  S SV+MGL   ++   +   +  WT +EYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVACWCISKSVSMGLSLTEIVPLIALGIFIWTFIEYTLHRFLFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPPAATA++  P W LVKL A      A+ GG +LGY++YD T
Sbjct  121  LLHGCHHKHPMDHLRLVFPPAATAVLCFPFWNLVKLFATPSTTPALFGGGMLGYVMYDIT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P   V+++LK++H++HHFR QDKGFGIT++ WDIVFG
Sbjct  181  HYYLHHAQPTRAVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFG  225



>ref|XP_006468341.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006468342.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Citrus 
sinensis]
Length=238

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 180/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            + AQ FTVDL+KPLVFQVGHLG+AY EWVH+PIVSKE PRFF + F EFLT T WWAIP 
Sbjct  2    VVAQEFTVDLNKPLVFQVGHLGEAYQEWVHQPIVSKEGPRFFESDFWEFLTLTVWWAIPV  61

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S S+ MG   P +A+ +L  +  WTLLEYTLHRFLFH+KTR YW NT HY
Sbjct  62   IWLPVVCWCISMSIRMGQTLPHVALMVLFGIFVWTLLEYTLHRFLFHIKTRSYWGNTIHY  121

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++L+P W ++ L++      A+ GG LLGY++YD T
Sbjct  122  LLHGCHHKHPMDGLRLVFPPAATAVLLLPFWKVLSLVSTPTTTPALFGGGLLGYVMYDVT  181

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V ++LK++H++HHFR Q+KGFGIT++ WD VFG
Sbjct  182  HYYLHHGQPSSEVPKNLKKYHLNHHFRIQNKGFGITSSLWDRVFG  226



>gb|EPS73321.1| hypothetical protein M569_01435, partial [Genlisea aurea]
Length=231

 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 177/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+K LVFQVGHLG++Y EWVH+PI  KESPRFF N F+EFLTRT WW IP 
Sbjct  1    MVAQGFTVDLNKALVFQVGHLGESYQEWVHQPIGGKESPRFFENDFVEFLTRTHWWIIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLPVV WF S S+ +G    +++  ++  +  WTLLEY LHRFLFH+KT+ YW NT HY
Sbjct  61   VWLPVVAWFLSRSIVLGFTVVEVSEMVVLGIFVWTLLEYILHRFLFHIKTKSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+L P W L+K  A       I GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILLYPFWCLIKSCATPATTPGIFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HY+LHHG+P + V ++LKR+H++HHFR Q+KGFGIT++FWD VFG
Sbjct  181  HYFLHHGQPTSNVVKNLKRYHLNHHFRIQNKGFGITSSFWDKVFG  225



>ref|XP_009623138.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=290

 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 179/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGF VDL+K LVFQVGHLG+AY EW+H+PIVSKE PRFF + F EFLTRT WWAIPT
Sbjct  55   MVAQGFNVDLNKALVFQVGHLGEAYQEWIHQPIVSKEGPRFFESDFWEFLTRTVWWAIPT  114

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +   TS++MG   P++A+ +   +  WTL+EYTLHRFLFH+ T  YW NT HY
Sbjct  115  IWLPVVCYSIFTSIHMGHTVPEVALMVALGIFIWTLMEYTLHRFLFHINTTSYWGNTAHY  174

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++ +P W L+K LA      A+ GG LLGY++YD T
Sbjct  175  LLHGCHHKHPMDGLRLVFPPAATAVLCIPFWNLIKFLATPSTAPALFGGGLLGYVMYDVT  234

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P   V +SLK++H++HHFR Q+KGFGIT++FWD VFG
Sbjct  235  HYYLHHGQPTNEVPKSLKKYHLNHHFRIQNKGFGITSSFWDKVFG  279



>ref|XP_007211938.1| hypothetical protein PRUPE_ppa010767mg [Prunus persica]
 ref|XP_007211939.1| hypothetical protein PRUPE_ppa010767mg [Prunus persica]
 gb|EMJ13137.1| hypothetical protein PRUPE_ppa010767mg [Prunus persica]
 gb|EMJ13138.1| hypothetical protein PRUPE_ppa010767mg [Prunus persica]
Length=237

 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 180/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q F VDL+K LVFQVGHLG+AY EWVH+PIV KE PRFF N F EFLTRT WWA+P 
Sbjct  1    MVVQDFKVDLNKALVFQVGHLGEAYQEWVHQPIVCKEGPRFFENEFWEFLTRTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV++  S SV MG   P++A+ + A +  WTLLEYTLHRFLFH++T+ YW NT HY
Sbjct  61   IWLPVVFYSISMSVRMGHGFPEIALMVFAGIFVWTLLEYTLHRFLFHIETKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++ +P W LVKL++      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAVLCVPFWNLVKLISVPSVTPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V ++LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSSDVPRNLKKYHLNHHFRIQDKGFGITSSIWDRVFG  225



>gb|KHN25858.1| Fatty acid 2-hydroxylase [Glycine soja]
Length=239

 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 173/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ F VDL+KPLVFQVGHLG+AYD+WVH PIVSKE PRFF +GFLE  TRT WW IPT
Sbjct  1    MVAQKFVVDLNKPLVFQVGHLGEAYDDWVHDPIVSKEGPRFFQSGFLELFTRTAWWVIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +W+PV  WF S SV  GLP+  +A+ +   +  WTL EYTLHRFLFHVKT+ YW NT HY
Sbjct  61   VWVPVASWFISNSVKSGLPSLDVALLVFLGIFVWTLAEYTLHRFLFHVKTKSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD  RLVFPP A AI+ +P+W LVKL+       A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDSYRLVFPPVAAAILALPIWNLVKLICTPSVAPAVFGGILLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYL HG+P + V +SLK++H++HH+R Q+ GFGIT+  WD VFG
Sbjct  181  HYYLRHGQPKSDVPKSLKKYHLNHHYRLQNYGFGITSPLWDKVFG  225



>ref|XP_004134612.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Cucumis sativus]
 ref|XP_004162837.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Cucumis sativus]
 gb|KGN49479.1| hypothetical protein Csa_6G525640 [Cucumis sativus]
Length=237

 Score =   302 bits (774),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 178/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M+++ FTVDL+KPLVFQVGHLG+AY+EWVH+PI+SK+ PRFF N FLE LTRT WW IP 
Sbjct  1    MSSKPFTVDLNKPLVFQVGHLGEAYNEWVHQPIISKDGPRFFGNDFLEMLTRTVWWVIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLPV+ W  S S++ GL     A  L   +  WTLLEYTLHRFLFH++TR YWANT HY
Sbjct  61   VWLPVISWLVSVSLSRGLTPSDAASCLAGGIFIWTLLEYTLHRFLFHMETRSYWANTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAAT I+ +PLW +++L +      A+ GG LLGY++YD T
Sbjct  121  VLHGCHHKHPMDGLRLVFPPAATTILSVPLWIVIRLTSTPAVAPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHGKP  G+SQ+LKR+H++HHFR+Q +GFGIT+  WD  FG
Sbjct  181  HYYLHHGKPSPGLSQNLKRYHLNHHFRDQSEGFGITSPLWDRAFG  225



>ref|XP_007158989.1| hypothetical protein PHAVU_002G198700g [Phaseolus vulgaris]
 gb|ESW30983.1| hypothetical protein PHAVU_002G198700g [Phaseolus vulgaris]
Length=239

 Score =   302 bits (774),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 173/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ F VDL+KPLV QVGHLG+ YDEWVH+PIVSKE PRFF + FLE  TRT WW IPT
Sbjct  1    MVAQKFLVDLNKPLVSQVGHLGEDYDEWVHEPIVSKEGPRFFQSDFLELFTRTAWWVIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +W+PV  WF S S   GLP+  +A  +L  +  WTL EYTLHRFLFH+KT+ YW NTFHY
Sbjct  61   VWVPVASWFISNSAKSGLPSQHVAPFVLLGIFVWTLAEYTLHRFLFHIKTKSYWGNTFHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD  RLVFPP A AI+ +P+W LVKL+ P     A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDSFRLVFPPVAAAILALPIWNLVKLVCPPSIAPAVFGGILLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V +SLK++H++HH+R Q+ GFGIT+  WD VFG
Sbjct  181  HYYLHHGQPKSEVPKSLKKYHLNHHYRLQNYGFGITSPLWDKVFG  225



>ref|XP_006650678.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Oryza brachyantha]
Length=244

 Score =   302 bits (773),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 174/229 (76%), Gaps = 0/229 (0%)
 Frame = +1

Query  49   TGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWW  228
            T  KM  Q FTVDL++PLVFQVGHL + Y EWVH+PIVSKE PRFF N  LEFLTRT WW
Sbjct  4    TLGKMVVQEFTVDLNEPLVFQVGHLEERYQEWVHQPIVSKEGPRFFGNNVLEFLTRTKWW  63

Query  229  AIPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWAN  408
            A+PTIWLPVV W    S+ MG    ++A+  L  +  WTL+EYTLHRFLFH+ T+ YWAN
Sbjct  64   AVPTIWLPVVCWLLVKSIRMGHSIQEVALMALFGVFIWTLIEYTLHRFLFHIDTKTYWAN  123

Query  409  TFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYII  588
            T HY++HGCHHKHPMD +RLVFPP ATAI+ +P W LV   A      A+ GG LLGY++
Sbjct  124  TAHYLLHGCHHKHPMDSLRLVFPPTATAILCVPFWKLVAFFATPTTTPALFGGGLLGYVM  183

Query  589  YDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            YDCTHYYLHHG+P    +++LKR+H++HHFR QDKGFGIT++ WD VFG
Sbjct  184  YDCTHYYLHHGQPSKDPAKNLKRYHLNHHFRVQDKGFGITSSLWDYVFG  232



>ref|XP_002268031.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Vitis vinifera]
Length=237

 Score =   302 bits (773),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 176/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDLSKPLVFQVGHLG+ Y EWVH+PIVSKE PRFF + F E LTRT WWAIP 
Sbjct  1    MVAQDFTVDLSKPLVFQVGHLGEDYQEWVHQPIVSKEGPRFFDSDFWEALTRTKWWAIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S SV MGL  P+L + +   +  WTL+EY+LHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVTWSISRSVRMGLELPRLVLMMAIGIFVWTLMEYSLHRFLFHIKTKTYWGNTIHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPA  A++ +PLW L+K L+      A+ GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAGAAVICVPLWNLIKFLSTPTTAPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V ++LK++H++HHFR QD GFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSSKVPRNLKKYHLNHHFRIQDMGFGITSSLWDRVFG  225



>emb|CDX79577.1| BnaC03g19130D [Brassica napus]
Length=237

 Score =   301 bits (772),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLG++Y+EWVH+PIV+KE PRFF + F EFLT T WW IP 
Sbjct  1    MVAQGFTVDLNKPLVFQVGHLGESYEEWVHQPIVTKEGPRFFHSDFWEFLTLTRWWVIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPV  W  S SV+MGL   ++   +   +  WT +EYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVAIWCISKSVSMGLSLTEIFPLIALGIFIWTFIEYTLHRFLFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPPAATA++  P W LVKL A      A+ GG +LGY++YD T
Sbjct  121  LLHGCHHKHPMDHLRLVFPPAATAVLCFPFWNLVKLFATPSTTPALFGGGMLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P   V+++LK++H++HHFR QDKGFGIT++ WDIVFG
Sbjct  181  HYYLHHAQPTRAVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFG  225



>gb|EYU19105.1| hypothetical protein MIMGU_mgv1a012885mg [Erythranthe guttata]
Length=237

 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 177/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  QGFTVDL+KPLVFQVGHLG+AY EWVH+PIVSKE PRFF + F E+LTR  WW IP 
Sbjct  1    MVVQGFTVDLNKPLVFQVGHLGEAYQEWVHQPIVSKEGPRFFKSDFWEYLTRNEWWVIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S +V+ G   P++ +  +  + AWTL+EYTLHRFLFH++T+ YW NT HY
Sbjct  61   IWLPVVCWSLSRAVSFGNTIPEVVLLTVFGIFAWTLVEYTLHRFLFHIETKSYWGNTMHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG RLVFPPAATA++L P W L+KL++  +   A+ GG LLGY++YD T
Sbjct  121  LIHGCHHKHPMDGQRLVFPPAATAVLLFPFWNLIKLISTPMTAPAVFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P +   ++LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHSQPTSEFPKNLKKYHLNHHFRVQDKGFGITSSLWDKVFG  225



>ref|XP_009353853.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Pyrus x bretschneideri]
 ref|XP_009353854.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Pyrus x bretschneideri]
Length=237

 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 179/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ F VDL K LVFQVGHLG+AY EWVH+PIVSKE PRFF + F EFLTRT WWA+P 
Sbjct  1    MVAQDFKVDLDKALVFQVGHLGEAYQEWVHQPIVSKEGPRFFESEFWEFLTRTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV++  S SV MG   P++ + +++ +  WTLLEYTLHRFLFH +T  YW NT HY
Sbjct  61   IWLPVVFYSISVSVRMGHTFPEIVLMVVSGIFVWTLLEYTLHRFLFHFETNSYWWNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++ +P + LVKL+A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAVLCIPFFNLVKLMASPTVAPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V ++LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSSEVPRNLKKYHLNHHFRIQDKGFGITSSLWDRVFG  225



>ref|XP_004963263.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Setaria 
italica]
Length=237

 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 172/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A  FTVDL KPLVFQVGHL + Y EWVH+PIVSKE PRFF N  LEFLTRT WWA+P 
Sbjct  1    MVAAAFTVDLDKPLVFQVGHLEEQYQEWVHQPIVSKEGPRFFQNDVLEFLTRTKWWAVPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  STS+ MG    ++A+ ++  +  WTL+EY LHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVCWCLSTSIQMGHTITEVAMMVVFGICLWTLIEYVLHRFLFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAA AI+  P W L+KL +       I GG LLGY+IYDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAAAAILCFPFWNLIKLFSTPSTTPGIFGGGLLGYVIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P +  ++ LK++H++HHFR Q KGFGIT+T WD VFG
Sbjct  181  HYYLHHGQPSSDPAKHLKKYHLNHHFRIQTKGFGITSTLWDHVFG  225



>ref|XP_010247168.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Nelumbo nucifera]
 ref|XP_010247169.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Nelumbo nucifera]
Length=237

 Score =   300 bits (767),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q FTVDL+KPLVFQVGHLG+ Y +WVH+PIVSKE PRFF + F EF TRT WWA+P 
Sbjct  1    MVVQEFTVDLNKPLVFQVGHLGETYQDWVHQPIVSKEGPRFFESNFWEFFTRTVWWAVPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV WF  TS  MG   PQ+ + +L  +  WTLLEYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVCWFIYTSFQMGHTLPQVCLMILGGIFVWTLLEYTLHRFLFHIKTKSYWGNTIHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+ +P W LVK ++      A+ GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILCVPFWNLVKFMSTPSIAPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P   V ++LK++H++HHF+ Q+KGFGIT++ WD  FG
Sbjct  181  HYYLHHGQPSKEVPRNLKKYHLNHHFKVQNKGFGITSSLWDRTFG  225



>ref|XP_010687074.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=237

 Score =   300 bits (767),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 177/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGF VDL+KPLVFQVGHL ++Y+EWVH+PIVSKE PRFF + F EFLT T WWAIP 
Sbjct  1    MVAQGFIVDLNKPLVFQVGHLEESYEEWVHQPIVSKEGPRFFESDFWEFLTLTVWWAIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV    S SV MG   P++ + ++  +  WTL+EYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVCCCISMSVRMGHTLPEIVLMVIFGVFLWTLIEYTLHRFLFHIKTKSYWGNTIHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++  P W LVK+ A      A+ GG LLGY++YD T
Sbjct  121  LIHGCHHKHPMDGLRLVFPPAATAVLCFPFWNLVKVFATPSTTPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V ++LKR+H++HHFR Q+KGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSSDVPKNLKRYHLNHHFRIQNKGFGITSSIWDKVFG  225



>ref|XP_006468337.1| PREDICTED: fatty acid 2-hydroxylase 2-like [Citrus sinensis]
 ref|XP_006468340.1| PREDICTED: fatty acid 2-hydroxylase 2-like [Citrus sinensis]
 gb|KDO75198.1| hypothetical protein CISIN_1g023817mg [Citrus sinensis]
 gb|KDO75199.1| hypothetical protein CISIN_1g023817mg [Citrus sinensis]
Length=236

 Score =   299 bits (766),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            +A + F+VDL+KPLVFQVGHLG+AY+EWVH+PIV K+SPRFFANGF+EFLTRT WW IP 
Sbjct  2    VADEPFSVDLNKPLVFQVGHLGEAYEEWVHQPIVGKDSPRFFANGFMEFLTRTKWWVIPL  61

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLPVV W  S SV MGL      + +   +  WTLLEY LHR+LFH+KT+ YW NTFHY
Sbjct  62   VWLPVVCWSVSKSVKMGLAPYLAGLIVFLGIITWTLLEYFLHRYLFHIKTKSYWGNTFHY  121

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPA  A++ + LW L+ +L       A+ GG LLGY++YD T
Sbjct  122  LIHGCHHKHPMDGLRLVFPPAGAALVSLALWNLIDVLTKPFITPALYGGILLGYVMYDVT  181

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYY HHGKP  G+   LKRFHM+HHFR +DKGFGI+++ WDIVFG
Sbjct  182  HYYTHHGKPSKGIILRLKRFHMNHHFRIRDKGFGISSSLWDIVFG  226



>ref|XP_008439531.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Cucumis melo]
Length=237

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 177/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M +Q FTVDL+KPLVFQVGHLG+AY EWVH+PI+SKE PRFF + F EF T T WWA+P 
Sbjct  1    MVSQQFTVDLNKPLVFQVGHLGEAYQEWVHQPIISKERPRFFKSDFWEFCTCTAWWAVPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV WF S SVNMG    Q+++ ++  ++ WTL+EY +HRFLFH++T+ YW NT HY
Sbjct  61   IWLPVVCWFVSMSVNMGHTFSQISLMVIFGISIWTLIEYIVHRFLFHIETQSYWGNTMHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATA++L+PLW LVKL  PS    A+ GG LLGY+IYD T
Sbjct  121  LIHGCHHKHPMDSLRLVFPPTATAVLLVPLWNLVKLFFPSSMAPALFGGGLLGYVIYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P   + + LK++HM+HHFR  +KGFG+T+  WD VFG
Sbjct  181  HYYLHHGQPTGDMPKKLKKYHMNHHFRILNKGFGVTSPLWDRVFG  225



>ref|XP_006448866.1| hypothetical protein CICLE_v10016504mg [Citrus clementina]
 gb|ESR62106.1| hypothetical protein CICLE_v10016504mg [Citrus clementina]
Length=236

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            +A + F+VDL+KPLVFQVGHLG+AY+EWVH+PIV ++SPRFFANGF+EFLTRT WW IP 
Sbjct  2    VADEPFSVDLNKPLVFQVGHLGEAYEEWVHQPIVGRDSPRFFANGFMEFLTRTKWWVIPL  61

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLPVV W  S SV MGL      + +   +  WTLLEY LHR+LFH+KT+ YW NTFHY
Sbjct  62   VWLPVVCWSVSKSVKMGLSPYLAGLIVFLGIITWTLLEYFLHRYLFHIKTKSYWGNTFHY  121

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPA  A++ + LW L+ +L       A+ GG LLGY++YD T
Sbjct  122  LIHGCHHKHPMDGLRLVFPPAGAALVSLALWNLIDVLTKPFITPALYGGILLGYVMYDVT  181

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYY HHGKP  G+   LKRFHM+HHFR +DKGFGI+++ WDIVFG
Sbjct  182  HYYTHHGKPSKGIILRLKRFHMNHHFRIRDKGFGISSSLWDIVFG  226



>ref|XP_010540644.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Tarenaya hassleriana]
Length=235

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLGDAY+EWVH+PIV+KE PRFF N F EFLTRT WWA+P 
Sbjct  1    MGAQGFTVDLNKPLVFQVGHLGDAYEEWVHQPIVTKEGPRFFQNDFCEFLTRTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV++  STSV MG   P++A  +   +  WTL+EYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVFYCISTSVMMGHTLPEMAAMVAFGIFIWTLIEYTLHRFLFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            +MHGCHHKHPMD +RLVFPPAATAI+ +P W +VKL A       + GG LLGY++YD T
Sbjct  121  LMHGCHHKHPMDHLRLVFPPAATAILCIPFWNIVKLFATPSTTPGLFGGGLLGYVMYDIT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P + V+++LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHAQPSSQVTKNLKKYHLNHHFRIQDKGFGITSSLWDNVFG  225



>ref|XP_006294911.1| hypothetical protein CARUB_v10023963mg [Capsella rubella]
 gb|EOA27809.1| hypothetical protein CARUB_v10023963mg [Capsella rubella]
Length=237

 Score =   297 bits (761),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLG+ Y+EWVH+PI +KE PRFF + F EFLT T WWA+P 
Sbjct  1    MVAQGFTVDLTKPLVFQVGHLGEEYEEWVHQPIATKEGPRFFQSDFWEFLTLTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S SV+MG   PQ+   ++  +  WT +EY LHRF+FH+KT+ YW NT HY
Sbjct  61   IWLPVVVWCISMSVSMGCSLPQIVSVVVMGIFIWTFIEYFLHRFVFHIKTKSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATAI+ +P W + K ++      A+ GG +LGY++YD T
Sbjct  121  LIHGCHHKHPMDHLRLVFPPTATAILCIPFWNIAKAISTPSTAPALFGGGMLGYVLYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P   V+++LK++H++HHFR QDKGFGIT++ WDIVFG
Sbjct  181  HYYLHHAQPTRPVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFG  225



>gb|EMT29039.1| Fatty acid 2-hydroxylase [Aegilops tauschii]
Length=237

 Score =   297 bits (761),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 173/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDL KPLVFQVGHL + Y +WVH+PIVSKE PRFFAN  LEFLTRT WWA+P 
Sbjct  1    MVAQAFTVDLDKPLVFQVGHLEEQYQDWVHQPIVSKEGPRFFANDVLEFLTRTKWWAVPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  +TS+ MG   P++A+ ++A +  WTL+EY LHR+LFH+ T+ YW NT HY
Sbjct  61   IWLPVVCWCLNTSIQMGHTVPEVALMVVAGIFIWTLVEYVLHRYLFHIDTKSYWTNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPP A AI+  P W  VKL   +     + GG LLGY+IYDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPTAAAILCYPFWNFVKLFTTTTTTPGVFGGGLLGYVIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P +  ++ LK++H++HHFR Q+KGFGIT+T WD VFG
Sbjct  181  HYYLHHAQPSSDPAKYLKKYHLNHHFRIQNKGFGITSTLWDHVFG  225



>ref|XP_004293705.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Fragaria vesca subsp. 
vesca]
Length=237

 Score =   296 bits (759),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ F VDL+K LVFQVGHLG+AY EWVH+PIV  E PRFF N F EFLTRT WWAIPT
Sbjct  1    MVAQDFQVDLNKGLVFQVGHLGEAYQEWVHQPIVCVEGPRFFENEFWEFLTRTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +F S SV MG   P++ + +L  +  WTLLEYTLHRFLFH++T+ YW NT HY
Sbjct  61   IWLPVVCYFISKSVRMGHTFPEIVLMVLFGIFVWTLLEYTLHRFLFHIETKSYWGNTVHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPP ATAI+  P + LVKL++      A+  G LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPTATAILCFPFYNLVKLMSSPSVAPALFAGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V + LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSSKVPKDLKKYHLNHHFRIQDKGFGITSSLWDWVFG  225



>ref|XP_010053016.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Eucalyptus grandis]
 ref|XP_010053017.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Eucalyptus grandis]
 ref|XP_010053018.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Eucalyptus grandis]
 gb|KCW77254.1| hypothetical protein EUGRSUZ_D01613 [Eucalyptus grandis]
 gb|KCW77255.1| hypothetical protein EUGRSUZ_D01613 [Eucalyptus grandis]
 gb|KCW77256.1| hypothetical protein EUGRSUZ_D01613 [Eucalyptus grandis]
 gb|KCW77257.1| hypothetical protein EUGRSUZ_D01613 [Eucalyptus grandis]
 gb|KCW77258.1| hypothetical protein EUGRSUZ_D01613 [Eucalyptus grandis]
Length=237

 Score =   296 bits (758),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 176/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDL+KPLVFQVGHLG++Y EWVH+PIVSK  PRFF + F EFLTRT W+A+P+
Sbjct  1    MVAQEFTVDLNKPLVFQVGHLGESYQEWVHQPIVSKTGPRFFESDFWEFLTRTRWYAVPS  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S SV MG    ++ + ++  +  WT LEY+LHRF+FH+ T  YW NT HY
Sbjct  61   IWLPVVCYCISMSVRMGHTALEIGLLVIMGIFVWTFLEYSLHRFVFHINTNSYWWNTIHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPA TA++ +P W LVKL++      A+  G LLGY+IYDCT
Sbjct  121  LIHGCHHKHPMDGLRLVFPPAGTAVLCVPFWNLVKLISTPTTTPALFAGGLLGYVIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P T V ++LK++H++HHFR QDKGFGIT+T WD VFG
Sbjct  181  HYYLHHGQPATDVPRNLKKYHLNHHFRVQDKGFGITSTLWDRVFG  225



>ref|XP_004981551.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Setaria italica]
Length=237

 Score =   296 bits (758),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 171/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q FTVDL+KPLVFQVGHL + Y EWVH+PIVSKE PRFF N  LEFLTRT WWA+PT
Sbjct  1    MVVQEFTVDLNKPLVFQVGHLEERYQEWVHQPIVSKEGPRFFGNDVLEFLTRTKWWAVPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +F   S+ MG    ++ +  L  +  WTL+EYTLHRFLFH++T+ YW+NT HY
Sbjct  61   IWLPVVCYFFVKSILMGHTIQEVVLIALFGIFIWTLIEYTLHRFLFHIETKTYWSNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATAI+  P W LV   A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDSLRLVFPPTATAILCFPFWNLVAFFATPSTTPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    ++ LKR+H++HHFR QDKGFGIT+T WD +FG
Sbjct  181  HYYLHHGQPSKDPAKHLKRYHLNHHFRIQDKGFGITSTLWDTIFG  225



>ref|XP_010098539.1| Fatty acid 2-hydroxylase [Morus notabilis]
 gb|EXB75199.1| Fatty acid 2-hydroxylase [Morus notabilis]
Length=237

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  + FTVDL+KPLVFQVGHLG+AY EW H+PIVSKE PR FAN   E LTRT WW +P 
Sbjct  1    MVNKPFTVDLNKPLVFQVGHLGEAYSEWAHQPIVSKEGPRLFANDLCELLTRTVWWVVPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLPV+ WF + S+ MGL + Q A++++  +  WTLLEY LHRFLFH+KT  YW NT HY
Sbjct  61   VWLPVMCWFVTKSLQMGLSSSQAALAVVGGIFIWTLLEYCLHRFLFHMKTTSYWGNTVHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAA AI+ +P+W L++L +      AI GG LLGY+IYD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAAAAILSVPIWTLIRLSSTPSTAPAIFGGCLLGYVIYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            H+YLHHGKP  G+++SLK +H+ HHFR Q  GFGIT++FWD VFG
Sbjct  181  HFYLHHGKPSKGLTKSLKTYHLSHHFRVQTLGFGITSSFWDRVFG  225



>emb|CDY46240.1| BnaCnng13910D [Brassica napus]
Length=240

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 171/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL KPL FQVGHLG+AYDEWVH+PIV+KE PRFF + F EFLT T WWA+P 
Sbjct  1    MVAQGFTVDLDKPLAFQVGHLGEAYDEWVHQPIVTKEGPRFFHSDFWEFLTLTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S SV+MG   P++   +   +  WT +EY LHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVVWCISMSVSMGCSFPEIVSLVALGIFIWTFIEYCLHRFLFHMKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HG HHKHPMD +RLVFPPA TAIM  PLW L KL+A      A+ GG LLGY++YD T
Sbjct  121  LIHGYHHKHPMDHLRLVFPPALTAIMCFPLWNLAKLIATPSTAPALFGGGLLGYVMYDLT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH  P   V++SLK+ H++HHFR QDKG+G+T++ WDIVFG
Sbjct  181  HYYLHHANPTIPVTKSLKKSHLNHHFRIQDKGYGVTSSLWDIVFG  225



>ref|XP_010516639.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Camelina sativa]
Length=237

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLG+ Y+EWVH+PI +KE PRFF + F EFLT T WWA+P 
Sbjct  1    MVAQGFTVDLTKPLVFQVGHLGEDYEEWVHQPIATKEGPRFFQSDFWEFLTLTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S SV+MG   P++   +   +  WT +EY LHRF+FH+KT+ YW NT HY
Sbjct  61   IWLPVVVWCISKSVSMGCSLPEIVPVVAMGIFIWTFIEYFLHRFVFHIKTKSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATAI+ +P W + K ++ +    A+ GG +LGY++YD T
Sbjct  121  LIHGCHHKHPMDHLRLVFPPTATAILCIPFWNIAKAISTTSTAPALFGGGMLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P   V+++LK++H++HHFR QDKGFGIT++ WDIVFG
Sbjct  181  HYYLHHAQPTRPVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFG  225



>gb|ADE77668.1| unknown [Picea sitchensis]
Length=232

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 170/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  + F+VDL++PLVFQVGHLGDAY EWVH+PIVS+E PRFF + F EFLTRT WW IP 
Sbjct  1    MVVKAFSVDLNQPLVFQVGHLGDAYQEWVHQPIVSREGPRFFKSDFWEFLTRTAWWVIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLPVV W   T++  GL     A   L  +  W+L+EY+LHRFLFH+KT  YW NT HY
Sbjct  61   VWLPVVSWSILTTIQRGLSPSMAAYLALIGIFVWSLMEYSLHRFLFHIKTSSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG RLVFPPAATAI+ +P W LVK + P     A+ GG +LGY++YD T
Sbjct  121  LLHGCHHKHPMDGYRLVFPPAATAILCIPFWSLVKSVVPYTAAPAVFGGGMLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P   V+ +LK++H++HHFRNQ  GFGIT++ WD VFG
Sbjct  181  HYYLHHGRPSQTVAHNLKKYHLNHHFRNQTSGFGITSSLWDSVFG  225



>ref|XP_009141398.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Brassica rapa]
 ref|XP_009141399.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Brassica rapa]
 emb|CDY43655.1| BnaA04g20360D [Brassica napus]
 emb|CDY43657.1| BnaA04g20340D [Brassica napus]
Length=237

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 169/225 (75%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLG+ Y+EWVH+PIVSKE PRFF + F EFLT T WW +P 
Sbjct  1    MVAQGFTVDLNKPLVFQVGHLGEEYEEWVHQPIVSKEGPRFFKSDFWEFLTLTRWWVVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPV  W  S SV MGL   ++   +   +  WT +EYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVSLWCISMSVRMGLSLAEIVPLIALGIFIWTFIEYTLHRFLFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP AT I+  P W +VKL         + GG +LGY++YD T
Sbjct  121  LLHGCHHKHPMDHLRLVFPPTATLILCFPFWNIVKLFTTPSVTPVLFGGGMLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P   V+++LK++H++HHFR QDKGFGIT++ WDIVFG
Sbjct  181  HYYLHHAQPTKAVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFG  225



>ref|XP_002867872.1| hypothetical protein ARALYDRAFT_914595 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44131.1| hypothetical protein ARALYDRAFT_914595 [Arabidopsis lyrata subsp. 
lyrata]
Length=237

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+ +TVDL+KPLVFQVGHLG+ Y EW+H+PIV  E PRFF + F EFLTRT WWAIPT
Sbjct  1    MVAERYTVDLNKPLVFQVGHLGEEYQEWIHQPIVCVEGPRFFESDFWEFLTRTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S S   GL  PQ+ + +   +  WTLLEYTLHRFLFH++T+ YWANT HY
Sbjct  61   IWLPVVCYVLSISARKGLTIPQIGLIVAFGVLTWTLLEYTLHRFLFHIQTKSYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHP DG+RLVFPP ATAI+L+PLW L+ LLA      AILGG L GY++YD T
Sbjct  121  LLHGCHHKHPQDGLRLVFPPTATAILLVPLWKLLHLLATPATAPAILGGILFGYVMYDIT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P     + LK++H++HHFR QDKG+GIT++ WD VFG
Sbjct  181  HYYLHHGQPKEPTFKHLKKYHLNHHFRIQDKGYGITSSLWDKVFG  225



>ref|NP_001051453.1| Os03g0780800 [Oryza sativa Japonica Group]
 gb|AAK09233.1|AC084320_20 putative fatty acid hydroxylase [Oryza sativa Japonica Group]
 gb|ABF99179.1| Fatty acid hydroxylase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13367.1| Os03g0780800 [Oryza sativa Japonica Group]
 gb|EAZ28790.1| hypothetical protein OsJ_12811 [Oryza sativa Japonica Group]
 dbj|BAG87183.1| unnamed protein product [Oryza sativa Japonica Group]
Length=237

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 172/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q FTVDL+KPLVFQVGHL + Y EWVH+PIVSKE PRFF N  LEFLTRT W+A+PT
Sbjct  1    MVVQEFTVDLNKPLVFQVGHLEERYQEWVHQPIVSKEGPRFFGNDVLEFLTRTKWFAVPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W    S+ MG    ++ +  L  +  WTL+EYTLHRFLFH++T+ YWANT HY
Sbjct  61   IWLPVVCWLLVKSIRMGHTIQEVGLMALFGIFIWTLIEYTLHRFLFHIETKTYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATAI+ +P W LV   A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDSLRLVFPPTATAILCVPFWKLVAFFATPTITPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    +++LKR+H++HHFR Q+KGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSKEPAKNLKRYHLNHHFRIQNKGFGITSSLWDYVFG  225



>gb|AFK47890.1| unknown [Lotus japonicus]
Length=238

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 168/225 (75%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q F VDL+KPLVFQVGHLG+AYDEWVH+PI+SKE PRFF +G LE  T+T WW IP 
Sbjct  1    MVVQNFVVDLNKPLVFQVGHLGEAYDEWVHEPIISKEGPRFFQSGVLELFTQTAWWVIPI  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IW+PV  WF S SV  GLP   +A  +   +  WTL EY  HRFLFHVKT+ YW NT HY
Sbjct  61   IWVPVASWFISGSVKAGLPCSHVAPLVFLGIFLWTLAEYLSHRFLFHVKTKSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            +MHGCHHKHPMD +RLVFPPAA  I+ +P+W +VKL +      A+ GG LLGY++YDCT
Sbjct  121  LMHGCHHKHPMDSLRLVFPPAAAVILAVPIWNIVKLASTPSTAPAVFGGILLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P T V +SLK++H++HH+R Q  GFGIT+  WD VFG
Sbjct  181  HYYLHHGQPKTEVPRSLKKYHLNHHYRLQSYGFGITSPLWDKVFG  225



>ref|XP_010687203.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=233

 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 174/220 (79%), Gaps = 0/220 (0%)
 Frame = +1

Query  76   FTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPV  255
            F VDL KPLV QVGHLG+AYDEWVH+PIVSKE PRFFAN  LE LTRT WW IP +WLPV
Sbjct  5    FVVDLDKPLVSQVGHLGEAYDEWVHQPIVSKEGPRFFANDILETLTRTRWWVIPLVWLPV  64

Query  256  VWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHYMMHGC  435
            V W    S+   L   + A +L++ +  W+LLEY+LHRFLFH+KT+ YW NTFHY++HGC
Sbjct  65   VCWLVFVSMQRSLTPAEAATTLVSGIFTWSLLEYSLHRFLFHMKTQSYWGNTFHYLLHGC  124

Query  436  HHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLH  615
            HHKHPMD +RLVFPPAATAI+ +P+W +V+LL+      A  GG LLGY++YD THYYLH
Sbjct  125  HHKHPMDALRLVFPPAATAILCVPIWTVVRLLSAPSVAPAFFGGLLLGYVMYDTTHYYLH  184

Query  616  HGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HG+P TGV ++LKR+H++HHFR Q+KGFGIT++ WD VFG
Sbjct  185  HGQPSTGVPKNLKRYHLNHHFRVQEKGFGITSSLWDHVFG  224



>ref|XP_010509705.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Camelina sativa]
Length=237

 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 173/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLG+ Y+EWVH+PI +KE PRFF + F EFLT T WWA+P 
Sbjct  1    MVAQGFTVDLTKPLVFQVGHLGEDYEEWVHQPIATKEGPRFFESDFWEFLTLTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S SV+MG   P++   +   +  WT +EY LHRF+FH+KT+ YW NT HY
Sbjct  61   IWLPVVVWCISKSVSMGCSLPEIVPVVAMGIFIWTFIEYFLHRFVFHIKTKSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATAI+  P W + K ++ +    A+ GG +LGY++YD T
Sbjct  121  LIHGCHHKHPMDHLRLVFPPTATAILCFPFWNIAKAISTTSTAPALFGGGMLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P   V+++LK++H++HHFR QDKGFGIT++ WDIVFG
Sbjct  181  HYYLHHAQPTRPVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFG  225



>ref|XP_004134610.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Cucumis sativus]
 ref|XP_004162838.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Cucumis sativus]
 gb|KGN49480.1| hypothetical protein Csa_6G525650 [Cucumis sativus]
Length=237

 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M +Q FTVDL+KPLVFQVGHLG+AY EWVH+PI+SKE PRFF + F EF T T WWA+P 
Sbjct  1    MVSQQFTVDLNKPLVFQVGHLGEAYQEWVHQPIISKERPRFFKSDFWEFCTCTAWWAVPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV WF S SVNMG    Q+++ ++  ++ WTL+EY +HRFLFH++T+ YW NT HY
Sbjct  61   IWLPVVCWFVSMSVNMGHTFSQISLMVILGISIWTLIEYIVHRFLFHIETQSYWGNTMHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATA++L PLW LVKL  P     A+ GG LLGY+IYD T
Sbjct  121  LIHGCHHKHPMDSLRLVFPPTATAVLLFPLWNLVKLFFPPSMAPALFGGGLLGYVIYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P   + + LK++HM+HH+R  +KGFG+T+  WD VFG
Sbjct  181  HYYLHHGQPTGDMPKKLKKYHMNHHYRILNKGFGVTSPLWDRVFG  225



>ref|XP_010504961.1| PREDICTED: fatty acid 2-hydroxylase 1 [Camelina sativa]
Length=237

 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 173/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL+KPLVFQVGHLG+ Y+EWVH+PI +KE PRFF + F EFLT T WWA+P 
Sbjct  1    MVAQGFTVDLTKPLVFQVGHLGEDYEEWVHQPIATKEGPRFFQSDFWEFLTLTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S SV+MG   P++   +   +  WT +EY LHRF+FH+KT+ YW NT HY
Sbjct  61   IWLPVVVWCISKSVSMGCSLPEIVPVVAMGIFIWTFIEYFLHRFVFHIKTKSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATAI+  P W + K ++ +    A+ GG +LGY++YD T
Sbjct  121  LIHGCHHKHPMDHLRLVFPPTATAILCFPFWNIAKAISTTSTAPALFGGGMLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P   V+++LK++H++HHFR QDKGFGIT++ WDIVFG
Sbjct  181  HYYLHHAQPTRPVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFG  225



>gb|EAY92050.1| hypothetical protein OsI_13744 [Oryza sativa Indica Group]
Length=237

 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 172/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q FTVDL+KPLVFQVGHL + Y EWVH+PIVSKE PRFF N  LEFLTRT W+A+PT
Sbjct  1    MVVQEFTVDLNKPLVFQVGHLEERYQEWVHQPIVSKEGPRFFGNDVLEFLTRTKWFAVPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W    S+ MG    ++ +  L  +  WTL+EYTLHRFLFH++T+ YWANT HY
Sbjct  61   IWLPVVCWLLVKSIRMGHTIQEVGLMALFGIFIWTLIEYTLHRFLFHIETKTYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATAI+ +P W LV   A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDSLRLVFPPTATAILCVPFWKLVAFFATPTTTPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    +++LKR+H++HHFR Q+KGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSKEPAKNLKRYHLNHHFRIQNKGFGITSSLWDYVFG  225



>ref|NP_193819.1| fatty acid hydroxylase 2 [Arabidopsis thaliana]
 sp|Q9SUC5.1|FAH2_ARATH RecName: Full=Fatty acid 2-hydroxylase 2; Short=AtFAH2 [Arabidopsis 
thaliana]
 emb|CAB45882.1| fatty acid hydroxylase-like protein [Arabidopsis thaliana]
 emb|CAB79087.1| fatty acid hydroxylase-like protein [Arabidopsis thaliana]
 gb|AAK73256.1| fatty acid hydroxylase-like protein [Arabidopsis thaliana]
 gb|AAL25567.1| AT4g20870/T13K14_30 [Arabidopsis thaliana]
 gb|AAM26659.1| AT4g20870/T13K14_30 [Arabidopsis thaliana]
 gb|AEE84370.1| fatty acid hydroxylase 2 [Arabidopsis thaliana]
Length=237

 Score =   295 bits (754),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+ +TVDL+KPLVFQVGHLG+ Y EW+H+PIV  E PRFF + F EFLTRT WWAIPT
Sbjct  1    MVAERYTVDLNKPLVFQVGHLGEEYQEWIHQPIVCVEGPRFFESDFWEFLTRTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S S + GL  PQ+ + +   +  WTLLEYTLHRFLFH++T+ YWANT HY
Sbjct  61   IWLPVVCYVLSISASKGLTFPQIGLIVAFGVLTWTLLEYTLHRFLFHIQTKSYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHP DG+RLVFPP ATAI+L+PLW L+ LLA      AILGG L GY++YD T
Sbjct  121  LLHGCHHKHPQDGLRLVFPPTATAILLVPLWKLLHLLATPATAPAILGGILFGYVMYDIT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P     + LK++H++HHFR QDKG+GIT++ WD VFG
Sbjct  181  HYYLHHGQPKEPTFKHLKKYHLNHHFRIQDKGYGITSSLWDKVFG  225



>ref|XP_006284450.1| hypothetical protein CARUB_v10005630mg [Capsella rubella]
 gb|EOA17348.1| hypothetical protein CARUB_v10005630mg [Capsella rubella]
Length=237

 Score =   295 bits (754),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+ FTVDL+KPLVFQVGHLG+ Y EW+H+PIV  E PRFF + F EFLTRT WWAIPT
Sbjct  1    MVAERFTVDLNKPLVFQVGHLGEEYQEWIHQPIVCVEGPRFFESDFWEFLTRTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S S + GL  PQ+ + +   +  WTLLEYTLHRFLFH++T+ YWANT HY
Sbjct  61   IWLPVVCYVLSISASKGLTFPQIGLIVAFGVLTWTLLEYTLHRFLFHIQTKSYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHP DG+RLVFPP ATAI+L+PLW L+ LLA      A+LGG L GY++YD T
Sbjct  121  LLHGCHHKHPQDGLRLVFPPTATAILLVPLWKLLHLLATPATAPALLGGILFGYVMYDIT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P     + LK++H++HHFR QDKG+GIT++ WD VFG
Sbjct  181  HYYLHHGQPKEPTFKHLKKYHLNHHFRIQDKGYGITSSLWDKVFG  225



>ref|XP_010538659.1| PREDICTED: fatty acid 2-hydroxylase 2 [Tarenaya hassleriana]
 ref|XP_010538660.1| PREDICTED: fatty acid 2-hydroxylase 2 [Tarenaya hassleriana]
 ref|XP_010538661.1| PREDICTED: fatty acid 2-hydroxylase 2 [Tarenaya hassleriana]
 ref|XP_010538662.1| PREDICTED: fatty acid 2-hydroxylase 2 [Tarenaya hassleriana]
Length=237

 Score =   294 bits (752),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+GFTVDL+KPLVFQVGHLG+AY EWVH+PI++ E PRFF + F EFLTRT WWAIPT
Sbjct  1    MVAKGFTVDLNKPLVFQVGHLGEAYQEWVHQPIITVEGPRFFESEFWEFLTRTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV++  S S  MG   P + + +   +  WTLLEYTLHRFLFH+ T  YW NT HY
Sbjct  61   IWLPVVFYSISISARMGHTFPNIGLLVALGVLIWTLLEYTLHRFLFHINTTSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+ +P W ++ LLA      A+ GG LLGY++YD T
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILCIPFWKVLHLLATPSTAPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P     + LK++H++HHFR Q+KGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSDQTFKHLKKYHLNHHFRIQNKGFGITSSLWDKVFG  225



>ref|XP_006664224.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Oryza brachyantha]
Length=238

 Score =   293 bits (751),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 171/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+ FTVDL+KPLVFQVGHLGD Y EWVH+PIVSKE PR F N  LEFLTRT WWAIP 
Sbjct  1    MVAEAFTVDLNKPLVFQVGHLGDQYQEWVHQPIVSKEGPRLFGNDALEFLTRTEWWAIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S SV  G    ++A+ ++  +  WTL+EY +HRFLFH+ T+ YWANT HY
Sbjct  61   IWLPVVCWCLSKSVQTGHTLSEVALMVVFGICLWTLIEYIMHRFLFHINTKSYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HG HHKHP DG+RLVFPPAA AI+  P W L++L+      + + GG LLGY++YDCT
Sbjct  121  LLHGIHHKHPTDGLRLVFPPAAAAILCFPFWNLIRLITTPTTTHGVFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P +   + LK++H++HHFR Q+KGFGIT+T WD VFG
Sbjct  181  HYYLHHGQPSSDPGKHLKKYHLNHHFRIQNKGFGITSTLWDHVFG  225



>ref|XP_009140305.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Brassica rapa]
Length=240

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 170/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL KPL FQVGHLG+AYDEWVH+PIV+KE PRFF + F EFLT T WWA+P 
Sbjct  1    MVAQGFTVDLDKPLAFQVGHLGEAYDEWVHQPIVTKEGPRFFHSDFWEFLTLTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S SV+MG   P++   +   +  WT +EY LHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVVWCISMSVSMGCSFPEVVSLVALGIFIWTFIEYCLHRFLFHMKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HG HHKHPMD +RLVFPPA TAIM  PLW L KL+A      A+ GG L GY++YD T
Sbjct  121  LIHGYHHKHPMDHLRLVFPPALTAIMCFPLWNLAKLIATPSAAPALFGGGLFGYVMYDLT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH  P   V+++LK+ H++HHFR QDKG+G+T++ WDIVFG
Sbjct  181  HYYLHHANPTIPVTKNLKKSHLNHHFRIQDKGYGVTSSLWDIVFG  225



>emb|CDX84282.1| BnaC04g10440D [Brassica napus]
Length=247

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 172/224 (77%), Gaps = 0/224 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+GFTVDL+KPLVFQVGHLG+ Y+EWVH+PIV+K+ PRFF + F EFLT T WWA+P 
Sbjct  1    MVAEGFTVDLNKPLVFQVGHLGETYEEWVHQPIVTKKGPRFFHSDFWEFLTLTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPV  W  S S++ GL  P++   +   +  WTL+EYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVSVWCISMSISRGLSLPEIVPLIALGIFIWTLIEYTLHRFLFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPPAATA++  P W LVKL        A+ GG +LGY++YD T
Sbjct  121  LLHGCHHKHPMDHLRLVFPPAATAVLCFPFWNLVKLFTTLSVTPALFGGGMLGYVMYDIT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
            HYYLHH  P   V+++LK++H+ HHFR QDKGFGIT++ WDIVF
Sbjct  181  HYYLHHAHPTRAVTKNLKKYHLSHHFRIQDKGFGITSSLWDIVF  224



>ref|NP_181023.1| fatty acid hydroxylase 1 [Arabidopsis thaliana]
 sp|O48916.1|FAH1_ARATH RecName: Full=Fatty acid 2-hydroxylase 1; Short=AtFAH1 [Arabidopsis 
thaliana]
 gb|AAB94072.1| fatty acid hydroxylase Fah1p [Arabidopsis thaliana]
 gb|AAC16270.1| fatty acid hydroxylase (FAH1) [Arabidopsis thaliana]
 gb|AAK91343.1| At2g34770/T29F13.2 [Arabidopsis thaliana]
 gb|AAN18051.1| At2g34770/T29F13.2 [Arabidopsis thaliana]
 gb|AEC09019.1| fatty acid hydroxylase 1 [Arabidopsis thaliana]
Length=237

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 171/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL KPLVFQVGHLG+ Y+EWVH+PI +KE PRFF + F EFLT T WWA+P 
Sbjct  1    MVAQGFTVDLKKPLVFQVGHLGEDYEEWVHQPIATKEGPRFFQSDFWEFLTLTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S SV+MG   P++   ++  +  WT  EY LHRF+FH+KT+ YW NT HY
Sbjct  61   IWLPVVVWCISRSVSMGCSLPEIVPIVVMGIFIWTFFEYVLHRFVFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATAI+  P W + K ++      A+ GG +LGY++YD T
Sbjct  121  LIHGCHHKHPMDHLRLVFPPTATAILCFPFWNIAKAISTPSTAPALFGGGMLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P   V+++LK++H++HHFR QDKGFGIT++ WDIVFG
Sbjct  181  HYYLHHAQPTRPVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFG  225



>ref|XP_010439556.1| PREDICTED: fatty acid 2-hydroxylase 2-like [Camelina sativa]
 ref|XP_010439558.1| PREDICTED: fatty acid 2-hydroxylase 2-like [Camelina sativa]
 ref|XP_010439559.1| PREDICTED: fatty acid 2-hydroxylase 2-like [Camelina sativa]
Length=239

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            +A Q FTVDL+KPLVFQVGHLG+ Y EW+H+PIV  E PRFF + F EFLTRT WWAIPT
Sbjct  2    VAEQRFTVDLNKPLVFQVGHLGEEYQEWIHQPIVCVEGPRFFQSDFWEFLTRTVWWAIPT  61

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S S   GL  PQ+ + +   +  WTLLEYTLHRFLFH++T+ YWANT HY
Sbjct  62   IWLPVVCYVLSISARKGLTYPQIGLIVALGVLTWTLLEYTLHRFLFHIQTKSYWANTAHY  121

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHP DG+RLVFPP ATAI+L+PLW L+ L+A      A+LGG L GY++YD T
Sbjct  122  LLHGCHHKHPQDGLRLVFPPTATAILLVPLWKLLHLVATPATAPAMLGGILFGYVMYDIT  181

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P     + LK++H++HHFR QDKG+GIT++ WD VFG
Sbjct  182  HYYLHHGQPKEPTFKHLKKYHLNHHFRIQDKGYGITSSLWDKVFG  226



>ref|NP_001067329.1| Os12g0628400 [Oryza sativa Japonica Group]
 dbj|BAF30348.1| Os12g0628400 [Oryza sativa Japonica Group]
 gb|EEC69720.1| hypothetical protein OsI_39209 [Oryza sativa Indica Group]
Length=238

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 172/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+ FTVDL++PLVFQVGHLG+ Y EWVH+PIVSKE PR FAN  LEFLTRT WWAIP 
Sbjct  1    MVAEAFTVDLNEPLVFQVGHLGEQYQEWVHQPIVSKEGPRLFANDVLEFLTRTEWWAIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  + SV MG    ++A+ ++  +  WTL+EY +HRFLFH+ T+ YW NT HY
Sbjct  61   IWLPVVCWCLTKSVEMGHTLSEVALMVVFGICLWTLIEYIMHRFLFHINTKSYWTNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HG HHKHP DG+RLVFPPAA AI+  P W L++L+      + + GG LLGY++YDCT
Sbjct  121  LLHGIHHKHPTDGLRLVFPPAAAAILCFPFWNLIRLITTPTTTHGVFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P +   + LK++H++HHFR Q+KGFGIT+T WD VFG
Sbjct  181  HYYLHHGQPSSDPGKHLKKYHLNHHFRIQNKGFGITSTLWDHVFG  225



>ref|XP_002879514.1| hypothetical protein ARALYDRAFT_345212 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55773.1| hypothetical protein ARALYDRAFT_345212 [Arabidopsis lyrata subsp. 
lyrata]
Length=237

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 170/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL KPLVFQVGHLG+ Y+EWVH+PI +KE PRFF + F EFLT T WWA+P 
Sbjct  1    MVAQGFTVDLKKPLVFQVGHLGEDYEEWVHQPIATKEGPRFFQSDFWEFLTLTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S S++MG   P++   +   +  WT  EY LHRF+FH+KT+ YW NT HY
Sbjct  61   IWLPVVVWCISVSISMGCSLPEIVPIVFMGIFIWTFFEYVLHRFVFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATAI+  P W + K ++      A+ GG +LGY++YD T
Sbjct  121  LIHGCHHKHPMDHLRLVFPPTATAILCFPFWNIAKAISTPSTAPALFGGGMLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P   V+++LK++H++HHFR QDKGFGIT++ WDIVFG
Sbjct  181  HYYLHHAQPTRPVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFG  225



>ref|XP_010434263.1| PREDICTED: fatty acid 2-hydroxylase 2 [Camelina sativa]
Length=238

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+ FTVDL+KPLVFQVGHLG+ Y EW+H+PIV  E PRFF + F EFLTRT WWAIPT
Sbjct  1    MVAERFTVDLNKPLVFQVGHLGEEYQEWIHQPIVCVEGPRFFQSDFWEFLTRTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S S   GL  PQ+ + +   +  WTLLEYTLHRFLFH++T+ YWANT HY
Sbjct  61   IWLPVVCYVLSISARKGLTFPQIGLIVALGVLTWTLLEYTLHRFLFHIQTKSYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHP DG+RLVFPP ATAI+L+PLW L+ L+A      A+LGG L GY++YD T
Sbjct  121  LLHGCHHKHPQDGLRLVFPPTATAILLVPLWKLLHLVATPATAPAMLGGILFGYVMYDIT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P     + LK++H++HHFR QDKG+GIT++ WD VFG
Sbjct  181  HYYLHHGQPKEPTFKHLKKYHLNHHFRIQDKGYGITSSLWDKVFG  225



>ref|XP_009134054.1| PREDICTED: fatty acid 2-hydroxylase 2 [Brassica rapa]
 ref|XP_009134061.1| PREDICTED: fatty acid 2-hydroxylase 2 [Brassica rapa]
 emb|CDX79011.1| BnaA01g10780D [Brassica napus]
Length=237

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 173/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+ FTVDL KPLVFQVGHLG+ Y EW+H+PIV  E PRFF + F EFLTRT WWAIPT
Sbjct  1    MVAERFTVDLDKPLVFQVGHLGEEYQEWIHQPIVCVEGPRFFQSDFWEFLTRTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S S   GL  PQ+ + +   +  WTLLEYTLHRFLFH++T+ YWANT HY
Sbjct  61   IWLPVVCYVLSISARKGLTFPQIGLIVAFGVLTWTLLEYTLHRFLFHIETKSYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHP DG+RLVFPP ATAI+L+PLW L+ L+A      A+LGG L GY++YD T
Sbjct  121  LLHGCHHKHPQDGLRLVFPPTATAILLVPLWKLLHLIATPATAPAMLGGILFGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P     + LK++H++HHFR QDKG+GIT++ WD VFG
Sbjct  181  HYYLHHGQPKEPTFKHLKKYHLNHHFRIQDKGYGITSSLWDRVFG  225



>ref|XP_010519049.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Tarenaya hassleriana]
 ref|XP_010519050.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Tarenaya hassleriana]
Length=242

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M   GFTVDL+KPLVFQVGHLGD Y+EWVH+PIV+KE PRFF N F EFLTRT WWA+P 
Sbjct  1    MGGHGFTVDLNKPLVFQVGHLGDVYEEWVHQPIVTKEGPRFFHNDFCEFLTRTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV+W   TS+ MG    ++A      +  WT +EYTLHRFLFHVKT+ YW NT HY
Sbjct  61   IWLPVVFWSMFTSMKMGHTVAEIAAMAAFGIFIWTFMEYTLHRFLFHVKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPPAATAI+ +P W  VKL A       + GG LLGY++YD T
Sbjct  121  LIHGCHHKHPMDRLRLVFPPAATAILCIPFWNTVKLFATPSTTPGLFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P T V+++LK++H++HHFR QDKGFGIT++FWDIVFG
Sbjct  181  HYYLHHAQPNTHVTKNLKKYHLNHHFRIQDKGFGITSSFWDIVFG  225



>ref|XP_006413844.1| hypothetical protein EUTSA_v10026120mg [Eutrema salsugineum]
 ref|XP_006413845.1| hypothetical protein EUTSA_v10026120mg [Eutrema salsugineum]
 ref|XP_006413846.1| hypothetical protein EUTSA_v10026120mg [Eutrema salsugineum]
 gb|ESQ55297.1| hypothetical protein EUTSA_v10026120mg [Eutrema salsugineum]
 gb|ESQ55298.1| hypothetical protein EUTSA_v10026120mg [Eutrema salsugineum]
 gb|ESQ55299.1| hypothetical protein EUTSA_v10026120mg [Eutrema salsugineum]
Length=238

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 173/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+ FTVDL KPLVFQVGHLG+ Y EW+H+PIV  E PRFF + F EFLTRT WWAIPT
Sbjct  1    MVAERFTVDLDKPLVFQVGHLGEEYQEWIHQPIVCVEGPRFFQSDFWEFLTRTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S S   GL  PQ+ + +   +  WTLLEYTLHRFLFH+KT+ YWANT HY
Sbjct  61   IWLPVVCYMFSLSARKGLTFPQIGLIVAFGVLTWTLLEYTLHRFLFHIKTKTYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHP DG+RLVFPP ATAI+L+PLW L+ LLA      A+LGG L GY++YD T
Sbjct  121  LLHGCHHKHPQDGLRLVFPPTATAILLVPLWKLLHLLATPATAPALLGGILFGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P     + LK++H++HHFR Q+KG+GIT++ WD VFG
Sbjct  181  HYYLHHGQPKEPTFKHLKKYHLNHHFRIQNKGYGITSSLWDKVFG  225



>emb|CDY15865.1| BnaA04g12460D [Brassica napus]
Length=240

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 169/225 (75%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGFTVDL KPL FQVGHLG+AYDEWVH+PIV+KE PRFF N F EFLT T WWA+P 
Sbjct  1    MVAQGFTVDLDKPLAFQVGHLGEAYDEWVHQPIVTKEGPRFFHNDFWEFLTLTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S S +MG   P++   +   +  WT +EY LHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVVWCISMSGSMGCSFPEVVSLVALGIFIWTFIEYCLHRFLFHMKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HG HHKHPMD +RLVFPPA TAIM  PLW L KL+A      A+ GG L GY++YD T
Sbjct  121  LIHGYHHKHPMDHLRLVFPPALTAIMCFPLWNLAKLIATPSAAPALFGGGLFGYVMYDLT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH  P   V+++LK+ H++HHFR QDKG+G+T++ WDIVFG
Sbjct  181  HYYLHHANPTIPVTKNLKKSHLNHHFRIQDKGYGVTSSLWDIVFG  225



>dbj|BAJ95608.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=237

 Score =   292 bits (747),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 170/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDL KPLVFQVGHL + Y +WVH+PIVSKE PRFFAN  LEFLTRT WWA+P 
Sbjct  1    MVAQAFTVDLDKPLVFQVGHLEEQYQDWVHQPIVSKEGPRFFANDVLEFLTRTKWWAVPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  +TS+ MG   P++A+ ++A +  WTL+EY LHR+LFH+ T+ YW NT HY
Sbjct  61   IWLPVVCWCLNTSIQMGHTVPEVALMVVAGIFIWTLVEYVLHRYLFHIDTKSYWTNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP A AI+  P W  VKL   +     + GG LLGY+IYDCT
Sbjct  121  LLHGCHHKHPMDELRLVFPPTAAAILCYPFWNFVKLFTTTTTTPGVFGGGLLGYVIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH  P    ++ LK++H++HHFR Q+KGFGIT+T WD VFG
Sbjct  181  HYYLHHAHPSFDPAKYLKKYHLNHHFRIQNKGFGITSTLWDHVFG  225



>ref|XP_010449146.1| PREDICTED: fatty acid 2-hydroxylase 2-like [Camelina sativa]
 ref|XP_010449147.1| PREDICTED: fatty acid 2-hydroxylase 2-like [Camelina sativa]
Length=238

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+ FTVDL+KPLVFQVGHLG+ Y EW+H+PIV  E PRFF + F EFLTRT WWAIPT
Sbjct  1    MVAERFTVDLNKPLVFQVGHLGEEYQEWIHQPIVCVEGPRFFQSDFWEFLTRTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S S   GL  PQ+ + +   +  WTLLEYTLHRFLFH++T+ YWANT HY
Sbjct  61   IWLPVVCYVLSISARKGLTYPQIGLIVALGVLTWTLLEYTLHRFLFHIQTKSYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHP DG+RLVFPP ATAI+L+PLW L+ L+A      A+LGG L GY++YD T
Sbjct  121  LLHGCHHKHPQDGLRLVFPPTATAILLVPLWKLLHLVATPATAPAMLGGILFGYVMYDIT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            H+YLHHG+P     + LK++H++HHFR QDKG+GIT++ WD VFG
Sbjct  181  HFYLHHGQPKVPTFKHLKKYHLNHHFRIQDKGYGITSSLWDKVFG  225



>emb|CDX82786.1| BnaC01g12360D [Brassica napus]
Length=237

 Score =   291 bits (746),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 172/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+ FTVDL KPLVFQVGHLG+ Y EW+H+PIV  E PRFF + F EFLTRT WWAIPT
Sbjct  1    MVAERFTVDLDKPLVFQVGHLGEEYQEWIHQPIVCVEGPRFFQSDFWEFLTRTVWWAIPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +  S S   GL  PQ+ + +   +  WTLLEYTLHRFLFH+ T+ YWANT HY
Sbjct  61   IWLPVVCYVLSISARKGLTFPQIGLIVAFGVLTWTLLEYTLHRFLFHIDTKSYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHP DG+RLVFPP ATAI+L+PLW L+ L+A      A+LGG L GY++YD T
Sbjct  121  LLHGCHHKHPQDGLRLVFPPTATAILLVPLWKLLHLIATPATAPAMLGGILFGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P     + LK++H++HHFR QDKG+GIT++ WD VFG
Sbjct  181  HYYLHHGQPKEPTFKHLKKYHLNHHFRIQDKGYGITSSLWDRVFG  225



>gb|EMT00937.1| Fatty acid 2-hydroxylase [Aegilops tauschii]
Length=237

 Score =   291 bits (745),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 168/225 (75%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  + FTVDL+KPLVFQVGHL + Y EWVH+PIVSKE PRFFAN  +EFLTRT WWA+P 
Sbjct  1    MVVKEFTVDLNKPLVFQVGHLEEHYQEWVHQPIVSKEGPRFFANDTMEFLTRTKWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  + SV MG    ++ +  L  +  WTL+EY+LHRFLFH++TR YW+NT HY
Sbjct  61   IWLPVVCWLFAMSVRMGHTIQEVILMALFGVFVWTLIEYSLHRFLFHIETRSYWSNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPPA  AI+ +P W +V   A      A+  G LLGY++YDCT
Sbjct  121  LIHGCHHKHPMDSLRLVFPPAGAAIICVPFWNVVAFFASPSTTPALFAGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    +  LKR+H+ HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSKDPANHLKRYHLSHHFRIQDKGFGITSSLWDAVFG  225



>gb|KDO75197.1| hypothetical protein CISIN_1g041340mg [Citrus sinensis]
Length=236

 Score =   291 bits (745),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 178/225 (79%), Gaps = 2/225 (1%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            + AQ FTVDL+KPLVFQVGHLG+AY EWVH+PIVSKE PRFF + F EFLT T WWAIP 
Sbjct  2    VVAQEFTVDLNKPLVFQVGHLGEAYQEWVHQPIVSKEGPRFFESDFWEFLTLTVWWAIPV  61

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S S+ MG   P +A+ +L  +  WTLLEYTLHRFLFH+KT+    NT HY
Sbjct  62   IWLPVVCWCISMSIRMGQTLPHVALMVLFGIFVWTLLEYTLHRFLFHIKTKE--GNTIHY  119

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++L+P W ++ L++      A+ GG LLGY++YD T
Sbjct  120  LLHGCHHKHPMDGLRLVFPPAATAVLLLPFWKVLSLVSTPTTTPALFGGGLLGYVMYDVT  179

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V ++LK++H++HHFR Q+KGFGIT++ WD VFG
Sbjct  180  HYYLHHGQPSSEVPKNLKKYHLNHHFRIQNKGFGITSSLWDRVFG  224



>ref|NP_001149139.1| inositolphosphorylceramide-B C-26 hydroxylase [Zea mays]
 gb|ACG34343.1| inositolphosphorylceramide-B C-26 hydroxylase [Zea mays]
 gb|ACG48734.1| inositolphosphorylceramide-B C-26 hydroxylase [Zea mays]
Length=236

 Score =   290 bits (741),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 168/225 (75%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q FTVDL+KPLVFQVGHL + Y EWVH+PIVSKE PRFF N  LEFLTRT WWA+PT
Sbjct  1    MVVQEFTVDLNKPLVFQVGHLEERYQEWVHQPIVSKEGPRFFGNDVLEFLTRTKWWAVPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV      S+ MG     +A+  L  +  WTL+EYTLHRFLFH++T+ YW NT HY
Sbjct  61   IWLPVVCCLLVKSILMGHTVQDVAMMALFGIFIWTLIEYTLHRFLFHIETKTYWWNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATAI+  P W LV   A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDSLRLVFPPTATAILCFPFWNLVAFFATPSTTPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    ++ LKR+H++HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSKDPAKHLKRYHLNHHFRIQDKGFGITSSLWDAVFG  225



>ref|XP_008676783.1| PREDICTED: inositolphosphorylceramide-B C-26 hydroxylase isoform 
X1 [Zea mays]
 gb|ACR38434.1| unknown [Zea mays]
 gb|ACR38438.1| unknown [Zea mays]
 tpg|DAA51740.1| TPA: inositolphosphorylceramide-B C-26 hydroxylase [Zea mays]
Length=237

 Score =   290 bits (741),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 168/225 (75%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q FTVDL+KPLVFQVGHL + Y EWVH+PIVSKE PRFF N  LEFLTRT WWA+PT
Sbjct  1    MVVQEFTVDLNKPLVFQVGHLEERYQEWVHQPIVSKEGPRFFGNDVLEFLTRTKWWAVPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV      S+ MG     +A+  L  +  WTL+EYTLHRFLFH++T+ YW NT HY
Sbjct  61   IWLPVVCCLLVKSILMGHTVQDVAMMALFGIFIWTLIEYTLHRFLFHIETKTYWWNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATAI+  P W LV   A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDSLRLVFPPTATAILCFPFWNLVAFFATPSTTPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    ++ LKR+H++HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSKDPAKHLKRYHLNHHFRIQDKGFGITSSLWDAVFG  225



>ref|XP_004504720.1| PREDICTED: fatty acid 2-hydroxylase 2-like [Cicer arietinum]
Length=239

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 173/225 (77%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            + A  + VDL+KPLVFQVGHLG+AY+EWVH+PI+SK+ PRFF + FLE LTRT WW IP 
Sbjct  2    VVANKYVVDLNKPLVFQVGHLGEAYEEWVHQPIISKDGPRFFHSSFLEVLTRTAWWVIPI  61

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +W+PV  WF   S  +GLP  QL + ++  +  WTL EY LHRFLFH++T+ YWANT HY
Sbjct  62   VWVPVASWFIYNSFRLGLPIHQLPLFVILGIFVWTLAEYLLHRFLFHIQTKTYWANTLHY  121

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP A  ++ +P+W +VKL+ P     A+ GG LLGY++YDCT
Sbjct  122  LLHGCHHKHPMDSLRLVFPPTAATLIALPIWSVVKLVCPPSIAPAVFGGILLGYVMYDCT  181

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V ++LK++H++HH+R Q+ GFGIT+  WD VFG
Sbjct  182  HYYLHHGQPKSDVPKNLKKYHLNHHYRVQNLGFGITSPLWDKVFG  226



>ref|XP_003558416.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Brachypodium distachyon]
 ref|XP_010228964.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Brachypodium distachyon]
Length=237

 Score =   289 bits (739),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 168/225 (75%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q FTVDL+KPLVFQVGHL + Y EWVH+PIVSKE PRFF N  +E LT T WWA+P 
Sbjct  1    MVVQEFTVDLNKPLVFQVGHLEEHYQEWVHQPIVSKEGPRFFRNDVMELLTLTKWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W    S+ MG    ++ +  L  +  WTL+EY+LHRFLFH++T+ YW+NT HY
Sbjct  61   IWLPVVCWLFVKSIQMGHTIQEVILMALFGVFVWTLIEYSLHRFLFHIETKSYWSNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPPA TAI+ +P W +V   A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDSLRLVFPPAGTAILCVPFWNVVAFFATPSSTPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    ++ LKR+H++HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSKDPAKHLKRYHLNHHFRIQDKGFGITSSLWDAVFG  225



>gb|EMS61991.1| Fatty acid 2-hydroxylase [Triticum urartu]
Length=262

 Score =   290 bits (741),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 167/226 (74%), Gaps = 0/226 (0%)
 Frame = +1

Query  58   KMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIP  237
            KM  + FTVDL++PLVFQVGHL + Y EWVH+PIVSKE PRFF N  +EFLTRT WWA+P
Sbjct  25   KMVVKEFTVDLNQPLVFQVGHLEEHYQEWVHQPIVSKEGPRFFTNDTMEFLTRTKWWAVP  84

Query  238  TIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFH  417
             IWLPVV W  + S+ MG    ++ +  L  +  WT +EY LHRFLFH++T+ YW+NT H
Sbjct  85   VIWLPVVCWLFAKSIRMGHTIQEVILMALFGVFVWTFIEYALHRFLFHIETKSYWSNTAH  144

Query  418  YMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDC  597
            Y++HGCHHKHPMD +RLVFPPA  AI+ +P W +V   A      A+  G LLGY++YDC
Sbjct  145  YLIHGCHHKHPMDSLRLVFPPAGAAIICVPFWNVVAFFASPSTTPALFAGGLLGYVMYDC  204

Query  598  THYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            THYYLHHG+P    ++ LKR+H+ HHFR QDKGFGIT++ WD VFG
Sbjct  205  THYYLHHGQPSKDPAKHLKRYHLSHHFRIQDKGFGITSSLWDAVFG  250



>dbj|BAK07445.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=237

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 167/225 (74%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q F +DL KPLVFQVGHL + Y EWVH+PIVSKE PRFFAN  +EFLTRT WWA+P 
Sbjct  1    MVVQEFAIDLDKPLVFQVGHLEEHYQEWVHQPIVSKEGPRFFANDTMEFLTRTKWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  + S+ MG    +L +  L  +  WTL+EY+LHRFLFH++T+ YW+NT HY
Sbjct  61   IWLPVVCWLFAKSILMGHTIQELILMALFGVFVWTLIEYSLHRFLFHIETKSYWSNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPPA  AI+ +P W +V   A      A+  G LLGY++YDCT
Sbjct  121  LIHGCHHKHPMDSLRLVFPPAGAAILCVPFWNVVAFFASPSTTPALFAGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    ++ LKR+H+ HHFR QDKGFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSIDPAKHLKRYHLSHHFRIQDKGFGITSSLWDAVFG  225



>ref|XP_009143742.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Brassica rapa]
Length=237

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 170/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGF+VDL+KPLVF VGHLG+ Y+EWVH+PIV+K+ PRFF + F EFLT T WWA+P 
Sbjct  1    MVAQGFSVDLNKPLVFLVGHLGETYEEWVHQPIVTKKGPRFFHSDFWEFLTLTVWWAVPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLP   W  S SV+ GL  P++A  +   +  WTL+EYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPGSVWCISMSVSRGLSLPEIAPLIALGIFIWTLIEYTLHRFLFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPPAATA++  P W LVKL        A+ GG + GY++YD T
Sbjct  121  LIHGCHHKHPMDHLRLVFPPAATAVLCFPFWNLVKLFTTPSVTPALFGGGMFGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH  P   V+++LK++H+ HHFR  DKGFG+T++ WDIVFG
Sbjct  181  HYYLHHAHPTRAVTKNLKKYHLSHHFRIHDKGFGVTSSLWDIVFG  225



>ref|XP_002466355.1| hypothetical protein SORBIDRAFT_01g006300 [Sorghum bicolor]
 gb|EER93353.1| hypothetical protein SORBIDRAFT_01g006300 [Sorghum bicolor]
Length=237

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 166/225 (74%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q FTVDL+KPLVFQVGHL + Y EWVH+PIVSKE PRFF N  LEFLT T WWA+PT
Sbjct  1    MVVQEFTVDLNKPLVFQVGHLEERYQEWVHQPIVSKEGPRFFGNDVLEFLTCTKWWAVPT  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV +    S+ MG     + +  L  +  WTL+EYTLHRFLFH++T+ YW NT HY
Sbjct  61   IWLPVVCFMFVKSILMGNTIQDVVLMALFGIFIWTLIEYTLHRFLFHIETKTYWWNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPP ATAI+  P W LV   A      A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDSLRLVFPPTATAILCFPFWNLVAFFATPSTTPALFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P T  ++ LKR+H+ HHFR QD GFGIT++ WD VFG
Sbjct  181  HYYLHHGQPSTDPAKHLKRYHLSHHFRIQDMGFGITSSLWDAVFG  225



>ref|XP_004293708.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Fragaria vesca subsp. 
vesca]
Length=239

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 167/225 (74%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  + FTVDL KPLVFQVGHLG  Y EWVH+P+VSKE PRFFAN +LEFLTRT WW IP 
Sbjct  1    MVVKPFTVDLDKPLVFQVGHLGKGYYEWVHQPVVSKEGPRFFANDYLEFLTRTTWWVIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLPV  W  S S+ MGL  PQ A++++  +  WTLLEY +HRF  H+KT  YW NT HY
Sbjct  61   VWLPVASWLVSVSLRMGLTLPQAALAVVGGIFIWTLLEYVIHRFPLHMKTISYWGNTIHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            + HGCHHKHPMD M LVFPPA TAI+ +P W + +LL+P     A+ GG + GY+ YD T
Sbjct  121  LFHGCHHKHPMDRMHLVFPPAVTAILCVPFWNMFRLLSPPSVAPALFGGTVFGYVAYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HY+LHHGKP   ++Q +K++H++HHFR + KGFGIT++ WD VFG
Sbjct  181  HYFLHHGKPSNRLTQDMKKYHLNHHFRIRSKGFGITSSLWDNVFG  225



>ref|XP_002442581.1| hypothetical protein SORBIDRAFT_08g022360 [Sorghum bicolor]
 gb|EES16419.1| hypothetical protein SORBIDRAFT_08g022360 [Sorghum bicolor]
Length=237

 Score =   284 bits (726),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 170/225 (76%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A  FTVDL KPLVFQVGHL + Y EWVH+PIVSKE PRFF N  LEFLTRT WWA+P 
Sbjct  1    MVAAAFTVDLDKPLVFQVGHLEEQYQEWVHQPIVSKEGPRFFENDILEFLTRTKWWAVPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  STS+ MG     +A+  +  +  WTL+EY +HRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVCWCLSTSIQMGNTITDVAMMTVFGIFLWTLIEYVVHRFLFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAA AI+  P W ++KL +       + GG LLGY+IYDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAAAAILCFPFWNMIKLFSTPSTTPGLFGGGLLGYVIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P +  ++ LK++H++HHFR Q KGFGIT+T WD VFG
Sbjct  181  HYYLHHGRPSSDPAKYLKKYHLNHHFRIQTKGFGITSTLWDHVFG  225



>ref|XP_008662191.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Zea mays]
Length=279

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 170/229 (74%), Gaps = 0/229 (0%)
 Frame = +1

Query  49   TGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWW  228
               KM A  FTVDL KPLVFQVGHL + Y EWVH+PIV KE PRFF N  LEFLTRT WW
Sbjct  39   CSEKMVASAFTVDLDKPLVFQVGHLEEQYQEWVHQPIVCKEGPRFFENDILEFLTRTKWW  98

Query  229  AIPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWAN  408
            A+P IWLP+V W  STS+ MG     +A+ +   +  WTL+EY LHRFLFH+KT+ YW N
Sbjct  99   AVPLIWLPIVCWCLSTSIKMGNTITDVAMMIGFGIFLWTLIEYVLHRFLFHIKTKSYWGN  158

Query  409  TFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYII  588
            T HY++HGCHHKHPMDG+RLVFPPAA AI+  P W ++KL +       + GG LLGY+I
Sbjct  159  TAHYLLHGCHHKHPMDGLRLVFPPAAAAILCFPFWNMIKLFSTPSTTPGLFGGGLLGYVI  218

Query  589  YDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            YDCTHYYLHHG+P +  ++ LK++H++HHFR Q KGFGIT+T WD VFG
Sbjct  219  YDCTHYYLHHGQPSSDPAKYLKKYHLNHHFRIQTKGFGITSTLWDHVFG  267



>ref|NP_001130161.1| uncharacterized protein LOC100191255 [Zea mays]
 gb|ACF78300.1| unknown [Zea mays]
 gb|ACN31101.1| unknown [Zea mays]
Length=237

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 169/225 (75%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A  FTVDL KPLVFQVGHL + Y EWVH+PIV KE PRFF N  LEFLTRT WWA+P 
Sbjct  1    MVASAFTVDLDKPLVFQVGHLEEQYQEWVHQPIVCKEGPRFFENDILEFLTRTKWWAVPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLP+V W  STS+ MG     +A+ +   +  WTL+EY LHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPIVCWCLSTSIKMGNTITDVAMMIGFGIFLWTLIEYVLHRFLFHIKTKSYWGNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAA AI+  P W ++KL +       + GG LLGY+IYDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAAAAILCFPFWNMIKLFSTPSTTPGLFGGGLLGYVIYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P +  ++ LK++H++HHFR Q KGFGIT+T WD VFG
Sbjct  181  HYYLHHGQPSSDPAKYLKKYHLNHHFRIQTKGFGITSTLWDHVFG  225



>ref|XP_008808518.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Phoenix dactylifera]
 ref|XP_008808519.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Phoenix dactylifera]
Length=237

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 176/225 (78%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ F VDLSKPLVFQVGHLG+ Y+EWVH+PIVSKE PRFF N FLE  TRT WW IP 
Sbjct  1    MVAQKFNVDLSKPLVFQVGHLGEDYEEWVHQPIVSKEGPRFFENDFLEMFTRTKWWVIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +W+PVV W  + S+ MG   PQ A+ ++  +  WTL+EY LHRFLFH++T  YWANT HY
Sbjct  61   VWIPVVCWLVTMSIRMGHAVPQAALMVVGGILLWTLIEYALHRFLFHIRTSSYWANTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+ +P+W L++LL       AI GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILCVPIWCLIRLLTTPTTAPAIFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    ++ +K++H++HH+R Q+KGFGIT+  WDIVFG
Sbjct  181  HYYLHHGQPSKDTARDMKKYHLNHHYRIQNKGFGITSPLWDIVFG  225



>ref|XP_006597671.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X3 [Glycine 
max]
Length=214

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  Q F VDL+K LVFQVGHLG+AY+EWVH+PIVSKE PRFF N  LEFLTRT WWAIP 
Sbjct  2    MVVQNFVVDLNKALVFQVGHLGEAYEEWVHQPIVSKEGPRFFENEILEFLTRTVWWAIPV  61

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV WF   S+ MGL  P LA+ ++  +  WTLLEY+LHRFLFH+KT+ YW NT HY
Sbjct  62   IWLPVVCWFIYKSIRMGLSCPHLALLVVLGIFVWTLLEYSLHRFLFHIKTKTYWGNTLHY  121

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+LMP W LVKL+A +    A+ GG LLGY++YDCT
Sbjct  122  LLHGCHHKHPMDGLRLVFPPAATAILLMPFWNLVKLMATTSTAPALFGGGLLGYVMYDCT  181

Query  601  HYYLHHGKPLTGVSQSLK  654
            HYYLHHG+P T V ++LK
Sbjct  182  HYYLHHGQPRTEVPRNLK  199



>gb|KDO75200.1| hypothetical protein CISIN_1g023817mg [Citrus sinensis]
Length=276

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 175/265 (66%), Gaps = 40/265 (15%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            +A + F+VDL+KPLVFQVGHLG+AY+EWVH+PIV K+SPRFFANGF+EFLTRT WW IP 
Sbjct  2    VADEPFSVDLNKPLVFQVGHLGEAYEEWVHQPIVGKDSPRFFANGFMEFLTRTKWWVIPL  61

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLPVV W  S SV MGL      + +   +  WTLLEY LHR+LFH+KT+ YW NTFHY
Sbjct  62   VWLPVVCWSVSKSVKMGLAPYLAGLIVFLGIITWTLLEYFLHRYLFHIKTKSYWGNTFHY  121

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPA  A++ + LW L+ +L       A+ GG LLGY++YD T
Sbjct  122  LIHGCHHKHPMDGLRLVFPPAGAALVSLALWNLIDVLTKPFITPALYGGILLGYVMYDVT  181

Query  601  HYYLHHGKPLTGVSQSLK----------------------------------------RF  660
            HYY HHGKP  G+   LK                                        RF
Sbjct  182  HYYTHHGKPSKGIILRLKVTTYQNELLNLSVSFSFVFPAWKERVHIAFYKSFYVCFEQRF  241

Query  661  HMDHHFRNQDKGFGITNTFWDIVFG  735
            HM+HHFR +DKGFGI+++ WDIVFG
Sbjct  242  HMNHHFRIRDKGFGISSSLWDIVFG  266



>ref|XP_002976346.1| hypothetical protein SELMODRAFT_104830, partial [Selaginella 
moellendorffii]
 gb|EFJ22606.1| hypothetical protein SELMODRAFT_104830, partial [Selaginella 
moellendorffii]
Length=223

 Score =   278 bits (710),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 163/220 (74%), Gaps = 0/220 (0%)
 Frame = +1

Query  76   FTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPV  255
            FTVDLSKPLV QVGHLGDAY++WVH+PIV KESPRFF N  LE LTRT WW IP +WLP 
Sbjct  1    FTVDLSKPLVSQVGHLGDAYEKWVHQPIVCKESPRFFENQILESLTRTVWWVIPLVWLPF  60

Query  256  VWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHYMMHGC  435
            + W    S   GL +  +   L++ +  W+LLEY++HRFLFHVKT GYW+NTFHY++HGC
Sbjct  61   ICWLLLVSSQRGLKSQSIVSCLISGVIIWSLLEYSMHRFLFHVKTSGYWSNTFHYLLHGC  120

Query  436  HHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLH  615
            HHKHPMDG RLVFPPAAT   L   W ++  LAP      ILGG +LGY+IYD THY+LH
Sbjct  121  HHKHPMDGYRLVFPPAATLGFLSIFWPIIASLAPREMAPTILGGGILGYVIYDVTHYFLH  180

Query  616  HGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HG      S+ LKR+H++HHF+NQ  GFGIT+ FWD +FG
Sbjct  181  HGVAFDQWSRRLKRYHLNHHFKNQTVGFGITSNFWDRIFG  220



>ref|XP_002987190.1| hypothetical protein SELMODRAFT_125528, partial [Selaginella 
moellendorffii]
 gb|EFJ11766.1| hypothetical protein SELMODRAFT_125528, partial [Selaginella 
moellendorffii]
Length=223

 Score =   278 bits (710),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 163/220 (74%), Gaps = 0/220 (0%)
 Frame = +1

Query  76   FTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPV  255
            FTVDLSKPLV QVGHLGDAY++WVH+PIV KESPRFF N  LE LTRT WW IP +WLP 
Sbjct  1    FTVDLSKPLVAQVGHLGDAYEKWVHQPIVCKESPRFFENQILESLTRTVWWVIPLVWLPF  60

Query  256  VWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHYMMHGC  435
            + W    S   GL +  +   L++ +  W+LLEY++HRFLFHVKT GYW+NTFHY++HGC
Sbjct  61   ICWLLLVSSQRGLKSQSIVSCLISGVIIWSLLEYSMHRFLFHVKTSGYWSNTFHYLLHGC  120

Query  436  HHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLH  615
            HHKHPMDG RLVFPPAAT   L   W ++  LAP      ILGG +LGY+IYD THY+LH
Sbjct  121  HHKHPMDGYRLVFPPAATLGFLSIFWPIIASLAPREMAPTILGGGILGYVIYDVTHYFLH  180

Query  616  HGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HG      S+ LKR+H++HHF+NQ  GFGIT+ FWD +FG
Sbjct  181  HGVAFDQWSRRLKRYHLNHHFKNQTVGFGITSNFWDRIFG  220



>gb|EYU43217.1| hypothetical protein MIMGU_mgv1a012910mg [Erythranthe guttata]
Length=231

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 161/199 (81%), Gaps = 0/199 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  + F+VDL+KPLVFQVGHLG+ Y+EWVH+PIV+KE+PRFF+NG +EFLTRT WWAIP 
Sbjct  1    MVHREFSVDLNKPLVFQVGHLGEDYEEWVHQPIVTKETPRFFSNGLIEFLTRTRWWAIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S S+  G+P     +++LA +  WT +EY LHRF+FH++T  YW NT HY
Sbjct  61   IWLPVVCWLVSLSLENGVPVNHAPLTVLAGVCLWTFMEYCLHRFVFHIRTTSYWGNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+L+P W L+K++ P+ Y +A LGG LLGY++YDCT
Sbjct  121  LVHGCHHKHPMDGLRLVFPPAATAILLVPFWNLIKIVVPAPYSHAFLGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKR  657
            HYYLHHGKPL GVS  LK 
Sbjct  181  HYYLHHGKPLKGVSYQLKN  199



>ref|XP_008807188.1| PREDICTED: fatty acid 2-hydroxylase 1 [Phoenix dactylifera]
Length=237

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 177/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+  TVDL+KPLVFQVGHLG  Y+EWVH+PIVSKE PRFF N FLE  TRT WW IP 
Sbjct  1    MVAEKITVDLNKPLVFQVGHLGKDYEEWVHQPIVSKEGPRFFENDFLEMFTRTKWWVIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +W+PVV W  + SV+MG    Q+A+ ++  +  WTL+EYTLHRFLFH+KT  YWANT HY
Sbjct  61   VWIPVVCWLVTKSVHMGHTVSQVALMVVGGVLLWTLIEYTLHRFLFHIKTSSYWANTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+ +P+W L++LL       AI GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDGLRLVFPPAATAILCVPIWSLIRLLTTPSSAPAIFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    +++LK++H++HH+R Q +GFGIT++ WDIVF 
Sbjct  181  HYYLHHGQPSQSPARNLKKYHLNHHYRMQTRGFGITSSLWDIVFA  225



>gb|EYU19104.1| hypothetical protein MIMGU_mgv1a012885mg [Erythranthe guttata]
Length=226

 Score =   276 bits (705),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 167/225 (74%), Gaps = 11/225 (5%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  QGFTVDL+KPLVFQVGHLG+AY EWVH+PIVSKE PRFF + F E+LTR  WW IP 
Sbjct  1    MVVQGFTVDLNKPLVFQVGHLGEAYQEWVHQPIVSKEGPRFFKSDFWEYLTRNEWWVIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  S +V+ G   P++ +  +  + AWTL+EYTLHRFLFH++T+ YW NT HY
Sbjct  61   IWLPVVCWSLSRAVSFGNTIPEVVLLTVFGIFAWTLVEYTLHRFLFHIETKSYWGNTMHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG RLVFPPAATA++L P W L+KL++  +   A+ GG LLGY++YD T
Sbjct  121  LIHGCHHKHPMDGQRLVFPPAATAVLLFPFWNLIKLISTPMTAPAVFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHH +P +   ++LK           DKGFGIT++ WD VFG
Sbjct  181  HYYLHHSQPTSEFPKNLK-----------DKGFGITSSLWDKVFG  214



>ref|XP_010926886.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Elaeis guineensis]
Length=237

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 178/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+ FTVDL+KPLVFQVGHLG+ Y+EWVH+PI+SKE PRFF N FLE  T T WW IP 
Sbjct  1    MVAERFTVDLNKPLVFQVGHLGEDYEEWVHQPIMSKEGPRFFENDFLEMFTCTKWWVIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +W+PVV W    SV+MG    Q A+ ++  +  WTL+EYTLHRFLFH+KT  YW NT HY
Sbjct  61   VWIPVVCWLVIKSVHMGHTVSQAALMVVGGVLLWTLIEYTLHRFLFHIKTSSYWTNTLHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATAI+ +P+W L++LL+      AI GG LLGY++YDCT
Sbjct  121  LIHGCHHKHPMDGLRLVFPPAATAILCVPIWSLIRLLSTPSTAPAIFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P    +++LK++H++HH+R Q++GFGIT++ WDIVFG
Sbjct  181  HYYLHHGQPSKVPARNLKKYHLNHHYRMQNRGFGITSSLWDIVFG  225



>gb|ACN28214.1| unknown [Zea mays]
 tpg|DAA51739.1| TPA: hypothetical protein ZEAMMB73_391712 [Zea mays]
Length=222

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 155/209 (74%), Gaps = 0/209 (0%)
 Frame = +1

Query  109  QVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVWWFASTSVNM  288
            QVGHL + Y EWVH+PIVSKE PRFF N  LEFLTRT WWA+PTIWLPVV      S+ M
Sbjct  2    QVGHLEERYQEWVHQPIVSKEGPRFFGNDVLEFLTRTKWWAVPTIWLPVVCCLLVKSILM  61

Query  289  GLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHYMMHGCHHKHPMDGMRL  468
            G     +A+  L  +  WTL+EYTLHRFLFH++T+ YW NT HY++HGCHHKHPMD +RL
Sbjct  62   GHTVQDVAMMALFGIFIWTLIEYTLHRFLFHIETKTYWWNTAHYLLHGCHHKHPMDSLRL  121

Query  469  VFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTGVSQS  648
            VFPP ATAI+  P W LV   A      A+ GG LLGY++YDCTHYYLHHG+P    ++ 
Sbjct  122  VFPPTATAILCFPFWNLVAFFATPSTTPALFGGGLLGYVMYDCTHYYLHHGQPSKDPAKH  181

Query  649  LKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            LKR+H++HHFR QDKGFGIT++ WD VFG
Sbjct  182  LKRYHLNHHFRIQDKGFGITSSLWDAVFG  210



>ref|XP_004293707.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Fragaria vesca subsp. 
vesca]
Length=223

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 158/225 (70%), Gaps = 16/225 (7%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M  + FTVDL KPLVFQVGHLG  Y+EWVH+PIVSKE PRFFAN +LE LTRT WW IP 
Sbjct  1    MVVKPFTVDLDKPLVFQVGHLGKGYNEWVHQPIVSKEGPRFFANDYLELLTRTAWWVIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            +WLPV  W  S S+ MGL  PQ A++++  +  WTL+E                 NT HY
Sbjct  61   VWLPVASWLVSVSLRMGLTLPQAALAVVGGIFIWTLME----------------GNTIHY  104

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            + HGCHHKHP DGMRLVFPPAA AI+ +P W + +LL+P+    A+ GG L GY+ YD T
Sbjct  105  LFHGCHHKHPTDGMRLVFPPAAAAILCVPFWNMFRLLSPTSVAPALFGGTLFGYVAYDVT  164

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHGKP   ++Q +K++H++HHFR Q KGFGIT++ WD VFG
Sbjct  165  HYYLHHGKPSNRLTQDMKKYHLNHHFRIQSKGFGITSSLWDNVFG  209



>ref|XP_006410630.1| hypothetical protein EUTSA_v10017638mg, partial [Eutrema salsugineum]
 gb|ESQ52083.1| hypothetical protein EUTSA_v10017638mg, partial [Eutrema salsugineum]
Length=320

 Score =   264 bits (674),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 163/242 (67%), Gaps = 30/242 (12%)
 Frame = +1

Query  100  LVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVWWFASTS  279
            +V  VGHLG+AY+EWVH+PIV+KE PRFF + F EFLT T WWAIP IWLPVV W  S S
Sbjct  67   VVGPVGHLGEAYEEWVHQPIVTKEGPRFFQSDFWEFLTLTVWWAIPVIWLPVVVWCISMS  126

Query  280  VNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHYMMHGCHHKHPMDG  459
            V+MG   P++   +   +  WT +EYTLHRFLFH+KT+ YW NT HY++HGCHHKHPMD 
Sbjct  127  VSMGRSLPEIVSMVALGIFIWTFIEYTLHRFLFHIKTKSYWGNTAHYLLHGCHHKHPMDH  186

Query  460  MRLVFPPAATAIMLMPL------------------------------WGLVKLLAPSIYV  549
            +RLVFPP ATAI+  P+                              W LVKL A     
Sbjct  187  LRLVFPPTATAILCFPVCILIIYTVPPLYLFSQINLKPSSFLVSHQFWNLVKLFATPSTT  246

Query  550  YAILGGALLGYIIYDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIV  729
             A+ GG LLGY++YD THYYLHH +P   V+++LK++H++HHFR QDKGFGIT++ WDIV
Sbjct  247  PALFGGGLLGYVMYDVTHYYLHHAQPTRPVTKNLKKYHLNHHFRIQDKGFGITSSLWDIV  306

Query  730  FG  735
            FG
Sbjct  307  FG  308



>ref|XP_010687075.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=218

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 153/198 (77%), Gaps = 0/198 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQGF VDL+KPLVFQVGHL ++Y+EWVH+PIVSKE PRFF + F EFLT T WWAIP 
Sbjct  1    MVAQGFIVDLNKPLVFQVGHLEESYEEWVHQPIVSKEGPRFFESDFWEFLTLTVWWAIPV  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV    S SV MG   P++ + ++  +  WTL+EYTLHRFLFH+KT+ YW NT HY
Sbjct  61   IWLPVVCCCISMSVRMGHTLPEIVLMVIFGVFLWTLIEYTLHRFLFHIKTKSYWGNTIHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPPAATA++  P W LVK+ A      A+ GG LLGY++YD T
Sbjct  121  LIHGCHHKHPMDGLRLVFPPAATAVLCFPFWNLVKVFATPSTTPALFGGGLLGYVMYDVT  180

Query  601  HYYLHHGKPLTGVSQSLK  654
            HYYLHHG+P + V ++LK
Sbjct  181  HYYLHHGQPSSDVPKNLK  198



>ref|XP_001769286.1| predicted protein [Physcomitrella patens]
 gb|EDQ65840.1| predicted protein [Physcomitrella patens]
Length=233

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 154/218 (71%), Gaps = 0/218 (0%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VDL KPLVFQVGHLGD Y EWVH+PIV KESPRFFA+ F+E  T+T WW +P IW+PVV 
Sbjct  2    VDLGKPLVFQVGHLGDGYQEWVHQPIVQKESPRFFASDFMESTTKTLWWVVPLIWIPVVC  61

Query  262  WFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHYMMHGCHH  441
            W    ++  G P  +   ++      W+L+EY LHRFLFHVKT  YW NT HY++HGCHH
Sbjct  62   WLQVIAIRRGFPVDKFITTMPLGFLIWSLVEYILHRFLFHVKTTSYWGNTLHYLLHGCHH  121

Query  442  KHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHG  621
            KHPMDG RLVFPP    +  +PL+G++ L+    +  ++ G  LLGY++YD THY++HHG
Sbjct  122  KHPMDGYRLVFPPTFATMFAIPLYGMINLMFSRTWAPSVFGFGLLGYVMYDVTHYFIHHG  181

Query  622  KPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
                  +++LKRFH++HHF+ ++  +GIT+  WD VFG
Sbjct  182  SAANDFTRNLKRFHLNHHFKMREDSYGITSPLWDYVFG  219



>gb|ACJ86272.1| unknown [Medicago truncatula]
 gb|AFK35076.1| unknown [Medicago truncatula]
 gb|KEH31336.1| fatty acid 2-hydroxylase-like protein [Medicago truncatula]
Length=238

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 164/225 (73%), Gaps = 0/225 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A  F VDL+KPLV QVGHLG+ YD+WVH+PI+ KE PRFF +  LE  TRT WW IP 
Sbjct  1    MVANKFVVDLNKPLVCQVGHLGEDYDKWVHQPIMGKEGPRFFHSNILEVFTRTAWWVIPI  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IW+P+   F  +S  +GLP P L + +L  +  WTL EY LHRFLFHV+T+ YW NT HY
Sbjct  61   IWIPIASCFIYSSFRLGLPVPHLPLFVLLGIFVWTLTEYLLHRFLFHVQTKSYWGNTMHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPPA  A++   +W  VKL+ P     A+ GG LLGY++YDCT
Sbjct  121  LLHGCHHKHPMDSLRLVFPPAGAALIAYMIWSSVKLVFPPSIAPAVFGGILLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V ++LK++H++HH+R Q  GFGIT+  WD VFG
Sbjct  181  HYYLHHGQPKSDVPKNLKKYHLNHHYRVQSLGFGITSPLWDKVFG  225



>gb|EPS73322.1| hypothetical protein M569_01436, partial [Genlisea aurea]
Length=219

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 165/213 (77%), Gaps = 1/213 (0%)
 Frame = +1

Query  100  LVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVWWFASTS  279
            +  QVGHLGD YDEWVH+PIV+KE+PRFF N  LE LTRTPWW +P +WLPVVWWF ++S
Sbjct  2    IFLQVGHLGDRYDEWVHQPIVTKETPRFFHNALLELLTRTPWWVVPVVWLPVVWWFVTSS  61

Query  280  VNMGLPTP-QlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHYMMHGCHHKHPMD  456
            +  GL  P  LA ++   +  WTLLEY+LHRF+FHVKTR YW NT HY++HGCHHKHPMD
Sbjct  62   IEAGLTGPPHLAATMGVGMLIWTLLEYSLHRFVFHVKTRSYWGNTLHYLIHGCHHKHPMD  121

Query  457  GMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTG  636
            G+RLVFPPA  AI+   LW  VK+L+   Y  A+ GG LLGY++YDCTHYYLH+GKPL G
Sbjct  122  GLRLVFPPAPAAILAFLLWNAVKVLSTEPYSSALFGGGLLGYVMYDCTHYYLHYGKPLKG  181

Query  637  VSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
             +  LKR HM+HHFR Q+KGFGIT+ FWD VF 
Sbjct  182  FAHDLKRNHMNHHFRIQNKGFGITSNFWDWVFA  214



>ref|XP_010923777.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X3 [Elaeis 
guineensis]
Length=190

 Score =   244 bits (623),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 151/225 (67%), Gaps = 39/225 (17%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDLSKPLVFQVGHLG+AY EWVH+PIVSKE PRFFAN FLEFLT T WWAIP 
Sbjct  1    MVAQKFTVDLSKPLVFQVGHLGEAYQEWVHQPIVSKEGPRFFANDFLEFLTCTAWWAIPA  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV WF + S+ MG   P++A+ +   +  WTL+EYT+HRFLFH+KT+ YWANT HY
Sbjct  61   IWLPVVCWFVTMSMRMGHTIPEVAMMVGTGVFVWTLIEYTIHRFLFHMKTQTYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMDG+RLVFPP A AI+ +P                               
Sbjct  121  LLHGCHHKHPMDGLRLVFPPTAAAILCVP-------------------------------  149

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
                    P    +++LK +HM HHFR Q+KGFGIT+  WDIVFG
Sbjct  150  --------PSKNPARNLKLYHMSHHFRVQNKGFGITSKLWDIVFG  186



>gb|EEE53651.1| hypothetical protein OsJ_36952 [Oryza sativa Japonica Group]
Length=653

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 150/200 (75%), Gaps = 0/200 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A+ FTVDL++PLVFQVGHLG+ Y EWVH+PIVSKE PR FAN  LEFLTRT WWAIP 
Sbjct  1    MVAEAFTVDLNEPLVFQVGHLGEQYQEWVHQPIVSKEGPRLFANDVLEFLTRTEWWAIPL  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV W  + SV MG    ++A+ ++  +  WTL+EY +HRFLFH+ T+ YW NT HY
Sbjct  61   IWLPVVCWCLTKSVEMGHTLSEVALMVVFGICLWTLIEYIMHRFLFHINTKSYWTNTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HG HHKHP DG+RLVFPPAA AI+  P W L++L+      + + GG LLGY++YDCT
Sbjct  121  LLHGIHHKHPTDGLRLVFPPAAAAILCFPFWNLIRLITTPTTTHGVFGGGLLGYVMYDCT  180

Query  601  HYYLHHGKPLTGVSQSLKRF  660
            HYYLHHG+P +   + LK++
Sbjct  181  HYYLHHGQPSSDPGKHLKKY  200



>gb|KHG17877.1| Fatty acid 2-hydroxylase [Gossypium arboreum]
Length=263

 Score =   233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 140/201 (70%), Gaps = 3/201 (1%)
 Frame = +1

Query  58   KMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIP  237
             MA + FTVDL+KPLVFQVGHLG+AY EWVH PIV+ ESPRFF +  +E LTRT WW +P
Sbjct  13   DMAGKEFTVDLNKPLVFQVGHLGEAYQEWVHTPIVTDESPRFFKSDLMEILTRTVWWVVP  72

Query  238  TIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFH  417
             IW+PV  WF S S  MG   P + +  +     WT LEY  HRFLFH++T+ YWANTFH
Sbjct  73   LIWVPVAMWFISISYTMGHTLPLVVLMSVVGSFIWTFLEYCFHRFLFHIETKSYWANTFH  132

Query  418  YMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDC  597
            Y++HGCHHKHPMDG+RLV PPA  AI+ +  W L  +L       A+ GG L+GY+IYD 
Sbjct  133  YLIHGCHHKHPMDGLRLVIPPAEAAILAIMFWNLYGILFTVSTRPALFGGGLIGYVIYDM  192

Query  598  THYYLHHGKPLTGVSQSLKRF  660
             HYY+HHG+P     QS+K+ 
Sbjct  193  IHYYVHHGQP---TKQSIKKL  210



>gb|KDO75201.1| hypothetical protein CISIN_1g023817mg [Citrus sinensis]
Length=189

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 132/179 (74%), Gaps = 0/179 (0%)
 Frame = +1

Query  199  LEFLTRTPWWAIPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLF  378
            +EFLTRT WW IP +WLPVV W  S SV MGL      + +   +  WTLLEY LHR+LF
Sbjct  1    MEFLTRTKWWVIPLVWLPVVCWSVSKSVKMGLAPYLAGLIVFLGIITWTLLEYFLHRYLF  60

Query  379  HVKTRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAI  558
            H+KT+ YW NTFHY++HGCHHKHPMDG+RLVFPPA  A++ + LW L+ +L       A+
Sbjct  61   HIKTKSYWGNTFHYLIHGCHHKHPMDGLRLVFPPAGAALVSLALWNLIDVLTKPFITPAL  120

Query  559  LGGALLGYIIYDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
             GG LLGY++YD THYY HHGKP  G+   LKRFHM+HHFR +DKGFGI+++ WDIVFG
Sbjct  121  YGGILLGYVMYDVTHYYTHHGKPSKGIILRLKRFHMNHHFRIRDKGFGISSSLWDIVFG  179



>emb|CDY31640.1| BnaA05g09070D [Brassica napus]
Length=219

 Score =   221 bits (563),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 131/178 (74%), Gaps = 0/178 (0%)
 Frame = +1

Query  202  EFLTRTPWWAIPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFH  381
            +FLT T WWA+P IWLPV  W  S SV+ GL  P++   +   +  WTL+EYTLHRFLFH
Sbjct  32   QFLTLTVWWAVPVIWLPVSVWCISMSVSRGLSLPEIVPLIALGIFIWTLIEYTLHRFLFH  91

Query  382  VKTRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
            +KT+ YW NT HY++HGCHHKHPMD +RLVFPPAATA++  P W LVKL        A+ 
Sbjct  92   IKTKSYWGNTAHYLIHGCHHKHPMDHLRLVFPPAATAVLCFPFWNLVKLFTTPSVTPALF  151

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            GG +LGY++YD THYYLHH  P   V+++LK++H+ HHFR  DKGFG+T++ WDIVFG
Sbjct  152  GGGMLGYVMYDVTHYYLHHAHPTRAVTKNLKKYHLSHHFRIHDKGFGVTSSLWDIVFG  209



>ref|XP_001757039.1| predicted protein [Physcomitrella patens]
 gb|EDQ78270.1| predicted protein [Physcomitrella patens]
Length=264

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 152/236 (64%), Gaps = 3/236 (1%)
 Frame = +1

Query  37   SSIVTGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTR  216
             S V     +   ++VD++KP+V QVGHLG  YDEWVH+P++ K SPRFF +  LE  T+
Sbjct  8    QSAVNYDSGSKSKYSVDMTKPMVAQVGHLGAYYDEWVHQPVMRKGSPRFFHSNVLEMGTK  67

Query  217  TPWWAIPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRG  396
              WW IP IW P V      +V+ GLP   +  +    L  WTL+EY LHRFLFH+KT  
Sbjct  68   AKWWMIPGIWGPAVAVCVYRAVSEGLPLHMVVATFCVGLLMWTLVEYILHRFLFHMKTSS  127

Query  397  YWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPS-IYVYAILGGAL  573
            YW+NT HY++HG HHKHPMD  RLVFPP     +++P+W  ++L+ PS  Y  ++ GG L
Sbjct  128  YWSNTIHYVLHGFHHKHPMDSDRLVFPPLFALSIIIPVWFALQLVVPSPAYHSSLFGGLL  187

Query  574  LGYIIYDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQ--DKGFGITNTFWDIVFG  735
             GYI+YD THYYLH G   T     +K+ H DHHF+NQ  +  FG+T+ FWDIVF 
Sbjct  188  SGYILYDVTHYYLHFGMAFTPRLHKMKKDHSDHHFKNQLYNYSFGVTSPFWDIVFN  243



>ref|XP_001764590.1| predicted protein [Physcomitrella patens]
 gb|EDQ70572.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 142/235 (60%), Gaps = 4/235 (2%)
 Frame = +1

Query  40   SIVTGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRT  219
            S  T  +   + + VDL KPLVFQVG LG  YD+WVH PIV K+ PRFF +   EF T+T
Sbjct  2    SESTRPRREERKYVVDLDKPLVFQVGKLGAEYDQWVHNPIVQKDPPRFFESDVAEFFTKT  61

Query  220  PWWAIPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGY  399
              WAIP +W PVV   A  +   GL        + +    WTL+EY LHR+LFH+KT GY
Sbjct  62   ACWAIPAVWGPVVMCLAVAAHKDGLQLSAAPFFMASGAFVWTLIEYILHRYLFHMKTSGY  121

Query  400  WANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPL----WGLVKLLAPSIYVYAILGG  567
            W NT HY +HG HHKHPMDG RLVFPP  +    + L    + LV +L       ++  G
Sbjct  122  WTNTLHYFLHGFHHKHPMDGTRLVFPPKFSPSSSLELAWLTFQLVVILLQQPAKLSMFSG  181

Query  568  ALLGYIIYDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             LL YI YD THY+LH G P   +S+ LKR H DHHF++Q   FG+T  FWD VF
Sbjct  182  GLLMYIAYDLTHYFLHFGTPTNEMSRKLKRLHFDHHFKDQSTSFGVTTHFWDKVF  236



>ref|XP_001763959.1| predicted protein [Physcomitrella patens]
 gb|EDQ71098.1| predicted protein [Physcomitrella patens]
Length=237

 Score =   219 bits (558),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 143/222 (64%), Gaps = 3/222 (1%)
 Frame = +1

Query  76   FTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPV  255
            + VDL+KPLVFQVG LG  YD WVH P+V KE PRFF +   EF TRT WW IP +W P+
Sbjct  1    YVVDLNKPLVFQVGKLGADYDRWVHDPVVQKEPPRFFESDIAEFFTRTAWWVIPAVWGPL  60

Query  256  VWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHYMMHGC  435
            V + A  +   GL        +      WT +EY LHR++FH+KT G W+ T HY +HG 
Sbjct  61   VIYLAVLAHKGGLWLSTAPFVMAIGAFIWTFIEYLLHRYVFHMKTTGKWSCTAHYFLHGF  120

Query  436  HHKHPMDGMRLVFPPAATAIMLMPLWGLVK---LLAPSIYVYAILGGALLGYIIYDCTHY  606
            HHKHPMDG RLVFPPA T I+++ +W L +   LL       ++  G LL YI YD THY
Sbjct  121  HHKHPMDGTRLVFPPAVTGILVIIIWYLTEPLVLLLGRPVKLSLFSGGLLMYIAYDLTHY  180

Query  607  YLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
            +LH G P   +++SLKR H++HHFRN+   FG+T+ FWD VF
Sbjct  181  FLHFGTPHNELARSLKRSHLNHHFRNEHYSFGVTSHFWDTVF  222



>ref|XP_010923776.1| PREDICTED: fatty acid 2-hydroxylase 2-like isoform X2 [Elaeis 
guineensis]
Length=199

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M AQ FTVDLSKPLVFQVGHLG+AY EWVH+PIVSKE PRFFAN FLEFLT T WWAIP 
Sbjct  1    MVAQKFTVDLSKPLVFQVGHLGEAYQEWVHQPIVSKEGPRFFANDFLEFLTCTAWWAIPA  60

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IWLPVV WF + S+ MG   P++A+ +   +  WTL+EYT+HRFLFH+KT+ YWANT HY
Sbjct  61   IWLPVVCWFVTMSMRMGHTIPEVAMMVGTGVFVWTLIEYTIHRFLFHMKTQTYWANTAHY  120

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPL  510
            ++HGCHHKHPMDG+RLVFPP A AI+ +P+
Sbjct  121  LLHGCHHKHPMDGLRLVFPPTAAAILCVPI  150



>gb|EYU19106.1| hypothetical protein MIMGU_mgv1a015626mg [Erythranthe guttata]
Length=151

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +1

Query  352  EYTLHRFLFHVKTRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLL  531
            EY+LHRFLFH+KT GYW NT HY++HGCHHKHPMDG+RLVFPPAA AI+  PLW LVK+L
Sbjct  12   EYSLHRFLFHMKTTGYWGNTAHYLLHGCHHKHPMDGLRLVFPPAAAAILAFPLWNLVKIL  71

Query  532  APSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITN  711
            AP+ Y  A+ GG LLGY++YDCTHYYLHHGKPL GVS  LKR HMDHHFR QDKG+GIT+
Sbjct  72   APAQYAPAMFGGGLLGYVMYDCTHYYLHHGKPLKGVSHQLKRNHMDHHFRIQDKGYGITS  131

Query  712  TFWDIVFG  735
             FWD VFG
Sbjct  132  NFWDWVFG  139



>ref|XP_006661481.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Oryza brachyantha]
Length=211

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 135/192 (70%), Gaps = 7/192 (4%)
 Frame = +1

Query  163  SKESPRFFANGFLEFLTRTPWWAIPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaaw  342
             K+  RF      +FLT T WWA+PTIWLPVV W    S+ MG    ++A+  L  +  W
Sbjct  14   QKKKNRF------QFLTLTKWWAVPTIWLPVVCWLLVKSIRMGHTLQEVALMALFGVFIW  67

Query  343  tllEYTLHRFLFHVKTRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLV  522
            TL+EYTLHRFLFH++T+ YWANT HY++HGCHHKHPMD +RLV PP ATA + +P W LV
Sbjct  68   TLIEYTLHRFLFHIETKTYWANTAHYLLHGCHHKHPMDSLRLVLPPTATATLCVPFWKLV  127

Query  523  KLLAPSIYVYAILGGALLGYIIYDCTHYYL-HHGKPLTGVSQSLKRFHMDHHFRNQDKGF  699
               A S    A+ GG LLGY++YDCTH YL HHG+P    +++LKR+H++ HFR Q+KGF
Sbjct  128  TFFATSTTTPALFGGGLLGYVMYDCTHCYLQHHGQPSKDPAKNLKRYHLNRHFRIQNKGF  187

Query  700  GITNTFWDIVFG  735
             I+++ WD VFG
Sbjct  188  AISSSLWDYVFG  199



>ref|XP_006586858.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Glycine 
max]
Length=161

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  286  MGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHYMMHGCHHKHPMDGMR  465
            MGL  P LA+ ++  +  WTLLEY+LHRFLFH+KT+ YW NT HY++HGCHHKHPMDG+R
Sbjct  1    MGLSCPHLALLVVLGIFVWTLLEYSLHRFLFHIKTKTYWGNTLHYLLHGCHHKHPMDGLR  60

Query  466  LVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTGVSQ  645
            LVFPPAATAI+LMP W LVKL+A      A+ GG LLGY++YDCTHYYLHHG+P T V +
Sbjct  61   LVFPPAATAILLMPFWNLVKLMATPSTAPALFGGGLLGYVMYDCTHYYLHHGQPKTEVPR  120

Query  646  SLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            +LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  121  NLKKYHLNHHFRIQDKGFGITSSLWDKVFG  150



>ref|XP_008349164.1| PREDICTED: fatty acid 2-hydroxylase 1-like, partial [Malus domestica]
Length=194

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 137/209 (66%), Gaps = 34/209 (16%)
 Frame = +1

Query  109  QVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVWWFASTSVNM  288
            QVGHLG+AY EWVH+PIVSKE PRFF + F EFLTRT WWA+P IWLPVV++  S SV M
Sbjct  8    QVGHLGEAYQEWVHQPIVSKEGPRFFESEFWEFLTRTVWWAVPVIWLPVVFYSISVSVRM  67

Query  289  GLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHYMMHGCHHKHPMDGMRL  468
            G   P++ + ++  +  WTLLEYTLHRFLFH++T+ Y           C           
Sbjct  68   GHTFPEIVLMVVFGIFVWTLLEYTLHRFLFHIETKSY-----------CQ----------  106

Query  469  VFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTGVSQS  648
                          + LVKL+A      A+ GG LLGY++YDCTHYYLHHG+P + V ++
Sbjct  107  -------------FFNLVKLMASPTVAPALFGGGLLGYVMYDCTHYYLHHGQPSSEVPRN  153

Query  649  LKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            LK++H++HHFR QDKGFGIT++ WD VFG
Sbjct  154  LKKYHLNHHFRIQDKGFGITSSLWDRVFG  182



>ref|XP_001762706.1| predicted protein [Physcomitrella patens]
 gb|EDQ72505.1| predicted protein [Physcomitrella patens]
Length=256

 Score =   199 bits (506),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 138/213 (65%), Gaps = 3/213 (1%)
 Frame = +1

Query  106  FQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVWWFASTSVN  285
            F+VGHLG  YDEWVH+P++ KES R F +  +E +TR  WW +PT+W PVV W    ++ 
Sbjct  1    FKVGHLGSDYDEWVHEPVMRKESSRIFESSVIEIITRCKWWMVPTVWGPVVVWCQVKAME  60

Query  286  MGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWA-NTFHYMMHGCHHKHPMDGM  462
             GLPT  L ++LL     WT LEY +HRFLF+ K+   W+ N  HY++HG H KHPMD  
Sbjct  61   QGLPTSALPVALLVGFIFWTFLEYVIHRFLFNAKSSPAWSVNQLHYVIHGFHLKHPMDAD  120

Query  463  RLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTGVS  642
            RLVFPP  TA + M +W L++ +    ++ +I GGAL GYI YD THY+LH G   T   
Sbjct  121  RLVFPPVHTAAIAMVIWKLMEFVLTPTWMPSIFGGALFGYICYDLTHYFLHLGIAFTDYL  180

Query  643  QSLKRFHMDHHFRN--QDKGFGITNTFWDIVFG  735
              LK+ H +HHF++     GFG+T +FWD VFG
Sbjct  181  YKLKKDHFNHHFKSGMHRYGFGVTTSFWDAVFG  213



>ref|XP_005838179.1| hypothetical protein GUITHDRAFT_151008 [Guillardia theta CCMP2712]
 gb|EKX51199.1| hypothetical protein GUITHDRAFT_151008 [Guillardia theta CCMP2712]
Length=344

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 147/239 (62%), Gaps = 9/239 (4%)
 Frame = +1

Query  43   IVTGAKMAA----QGF-TVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEF  207
            I++GAK  A    QG   +D SKP++ Q+GHLG+ Y++++H+P V  E  RFF + FLE 
Sbjct  91   ILSGAKRKAAPQHQGMKALDFSKPIIMQIGHLGNNYNDFIHRPQVLDEPARFFESDFLEI  150

Query  208  LTRTPWWAIPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
             +RTPW+ +P +WLPV+      S+ MGL      +  L  L  WTL+EY LHRFLFH+ 
Sbjct  151  FSRTPWYVVPLVWLPVITGMVLLSLKMGLTPLGAGLIFLGGLFTWTLIEYVLHRFLFHLD  210

Query  388  T---RGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAI  558
                  YWA T H+++HG HH  PMD MRLVFPP  T I+L+  + L ++   +    + 
Sbjct  211  EWVQFNYWAITLHFLIHGVHHLLPMDPMRLVFPPILTFILLLGFYNLFRVFLDTPEAVSF  270

Query  559  LGGALLGYIIYDCTHYYLHH-GKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
              G LLGY+ YD THYYLHH G P      S+K +H+ HH++N   G+GIT+  WD VF
Sbjct  271  TAGGLLGYVGYDLTHYYLHHSGTPFLSHFSSMKSYHLAHHYKNPLLGYGITSKLWDYVF  329



>gb|KEH31335.1| fatty acid 2-hydroxylase-like protein [Medicago truncatula]
Length=207

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 140/225 (62%), Gaps = 31/225 (14%)
 Frame = +1

Query  61   MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPT  240
            M A  F VDL+KPLV QV                                TRT WW IP 
Sbjct  1    MVANKFVVDLNKPLVCQV-------------------------------FTRTAWWVIPI  29

Query  241  IWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGYWANTFHY  420
            IW+P+   F  +S  +GLP P L + +L  +  WTL EY LHRFLFHV+T+ YW NT HY
Sbjct  30   IWIPIASCFIYSSFRLGLPVPHLPLFVLLGIFVWTLTEYLLHRFLFHVQTKSYWGNTMHY  89

Query  421  MMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCT  600
            ++HGCHHKHPMD +RLVFPPA  A++   +W  VKL+ P     A+ GG LLGY++YDCT
Sbjct  90   LLHGCHHKHPMDSLRLVFPPAGAALIAYMIWSSVKLVFPPSIAPAVFGGILLGYVMYDCT  149

Query  601  HYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            HYYLHHG+P + V ++LK++H++HH+R Q  GFGIT+  WD VFG
Sbjct  150  HYYLHHGQPKSDVPKNLKKYHLNHHYRVQSLGFGITSPLWDKVFG  194



>ref|XP_010098538.1| hypothetical protein L484_025978 [Morus notabilis]
 gb|EXB75198.1| hypothetical protein L484_025978 [Morus notabilis]
Length=1613

 Score =   202 bits (515),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 100/232 (43%), Positives = 129/232 (56%), Gaps = 53/232 (23%)
 Frame = +1

Query  40   SIVTGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRT  219
            SI+    M AQ F VDL+KPLV QVGHLG+ Y EW H+PI +KESPRFF +  LE     
Sbjct  42   SIIIYYNMVAQEFVVDLNKPLVLQVGHLGEGYQEWAHQPIPTKESPRFFESDILEAFFEN  101

Query  220  PWWAIPTIWLPVVWWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGY  399
                           +AS  +                         T+H +L H      
Sbjct  102  E--------------YASVLIRGN----------------------TIH-YLLH------  118

Query  400  WANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLG  579
                      GCHHKHPMD +RLVFPP   AI+ +PLW ++KLL+ +    A+ GG LLG
Sbjct  119  ----------GCHHKHPMDSLRLVFPPVPAAILTIPLWNMIKLLSTTSTTPALFGGGLLG  168

Query  580  YIIYDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            Y++YD THYYLHHG P     ++LK++H++HHFR Q+KGFGIT++ WD VFG
Sbjct  169  YVMYDVTHYYLHHGHPSKETFRNLKKYHLNHHFRIQNKGFGITSSLWDKVFG  220



>gb|ELK36174.1| Fatty acid 2-hydroxylase, partial [Myotis davidii]
Length=286

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 139/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F + F+E LT+T W+++P IW+P++ 
Sbjct  38   VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFYSDFIEALTKTVWYSVPVIWMPLML  95

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  +  W+L EY LHRFLFH+K
Sbjct  96   YLSWSHYRTLAQGDVRLFASFTTEYSVAMPKSVFPGLFVLGMLLWSLTEYLLHRFLFHMK  155

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H++MHG HHK P D  RLVFPPA  ++++   +  ++LL P      + 
Sbjct  156  PPSNSYYLITLHFIMHGQHHKAPFDESRLVFPPAPASLVIAFFYTALQLLLPEAVGGTVF  215

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    S+K  H+ HHF +Q  GFGI+  FWD +F
Sbjct  216  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYSMKAHHVKHHFAHQKSGFGISTKFWDYIF  273



>ref|XP_006755885.1| PREDICTED: fatty acid 2-hydroxylase, partial [Myotis davidii]
Length=308

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 139/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F + F+E LT+T W+++P IW+P++ 
Sbjct  60   VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFYSDFIEALTKTVWYSVPVIWMPLML  117

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  +  W+L EY LHRFLFH+K
Sbjct  118  YLSWSHYRTLAQGDVRLFASFTTEYSVAMPKSVFPGLFVLGMLLWSLTEYLLHRFLFHMK  177

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H++MHG HHK P D  RLVFPPA  ++++   +  ++LL P      + 
Sbjct  178  PPSNSYYLITLHFIMHGQHHKAPFDESRLVFPPAPASLVIAFFYTALQLLLPEAVGGTVF  237

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    S+K  H+ HHF +Q  GFGI+  FWD +F
Sbjct  238  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYSMKAHHVKHHFAHQKSGFGISTKFWDYIF  295



>ref|XP_006641387.1| PREDICTED: fatty acid 2-hydroxylase-like [Lepisosteus oculatus]
Length=343

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/235 (42%), Positives = 140/235 (60%), Gaps = 23/235 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVV-  258
            VD  KPL++QVGHLG+ YD+WVH+P+      R F +  +E  ++T W+ +P +WLPVV 
Sbjct  95   VDWRKPLLWQVGHLGEKYDDWVHQPV--DRPIRLFYSDVIEACSKTSWYMVPIVWLPVVA  152

Query  259  ---WW------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
               W+            FAS + +  +P  +     +  L  +  +L+EY +HRFLFH+K
Sbjct  153  YLSWYCFSSLARGDTRLFASFTTDYSIPIHKYTFPFMFLLGMFLWSLVEYLIHRFLFHMK  212

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  TFH+++HG HHK P DG RLVFPP   +I+++  +GL++LL P     +I 
Sbjct  213  PPASNYYLITFHFLLHGQHHKSPYDGSRLVFPPIPASIVIVAFYGLIRLLLPEALGVSIF  272

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVSQ-SLKRFHMDHHFRNQDKGFGITNTFWD  723
             G L GY++YD  HYYLH+G P  G     LK +H+ HHF +Q  GFGIT  FWD
Sbjct  273  VGGLCGYVVYDMIHYYLHYGSPSKGSYMYGLKAYHVKHHFEHQRSGFGITTRFWD  327



>ref|XP_006091288.1| PREDICTED: fatty acid 2-hydroxylase [Myotis lucifugus]
Length=372

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 139/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F + F+E LT+T W+++P IW+P++ 
Sbjct  124  VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFYSDFIEALTKTVWYSVPVIWMPLML  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  +  W+L EY LHRFLFH+K
Sbjct  182  YLSWSHYRTLAQGDVRLFASFTTEYSVAMPKSVFPGLFVLGMLLWSLTEYLLHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H++MHG HHK P D  RLVFPPA  ++++   +  ++LL P      + 
Sbjct  242  PPSNSYYLITLHFIMHGQHHKAPFDESRLVFPPAPASLVIAFFYTALQLLLPEAVGGTVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    S+K  H+ HHF +Q  GFGI+  FWD +F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYSMKAHHVKHHFAHQKSGFGISTKFWDYIF  359



>ref|XP_005862777.1| PREDICTED: fatty acid 2-hydroxylase [Myotis brandtii]
Length=428

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 139/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F + F+E LT+T W+++P IW+P++ 
Sbjct  180  VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFYSDFIEALTKTVWYSVPVIWMPLML  237

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  +  W+L EY LHRFLFH+K
Sbjct  238  YLSWSHYRTLAQGDVRLFASFTTEYSVAMPKSMFPGLFVLGMLLWSLTEYLLHRFLFHMK  297

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H++MHG HHK P D  RLVFPPA  ++++   +  ++LL P      + 
Sbjct  298  PPSNSYYLITLHFIMHGQHHKAPFDESRLVFPPAPASLVIAFFYTALQLLLPEAVGGTVF  357

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    S+K  H+ HHF +Q  GFGI+  FWD +F
Sbjct  358  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYSMKAHHVKHHFAHQKSGFGISTKFWDYIF  415



>ref|XP_008137885.1| PREDICTED: fatty acid 2-hydroxylase [Eptesicus fuscus]
Length=372

 Score =   174 bits (441),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 139/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F + F+E LT+T W+++P IW+P++ 
Sbjct  124  VDWQKPLLWQVGHLGEKYDEWVHQPVA--RPIRLFYSDFIEALTKTVWYSVPVIWMPLML  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  +  W+L EY LHRFLFH+K
Sbjct  182  YLSWSHYRTFAQGDVRLFASFTTEYSVAMPKSVFPGLFVLGMLLWSLTEYLLHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H+++HG HHK P D  RLVFPPA  ++++   +  ++LL P      + 
Sbjct  242  PPSNSYYLITLHFILHGQHHKAPFDESRLVFPPAPASLVIAFFYTALQLLLPEAVGGTVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    S+K  H+ HHF +Q  GFGI+  FWD +F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYSMKAHHVKHHFAHQKSGFGISTKFWDYIF  359



>ref|XP_004987692.1| fatty acid 2-hydroxylase [Salpingoeca rosetta]
 gb|EGD81296.1| fatty acid 2-hydroxylase [Salpingoeca rosetta]
Length=301

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 134/239 (56%), Gaps = 22/239 (9%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD+  P+V QV  LGD Y EWVHKP  ++ S R FA    EF + TPWW IP +W+P++ 
Sbjct  54   VDMKGPMVPQVAKLGDKYWEWVHKP-SAQRSYRLFAGDLYEFFSWTPWWVIPIVWVPIIT  112

Query  262  WFASTSVN--------MGLPTPQlaisllasl-----------aawtllEYTLHRFLFHV  384
              +  ++         + L +P +  + + +L             W+ LEY LHRFLFH+
Sbjct  113  ALSMDALGRLDWSMSPLALVSPAMVSTQVLALWPFLGIFLTGILMWSFLEYCLHRFLFHI  172

Query  385  KT--RGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAI  558
                   +   FH+++HG HHK P+D  RLVFPP A  +M  P + +  L        A+
Sbjct  173  ILFPGTAFGIQFHFILHGQHHKFPLDRGRLVFPPMAGLMMTAPFYLVFHLTMAREVANAL  232

Query  559  LGGALLGYIIYDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
              GALLGYI YD THYYLHHG+P TG  Q LKR HM HH+R+   GFGI++  WD  F 
Sbjct  233  TAGALLGYIAYDLTHYYLHHGRPSTGYFQRLKRHHMQHHYRHSTLGFGISSKLWDFPFA  291



>gb|KFO63090.1| Fatty acid 2-hydroxylase, partial [Corvus brachyrhynchos]
Length=251

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 137/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLEFL++T W+ +  +W PVV 
Sbjct  3    VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLEFLSKTAWYVVFMVWTPVVL  60

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L     +LLEY +HRF+FH+K
Sbjct  61   YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFILGMILWSLLEYLIHRFVFHMK  120

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  121  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSVF  180

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD  F
Sbjct  181  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWDYPF  238



>ref|XP_010395032.1| PREDICTED: fatty acid 2-hydroxylase, partial [Corvus cornix cornix]
Length=294

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 137/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLEFL++T W+ +  +W PVV 
Sbjct  46   VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLEFLSKTAWYVVFMVWTPVVL  103

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L     +LLEY +HRF+FH+K
Sbjct  104  YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFILGMILWSLLEYLIHRFVFHMK  163

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  164  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSVF  223

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD  F
Sbjct  224  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWDYPF  281



>ref|XP_002188183.1| PREDICTED: fatty acid 2-hydroxylase [Taeniopygia guttata]
Length=369

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 138/239 (58%), Gaps = 23/239 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLEFL++T W+ +  +W PVV 
Sbjct  121  VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLEFLSKTAWYVVFMVWTPVVL  178

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L     +LLEY +HRF+FH+K
Sbjct  179  YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMILWSLLEYLIHRFVFHMK  238

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   A+++   +G+++LL P +   ++ 
Sbjct  239  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPAALVIGFFYGVLRLLLPEVLGLSVF  298

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD  FG
Sbjct  299  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWDYPFG  357



>ref|XP_007938552.1| PREDICTED: fatty acid 2-hydroxylase [Orycteropus afer afer]
Length=372

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 137/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P++ 
Sbjct  124  VDWQKPLLWQVGHLGEKYDEWVHQPVA--RPIRLFHSDLIEALSKTVWYSVPIIWVPLML  181

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F S +    +P P+     L     +  TL+EY +HRFLFH K
Sbjct  182  YLSWSYYRTLAQGNIRLFTSFTTEYAVPVPESMFLGLFLTGLFLWTLMEYLMHRFLFHTK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H++MHG HHK P DG RLVFPP   ++++   + L++L+ P     ++ 
Sbjct  242  PPSNSYYLITLHFIMHGQHHKAPFDGSRLVFPPVPASLVIAAFYALLRLILPEAVGGSVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGV-SQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    S+K  H+ HHF +Q  GFG++   WD  F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPHKGSFLYSMKAHHVRHHFAHQKSGFGVSTKLWDYFF  359



>gb|KFQ42624.1| Fatty acid 2-hydroxylase, partial [Nestor notabilis]
Length=264

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/244 (39%), Positives = 140/244 (57%), Gaps = 23/244 (9%)
 Frame = +1

Query  67   AQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIW  246
            A+   VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLE L++T W+ +  +W
Sbjct  11   AEKDLVDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLESLSKTAWYMVFMVW  68

Query  247  LPVVWW----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRF  372
             PVV +                F+S S    +P  +     +  L  +  +L+EY +HRF
Sbjct  69   TPVVLYLSWVSYTSLAQGNTRLFSSFSTEYSIPVHKYYFPFIFLLGMFLWSLIEYLIHRF  128

Query  373  LFHVK--TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIY  546
            +FH+K     Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P + 
Sbjct  129  VFHMKPPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVMGFFYGVLQLLLPEVL  188

Query  547  VYAILGGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWD  723
              ++  G L GY++YD  HYYLH+G P  G     LK +H+ HHF +Q  GFGIT  FWD
Sbjct  189  GLSVFVGGLCGYVVYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGITTRFWD  248

Query  724  IVFG  735
              FG
Sbjct  249  HPFG  252



>ref|XP_010013467.1| PREDICTED: fatty acid 2-hydroxylase, partial [Nestor notabilis]
Length=281

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/261 (38%), Positives = 147/261 (56%), Gaps = 30/261 (11%)
 Frame = +1

Query  37   SSIVTGAKMAAQGFTVDLSK-------PLVFQVGHLGDAYDEWVHKPIVSKESPRFFANG  195
            ++ +T A+M  +  TVD  K       PL++QVG+LG+ YDEWVH+P+      R F + 
Sbjct  11   AAALTQARMDPRCKTVDAEKDLVDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSD  68

Query  196  FLEFLTRTPWWAIPTIWLPVVWW----------------FASTSVNMGLPTPQlaislla  327
            FLE L++T W+ +  +W PVV +                F+S S    +P  +     + 
Sbjct  69   FLESLSKTAWYMVFMVWTPVVLYLSWVSYTSLAQGNTRLFSSFSTEYSIPVHKYYFPFIF  128

Query  328  slaaw--tllEYTLHRFLFHVK--TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAI  495
             L  +  +L+EY +HRF+FH+K     Y+  T H+++HG HHK P D  RLVFPP   ++
Sbjct  129  LLGMFLWSLIEYLIHRFVFHMKPPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASL  188

Query  496  MLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDH  672
            ++   +G+++LL P +   ++  G L GY++YD  HYYLH+G P  G     LK +H+ H
Sbjct  189  VMGFFYGVLQLLLPEVLGLSVFVGGLCGYVVYDMMHYYLHYGSPKKGTYLYGLKAYHVKH  248

Query  673  HFRNQDKGFGITNTFWDIVFG  735
            HF +Q  GFGIT  FWD  FG
Sbjct  249  HFEHQKSGFGITTRFWDHPFG  269



>ref|XP_008284757.1| PREDICTED: fatty acid 2-hydroxylase [Stegastes partitus]
Length=379

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 140/254 (55%), Gaps = 23/254 (9%)
 Frame = +1

Query  31   SPSSIVTGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFL  210
            SP S  +   +      VD +KPL +QVGHLG+ YD WVH+P+      R F N F+E  
Sbjct  122  SPYSRCSSVDLEKD--LVDWTKPLAWQVGHLGEKYDAWVHQPV--DRPIRLFGNPFMEAS  177

Query  211  TRTPWWAIPTIWLPVVW---WFASTSVNMGLPTPQlaisllaslaaw-------------  342
            T+T W+ +P +WLP+V+   WF  TS+  G    +L       +  +             
Sbjct  178  TKTSWYWVPVVWLPIVFYLSWFCYTSLAQGTTRIELTSDFSIPVHKYMFVPLFLLGWFLW  237

Query  343  tllEYTLHRFLFHVK--TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWG  516
            + +EY +HRF+FH++     Y+    H+++HG HHK P DG RLVFPP   +I++   + 
Sbjct  238  SFIEYCIHRFIFHMRPPAHNYYLIMLHFLLHGQHHKSPFDGSRLVFPPGLASIVVGGFYV  297

Query  517  LVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTGVSQ-SLKRFHMDHHFRNQDK  693
            L++   P I   ++  G L GY++YD  HYYLH+G P  G     LK +H+ HHF +Q  
Sbjct  298  LLRNTLPEILGASVFVGGLCGYVVYDMIHYYLHYGSPKRGSYMYGLKAYHVKHHFEHQRA  357

Query  694  GFGITNTFWDIVFG  735
            GFGIT+TFWD  F 
Sbjct  358  GFGITSTFWDYPFN  371



>ref|XP_008532332.1| PREDICTED: fatty acid 2-hydroxylase [Equus przewalskii]
Length=366

 Score =   171 bits (433),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 139/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KP+++QVGHLG+ YDEWVH+P+      R F + F+E LT+T W+++P +W+P++ 
Sbjct  118  VDWRKPILWQVGHLGEKYDEWVHQPVT--RPIRLFHSDFIESLTKTVWYSVPIVWMPLIL  175

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  L  W+L+EY LHRFLFH+K
Sbjct  176  YLSWSYYRTLAQGNVRLFTSFTTEYSVAMPESVFPGLFVLGLFLWSLVEYVLHRFLFHMK  235

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H+++HG HHK P D  RLVFPP   ++M+   + +++LL P      + 
Sbjct  236  PPSNSYYLITLHFVLHGQHHKAPFDESRLVFPPVPASLMIAFFYMVLRLLLPEAVGGTVF  295

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G     +K  H+ HHF +Q  GFGI++ FWD  F
Sbjct  296  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYKMKAHHVKHHFAHQKSGFGISSKFWDYFF  353



>ref|XP_005490873.1| PREDICTED: fatty acid 2-hydroxylase [Zonotrichia albicollis]
Length=304

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 136/238 (57%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLEFL++T W+ +  +W PVV 
Sbjct  56   VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLEFLSKTAWYVVFMVWTPVVL  113

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L     +LLEY +HRF+FH+K
Sbjct  114  YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMVLWSLLEYLIHRFVFHMK  173

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +    + 
Sbjct  174  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLCVF  233

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD  F
Sbjct  234  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWDYPF  291



>ref|XP_008637111.1| PREDICTED: fatty acid 2-hydroxylase [Corvus brachyrhynchos]
Length=326

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 137/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLEFL++T W+ +  +W PVV 
Sbjct  78   VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLEFLSKTAWYVVFMVWTPVVL  135

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L     +LLEY +HRF+FH+K
Sbjct  136  YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFILGMILWSLLEYLIHRFVFHMK  195

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  196  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSVF  255

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD  F
Sbjct  256  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWDYPF  313



>ref|XP_007071299.1| PREDICTED: fatty acid 2-hydroxylase [Chelonia mydas]
Length=396

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 138/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F + F+E L++T W+ +  +W+PVV 
Sbjct  148  VDWYKPLLWQVGHLGEKYDEWVHQPV--DRPIRLFHSDFIESLSKTAWYIVIMVWIPVVL  205

Query  262  ---WFASTSVNMG-------------LPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
               WF  TS+  G             +P  +     +  L     +L+EY +HRFLFH+K
Sbjct  206  YLSWFCYTSLAQGTTRLFSSFTTEYSIPVHKYFFPFIFVLGMCLWSLVEYLIHRFLFHMK  265

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   + L++LL P     ++ 
Sbjct  266  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYTLLRLLLPEAVGISMF  325

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G L GY++YD THYYLH+G P  G     LK +H+ HHF +Q  GFGIT+ FWD  F
Sbjct  326  VGGLFGYVVYDMTHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGITSKFWDRPF  383



>ref|XP_005152461.1| PREDICTED: fatty acid 2-hydroxylase, partial [Melopsittacus undulatus]
Length=320

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/261 (38%), Positives = 149/261 (57%), Gaps = 30/261 (11%)
 Frame = +1

Query  37   SSIVTGAKMAAQGFTVDLSK-------PLVFQVGHLGDAYDEWVHKPIVSKESPRFFANG  195
            ++  T A+M  +  TVD+ K       PL++QVG+LG+ YDEWVH+P+      R F + 
Sbjct  50   AATQTPARMDPRCKTVDVEKDLVDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSD  107

Query  196  FLEFLTRTPWWAIPTIWLPVVW---WFASTSVNMG-------------LPTPQlaislla  327
            FLE L++T W+ +  +W PVV    W + TS++ G             +P  +     + 
Sbjct  108  FLESLSKTAWYVVFMVWTPVVLYLSWVSYTSLDQGNTRLFSSFTTEYSIPVHKYYFPFIF  167

Query  328  slaaw--tllEYTLHRFLFHVK--TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAI  495
             +  +  +LLEY +HRF+FH+K     Y+  T H+++HG HHK P D  RLVFPP   ++
Sbjct  168  LVGMFLWSLLEYLIHRFVFHMKPPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASL  227

Query  496  MLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDH  672
            ++   +G+++LL P +   ++  G L GY++YD  HYYLH+G P  G     LK +H+ H
Sbjct  228  VIGFFYGVLQLLLPEVLGLSVFVGGLCGYVVYDMMHYYLHYGSPKKGTYLYGLKAYHVKH  287

Query  673  HFRNQDKGFGITNTFWDIVFG  735
            HF +Q  GFGIT  FWD  FG
Sbjct  288  HFEHQKSGFGITTRFWDHPFG  308



>ref|XP_005526361.1| PREDICTED: fatty acid 2-hydroxylase [Pseudopodoces humilis]
Length=372

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 138/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLEFL++T W+ +  +W PVV 
Sbjct  124  VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLEFLSKTAWYVVFMVWTPVVL  181

Query  262  ---WFASTSVNMG-------------LPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
               W + TS+  G             +P  +     +  L     +LLEY +HRF+FH+K
Sbjct  182  YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMILWSLLEYLIHRFVFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   A+++   +G+++LL P +   A+ 
Sbjct  242  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPAALVIGFFYGVLQLLLPEMLGLAVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD  F
Sbjct  302  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQRSGFGISTRFWDYPF  359



>gb|KFP79397.1| Fatty acid 2-hydroxylase, partial [Acanthisitta chloris]
Length=251

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 136/235 (58%), Gaps = 23/235 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F +  LEFL++T W+ +  +W PVV 
Sbjct  3    VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDILEFLSKTAWYVVFMVWTPVVL  60

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L  +  +LLEY +HRF+FH+K
Sbjct  61   YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMFLWSLLEYLIHRFVFHMK  120

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  121  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSVF  180

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWD  723
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD
Sbjct  181  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWD  235



>gb|ELW63012.1| Fatty acid 2-hydroxylase [Tupaia chinensis]
Length=317

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/249 (38%), Positives = 143/249 (57%), Gaps = 23/249 (9%)
 Frame = +1

Query  49   TGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWW  228
            TG  +      VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+
Sbjct  58   TGTVLIEAQDLVDWKKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEALSKTVWY  115

Query  229  AIPTIWLPVVWWFA------------------STSVNMGLPTPQlaisllaslaawtllE  354
            ++P +W+P++ + +                  +T  ++ +P        +  L  W+L+E
Sbjct  116  SVPIVWMPLMLYLSWSYYRTLAQGNVRLFTSFTTEYSVVVPESVFPGLFMLGLLLWSLVE  175

Query  355  YTLHRFLFHVK--TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKL  528
            Y +HRFLFH+K  +  Y+  T H++MHG HHK P D  RLVFPP   ++++   + L++L
Sbjct  176  YLIHRFLFHMKPPSDSYYLITLHFIMHGQHHKAPFDDSRLVFPPVPASLVIATFYVLLRL  235

Query  529  LAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGI  705
            + P     ++  G LLGYI+YD THYYLH G P  G    ++K  H+ HHF +Q  GFGI
Sbjct  236  ILPEAVGGSLFAGGLLGYILYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFTHQKSGFGI  295

Query  706  TNTFWDIVF  732
            ++ FWD  F
Sbjct  296  SSKFWDYFF  304



>ref|XP_005052570.1| PREDICTED: fatty acid 2-hydroxylase [Ficedula albicollis]
Length=368

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 138/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLEFL++T W+ +  +W PVV 
Sbjct  120  VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLEFLSKTAWYVVFMVWTPVVL  177

Query  262  ---WFASTSVNMG-------------LPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
               W + TS+  G             +P  +     +  +     +LLEY +HRF+FH+K
Sbjct  178  YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLIGMILWSLLEYLIHRFVFHMK  237

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  238  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSVF  297

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD  F
Sbjct  298  VGGLCGYVIYDMMHYYLHYGSPRKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWDYPF  355



>ref|XP_004704850.1| PREDICTED: fatty acid 2-hydroxylase [Echinops telfairi]
Length=419

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 141/238 (59%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P++     R F +  +E L++T W+++P IW+P++ 
Sbjct  171  VDWQKPLLWQVGYLGEKYDEWVHQPVL--RPIRLFHSDLIEALSKTVWYSVPLIWVPLML  228

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F S +    +P P+     L  L     T+LEY +HRFLFH+K
Sbjct  229  YLSWSCYRILAQGNVRLFTSFTTEYSVPVPKSMFPGLILLGMLFWTILEYLIHRFLFHMK  288

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  ++    H+M+HG HHK P DG RLVFPPA  ++++   + LV+LL P      + 
Sbjct  289  PPSDSHYLIMLHFMLHGQHHKAPFDGSRLVFPPAPASLVIAFFYMLVRLLLPEAVGGTVF  348

Query  562  GGALLGYIIYDCTHYYLHHGKPLTG-VSQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY+IYD  HYYLH G P  G +  +LK +H+ HHF +Q  GFGIT+  WD +F
Sbjct  349  SGGLLGYVIYDMMHYYLHFGSPHKGSLLYNLKTYHVKHHFSHQKSGFGITSKLWDYLF  406



>ref|XP_008571004.1| PREDICTED: fatty acid 2-hydroxylase isoform X2 [Galeopterus variegatus]
Length=280

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/256 (36%), Positives = 142/256 (55%), Gaps = 23/256 (9%)
 Frame = +1

Query  28   ISPSSIVTGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEF  207
            + P+S             VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E 
Sbjct  14   VGPTSFTDERNGGPHKDLVDWKKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEA  71

Query  208  LTRTPWWAIPTIWLPVVWWFA------------------STSVNMGLPTPQlaisllasl  333
            L++T W+++P IW+P++ + +                  +T  ++ +P        +  +
Sbjct  72   LSKTVWYSVPIIWVPLMLYLSWSYYRILAQGNVRLFTSFTTEYSVVVPESVFPGLFMLGM  131

Query  334  aawtllEYTLHRFLFHVK--TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMP  507
              W+L+EY +HRFLFH+K  +  Y+  T H++MHG HHK P DG RLVFPP   ++++  
Sbjct  132  FLWSLVEYLIHRFLFHMKPPSDSYYLITLHFVMHGQHHKAPFDGSRLVFPPVPASLVIAF  191

Query  508  LWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRN  684
             + L++L+ P      +  G LLGY++YD THYYLH G P  G    ++K  H+ HHF +
Sbjct  192  FYVLLRLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFAH  251

Query  685  QDKGFGITNTFWDIVF  732
            Q  GFGI+   WD  F
Sbjct  252  QKSGFGISTKLWDHFF  267



>ref|XP_004387897.1| PREDICTED: fatty acid 2-hydroxylase [Trichechus manatus latirostris]
Length=302

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 137/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P++ 
Sbjct  54   VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIESLSKTVWYSVPIIWVPLML  111

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  L  W+L+EY +HRFLFH+K
Sbjct  112  YLSWSYYRTLAQGNVRLFTSFTTEYSVTVPESMFLGLFMIGLFLWSLIEYLIHRFLFHMK  171

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +   +    H++MHG HHK P DG RLVFPP   ++++   + L++L+ P      + 
Sbjct  172  PPSDSCYLIMLHFIMHGQHHKSPFDGSRLVFPPVPASLVIAFFYALLRLILPEAVGGTVF  231

Query  562  GGALLGYIIYDCTHYYLHHGKPLTG-VSQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    S+K +H+ HHF +Q  GFGI+   WD  F
Sbjct  232  AGGLLGYVLYDMTHYYLHFGSPHKGSFLYSMKAYHVKHHFAHQKSGFGISTKLWDYFF  289



>emb|CDQ73587.1| unnamed protein product [Oncorhynchus mykiss]
Length=269

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 133/233 (57%), Gaps = 21/233 (9%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL +QVGHLG+ YD WVH+P+      R F N FLE  T+T W+ +P +W+P+V+
Sbjct  27   VDWRKPLAWQVGHLGEKYDTWVHQPV--DRPIRLFGNEFLEASTKTSWYMVPAVWMPLVF  84

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK--  387
            +                FAST  ++ +      +  +  +  WT +EY +HRF+FH++  
Sbjct  85   YLSWYCYTTLALETTRLFASTDYSVLVHKYSFPLIFIMGMVMWTFIEYCIHRFVFHMRPP  144

Query  388  TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGG  567
               Y+  T H+++HG HHK P DG RLVFPP   ++++   + L+    P     ++  G
Sbjct  145  AHNYYLITIHFLLHGQHHKSPYDGSRLVFPPGLASVVVGSFYLLLTKAFPETLGVSLFVG  204

Query  568  ALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWD  723
             L GY++YD THYYLH+G P       SLK +H+ HHF +Q  GFGI+ T WD
Sbjct  205  GLFGYVVYDMTHYYLHYGSPQRNTYLYSLKAYHVKHHFEHQRAGFGISTTLWD  257



>gb|KFW77475.1| Fatty acid 2-hydroxylase, partial [Manacus vitellinus]
Length=251

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 138/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F +  LE L++T W+ +  +W PVV 
Sbjct  3    VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDILESLSKTAWYVVFLVWTPVVL  60

Query  262  ---WFASTSVNMG-------------LPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
               WF+ TS+  G             +P  +     +  L  +  +LLEY +HRF+FH+K
Sbjct  61   YLSWFSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMFLWSLLEYLIHRFVFHMK  120

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  121  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSVF  180

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD  F
Sbjct  181  VGGLCGYVIYDMMHYYLHYGSPRKGTYLYGLKAYHVKHHFEHQRSGFGISTRFWDYPF  238



>ref|XP_009071914.1| PREDICTED: fatty acid 2-hydroxylase, partial [Acanthisitta chloris]
Length=283

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 136/235 (58%), Gaps = 23/235 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F +  LEFL++T W+ +  +W PVV 
Sbjct  35   VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDILEFLSKTAWYVVFMVWTPVVL  92

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L  +  +LLEY +HRF+FH+K
Sbjct  93   YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMFLWSLLEYLIHRFVFHMK  152

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  153  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSVF  212

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWD  723
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD
Sbjct  213  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWD  267



>ref|XP_008309241.1| PREDICTED: fatty acid 2-hydroxylase [Cynoglossus semilaevis]
 ref|XP_008309242.1| PREDICTED: fatty acid 2-hydroxylase [Cynoglossus semilaevis]
 ref|XP_008309243.1| PREDICTED: fatty acid 2-hydroxylase [Cynoglossus semilaevis]
Length=382

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 132/237 (56%), Gaps = 21/237 (9%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL +QVGHLG+ YD WVH+P+      R F N FLE  T+T W+ +P +WLP+V+
Sbjct  140  VDWRKPLAWQVGHLGEKYDAWVHQPV--DRPIRLFGNPFLEASTKTSWYWVPVVWLPIVF  197

Query  262  WFA-STSVNMGLPTPQlaisllaslaawtll---------------EYTLHRFLFHVK--  387
            + + S  + +   T ++  +   S+                     EY +HRF+FH+K  
Sbjct  198  YLSWSCYMTLAQGTTRIVFTSDFSVLVHKYTFLLLFMMGWFLWSFMEYCIHRFVFHMKPP  257

Query  388  TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGG  567
               Y+  T H+++HG HHK P DG RLVFPP   ++M+   + +++   P I    +  G
Sbjct  258  AHNYYLITLHFLLHGQHHKSPFDGSRLVFPPGLASLMVGSFYAILQYAFPEIIGKCLFVG  317

Query  568  ALLGYIIYDCTHYYLHHGKPLTGVSQ-SLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
             L GY++YD  HYYLH+G P  G     LK +H+ HHF +Q  GFGIT TFWD  F 
Sbjct  318  GLCGYVVYDMIHYYLHYGSPKRGSYMYGLKAYHVKHHFEHQRAGFGITTTFWDHPFN  374



>gb|KFP06200.1| Fatty acid 2-hydroxylase, partial [Calypte anna]
Length=251

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 136/235 (58%), Gaps = 23/235 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F +  LEFL++T W+ +  +W PVV 
Sbjct  3    VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDILEFLSKTAWYVVFMVWAPVVL  60

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L  +  +LLEY +HRF+FH+K
Sbjct  61   YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMFLWSLLEYLIHRFVFHMK  120

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++L+ P +   ++ 
Sbjct  121  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIAFFYGVLQLMLPEVLGLSVF  180

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWD  723
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD
Sbjct  181  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKVYHVKHHFEHQKSGFGISTRFWD  235



>ref|XP_004437173.1| PREDICTED: fatty acid 2-hydroxylase [Ceratotherium simum simum]
Length=372

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 138/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F + F+E LT+T W+++P IW+P++ 
Sbjct  124  VDWRKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFQSDFIESLTKTVWYSVPIIWMPLIL  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  +  W+L+EY LHRFLFH+K
Sbjct  182  YLSWSYYRTLAQGNIRLFTSFTTEHSVAMPESVFPGLFVLGIFLWSLVEYLLHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H+++HG HHK P D  RLVFPP   ++++   + +++LL P      + 
Sbjct  242  PPSNSYYLITLHFVLHGQHHKAPFDESRLVFPPVPASLVIATFYVVLQLLLPEAVGGTVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    ++K  H+ HHF +Q  GFGI+   WD  F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPRKGSYLYNMKAHHVKHHFAHQKSGFGISTKLWDYFF  359



>ref|XP_002594272.1| hypothetical protein BRAFLDRAFT_65126 [Branchiostoma floridae]
 gb|EEN50283.1| hypothetical protein BRAFLDRAFT_65126 [Branchiostoma floridae]
Length=348

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 132/240 (55%), Gaps = 25/240 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESP-RFFANGFLEFLTRTPWWAIPTIWLPVV  258
            +D +KPL+ QVG LGD YDEWVH P+   E P R F++   EF +R PW+ +PT+WLP+V
Sbjct  106  IDWNKPLLGQVGQLGDLYDEWVHYPV---EKPYRLFSSEVCEFFSRCPWFLVPTLWLPLV  162

Query  259  WWFASTSV------------------NMGLPTPQlaisllaslaawtllEYTLHRFLFHV  384
             +FA TS+                      P     +   A +  WT  EY LHRFLFH 
Sbjct  163  VYFAFTSIVELRQGQVQVFTQTCSALKFTAPVSLFPVVFAAGVMLWTFWEYCLHRFLFHS  222

Query  385  K--TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAI  558
            K  T        H+++HG HHK P D  RLVFPP   ++ +   + L  LL P   V+A+
Sbjct  223  KAVTSSPGLIIAHFLLHGQHHKVPFDPGRLVFPPVPCSVFVTLFYVLYSLLLPRALVHAL  282

Query  559  LGGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            + G L GY+ YD THYYL HG P        LK +H  HHF +Q+ GFGI++ FWD  FG
Sbjct  283  VSGKLCGYVCYDLTHYYLLHGSPREDSYFHRLKSYHAKHHFVHQETGFGISSRFWDRPFG  342



>ref|XP_001743665.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ91243.1| predicted protein [Monosiga brevicollis MX1]
Length=223

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 126/213 (59%), Gaps = 7/213 (3%)
 Frame = +1

Query  109  QVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVV---WWFASTS  279
            QV  LG AY +WVH+P  S+ + R F   F EF   T WWAIP +WLP++    W A+ +
Sbjct  4    QVARLGPAYWDWVHRP-SSQRTFRMFRYDFFEFFAATSWWAIPVVWLPIIAFLMWRATGT  62

Query  280  VNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK-TRGYWANTFHYMMHGCHHKHPMD  456
                L    + +  +     WT LEY LHRFLFH+  ++ ++  TFH+++HG HHK P+D
Sbjct  63   A--ALSQASIIVWFMGGFLLWTFLEYMLHRFLFHILFSQSHFFITFHFLLHGQHHKFPLD  120

Query  457  GMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTG  636
              RLVFPP A  +M  P + L + L  +     ++ GALLGY+ YD  HYYLHHGKP   
Sbjct  121  KGRLVFPPVAGFMMASPFYLLFRSLLSAPTADTLMAGALLGYVSYDLIHYYLHHGKPTLA  180

Query  637  VSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
              Q LK +H  HH++  D G+GI++  WD  FG
Sbjct  181  YFQDLKDYHRRHHYKEPDLGYGISSKLWDYPFG  213



>ref|XP_005422872.1| PREDICTED: fatty acid 2-hydroxylase [Geospiza fortis]
Length=376

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 137/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLEFL++T W+ +  +W PVV 
Sbjct  128  VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLEFLSKTAWYVVFMVWTPVVL  185

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                FAS +    +P  +     +  L     +LLEY +HRF+FH+K
Sbjct  186  YLSWVSYTSLAQGNTRLFASFTTEYSIPVHKYYFPFIFLLGMILWSLLEYLIHRFVFHMK  245

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   +I 
Sbjct  246  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSIF  305

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             GAL GY+IYD  HY LH+G P  G     LK +H+ HHF +Q  GFGI+  FWD  F
Sbjct  306  VGALCGYVIYDMMHYSLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWDYPF  363



>ref|XP_009089101.1| PREDICTED: fatty acid 2-hydroxylase [Serinus canaria]
Length=370

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 138/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLEFL++T W+ +  +W PVV 
Sbjct  122  VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLEFLSKTAWYVVFMVWTPVVL  179

Query  262  ---WFASTSVNMG-------------LPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
               W + TS+  G             +P  +     +  L     +LLEY +HRF+FH+K
Sbjct  180  YLSWVSYTSLGQGNTRLFSSFTTEYSIPIHKYYFPFIFLLGMILWSLLEYLIHRFVFHMK  239

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  240  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSVF  299

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD  F
Sbjct  300  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWDYPF  357



>ref|XP_006860233.1| PREDICTED: fatty acid 2-hydroxylase [Chrysochloris asiatica]
Length=372

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 138/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P++     R F + F+E L++T W+++P IWLP+V 
Sbjct  124  VDWQKPLLWQVGHLGEKYDEWVHQPVI--RPIRLFHSDFIEALSKTVWYSVPLIWLPLVL  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +         +  +  W+L+EY +HRFLFH+K
Sbjct  182  YLSWSYYQTLAQSKVRLFMSFTTDYSVTMSESMFPGLFMLGMFLWSLIEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H++MHG HHK P DG RLVFPPA  ++++   + L +L+ P      + 
Sbjct  242  PPSNSYYLITLHFIMHGQHHKAPFDGSRLVFPPAPASMVIFFFYVLARLMLPEAVGGTLF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGV-SQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD  HYYLH G P  G    ++K  H+ HHF +Q  GFGI+   WD  F
Sbjct  302  AGGLLGYVLYDMMHYYLHFGSPHKGSFLYNMKAHHVKHHFTHQKSGFGISTRLWDYFF  359



>ref|XP_001959617.1| GF11951 [Drosophila ananassae]
 gb|EDV36439.1| GF11951 [Drosophila ananassae]
Length=348

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 137/227 (60%), Gaps = 17/227 (7%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESP-RFFANGFLEFLTRTPWWAIPTIWLPVV  258
            VD SK ++ Q+ ++ + YDEWVHKP+   + P R F   +LE LT+TPWW +P+ W+PV+
Sbjct  113  VDWSKAMLPQIANITENYDEWVHKPV---DRPLRLFGPWYLEMLTKTPWWLVPSFWIPVI  169

Query  259  WWFASTSVNMGLPTPQlaisllas----laawtllEYTLHRFLFHVKTR---GYWANTFH  417
               AS             + ++A     +  WT LEYTLHR++FHVK +   G W  TFH
Sbjct  170  LKCASEEFASSWQNKSQLVEVVAYFLFGVLLWTFLEYTLHRWVFHVKLKSNSGPWICTFH  229

Query  418  YMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVK--LLAPSIYVYAILGGALLGYIIY  591
            +M+HG HHK P D MRLVFPP   A++   ++  +   LL P I    +L GAL GY+ Y
Sbjct  230  FMIHGLHHKVPFDPMRLVFPPLPGAVLATIIYTPLSFMLLHPRI----VLSGALTGYLCY  285

Query  592  DCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
            D  HYYLH+G P T     +KR+H  HHF +Q  G+GI++  WD+VF
Sbjct  286  DLMHYYLHYGNPNTRAFVHMKRYHYHHHFSHQTLGYGISSPLWDVVF  332



>ref|XP_006878670.1| PREDICTED: fatty acid 2-hydroxylase [Elephantulus edwardii]
Length=372

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 138/239 (58%), Gaps = 23/239 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P++     R F + F+E L++T W+++P IW+P++ 
Sbjct  124  VDWKKPLLWQVGHLGEKYDEWVHQPVI--RPIRLFHSDFIESLSKTVWYSVPIIWVPLML  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +         +  +  W+L EY LHRFLFH+K
Sbjct  182  YLSWSYYQTLAQGNVRLFTSFTTEYSVTVRKSMFPGLFVLGMFLWSLAEYLLHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H+++HG HHK P DG RLVFPP   ++++   +GL++L+ P     +I 
Sbjct  242  PPSDSYYLITLHFVLHGQHHKAPFDGSRLVFPPVPASLLIAAFYGLLRLILPEAVGGSIF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGV-SQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
             G LLGY+ YD  HYYLH G P  G    ++K  H+ HHF +Q  GFGI+   WD  F 
Sbjct  302  AGGLLGYVFYDMIHYYLHFGSPHRGSFLYTMKAHHVKHHFVHQKSGFGISTKLWDYFFN  360



>emb|CAC20436.1| fatty acid hydroxylase [Homo sapiens]
 gb|AIC60677.1| FA2H, partial [synthetic construct]
 gb|AIC60678.1| FA2H, partial [synthetic construct]
Length=280

 Score =   166 bits (420),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 134/238 (56%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  32   VDWRKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEGLSKTVWYSVPIIWVPLVL  89

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T   + +P        +     W+L+EY +HRFLFH+K
Sbjct  90   YLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMK  149

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+    H++MHG HHK P DG RLVFPP   ++++   +  ++L+ P      + 
Sbjct  150  PPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVF  209

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    SLK  H+ HHF +Q  GFGI+   WD  F
Sbjct  210  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCF  267



>ref|XP_006908884.1| PREDICTED: fatty acid 2-hydroxylase [Pteropus alecto]
 gb|ELK15459.1| Fatty acid 2-hydroxylase [Pteropus alecto]
Length=372

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 139/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + F+E L++T W+++P IW+P++ 
Sbjct  124  VDWQKPLLWQVGYLGEKYDEWVHQPVT--RPIRLFYSDFVESLSKTAWYSVPVIWMPLML  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            +                    +T  ++ +P        +  +  W+L+EY +HRFLFH+K
Sbjct  182  YLGWSHYRTLAQGNVRLFATFTTEYSVAMPESVFPGLFILGMLLWSLIEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H+++HG HHK P D  RLVFPPA  ++++   + +++LL P      + 
Sbjct  242  PPSDSYYLITLHFILHGQHHKAPFDESRLVFPPAPASLVIAFFYAVLQLLLPEAVGGTVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    ++K  H+ HHF +Q  GFGI+  FWD  F
Sbjct  302  SGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFAHQKSGFGISTKFWDYFF  359



>ref|XP_008571003.1| PREDICTED: fatty acid 2-hydroxylase isoform X1 [Galeopterus variegatus]
Length=280

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 138/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P++ 
Sbjct  32   VDWKKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEALSKTVWYSVPIIWVPLML  89

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  +  W+L+EY +HRFLFH+K
Sbjct  90   YLSWSYYRILAQGNVRLFTSFTTEYSVVVPESVFPGLFMLGMFLWSLVEYLIHRFLFHMK  149

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H++MHG HHK P DG RLVFPP   ++++   + L++L+ P      + 
Sbjct  150  PPSDSYYLITLHFVMHGQHHKAPFDGSRLVFPPVPASLVIAFFYVLLRLILPEAVGGTVF  209

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    ++K  H+ HHF +Q  GFGI+   WD  F
Sbjct  210  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFAHQKSGFGISTKLWDHFF  267



>gb|EPQ05505.1| WD repeat-containing protein 59 [Myotis brandtii]
Length=1380

 Score =   176 bits (445),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 139/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82    VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
             VD  KPL++QVGHLG+ YDEWVH+P+      R F + F+E LT+T W+++P IW+P++ 
Sbjct  1132  VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFYSDFIEALTKTVWYSVPVIWMPLML  1189

Query  262   WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
             + +                  +T  ++ +P        +  +  W+L EY LHRFLFH+K
Sbjct  1190  YLSWSHYRTLAQGDVRLFASFTTEYSVAMPKSMFPGLFVLGMLLWSLTEYLLHRFLFHMK  1249

Query  388   --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
               +  Y+  T H++MHG HHK P D  RLVFPPA  ++++   +  ++LL P      + 
Sbjct  1250  PPSNSYYLITLHFIMHGQHHKAPFDESRLVFPPAPASLVIAFFYTALQLLLPEAVGGTVF  1309

Query  562   GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
              G LLGY++YD THYYLH G P  G    S+K  H+ HHF +Q  GFGI+  FWD +F
Sbjct  1310  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYSMKAHHVKHHFAHQKSGFGISTKFWDYIF  1367



>gb|KFQ11883.1| Fatty acid 2-hydroxylase, partial [Leptosomus discolor]
Length=288

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 136/235 (58%), Gaps = 23/235 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLE L++T W+ +  +W PVV 
Sbjct  40   VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLESLSKTAWYVVFLVWAPVVL  97

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L  +  +LLEY +HRF+FH+K
Sbjct  98   YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMFLWSLLEYLIHRFVFHMK  157

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  158  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSVF  217

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWD  723
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD
Sbjct  218  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWD  272



>ref|XP_005446869.1| PREDICTED: fatty acid 2-hydroxylase, partial [Falco cherrug]
Length=300

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/235 (40%), Positives = 136/235 (58%), Gaps = 23/235 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLE L++T W+ +  +W PVV 
Sbjct  52   VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLESLSKTAWYVVFIVWAPVVL  109

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L  +  +LLEY +HRF+FH+K
Sbjct  110  YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYFFPFIFLLGMFLWSLLEYLIHRFVFHMK  169

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  170  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSVF  229

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWD  723
             G L GYIIYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD
Sbjct  230  VGGLCGYIIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKAGFGISTRFWD  284



>ref|XP_003939962.1| PREDICTED: fatty acid 2-hydroxylase [Saimiri boliviensis boliviensis]
Length=372

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 136/238 (57%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F + F+E L++T W+++P IW+P+V 
Sbjct  124  VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFQSDFIEGLSKTVWYSVPVIWMPLVL  181

Query  262  W--------FASTSVNM----------GLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            +        FA  +V +           +P        +  +  W+L+EY +HRFLFH+K
Sbjct  182  YLSWSYYRTFAQGNVQLFASFTTEHAVAVPKSMFPGLFMLGIFLWSLIEYVIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+    H++MHG HHK P DG RLVFPP   ++ +   +  ++L+ P      + 
Sbjct  242  PPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLAIGVFYVCLRLILPEAVGGTLF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    SLK  H+ HHF +Q  GFGI+   WD  F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPPKGSYLYSLKAHHVKHHFAHQMSGFGISTKLWDYCF  359



>gb|KFM02737.1| Fatty acid 2-hydroxylase, partial [Aptenodytes forsteri]
Length=288

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 136/235 (58%), Gaps = 23/235 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLE L++T W+ +  +W PVV 
Sbjct  40   VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLESLSKTAWYVVFMVWAPVVL  97

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L  +  +LLEY +HRF+FH+K
Sbjct  98   YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMFLWSLLEYLIHRFVFHMK  157

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  158  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLQLLLPEVLGLSVF  217

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWD  723
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD
Sbjct  218  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWD  272



>ref|XP_003967047.1| PREDICTED: fatty acid 2-hydroxylase-like, partial [Takifugu rubripes]
Length=245

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 133/237 (56%), Gaps = 21/237 (9%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVV-  258
            VD  KPL +QVGHLG+ YD WVH+P+      R F N FLE  T+T W+ +P +WLP+V 
Sbjct  3    VDWQKPLAWQVGHLGEKYDAWVHQPV--DRPIRLFGNPFLEAGTKTSWYWVPVVWLPIVF  60

Query  259  ---WWFAST----------SVNMGLPTPQlaisllasl--aawtllEYTLHRFLFHVK--  387
               W   ST          + ++ +P  +     L  +    W+ +EY +HRF+FH+K  
Sbjct  61   FLSWHCYSTLAQGTTRVVLTSDLSIPVHKYLFLPLFLMGWFLWSFIEYCIHRFVFHMKPP  120

Query  388  TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGG  567
               Y+  T H+++HG HHK P DG RLVFPP   ++++   + ++    P I    +  G
Sbjct  121  AHNYYLITLHFLLHGQHHKSPFDGSRLVFPPGLASLVVGSFYVVLSNTLPDIVGICVFVG  180

Query  568  ALLGYIIYDCTHYYLHHGKPLTGVSQ-SLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
             L GY++YD  HYYLH+G P  G    SLK +H+ HHF +Q  GFGIT  FWD  F 
Sbjct  181  GLCGYVVYDMIHYYLHYGSPKRGSYMYSLKAYHVKHHFEHQRAGFGITTKFWDRPFN  237



>ref|XP_009949957.1| PREDICTED: fatty acid 2-hydroxylase [Leptosomus discolor]
Length=306

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 136/235 (58%), Gaps = 23/235 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLE L++T W+ +  +W PVV 
Sbjct  58   VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLESLSKTAWYVVFLVWAPVVL  115

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L  +  +LLEY +HRF+FH+K
Sbjct  116  YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMFLWSLLEYLIHRFVFHMK  175

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  176  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSVF  235

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWD  723
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD
Sbjct  236  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWD  290



>ref|XP_002826686.2| PREDICTED: fatty acid 2-hydroxylase [Pongo abelii]
Length=298

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 133/238 (56%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  50   VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEGLSKTVWYSVPIIWVPLVL  107

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T   + +P        +     W+L+EY +HRFLFH+K
Sbjct  108  YLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMK  167

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+    H++MHG HHK P DG RLVFPP   ++++   +  ++L+ P      + 
Sbjct  168  PPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVF  227

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G     LK  H+ HHF +Q  GFGI+   WD  F
Sbjct  228  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYKLKAHHVKHHFAHQKSGFGISTKLWDYCF  285



>ref|XP_005313561.1| PREDICTED: fatty acid 2-hydroxylase [Chrysemys picta bellii]
Length=373

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 138/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F + F+E L++T W+ +  +W+PVV 
Sbjct  125  VDWHKPLLWQVGHLGEKYDEWVHQPV--DRPIRLFHSDFIESLSKTAWYIVIMVWIPVVL  182

Query  262  ---WFASTSVNMG-------------LPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
               WF   S+  G             +P  +     +  L  +  +L+EY +HRFLFH+K
Sbjct  183  YLSWFCYASLAQGTTRLFSSFTAEYSIPVHKYFFPFIFVLGMFLWSLVEYLIHRFLFHMK  242

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   + L++LL P     ++ 
Sbjct  243  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYTLLRLLLPEAVGMSMF  302

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G L GY++YD THYYLH+G P  G     LK +H+ HHF +Q  GFGIT+ FWD  F
Sbjct  303  VGGLFGYVVYDMTHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGITSRFWDRPF  360



>ref|XP_004070153.1| PREDICTED: fatty acid 2-hydroxylase-like [Oryzias latipes]
Length=381

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 137/255 (54%), Gaps = 23/255 (9%)
 Frame = +1

Query  28   ISPSSIVTGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEF  207
            ISP S  +   +      VD  KPL +QVGHLG+ YD WVH+P+      R F N  LE 
Sbjct  123  ISPFSKCSPVDLDKD--LVDWRKPLAWQVGHLGEKYDAWVHQPV--DRPIRLFGNPLLEA  178

Query  208  LTRTPWWAIPTIWLPVVW---WFASTSVNMGLPTPQlaisllaslaawtl----------  348
             T+T W+ +P +WLP+V+   W   T++  G  +  +       +  ++           
Sbjct  179  GTKTSWYWVPVVWLPIVFYVSWHCYTTMAQGTSSVHITSDFSIPIHKYSFPVFFLMGWFL  238

Query  349  ---lEYTLHRFLFHVK--TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLW  513
               +EY +HRF+FH+K     Y+  T H+++HG HHK P DG RLVFPP   +I++   +
Sbjct  239  WSFIEYCIHRFVFHMKPPAHNYYLITLHFLLHGQHHKSPFDGARLVFPPGLASIVVGVFY  298

Query  514  GLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQD  690
              +  L P I   ++  G L GY++YD  HYYLH+G P  G     LK +H+ HHF +Q 
Sbjct  299  MTLHQLLPDIIGLSVFVGGLCGYVVYDMIHYYLHYGSPKKGSYLYDLKAYHVKHHFEHQR  358

Query  691  KGFGITNTFWDIVFG  735
             GFGIT TFWD  F 
Sbjct  359  SGFGITTTFWDHPFN  373



>ref|XP_008917941.1| PREDICTED: fatty acid 2-hydroxylase [Manacus vitellinus]
Length=338

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 138/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F +  LE L++T W+ +  +W PVV 
Sbjct  90   VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDILESLSKTAWYVVFLVWTPVVL  147

Query  262  ---WFASTSVNMG-------------LPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
               WF+ TS+  G             +P  +     +  L  +  +LLEY +HRF+FH+K
Sbjct  148  YLSWFSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMFLWSLLEYLIHRFVFHMK  207

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  208  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSVF  267

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD  F
Sbjct  268  VGGLCGYVIYDMMHYYLHYGSPRKGTYLYGLKAYHVKHHFEHQRSGFGISTRFWDYPF  325



>ref|XP_008498942.1| PREDICTED: fatty acid 2-hydroxylase [Calypte anna]
Length=299

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 136/235 (58%), Gaps = 23/235 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F +  LEFL++T W+ +  +W PVV 
Sbjct  51   VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDILEFLSKTAWYVVFMVWAPVVL  108

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L  +  +LLEY +HRF+FH+K
Sbjct  109  YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMFLWSLLEYLIHRFVFHMK  168

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++L+ P +   ++ 
Sbjct  169  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIAFFYGVLQLMLPEVLGLSVF  228

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWD  723
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD
Sbjct  229  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKVYHVKHHFEHQKSGFGISTRFWD  283



>ref|XP_008821193.1| PREDICTED: fatty acid 2-hydroxylase isoform X2 [Nannospalax galili]
Length=372

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 137/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  124  VDWQKPLLWQVGYLGEKYDEWVHQPVT--RPIRLFHSDLIEALSKTVWYSVPIIWVPLVM  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  +  W+L+EY +HRFLFH+K
Sbjct  182  YLSWSYYQTLARDNIRLFTSFTTEYSVAVPESVFPGLFVLGIFLWSLIEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+    H++MHG HHK P DG RLVFPP   ++M+   + L++L+ P      + 
Sbjct  242  PPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLMIAFFYVLLRLILPEAVGGTVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    S+K  H+ HHF +Q  GFGI+   WD  F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYSMKAHHVKHHFEHQKSGFGISTKLWDYFF  359



>ref|XP_009289134.1| PREDICTED: fatty acid 2-hydroxylase [Aptenodytes forsteri]
Length=295

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 136/235 (58%), Gaps = 23/235 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLE L++T W+ +  +W PVV 
Sbjct  47   VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLESLSKTAWYVVFMVWAPVVL  104

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L  +  +LLEY +HRF+FH+K
Sbjct  105  YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMFLWSLLEYLIHRFVFHMK  164

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  165  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLQLLLPEVLGLSVF  224

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWD  723
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD
Sbjct  225  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWD  279



>ref|XP_005233698.1| PREDICTED: fatty acid 2-hydroxylase, partial [Falco peregrinus]
Length=312

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/235 (40%), Positives = 136/235 (58%), Gaps = 23/235 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLE L++T W+ +  +W PVV 
Sbjct  64   VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLESLSKTAWYVVFIVWAPVVL  121

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L  +  +LLEY +HRF+FH+K
Sbjct  122  YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYFFPFIFLLGMFLWSLLEYLIHRFVFHMK  181

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  182  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSVF  241

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWD  723
             G L GYIIYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD
Sbjct  242  VGGLCGYIIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKAGFGISTRFWD  296



>ref|XP_010749537.1| PREDICTED: fatty acid 2-hydroxylase [Larimichthys crocea]
Length=337

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/233 (40%), Positives = 136/233 (58%), Gaps = 21/233 (9%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL +QVGHLG+ YD WVH+P+      R F N  LE  T+T W+ +P +WLP+V+
Sbjct  95   VDWRKPLAWQVGHLGEKYDAWVHQPV--DRPIRLFGNPLLEAGTKTSWYWVPVVWLPIVF  152

Query  262  WFA----------STSV----NMGLPTPQlaisllasl--aawtllEYTLHRFLFHVK--  387
            +F+          +T +    +  +P  +     L  L    W+ +EY +HRF+FH+K  
Sbjct  153  YFSWHCYTTLAEGTTRIVLTSDFSIPVHKSIFPFLFLLGWFLWSFIEYCIHRFVFHMKPP  212

Query  388  TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGG  567
               Y+  T H+++HG HHK P DG RLVFPP   ++++   + +++   P I    +  G
Sbjct  213  AHNYYLITLHFLLHGQHHKSPFDGSRLVFPPGLASLVVGSFYIILRQTLPDILGICVFVG  272

Query  568  ALLGYIIYDCTHYYLHHGKPLTGVSQ-SLKRFHMDHHFRNQDKGFGITNTFWD  723
             L GY++YD  HYYLH+G P  G    +LK +H+ HHF++Q  GFGIT TFWD
Sbjct  273  GLCGYVVYDMIHYYLHYGSPKRGSYMYNLKAYHVKHHFKHQRSGFGITTTFWD  325



>ref|XP_005073102.1| PREDICTED: fatty acid 2-hydroxylase [Mesocricetus auratus]
Length=372

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 137/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  124  VDWQKPLLWQVGHLGEKYDEWVHQPVA--RPIRLFHSDLIEALSKTVWYSVPIIWVPLVL  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P    A   +  +  WTL+EY +HRFLFH+K
Sbjct  182  YLSWSYYRTLSQDNIRLFASFTTDYSVAVPKSMFAGLFVLGMLIWTLVEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  ++    H++MHG HHK P DG RLVFPP   ++++   + L++L+ P      I 
Sbjct  242  PPSDSHYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIAFFYVLLRLILPEAVAGIIF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    ++K  H+ HHF  Q  GFGI+   WD  F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFEYQKSGFGISTKLWDYFF  359



>gb|KFO82826.1| Fatty acid 2-hydroxylase, partial [Cuculus canorus]
Length=288

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 143/256 (56%), Gaps = 24/256 (9%)
 Frame = +1

Query  31   SPSSIVTGAK-MAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEF  207
            +PS +    K +  +   VD  KPL++QVG+LG+ YDEWVH+P+      R F +  LE 
Sbjct  22   TPSRVDPPCKTVDEEKDLVDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDILES  79

Query  208  LTRTPWWAIPTIWLPVVWW----------------FASTSVNMGLPTPQlaisllaslaa  339
            L++T W+ +  +W PVV +                F+S +    +P  +     +  L  
Sbjct  80   LSKTAWYVVFMVWTPVVLYLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGM  139

Query  340  w--tllEYTLHRFLFHVK--TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMP  507
            +  +LLEY +HRF+FH+K     Y+  T H+++HG HHK P D  RLVFPP   ++++  
Sbjct  140  FLWSLLEYLIHRFVFHMKPPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGF  199

Query  508  LWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRN  684
             +G+++LL P +   ++  G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +
Sbjct  200  FYGVLQLLLPEVLGLSVFVGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEH  259

Query  685  QDKGFGITNTFWDIVF  732
            Q  GFGI+  FWD  F
Sbjct  260  QKSGFGISTRFWDRPF  275



>ref|XP_010882343.1| PREDICTED: fatty acid 2-hydroxylase [Esox lucius]
Length=369

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 139/254 (55%), Gaps = 21/254 (8%)
 Frame = +1

Query  31   SPSSIVTGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFL  210
             PS +   +++      VD  KPL +QVGHLG+ YD WVH+P+      R F N FLE  
Sbjct  110  EPSPLSKCSQVNLDTDLVDWRKPLAWQVGHLGEKYDTWVHQPV--DRPIRLFGNYFLEAS  167

Query  211  TRTPWWAIPTIWLPVV----WW------------FASTSVNMGLPTPQlaisllaslaaw  342
            T+T W+ +P +W+P+V    W+            FA+T  ++ +         L  +  W
Sbjct  168  TKTSWYMVPVVWIPLVIYLSWYSYTTLGQETTRLFANTDYSILVHKYSFPFIFLMGMIMW  227

Query  343  tllEYTLHRFLFHVK--TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWG  516
            T LEY +HRF+FH++     Y+  T H+++HG HHK P DG RLVFPP   ++ +  L+ 
Sbjct  228  TFLEYCIHRFVFHMRPPAHNYYLITIHFLLHGQHHKSPYDGSRLVFPPGLASVAIGGLYL  287

Query  517  LVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKP-LTGVSQSLKRFHMDHHFRNQDK  693
            L+  + P     ++  G L GY++YD  HYYLH+G P       SLK +H+ HHF +Q  
Sbjct  288  LLTKIFPETLGVSLFVGGLFGYVVYDMIHYYLHYGSPKRNSYLYSLKAYHVKHHFEHQRA  347

Query  694  GFGITNTFWDIVFG  735
            GFGIT T WD  F 
Sbjct  348  GFGITTTLWDRPFN  361



>gb|KFP19638.1| Fatty acid 2-hydroxylase, partial [Egretta garzetta]
Length=280

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/253 (38%), Positives = 142/253 (56%), Gaps = 30/253 (12%)
 Frame = +1

Query  49   TGAKMAAQGFTVDLSK-------PLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEF  207
            T A+M  +  TVD+ K       PL++QVG+LG+ YDEWVH+P+      R F +  LE 
Sbjct  22   TPARMDPRCKTVDVEKDLVDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDLLES  79

Query  208  LTRTPWWAIPTIWLPVVWW----------------FASTSVNMGLPTPQlaisllaslaa  339
            L++T W+ +  +W PVV +                F+S +    +P  +     +  L  
Sbjct  80   LSKTAWYVVFMVWAPVVLYLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGM  139

Query  340  w--tllEYTLHRFLFHVK--TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMP  507
            +  +LLEY +HRF+FH+K     Y+  T H+++HG HHK P D  RLVFPP   ++++  
Sbjct  140  FLWSLLEYLIHRFVFHMKPPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGF  199

Query  508  LWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRN  684
             +G+++LL P +   ++  G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +
Sbjct  200  FYGVLQLLLPEVLGLSVFVGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEH  259

Query  685  QDKGFGITNTFWD  723
            Q  GFGI+  FWD
Sbjct  260  QKSGFGISTRFWD  272



>ref|XP_007463004.1| PREDICTED: fatty acid 2-hydroxylase [Lipotes vexillifer]
Length=372

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 135/238 (57%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P++ 
Sbjct  124  VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEALSKTVWYSVPIIWVPLML  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  L  W+L+EY +HRFLFH+K
Sbjct  182  YLSWSYYRTLAQGNVRLFTSFTTEYSVAMPESTFPGLFMLGLLLWSLVEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+    H++MHG HHK P D  RLVFPP   ++++   + L++L+ P      + 
Sbjct  242  PPNNSYYLIMLHFIMHGQHHKAPFDESRLVFPPVPASLVIAFFYALLRLILPEAVGGTVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY+IYD  HYYLH G P  G    +LK  H+ HHF +Q  GFGI+  FWD  F
Sbjct  302  AGGLLGYVIYDMIHYYLHFGSPHKGSYLYNLKAHHVKHHFAHQQSGFGISTKFWDHFF  359



>gb|ERE78277.1| fatty acid 2-hydroxylase-like protein [Cricetulus griseus]
Length=372

 Score =   166 bits (419),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 138/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  124  VDWRKPLLWQVGHLGEKYDEWVHQPVA--RPIRLFHSDLIEALSKTVWYSVPIIWVPLVL  181

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                FAS + +  +  P+   + L  L     TL+EY +HRFLFH+K
Sbjct  182  YLSWSYYRTLSQDNTRLFASFTTDYSVVVPKSMFAGLFVLGMLFWTLMEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  ++    H++MHG HHK P DG RLVFPP   ++++   + L++L+ P +    I 
Sbjct  242  PPSDSHYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIAFFYVLLRLVLPEVVAGIIF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    ++K  H+ HHF  Q  GFGI+   WD  F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFEYQKSGFGISTKLWDYFF  359



>ref|XP_003829573.1| PREDICTED: fatty acid 2-hydroxylase [Pan paniscus]
Length=372

 Score =   166 bits (419),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 134/238 (56%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  124  VDWRKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEGLSKTVWYSVPIIWVPLVL  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T   + +P        +     W+L+EY +HRFLFH+K
Sbjct  182  YLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+    H++MHG HHK P DG RLVFPP   ++++   +  ++L+ P      + 
Sbjct  242  PPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    SLK  H+ HHF +Q  GFGI+   WD  F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCF  359



>ref|XP_005318484.1| PREDICTED: fatty acid 2-hydroxylase [Ictidomys tridecemlineatus]
Length=372

 Score =   166 bits (419),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 137/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F + F+E L++T W+ +P IW+P++ 
Sbjct  124  VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDFVEALSKTAWYCVPIIWVPLML  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  +  W+L+EY +HRFLFH+K
Sbjct  182  YLSWSYYQTLAQGNVRLFTSFTTEYSVAVPESVFPGLFVLGIFLWSLIEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H++MHG HHK P DG RLVFPP   ++++   + +++L+ P      + 
Sbjct  242  PPSNSYYLITLHFVMHGQHHKAPFDGSRLVFPPVPASLVVAFFYLVLRLILPEAVGGTLF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGYI+YD THYYLH G P  G     +K  H+ HHF +Q  GFGI+   WD  F
Sbjct  302  VGGLLGYIVYDMTHYYLHFGSPHKGSYLYRMKAHHVKHHFAHQKSGFGISTKLWDYFF  359



>ref|XP_010716352.1| PREDICTED: fatty acid 2-hydroxylase, partial [Meleagris gallopavo]
Length=303

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 136/235 (58%), Gaps = 23/235 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + F+E L++T W+ +  +W PVV 
Sbjct  55   VDWRKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFVEALSKTAWYVVFLVWTPVVL  112

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                F+S +    +P  +     +  L  +  +LLEY +HRF+FH+K
Sbjct  113  YLSWVSYTALAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMFLWSLLEYLIHRFVFHMK  172

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  173  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIAFFYGVLRLLLPEVLGLSVF  232

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWD  723
             G L GY++YD  HYYLH+G P  G     LK +H+ HHF +Q  GFGIT  FWD
Sbjct  233  VGGLCGYVVYDMMHYYLHYGSPKEGTYLYGLKAYHVKHHFEHQKSGFGITTRFWD  287



>ref|XP_002711768.1| PREDICTED: fatty acid 2-hydroxylase [Oryctolagus cuniculus]
Length=372

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 137/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P++ 
Sbjct  124  VDWKKPLLWQVGHLGEKYDEWVHQPVA--RPIRLFHSDLIEALSKTVWYSVPIIWVPLML  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  +  W+L+EY +HRFLFH+K
Sbjct  182  YLSWSYYQALARGNVRLFTSFTTEYSVAVPESAFPGLFVLGMFLWSLIEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y   T H+++HG HHK P DG RLVFPP   ++++   + L++L+ P      + 
Sbjct  242  PPSDSYCLITLHFVLHGQHHKAPFDGSRLVFPPVPASLVIAFFYVLLRLILPEAVGGTMF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    S+K  H+ HHF +Q  GFGI+   WD  F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPNKGSYLYSMKAHHVKHHFAHQKSGFGISTKLWDYFF  359



>gb|EHH60563.1| Fatty acid 2-hydroxylase, partial [Macaca fascicularis]
Length=283

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 134/238 (56%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  35   VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEGLSKTVWYSVPIIWVPLVL  92

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T   + +P        +  +  W+L+EY +HRFLFH+K
Sbjct  93   YLSWSYYRTFAQGNVRLFTSFTTEYALAVPKSMFPGLFMLGIFLWSLIEYLIHRFLFHMK  152

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+    H++MHG HHK P DG RLVFPP   ++++   +  ++L+ P        
Sbjct  153  PPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCLQLILPEAVGGPAF  212

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    +LK  H+ HHF +Q  GFGI+   WD  F
Sbjct  213  AGGLLGYVLYDMTHYYLHFGSPHRGSYLYNLKAHHVKHHFAHQKSGFGISTKLWDYCF  270



>ref|NP_077282.3| fatty acid 2-hydroxylase [Homo sapiens]
 sp|Q7L5A8.1|FA2H_HUMAN RecName: Full=Fatty acid 2-hydroxylase; AltName: Full=Fatty acid 
alpha-hydroxylase [Homo sapiens]
 gb|AAH02679.2| Fatty acid 2-hydroxylase [Homo sapiens]
 gb|AAH17049.2| Fatty acid 2-hydroxylase [Homo sapiens]
 gb|AAH04263.2| Fatty acid 2-hydroxylase [Homo sapiens]
 gb|EAW95678.1| fatty acid 2-hydroxylase, isoform CRA_b [Homo sapiens]
Length=372

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 134/238 (56%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  124  VDWRKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEGLSKTVWYSVPIIWVPLVL  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T   + +P        +     W+L+EY +HRFLFH+K
Sbjct  182  YLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+    H++MHG HHK P DG RLVFPP   ++++   +  ++L+ P      + 
Sbjct  242  PPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    SLK  H+ HHF +Q  GFGI+   WD  F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCF  359



>gb|EHH31847.1| Fatty acid 2-hydroxylase, partial [Macaca mulatta]
Length=331

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 135/238 (57%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  83   VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEGLSKTVWYSVPIIWVPLVL  140

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T   + +P        +  +  W+L+EY +HRFLFH+K
Sbjct  141  YLSWSYYRTFAQGNVRLFTSFTTEYALAVPKSMFPGLFMLGIFLWSLIEYLIHRFLFHMK  200

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+    H++MHG HHK P DG RLVFPP   ++++   +  ++L+ P      + 
Sbjct  201  PPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCLQLILPEAVGGTVF  260

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    +LK  H+ HHF +Q  GFGI+   WD  F
Sbjct  261  AGGLLGYVLYDMTHYYLHFGSPHRGSYLYNLKAHHVKHHFAHQKSGFGISTKLWDYCF  318



>emb|CDQ59509.1| unnamed protein product [Oncorhynchus mykiss]
Length=333

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/252 (37%), Positives = 136/252 (54%), Gaps = 21/252 (8%)
 Frame = +1

Query  37   SSIVTGAKMAAQGFTVDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTR  216
            S+I     M      VD  KPL +QVG+LG+ Y+ WVH+P+      R F N F+E  T+
Sbjct  49   STIAKSYSMHGSVDLVDWRKPLAWQVGNLGEKYETWVHQPV--NRPIRLFGNEFMEASTK  106

Query  217  TPWWAIPTIWLPVVWW----------------FASTSVNMGLPTPQlaisllaslaawtl  348
            T W+ +P +W+P+V++                FAST  +  +      +  +  +  WT 
Sbjct  107  TSWYMVPAVWMPLVFYLSWYCYTTLAQETTRLFASTDYSFLVHKYSFPLIFVMGMVTWTF  166

Query  349  lEYTLHRFLFHVK--TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLV  522
            +EY +HRF+FH++     Y+  T H+++HG HHK P DG RLVFPP   ++++   + L+
Sbjct  167  IEYCVHRFIFHMRPPAHNYYLITIHFLLHGQHHKSPYDGSRLVFPPCLASVVIGSFYLLL  226

Query  523  KLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPL-TGVSQSLKRFHMDHHFRNQDKGF  699
                P     ++  G L GY++YD  HYYLH+G P       SLK +H+ HHF NQ  GF
Sbjct  227  TKSFPEALGVSLFVGGLFGYVVYDMIHYYLHYGSPQKNSYLYSLKAYHVKHHFENQRAGF  286

Query  700  GITNTFWDIVFG  735
            GI+ T WD  F 
Sbjct  287  GISTTLWDYPFN  298



>ref|XP_006152802.1| PREDICTED: fatty acid 2-hydroxylase [Tupaia chinensis]
Length=377

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 140/238 (59%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P +W+P++ 
Sbjct  129  VDWKKPLLWQVGHLGEKYDEWVHQPVTRPI--RLFHSDLIEALSKTVWYSVPIVWMPLML  186

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  L  W+L+EY +HRFLFH+K
Sbjct  187  YLSWSYYRTLAQGNVRLFTSFTTEYSVVVPESVFPGLFMLGLLLWSLVEYLIHRFLFHMK  246

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H++MHG HHK P D  RLVFPP   ++++   + L++L+ P     ++ 
Sbjct  247  PPSDSYYLITLHFIMHGQHHKAPFDDSRLVFPPVPASLVIATFYVLLRLILPEAVGGSLF  306

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGYI+YD THYYLH G P  G    ++K  H+ HHF +Q  GFGI++ FWD  F
Sbjct  307  AGGLLGYILYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFTHQKSGFGISSKFWDYFF  364



>ref|NP_001082707.1| fatty acid 2-hydroxylase [Xenopus laevis]
 gb|AAH84384.1| LOC398669 protein [Xenopus laevis]
Length=369

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 137/239 (57%), Gaps = 23/239 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHL + YDEWVH+PI      R F + F+E  ++T W+ + ++W+PVV 
Sbjct  122  VDWEKPLLWQVGHLREKYDEWVHQPI--NRPIRLFHSDFVESCSKTAWYIVLSVWVPVVL  179

Query  262  ---WFASTSVNMG---------------LPTPQlaisllaslaawtllEYTLHRFLFHVK  387
               W+  T +  G               +P        L  +  WTL+EY +HRF+FH+ 
Sbjct  180  YLSWYCLTELAQGNTRIFSSFTKDYSVPVPVFFFFPLFLIGVLIWTLMEYAIHRFVFHMN  239

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+M+HG HHK P D  RLVFPP   + +++PL+ LV+L+ P     +I 
Sbjct  240  PPASNYYLITLHFMLHGQHHKAPFDSSRLVFPPVPASFVIIPLYILVQLIFPIPVGLSIF  299

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVSQS-LKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
             G L GY+ YD THYYLH+G P  G   + LK +H+ HHF +Q  GFGIT+T WD  F 
Sbjct  300  VGGLFGYVAYDMTHYYLHYGSPSKGSYLAWLKSYHVRHHFEHQKSGFGITSTLWDRPFN  358



>ref|XP_003735373.1| PREDICTED: LOW QUALITY PROTEIN: fatty acid 2-hydroxylase [Callithrix 
jacchus]
Length=372

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 136/238 (57%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  124  VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFQSDLIEGLSKTVWYSVPVIWVPLVL  181

Query  262  W----------------FASTSVNMGLPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
            +                FAS +    +  P+     L  L  +  +L+EY +HRFLFH+K
Sbjct  182  YLSWSYYRTFAQGNVRLFASFTTEHAVAVPKSMFPGLFMLGIFLWSLIEYCIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H++MHG HHK P DG RLVFPP   ++ +   +  ++L+ P      + 
Sbjct  242  PPSDSYYLITLHFVMHGQHHKAPFDGSRLVFPPVPASLAIGVFYVCLQLILPEAVGGTLF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    ++K  H+ HHF +Q  GFGI+   WD  F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPPKGSYLYNMKAHHVKHHFAHQMSGFGISTKLWDYCF  359



>dbj|BAG37893.1| unnamed protein product [Homo sapiens]
Length=280

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 133/238 (56%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  32   VDWRKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEGLSKTVWYSVPIIWVPLVL  89

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T   + +P        +     W+L+EY +HRFLFH+K
Sbjct  90   YLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMK  149

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+    H++MH  HHK P DG RLVFPP   ++++   +  ++L+ P      + 
Sbjct  150  PPSDSYYLIMLHFVMHVQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVF  209

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    SLK  H+ HHF +Q  GFGI+   WD  F
Sbjct  210  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCF  267



>ref|XP_004517443.1| PREDICTED: fatty acid 2-hydroxylase-like isoform X6 [Ceratitis 
capitata]
Length=403

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 132/234 (56%), Gaps = 26/234 (11%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESP-RFFANGFLEFLTRTPWWAIPTIWLPVV  258
            VD SK +  Q+ H+   YDEWVHKP+   + P R F   +LE  T+TPWW  P  W+PV+
Sbjct  163  VDWSKAMCPQIAHITRHYDEWVHKPV---DRPLRLFGPTYLEIFTKTPWWVTPLFWIPVI  219

Query  259  ----W------WFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGY---  399
                W      W  S+   + L    L       +  W+LLEY LHRF+FH+K       
Sbjct  220  SKCLWDEFSPLWHTSSLSMLTL----LFAYFAVGIVFWSLLEYVLHRFVFHMKINANTNP  275

Query  400  WANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLG  579
            W  TFH+M+HG HHK P D MRLVFPP    I+   ++  +  L P   +  +L GAL G
Sbjct  276  WLCTFHFMIHGLHHKVPFDSMRLVFPPLPGVIIASIIYAPLSFLLPHPRI--VLAGALFG  333

Query  580  YIIYDCTHYYLHHGKPL---TGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
            Y+ YD  HYYLH+G P    T    ++KR+H  HHF +QD G+GI++ FWDIVF
Sbjct  334  YLCYDLMHYYLHYGNPSIEHTNFMYNMKRYHYQHHFAHQDMGYGISSPFWDIVF  387



>ref|XP_007991822.1| PREDICTED: fatty acid 2-hydroxylase isoform X1 [Chlorocebus sabaeus]
Length=372

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 134/238 (56%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  124  VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEGLSKTVWYSVPIIWVPLVL  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T   + +P        +  +  W+L+EY +HRFLFH+K
Sbjct  182  YLSWSYYRTFAQGNVRLFTSFTTEYALAVPKSMFPGLFMLGIFLWSLIEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+    H++MHG HHK P DG RLVFPP   ++++   +  ++L+ P      + 
Sbjct  242  PPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCLQLILPEAVGGTVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G     LK  H+ HHF +Q  GFGI+   WD  F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPHRGSYLYKLKAHHVKHHFAHQKSGFGISTKLWDYCF  359



>ref|XP_003126916.2| PREDICTED: fatty acid 2-hydroxylase [Sus scrofa]
Length=372

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/238 (38%), Positives = 137/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P++ 
Sbjct  124  VDWRKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFQSDLIEALSKTVWYSVPIIWIPLML  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  +  W+L+EY +HRFLFH+K
Sbjct  182  YLSWSYYQTLAQGNVRLFTSFTTEYSVAMPESVFPGLFVLGMLLWSLVEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+    H+++HG HHK P D  RLVFPP   ++++   +  ++L+ P      + 
Sbjct  242  PPSNSYYLIMLHFVLHGQHHKAPFDESRLVFPPVPASLVIGFFYAFLRLILPEAVGGTVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY+IYD  HYYLH G P  G    SLK +H+ HHF +Q  GFGI++ FWD  F
Sbjct  302  AGGLLGYVIYDMIHYYLHFGSPHKGSYLYSLKAYHVKHHFAHQRSGFGISSKFWDHFF  359



>ref|XP_004690440.1| PREDICTED: fatty acid 2-hydroxylase [Condylura cristata]
Length=372

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 137/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F + F+E LT+T W+++P IW+P++ 
Sbjct  124  VDWRKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFYSDFIEALTKTVWYSVPIIWMPLML  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  + +WTL+EY +HRFLFH+K
Sbjct  182  YLSWSYYRTLAQGNVRLFESFTTEYSVAMPKSTFPGLFMLGVFSWTLIEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++ +   +  +++L P     ++ 
Sbjct  242  PPKDSYYLITLHFILHGQHHKAPFDESRLVFPPVPASLAIAFFYMCLRVLLPEPVGGSVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G     LK  H+ HHF +Q  GFGI+   WD +F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPHRGSYLYHLKAHHVKHHFAHQQSGFGISTNLWDYIF  359



>ref|XP_010583512.1| PREDICTED: fatty acid 2-hydroxylase [Haliaeetus leucocephalus]
Length=354

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 138/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVG+LG+ YDEWVH+P+      R F + FLE L++T W+ +  +W PVV 
Sbjct  106  VDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDFLESLSKTAWYVVFMVWAPVVL  163

Query  262  ---WFASTSVNMG-------------LPTPQlaisllaslaaw--tllEYTLHRFLFHVK  387
               W + TS+  G             +P  +     +  L  +  +LLEY +HRF+FH+K
Sbjct  164  YLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMFLWSLLEYLIHRFVFHMK  223

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
                 Y+  T H+++HG HHK P D  RLVFPP   ++++   +G+++LL P +   ++ 
Sbjct  224  PPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGFFYGVLRLLLPEVLGLSVF  283

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +Q  GFGI+  FWD  F
Sbjct  284  VGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWDRPF  341



>ref|XP_003917223.1| PREDICTED: fatty acid 2-hydroxylase isoform X1 [Papio anubis]
Length=372

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 135/238 (57%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  124  VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEGLSKTVWYSVPIIWVPLVL  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T   + +P        +  +  W+L+EY +HRFLFH+K
Sbjct  182  YLSWSYYRTFAQGNVRLFTSFTTEYALAVPKSMFPGLFMLGIFLWSLIEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+    H++MHG HHK P DG RLVFPP   ++++   +  ++L+ P      + 
Sbjct  242  PPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCLQLILPEAVGGTVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    +LK  H+ HHF +Q  GFGI+   WD  F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPHRGSYLYNLKAHHVKHHFAHQKSGFGISTKLWDYCF  359



>ref|NP_001181351.1| fatty acid 2-hydroxylase [Macaca mulatta]
 ref|NP_001270612.1| fatty acid 2-hydroxylase [Macaca fascicularis]
 sp|Q4R4P4.1|FA2H_MACFA RecName: Full=Fatty acid 2-hydroxylase; AltName: Full=Fatty acid 
alpha-hydroxylase [Macaca fascicularis]
 dbj|BAE01931.1| unnamed protein product [Macaca fascicularis]
Length=372

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 135/238 (57%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  124  VDWQKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEGLSKTVWYSVPIIWVPLVL  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T   + +P        +  +  W+L+EY +HRFLFH+K
Sbjct  182  YLSWSYYRTFAQGNVRLFTSFTTEYALAVPKSMFPGLFMLGIFLWSLIEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+    H++MHG HHK P DG RLVFPP   ++++   +  ++L+ P      + 
Sbjct  242  PPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCLQLILPEAVGGTVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    +LK  H+ HHF +Q  GFGI+   WD  F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPHRGSYLYNLKAHHVKHHFAHQKSGFGISTKLWDYCF  359



>ref|XP_002138439.1| GA24771 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY68997.1| GA24771 [Drosophila pseudoobscura pseudoobscura]
Length=230

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 128/217 (59%), Gaps = 15/217 (7%)
 Frame = +1

Query  109  QVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVWWFA----ST  276
            Q+ ++   YDEWVHKP+      R F   +LE LT+TPWW +P  W+PV+  FA     T
Sbjct  4    QIANITKCYDEWVHKPV--DRPLRLFGPWYLEMLTKTPWWLVPIFWIPVIIRFAWEDIHT  61

Query  277  SVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTR---GYWANTFHYMMHGCHHKH  447
            S N       +    L  +  WT LEYTLHR++FH+K +   G W  TFH+M+HG HHK 
Sbjct  62   SWNDKSQLACVTGYFLFGVLLWTFLEYTLHRWVFHIKLKCNSGPWICTFHFMIHGLHHKV  121

Query  448  PMDGMRLVFPPAATAIMLMPLWGLVK--LLAPSIYVYAILGGALLGYIIYDCTHYYLHHG  621
            P D MRLVFPP   AI+   ++  +   L+ P +    +L GAL GY+ YD  HYYLH+G
Sbjct  122  PFDPMRLVFPPLPGAILATLIYYPLSYFLIQPRV----VLSGALAGYLCYDMMHYYLHYG  177

Query  622  KPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             P       +KR+H  HHF +QD G+GI++  WD+VF
Sbjct  178  NPSFRHIVHMKRYHYQHHFTHQDLGYGISSPLWDVVF  214



>ref|XP_004663637.1| PREDICTED: fatty acid 2-hydroxylase [Jaculus jaculus]
Length=372

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 136/238 (57%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P++ 
Sbjct  124  VDWKKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEALSKTVWYSVPIIWVPLML  181

Query  262  WFAST------SVNMGLPTPQlaisllaslaaw------------tllEYTLHRFLFHVK  387
            + + +        N+ L T       +    +             +L+EY +HRFLFH+K
Sbjct  182  YLSQSYYRTLAQGNVRLFTSFTTEYSVVVRESMFPGLFVLGLLLWSLIEYLIHRFLFHMK  241

Query  388  TRG--YWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              G  Y+    H++MHG HHK P DG RLVFPP   ++++   + L++LL P      + 
Sbjct  242  PPGDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIAFFYMLLRLLLPEAVGGTVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    S+K  H+ HHF +Q  GFGI+   WD +F
Sbjct  302  AGGLLGYVVYDMTHYYLHFGSPHKGSYLYSMKAHHVKHHFEHQKSGFGISTKLWDHLF  359



>gb|ELU11413.1| hypothetical protein CAPTEDRAFT_171473 [Capitella teleta]
Length=352

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/237 (40%), Positives = 129/237 (54%), Gaps = 21/237 (9%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            +D SKPL +QVGHLGD Y EWVH P+      + F + F EF +  PWW +P +WLPV+ 
Sbjct  111  IDWSKPLYWQVGHLGDNYMEWVHSPV--DRQIKLFRSEFAEFFSTAPWWVVPIVWLPVMC  168

Query  262  WFASTSV--------NMGLP---------TPQlaisllaslaawtllEYTLHRFLFHVKT  390
             + + S          + +P         T  +          W+L EY +HR+LFH++ 
Sbjct  169  MYITLSFLNYSNGAGEVWMPNFYGGLWTCTYHMPFLFGFGAVMWSLFEYVVHRWLFHMRP  228

Query  391  RGY--WANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILG  564
              +  +  T H+++HG HHK PMD  RLVFPP   ++  + +  L   + P      +L 
Sbjct  229  PSWSPFLTTLHFVLHGQHHKAPMDRQRLVFPPLPASVFGVTISLLYLSVFPVAMAQILLA  288

Query  565  GALLGYIIYDCTHYYLHHGKPLTGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVFG  735
            G   GY+IYD  HYYLHHG P     Q LK +H+ HHF NQ KGFGI++ FWD  FG
Sbjct  289  GTAFGYVIYDLIHYYLHHGSPSLRYFQDLKNYHVRHHFVNQQKGFGISHKFWDYTFG  345



>ref|XP_010381264.1| PREDICTED: fatty acid 2-hydroxylase [Rhinopithecus roxellana]
Length=372

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 135/238 (57%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KPL++QVGHLG+ YDEWVH+P+      R F +  +E L++T W+++P IW+P+V 
Sbjct  124  VDWRKPLLWQVGHLGEKYDEWVHQPVT--RPIRLFHSDLIEGLSKTVWYSVPIIWVPLVL  181

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T   + +P        +  +  W+L+EY +HRFLFH+K
Sbjct  182  YLSWSYYRTFAQGNVRLFTSFTTEYALAVPKSMFPGLFMLGIFLWSLVEYLIHRFLFHMK  241

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+    H++MHG HHK P DG RLVFPP   ++++   +  ++L+ P      + 
Sbjct  242  PPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCLQLILPEAVGGTVF  301

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G    +LK  H+ HHF +Q  GFGI+   WD  F
Sbjct  302  AGGLLGYVLYDMTHYYLHFGSPHRGSYLYNLKAHHVKHHFAHQKSGFGISTKLWDYCF  359



>ref|XP_004517438.1| PREDICTED: fatty acid 2-hydroxylase-like isoform X1 [Ceratitis 
capitata]
 ref|XP_004517439.1| PREDICTED: fatty acid 2-hydroxylase-like isoform X2 [Ceratitis 
capitata]
 ref|XP_004517440.1| PREDICTED: fatty acid 2-hydroxylase-like isoform X3 [Ceratitis 
capitata]
 ref|XP_004517441.1| PREDICTED: fatty acid 2-hydroxylase-like isoform X4 [Ceratitis 
capitata]
 ref|XP_004517442.1| PREDICTED: fatty acid 2-hydroxylase-like isoform X5 [Ceratitis 
capitata]
Length=430

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 131/234 (56%), Gaps = 26/234 (11%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESP-RFFANGFLEFLTRTPWWAIPTIWLPVV  258
            VD SK +  Q+ H+   YDEWVHKP+   + P R F   +LE  T+TPWW  P  W+PV+
Sbjct  190  VDWSKAMCPQIAHITRHYDEWVHKPV---DRPLRLFGPTYLEIFTKTPWWVTPLFWIPVI  246

Query  259  ----------WWFASTSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVKTRGY---  399
                       W  S+   + L    L       +  W+LLEY LHRF+FH+K       
Sbjct  247  SKCLWDEFSPLWHTSSLSMLTL----LFAYFAVGIVFWSLLEYVLHRFVFHMKINANTNP  302

Query  400  WANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAILGGALLG  579
            W  TFH+M+HG HHK P D MRLVFPP    I+   ++  +  L P   +  +L GAL G
Sbjct  303  WLCTFHFMIHGLHHKVPFDSMRLVFPPLPGVIIASIIYAPLSFLLPHPRI--VLAGALFG  360

Query  580  YIIYDCTHYYLHHGKPL---TGVSQSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
            Y+ YD  HYYLH+G P    T    ++KR+H  HHF +QD G+GI++ FWDIVF
Sbjct  361  YLCYDLMHYYLHYGNPSIEHTNFMYNMKRYHYQHHFAHQDMGYGISSPFWDIVF  414



>ref|XP_009641612.1| PREDICTED: fatty acid 2-hydroxylase [Egretta garzetta]
Length=330

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/253 (38%), Positives = 142/253 (56%), Gaps = 30/253 (12%)
 Frame = +1

Query  49   TGAKMAAQGFTVDLSK-------PLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEF  207
            T A+M  +  TVD+ K       PL++QVG+LG+ YDEWVH+P+      R F +  LE 
Sbjct  38   TPARMDPRCKTVDVEKDLVDWQKPLLWQVGYLGEKYDEWVHQPV--DRPIRLFHSDLLES  95

Query  208  LTRTPWWAIPTIWLPVVWW----------------FASTSVNMGLPTPQlaisllaslaa  339
            L++T W+ +  +W PVV +                F+S +    +P  +     +  L  
Sbjct  96   LSKTAWYVVFMVWAPVVLYLSWVSYTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGM  155

Query  340  w--tllEYTLHRFLFHVK--TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMP  507
            +  +LLEY +HRF+FH+K     Y+  T H+++HG HHK P D  RLVFPP   ++++  
Sbjct  156  FLWSLLEYLIHRFVFHMKPPASNYYLITLHFLLHGQHHKSPFDSSRLVFPPVPASLVIGF  215

Query  508  LWGLVKLLAPSIYVYAILGGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRN  684
             +G+++LL P +   ++  G L GY+IYD  HYYLH+G P  G     LK +H+ HHF +
Sbjct  216  FYGVLQLLLPEVLGLSVFVGGLCGYVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEH  275

Query  685  QDKGFGITNTFWD  723
            Q  GFGI+  FWD
Sbjct  276  QKSGFGISTRFWD  288



>ref|XP_005608609.1| PREDICTED: fatty acid 2-hydroxylase [Equus caballus]
Length=535

 Score =   167 bits (424),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 139/238 (58%), Gaps = 23/238 (10%)
 Frame = +1

Query  82   VDLSKPLVFQVGHLGDAYDEWVHKPIVSKESPRFFANGFLEFLTRTPWWAIPTIWLPVVW  261
            VD  KP+++QVGHLG+ YDEWVH+P+      R F + F+E LT+T W+++P +W+P++ 
Sbjct  287  VDWRKPILWQVGHLGEKYDEWVHQPVTRPI--RLFHSDFIESLTKTVWYSVPIVWMPLIL  344

Query  262  WFA------------------STSVNMGLPTPQlaisllaslaawtllEYTLHRFLFHVK  387
            + +                  +T  ++ +P        +  L  W+L+EY LHRFLFH+K
Sbjct  345  YLSWSYYRTLAQGNVRLFTSFTTEYSVAMPESVFPGLFVLGLFLWSLVEYVLHRFLFHMK  404

Query  388  --TRGYWANTFHYMMHGCHHKHPMDGMRLVFPPAATAIMLMPLWGLVKLLAPSIYVYAIL  561
              +  Y+  T H+++HG HHK P D  RLVFPP   ++M+   + +++LL P      + 
Sbjct  405  PPSNSYYLITLHFVLHGQHHKAPFDESRLVFPPVPASLMIAFFYMVLRLLLPEAVGGTVF  464

Query  562  GGALLGYIIYDCTHYYLHHGKPLTGVS-QSLKRFHMDHHFRNQDKGFGITNTFWDIVF  732
             G LLGY++YD THYYLH G P  G     +K  H+ HHF +Q  GFGI++ FWD  F
Sbjct  465  AGGLLGYVLYDMTHYYLHFGSPHKGSYLYKMKAHHVKHHFAHQKSGFGISSKFWDYFF  522



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2364220596864