BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25420_g2_i1 len=920 path=[12097:0-382 4558:383-704 30654:705-707
12801:708-919]

Length=920
                                                                      Score     E

ref|XP_009588426.1|  PREDICTED: universal stress protein A-like p...    215   2e-65   
gb|EYU18171.1|  hypothetical protein MIMGU_mgv1a026609mg                213   1e-64   
ref|XP_009758852.1|  PREDICTED: universal stress protein A-like p...    213   2e-64   
ref|XP_004229048.1|  PREDICTED: universal stress protein A-like p...    212   2e-64   
gb|AIR07400.1|  universal stress protein A                              210   1e-63   
ref|XP_011094180.1|  PREDICTED: universal stress protein A-like p...    208   9e-63   
ref|XP_006337956.1|  PREDICTED: universal stress protein A-like p...    206   3e-62   
ref|XP_002266746.3|  PREDICTED: universal stress protein A-like p...    201   8e-60   Vitis vinifera
gb|KDO70762.1|  hypothetical protein CISIN_1g044973mg                   199   3e-59   
ref|XP_006429980.1|  hypothetical protein CICLE_v10012835mg             199   5e-59   
ref|XP_006481854.1|  PREDICTED: universal stress protein A-like p...    197   2e-58   
ref|XP_007029142.1|  Adenine nucleotide alpha hydrolases-like sup...    196   4e-58   
gb|AID16045.1|  putative universal stress protein                       195   8e-58   
ref|XP_007029143.1|  Adenine nucleotide alpha hydrolases-like sup...    194   1e-57   
ref|XP_004303418.1|  PREDICTED: universal stress protein YxiE-like      194   3e-57   
ref|XP_010263144.1|  PREDICTED: universal stress protein A-like p...    194   4e-57   
gb|KDO70763.1|  hypothetical protein CISIN_1g046290mg                   194   6e-57   
ref|XP_004229049.1|  PREDICTED: universal stress protein A-like p...    192   9e-57   
ref|XP_006481852.1|  PREDICTED: universal stress protein A-like p...    192   3e-56   
emb|CDP10546.1|  unnamed protein product                                196   3e-56   
ref|XP_006429978.1|  hypothetical protein CICLE_v10012833mg             191   5e-56   
ref|XP_011047113.1|  PREDICTED: uncharacterized protein LOC105141...    191   1e-55   
ref|XP_011047112.1|  PREDICTED: universal stress protein A-like p...    190   2e-55   
gb|KCW48157.1|  hypothetical protein EUGRSUZ_K01888                     189   3e-55   
gb|KDP21925.1|  hypothetical protein JCGZ_03063                         188   5e-55   
ref|XP_009376345.1|  PREDICTED: uncharacterized protein LOC103965052    188   7e-55   
ref|XP_010105075.1|  Universal stress protein A-like protein            187   2e-54   
ref|XP_010036539.1|  PREDICTED: universal stress protein A-like p...    189   2e-54   
ref|XP_006407393.1|  hypothetical protein EUTSA_v10021565mg             187   3e-54   
ref|XP_006407394.1|  hypothetical protein EUTSA_v10021565mg             186   3e-54   
ref|XP_002323356.2|  hypothetical protein POPTR_0016s06400g             187   4e-54   Populus trichocarpa [western balsam poplar]
ref|XP_007202546.1|  hypothetical protein PRUPE_ppa011155mg             187   5e-54   
ref|XP_008241214.1|  PREDICTED: uncharacterized protein LOC103339659    186   9e-54   
ref|XP_010653225.1|  PREDICTED: universal stress protein A-like p...    186   9e-54   
ref|XP_010263143.1|  PREDICTED: universal stress protein A-like p...    185   2e-53   
ref|XP_011042515.1|  PREDICTED: universal stress protein A-like p...    182   9e-53   
ref|XP_006429977.1|  hypothetical protein CICLE_v10012833mg             182   9e-53   
ref|XP_006296619.1|  hypothetical protein CARUB_v10014583mg             183   1e-52   
ref|XP_006296620.1|  hypothetical protein CARUB_v10014583mg             183   2e-52   
ref|XP_010524871.1|  PREDICTED: universal stress protein A-like p...    181   2e-52   
ref|XP_011094181.1|  PREDICTED: uncharacterized protein C167.05-like    181   3e-52   
ref|XP_010486865.1|  PREDICTED: uncharacterized protein LOC104764...    181   3e-52   
ref|XP_002882756.1|  universal stress protein family protein            181   3e-52   
ref|XP_010498281.1|  PREDICTED: uncharacterized protein LOC104775...    181   4e-52   
ref|XP_010486864.1|  PREDICTED: uncharacterized protein LOC104764...    181   4e-52   
ref|NP_566406.1|  universal stress protein-like protein                 181   4e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850562.1|  universal stress protein-like protein                 181   5e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498273.1|  PREDICTED: uncharacterized protein LOC104775...    181   5e-52   
ref|XP_010486863.1|  PREDICTED: uncharacterized protein LOC104764...    181   6e-52   
ref|XP_009121035.1|  PREDICTED: uncharacterized protein LOC103845...    181   6e-52   
ref|XP_010498264.1|  PREDICTED: uncharacterized protein LOC104775...    181   7e-52   
ref|NP_001030675.1|  universal stress protein-like protein              181   8e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121027.1|  PREDICTED: uncharacterized protein LOC103845...    181   8e-52   
ref|XP_009393020.1|  PREDICTED: universal stress protein A-like p...    179   9e-52   
ref|XP_010464928.1|  PREDICTED: universal stress protein A-like p...    180   1e-51   
emb|CDY47907.1|  BnaAnng09390D                                          180   1e-51   
ref|XP_010464927.1|  PREDICTED: uncharacterized protein LOC104745...    180   1e-51   
ref|XP_007029144.1|  Adenine nucleotide alpha hydrolases-like sup...    179   2e-51   
ref|XP_010524887.1|  PREDICTED: universal stress protein A-like p...    179   2e-51   
ref|XP_002308342.2|  hypothetical protein POPTR_0006s21250g             179   2e-51   Populus trichocarpa [western balsam poplar]
ref|XP_004504522.1|  PREDICTED: universal stress protein A-like p...    179   3e-51   
ref|XP_009135196.1|  PREDICTED: uncharacterized protein LOC103859...    178   5e-51   
ref|XP_009135195.1|  PREDICTED: uncharacterized protein LOC103859...    178   6e-51   
gb|KEH41787.1|  adenine nucleotide alpha hydrolase superfamily pr...    177   9e-51   
ref|XP_010464931.1|  PREDICTED: universal stress protein A-like p...    177   9e-51   
ref|XP_010464930.1|  PREDICTED: universal stress protein A-like p...    176   1e-50   
gb|AAM66054.1|  ethylene-responsive protein, putative                   176   3e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007202545.1|  hypothetical protein PRUPE_ppa011155mg             177   3e-50   
ref|XP_010524879.1|  PREDICTED: universal stress protein A-like p...    175   8e-50   
ref|XP_006481853.1|  PREDICTED: universal stress protein A-like p...    175   1e-49   
ref|XP_010677621.1|  PREDICTED: universal stress protein A-like p...    173   3e-49   
ref|XP_003519020.1|  PREDICTED: universal stress protein A-like p...    172   6e-49   
ref|XP_006429979.1|  hypothetical protein CICLE_v10013408mg             172   9e-49   
gb|KFK38558.1|  hypothetical protein AALP_AA3G129200                    172   2e-48   
ref|XP_009588427.1|  PREDICTED: universal stress protein A-like p...    171   2e-48   
gb|KDP21924.1|  hypothetical protein JCGZ_03062                         171   3e-48   
ref|XP_011094182.1|  PREDICTED: universal stress protein A-like p...    170   6e-48   
ref|XP_009593917.1|  PREDICTED: uncharacterized protein LOC104090...    168   1e-47   
emb|CDY08484.1|  BnaA05g27200D                                          169   2e-47   
ref|XP_009146670.1|  PREDICTED: uncharacterized protein LOC103870298    169   3e-47   
ref|XP_010519995.1|  PREDICTED: universal stress protein A-like p...    168   3e-47   
ref|XP_010519994.1|  PREDICTED: universal stress protein A-like p...    168   4e-47   
ref|XP_010534373.1|  PREDICTED: universal stress protein A-like p...    167   8e-47   
emb|CBI39085.3|  unnamed protein product                                165   1e-46   
ref|XP_010504799.1|  PREDICTED: uncharacterized protein LOC104781...    167   1e-46   
ref|XP_010917884.1|  PREDICTED: universal stress protein A-like p...    166   2e-46   
ref|XP_007145748.1|  hypothetical protein PHAVU_007G264400g             164   1e-45   
ref|NP_850563.1|  universal stress protein-like protein                 165   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009795288.1|  PREDICTED: uncharacterized protein LOC104242017    165   2e-45   
ref|XP_007145747.1|  hypothetical protein PHAVU_007G264400g             163   2e-45   
ref|XP_010516491.1|  PREDICTED: uncharacterized protein LOC104792...    162   6e-45   
ref|XP_006402787.1|  hypothetical protein EUTSA_v10006473mg             162   7e-45   
ref|XP_007202660.1|  hypothetical protein PRUPE_ppa012339mg             161   7e-45   
ref|XP_009389841.1|  PREDICTED: universal stress protein A-like p...    162   8e-45   
ref|XP_010504800.1|  PREDICTED: uncharacterized protein LOC104781...    162   8e-45   
emb|CDX67744.1|  BnaA07g17840D                                          161   2e-44   
emb|CDY01070.1|  BnaC05g41300D                                          160   2e-44   
ref|XP_002876463.1|  universal stress protein family protein            161   2e-44   
ref|XP_006293247.1|  hypothetical protein CARUB_v10019581mg             161   3e-44   
ref|XP_008241135.1|  PREDICTED: universal stress protein A-like p...    159   4e-44   
ref|NP_191404.2|  adenine nucleotide alpha hydrolases-like superf...    160   6e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AFK43196.1|  unknown                                                 159   7e-44   
gb|KEH41788.1|  adenine nucleotide alpha hydrolase superfamily pr...    159   8e-44   
ref|XP_007029145.1|  Adenine nucleotide alpha hydrolases-like sup...    159   8e-44   
gb|KFK35112.1|  hypothetical protein AALP_AA5G237800                    159   1e-43   
gb|KFK35113.1|  hypothetical protein AALP_AA5G237800                    159   2e-43   
ref|XP_008241215.1|  PREDICTED: uncharacterized protein LOC103339661    159   2e-43   
ref|XP_010516493.1|  PREDICTED: uncharacterized protein LOC104792...    157   5e-43   
ref|XP_009104144.1|  PREDICTED: universal stress protein A-like p...    157   7e-43   
emb|CDP10547.1|  unnamed protein product                                155   2e-42   
ref|NP_850717.1|  adenine nucleotide alpha hydrolases-like superf...    155   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006650590.1|  PREDICTED: universal stress protein A-like p...    150   1e-40   
gb|AAR87267.1|  putative stress-related protein                         149   3e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007202608.1|  hypothetical protein PRUPE_ppa011744mg             149   5e-40   
ref|XP_002467191.1|  hypothetical protein SORBIDRAFT_01g021200          148   7e-40   Sorghum bicolor [broomcorn]
gb|EMT31581.1|  Universal stress protein A-like protein                 149   8e-40   
gb|ADB54817.1|  universal stress protein 9308                           148   1e-39   Hordeum vulgare subsp. vulgare [barley]
ref|XP_003559418.1|  PREDICTED: universal stress protein A-like p...    149   2e-39   
gb|ADB54816.1|  universal stress protein 9308                           148   2e-39   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009116521.1|  PREDICTED: uncharacterized protein C167.05-l...    146   9e-39   
ref|XP_010431458.1|  PREDICTED: universal stress protein A-like p...    144   2e-38   
gb|EMS53028.1|  Universal stress protein A-like protein                 147   4e-38   
emb|CDX71957.1|  BnaC08g29170D                                          144   8e-38   
ref|XP_004981765.1|  PREDICTED: universal stress protein A-like p...    143   1e-37   
ref|XP_009116522.1|  PREDICTED: uncharacterized protein C167.05-l...    142   2e-37   
ref|XP_004983044.1|  PREDICTED: universal stress protein A-like p...    142   3e-37   
ref|XP_008679881.1|  PREDICTED: ethylene-responsive protein isofo...    142   3e-37   
ref|XP_009116523.1|  PREDICTED: uncharacterized protein C167.05-l...    141   5e-37   
ref|XP_008679887.1|  PREDICTED: ethylene-responsive protein isofo...    140   1e-36   
ref|XP_008679878.1|  PREDICTED: ethylene-responsive protein isofo...    140   2e-36   
ref|XP_009593918.1|  PREDICTED: universal stress protein A-like p...    137   2e-36   
tpg|DAA51379.1|  TPA: ethylene-responsive protein isoform 1             139   4e-36   
gb|EPS58073.1|  hypothetical protein M569_16744                         136   4e-36   
ref|XP_009116524.1|  PREDICTED: universal stress protein A-like p...    138   9e-36   
gb|AGT17355.1|  hypothetical protein SHCRBa_260_G18_F_60                137   1e-35   
ref|XP_002463873.1|  hypothetical protein SORBIDRAFT_01g007990          137   1e-35   Sorghum bicolor [broomcorn]
ref|XP_010668291.1|  PREDICTED: universal stress protein A-like p...    135   2e-35   
ref|NP_001151646.1|  ethylene-responsive protein                        137   3e-35   Zea mays [maize]
ref|NP_001064677.1|  Os10g0437500                                       135   8e-35   Oryza sativa Japonica Group [Japonica rice]
gb|EMS48379.1|  Universal stress protein A-like protein                 136   9e-35   
gb|EMT31582.1|  Universal stress protein A-like protein                 135   1e-34   
gb|EEC76183.1|  hypothetical protein OsI_13519                          134   3e-34   Oryza sativa Indica Group [Indian rice]
gb|EAY78646.1|  hypothetical protein OsI_33745                          133   4e-34   Oryza sativa Indica Group [Indian rice]
gb|EYU18168.1|  hypothetical protein MIMGU_mgv1a023549mg                128   7e-33   
emb|CDX98295.1|  BnaC06g16560D                                          130   1e-32   
gb|AFK41746.1|  unknown                                                 127   6e-32   
ref|XP_011023763.1|  PREDICTED: universal stress protein A-like p...    127   7e-32   
ref|XP_006588416.1|  PREDICTED: uncharacterized protein LOC100527...    126   2e-31   
ref|XP_006338073.1|  PREDICTED: universal stress protein A-like p...    126   2e-31   
ref|XP_004495667.1|  PREDICTED: universal stress protein A-like p...    125   6e-31   
gb|KDP23405.1|  hypothetical protein JCGZ_23238                         125   6e-31   
gb|ADB54810.1|  universal stress protein 23267                          124   8e-31   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010265105.1|  PREDICTED: universal stress protein A-like p...    124   9e-31   
ref|XP_003591211.1|  Universal stress protein A-like protein            124   1e-30   
ref|XP_004237985.1|  PREDICTED: universal stress protein A-like p...    124   1e-30   
gb|AAD46412.1|AF096262_1  ER6 protein                                   124   1e-30   Solanum lycopersicum
gb|ADB54809.1|  universal stress protein 23267                          124   1e-30   Hordeum vulgare subsp. vulgare [barley]
gb|EMT14537.1|  Universal stress protein A-like protein                 124   1e-30   
ref|NP_001240086.1|  uncharacterized protein LOC100816212               124   1e-30   
ref|XP_008389277.1|  PREDICTED: universal stress protein A-like p...    124   2e-30   
gb|KHG27977.1|  hypothetical protein F383_14126                         123   2e-30   
gb|ABK26351.1|  unknown                                                 122   3e-30   Picea sitchensis
ref|XP_010107691.1|  Universal stress protein A-like protein            122   6e-30   
ref|NP_001051280.1|  Os03g0750000                                       120   7e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003580727.1|  PREDICTED: universal stress protein A-like p...    122   7e-30   
ref|XP_007206031.1|  hypothetical protein PRUPE_ppa012501mg             122   7e-30   
gb|KHN23151.1|  Universal stress protein A-like protein                 122   8e-30   
gb|ABK23398.1|  unknown                                                 121   1e-29   Picea sitchensis
ref|XP_002319486.1|  hypothetical protein POPTR_0013s01110g             121   1e-29   Populus trichocarpa [western balsam poplar]
gb|EEE59934.1|  hypothetical protein OsJ_12581                          127   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002285692.1|  PREDICTED: universal stress protein A-like p...    121   1e-29   Vitis vinifera
emb|CDP18238.1|  unnamed protein product                                121   2e-29   
gb|ABR16994.1|  unknown                                                 120   2e-29   Picea sitchensis
ref|NP_001237625.1|  uncharacterized protein LOC100305594               120   2e-29   
ref|XP_009356255.1|  PREDICTED: universal stress protein A-like p...    121   3e-29   
ref|XP_009770125.1|  PREDICTED: universal stress protein A-like p...    120   4e-29   
gb|ABB13620.1|  USP-like protein                                        120   6e-29   Astragalus sinicus
ref|XP_008370382.1|  PREDICTED: universal stress protein A-like p...    119   6e-29   
ref|XP_010475820.1|  PREDICTED: universal stress protein A-like p...    119   6e-29   
ref|XP_004230297.1|  PREDICTED: universal stress protein A-like p...    119   6e-29   
ref|XP_009804591.1|  PREDICTED: universal stress protein A-like p...    119   6e-29   
gb|ADE77419.1|  unknown                                                 119   7e-29   
gb|EYU37243.1|  hypothetical protein MIMGU_mgv1a023360mg                119   8e-29   
ref|XP_004302247.1|  PREDICTED: universal stress protein A-like p...    119   8e-29   
ref|XP_010268015.1|  PREDICTED: universal stress protein A-like p...    119   9e-29   
ref|XP_006574464.1|  PREDICTED: uncharacterized protein LOC100816...    118   1e-28   
ref|XP_002512499.1|  conserved hypothetical protein                     119   1e-28   Ricinus communis
ref|XP_008388484.1|  PREDICTED: universal stress protein A-like p...    118   2e-28   
ref|XP_002455517.1|  hypothetical protein SORBIDRAFT_03g012520          118   2e-28   Sorghum bicolor [broomcorn]
ref|XP_009373274.1|  PREDICTED: universal stress protein A-like p...    118   2e-28   
ref|NP_001238718.1|  uncharacterized protein LOC100527357               118   2e-28   
emb|CDP11494.1|  unnamed protein product                                118   2e-28   
ref|XP_002526986.1|  conserved hypothetical protein                     118   2e-28   Ricinus communis
gb|ACF74293.1|  universal stress protein                                118   2e-28   Arachis hypogaea [goober]
gb|KDP41468.1|  hypothetical protein JCGZ_15875                         118   3e-28   
ref|XP_007031134.1|  USP-like protein isoform 3                         117   3e-28   
ref|XP_009588034.1|  PREDICTED: universal stress protein A-like p...    117   4e-28   
gb|ACG26484.1|  universal stress protein                                117   4e-28   Zea mays [maize]
ref|XP_006344751.1|  PREDICTED: uncharacterized protein C167.05-like    117   4e-28   
ref|XP_006842311.1|  hypothetical protein AMTR_s00079p00131240          117   4e-28   
gb|EYU18169.1|  hypothetical protein MIMGU_mgv11b0160062mg              114   5e-28   
gb|KDP29423.1|  hypothetical protein JCGZ_18344                         117   5e-28   
emb|CAB68183.1|  putative protein                                       117   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009395576.1|  PREDICTED: universal stress protein A-like p...    117   5e-28   
ref|XP_003591417.1|  Universal stress protein A-like protein            117   5e-28   
ref|NP_001132550.1|  universal stress protein                           117   5e-28   Zea mays [maize]
ref|XP_010264150.1|  PREDICTED: universal stress protein A-like p...    117   5e-28   
ref|XP_010490289.1|  PREDICTED: universal stress protein A-like p...    117   5e-28   
ref|XP_002514027.1|  conserved hypothetical protein                     117   5e-28   Ricinus communis
gb|KHG02297.1|  hypothetical protein F383_24645                         117   6e-28   
ref|XP_007031132.1|  USP-like protein isoform 1                         117   6e-28   
ref|XP_010099245.1|  Universal stress protein A-like protein            116   7e-28   
ref|XP_009630150.1|  PREDICTED: universal stress protein A-like p...    116   8e-28   
ref|XP_003554619.1|  PREDICTED: universal stress protein A-like p...    116   9e-28   
ref|XP_002962652.1|  hypothetical protein SELMODRAFT_79236              117   9e-28   
ref|XP_010659697.1|  PREDICTED: universal stress protein A-like p...    116   1e-27   
ref|XP_010544073.1|  PREDICTED: uncharacterized protein C167.05         116   1e-27   
gb|EMT03450.1|  Universal stress protein A-like protein                 116   1e-27   
ref|XP_009338192.1|  PREDICTED: universal stress protein A-like p...    116   1e-27   
ref|XP_008781084.1|  PREDICTED: universal stress protein A-like p...    116   1e-27   
gb|KHG14939.1|  hypothetical protein F383_18523                         116   1e-27   
gb|EMS51706.1|  Universal stress protein A-like protein                 116   1e-27   
ref|XP_003570587.1|  PREDICTED: uncharacterized protein C167.05 i...    115   1e-27   
ref|XP_010259332.1|  PREDICTED: universal stress protein A-like p...    115   2e-27   
gb|AFK39818.1|  unknown                                                 115   2e-27   
ref|XP_010044257.1|  PREDICTED: universal stress protein A-like p...    115   2e-27   
ref|XP_002282460.1|  PREDICTED: universal stress protein A-like p...    115   2e-27   Vitis vinifera
ref|XP_008800823.1|  PREDICTED: universal stress protein A-like p...    115   2e-27   
ref|XP_008389279.1|  PREDICTED: universal stress protein A-like p...    115   2e-27   
emb|CAN69650.1|  hypothetical protein VITISV_010535                     115   3e-27   Vitis vinifera
gb|EYU37244.1|  hypothetical protein MIMGU_mgv1a026749mg                115   3e-27   
gb|ACU19158.1|  unknown                                                 115   3e-27   Glycine max [soybeans]
ref|XP_009356876.1|  PREDICTED: universal stress protein A-like p...    115   3e-27   
ref|XP_011087485.1|  PREDICTED: universal stress protein A-like p...    115   3e-27   
ref|XP_008797667.1|  PREDICTED: universal stress protein A-like p...    114   3e-27   
ref|XP_002454587.1|  hypothetical protein SORBIDRAFT_04g033920          114   3e-27   Sorghum bicolor [broomcorn]
ref|XP_010458272.1|  PREDICTED: universal stress protein A-like p...    115   3e-27   
emb|CDY31068.1|  BnaA08g26180D                                          114   4e-27   
ref|XP_009791886.1|  PREDICTED: universal stress protein A-like p...    114   5e-27   
ref|XP_007223587.1|  hypothetical protein PRUPE_ppa012379mg             114   5e-27   
gb|EPS60930.1|  hypothetical protein M569_13873                         112   5e-27   
ref|XP_004953997.1|  PREDICTED: uncharacterized protein C167.05-like    114   5e-27   
ref|XP_009373939.1|  PREDICTED: uncharacterized protein C167.05-like    114   5e-27   
ref|NP_001060607.1|  Os07g0673400                                       114   5e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010921510.1|  PREDICTED: universal stress protein A-like p...    114   5e-27   
ref|NP_172445.2|  adenine nucleotide alpha hydrolases-like protein      114   7e-27   Arabidopsis thaliana [mouse-ear cress]
gb|EMS51705.1|  Universal stress protein A-like protein                 114   8e-27   
ref|XP_008339660.1|  PREDICTED: universal stress protein A-like p...    114   8e-27   
ref|XP_007044293.1|  Adenine nucleotide alpha hydrolases-like sup...    113   9e-27   
emb|CDY20676.1|  BnaC08g13820D                                          114   9e-27   
ref|XP_002282537.1|  PREDICTED: universal stress protein A-like p...    114   9e-27   Vitis vinifera
ref|XP_002889767.1|  hypothetical protein ARALYDRAFT_471075             114   1e-26   
ref|XP_004495962.1|  PREDICTED: universal stress protein A-like p...    114   1e-26   
ref|NP_001148900.1|  ER6 protein                                        113   1e-26   Zea mays [maize]
ref|XP_009356253.1|  PREDICTED: universal stress protein A-like p...    114   1e-26   
ref|XP_004968834.1|  PREDICTED: uncharacterized protein C167.05-l...    113   1e-26   
gb|AFW73547.1|  ER6 protein                                             113   1e-26   
emb|CBI36844.3|  unnamed protein product                                113   1e-26   
ref|XP_010264168.1|  PREDICTED: universal stress protein A-like p...    113   1e-26   
ref|XP_004958663.1|  PREDICTED: uncharacterized protein LOC101769282    114   1e-26   
dbj|BAJ92093.1|  predicted protein                                      113   1e-26   
ref|XP_003591541.1|  Universal stress protein                           113   1e-26   
ref|XP_011007756.1|  PREDICTED: universal stress protein A-like p...    113   1e-26   
ref|XP_004968833.1|  PREDICTED: uncharacterized protein C167.05-l...    113   2e-26   
gb|EPS66020.1|  hypothetical protein M569_08758                         112   2e-26   
ref|XP_004302246.1|  PREDICTED: universal stress protein A-like p...    113   2e-26   
gb|AGV40783.1|  universal stress protein                                112   2e-26   
ref|XP_010931649.1|  PREDICTED: universal stress protein A-like p...    112   2e-26   
ref|NP_001236718.1|  uncharacterized protein LOC100306046               112   2e-26   
ref|XP_010681485.1|  PREDICTED: universal stress protein A-like p...    112   2e-26   
ref|XP_011016913.1|  PREDICTED: uncharacterized protein LOC105120...    112   2e-26   
ref|XP_006448455.1|  hypothetical protein CICLE_v10017054mg             112   2e-26   
ref|XP_006576202.1|  PREDICTED: uncharacterized protein LOC100527...    112   2e-26   
ref|XP_009342098.1|  PREDICTED: universal stress protein A-like p...    112   2e-26   
gb|ABR17632.1|  unknown                                                 112   3e-26   Picea sitchensis
ref|NP_001066982.1|  Os12g0552400                                       112   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004148419.1|  PREDICTED: universal stress protein A-like p...    112   3e-26   
ref|XP_010921685.1|  PREDICTED: universal stress protein A-like p...    112   3e-26   
ref|XP_009804590.1|  PREDICTED: universal stress protein A-like p...    112   3e-26   
ref|XP_010692533.1|  PREDICTED: uncharacterized protein LOC104905637    112   3e-26   
ref|XP_002271563.1|  PREDICTED: universal stress protein A-like p...    112   3e-26   
ref|XP_006487496.1|  PREDICTED: uncharacterized protein LOC102621...    112   3e-26   
gb|EAZ05105.1|  hypothetical protein OsI_27297                          112   3e-26   
ref|XP_006417542.1|  hypothetical protein EUTSA_v10008924mg             112   3e-26   
ref|XP_004230296.1|  PREDICTED: universal stress protein A-like p...    112   4e-26   
gb|AAM09541.1|AF491815_1  putative universal stress protein USP1        112   4e-26   
gb|AAV65310.1|  universal stress protein                                112   4e-26   
emb|CDY53924.1|  BnaC03g73550D                                          108   4e-26   
ref|NP_001048190.1|  Os02g0760500                                       111   5e-26   
ref|XP_006647942.1|  PREDICTED: uncharacterized protein C167.05-like    111   6e-26   
ref|XP_006423746.1|  hypothetical protein CICLE_v10029382mg             111   6e-26   
ref|XP_002526987.1|  conserved hypothetical protein                     111   6e-26   
ref|XP_006448454.1|  hypothetical protein CICLE_v10017054mg             110   6e-26   
ref|XP_010921785.1|  PREDICTED: universal stress protein A-like p...    111   6e-26   
ref|XP_009373273.1|  PREDICTED: universal stress protein A-like p...    111   6e-26   
ref|XP_002312405.1|  universal stress family protein                    111   7e-26   
ref|XP_006433519.1|  hypothetical protein CICLE_v10002689mg             111   7e-26   
ref|XP_008781085.1|  PREDICTED: uncharacterized protein LOC103700...    110   7e-26   
ref|XP_007018204.1|  Adenine nucleotide alpha hydrolases-like sup...    111   7e-26   
ref|XP_010264134.1|  PREDICTED: universal stress protein A-like p...    111   8e-26   
ref|XP_006305720.1|  hypothetical protein CARUB_v10010470mg             111   8e-26   
ref|XP_008219288.1|  PREDICTED: universal stress protein A-like p...    111   9e-26   
ref|XP_010684515.1|  PREDICTED: uncharacterized protein LOC104899079    110   9e-26   
ref|XP_002302337.2|  ethylene-responsive family protein                 111   9e-26   
ref|XP_002314856.1|  hypothetical protein POPTR_0010s13330g             111   9e-26   
ref|XP_007031133.1|  Adenine nucleotide alpha hydrolases-like sup...    111   9e-26   
ref|XP_011036946.1|  PREDICTED: universal stress protein A-like p...    111   1e-25   
gb|KHN43511.1|  Universal stress protein A-like protein                 110   1e-25   
gb|EYU46674.1|  hypothetical protein MIMGU_mgv1a015298mg                110   1e-25   
ref|XP_008352713.1|  PREDICTED: uncharacterized protein C167.05-like    110   1e-25   
ref|XP_004968835.1|  PREDICTED: uncharacterized protein C167.05-l...    110   1e-25   
emb|CDP20842.1|  unnamed protein product                                110   1e-25   
ref|XP_006841415.1|  hypothetical protein AMTR_s00003p00027540          110   1e-25   
ref|XP_007144278.1|  hypothetical protein PHAVU_007G143000g             110   1e-25   
ref|XP_010916396.1|  PREDICTED: universal stress protein A-like p...    110   1e-25   
ref|XP_008369009.1|  PREDICTED: uncharacterized protein LOC103432589    110   2e-25   
ref|XP_008369003.1|  PREDICTED: uncharacterized protein LOC103432...    110   2e-25   
ref|XP_007050903.1|  Adenine nucleotide alpha hydrolases-like sup...    110   2e-25   
ref|XP_008781086.1|  PREDICTED: universal stress protein A-like p...    110   2e-25   
ref|XP_010024119.1|  PREDICTED: universal stress protein A-like p...    110   2e-25   
ref|XP_011007726.1|  PREDICTED: universal stress protein A-like p...    109   2e-25   
gb|AAT07452.1|  putative universal stress protein                       110   2e-25   
ref|XP_011022261.1|  PREDICTED: universal stress protein A-like p...    109   2e-25   
ref|XP_004144759.1|  PREDICTED: universal stress protein MJ0577-l...    110   2e-25   
ref|XP_008369004.1|  PREDICTED: uncharacterized protein LOC103432...    109   2e-25   
ref|XP_009110805.1|  PREDICTED: universal stress protein A-like p...    110   2e-25   
ref|XP_011076634.1|  PREDICTED: universal stress protein A-like p...    109   3e-25   
ref|XP_007145154.1|  hypothetical protein PHAVU_007G214800g             109   3e-25   
gb|AID16039.1|  putative universal stress protein                       109   3e-25   
ref|XP_002265489.2|  PREDICTED: uncharacterized protein LOC100260568    113   3e-25   
ref|XP_006423740.1|  hypothetical protein CICLE_v10029454mg             109   3e-25   
ref|XP_010259331.1|  PREDICTED: universal stress protein A-like p...    109   3e-25   
ref|XP_010549540.1|  PREDICTED: universal stress protein A-like p...    109   3e-25   
emb|CBI27006.3|  unnamed protein product                                108   4e-25   
ref|XP_006487493.1|  PREDICTED: uncharacterized protein LOC102621046    108   4e-25   
ref|XP_008444941.1|  PREDICTED: uncharacterized protein LOC103488134    109   4e-25   
gb|AEZ00873.1|  putative universal stress protein                       108   4e-25   
ref|XP_009630149.1|  PREDICTED: universal stress protein A-like p...    109   4e-25   
ref|XP_009403083.1|  PREDICTED: uncharacterized protein LOC103986718    109   5e-25   
ref|XP_004495963.1|  PREDICTED: universal stress protein A-like p...    108   6e-25   
ref|XP_010265106.1|  PREDICTED: universal stress protein A-like p...    108   6e-25   
gb|AID16041.1|  putative universal stress protein                       108   6e-25   
emb|CBI27004.3|  unnamed protein product                                108   6e-25   
ref|NP_001235063.1|  uncharacterized protein LOC100527623               109   6e-25   
gb|AAB60745.1|  ESTs gb|ATTS1236,gb|T43334,gb|N97019,gb|AA395203 ...    108   6e-25   
ref|XP_002283457.1|  PREDICTED: universal stress protein A-like p...    108   6e-25   
gb|KDO76973.1|  hypothetical protein CISIN_1g031713mg                   108   6e-25   
ref|XP_010269547.1|  PREDICTED: uncharacterized protein LOC104606...    108   6e-25   
ref|XP_008801104.1|  PREDICTED: universal stress protein A-like p...    109   6e-25   
ref|XP_010675243.1|  PREDICTED: universal stress protein A-like p...    108   7e-25   
ref|XP_004299723.1|  PREDICTED: universal stress protein A-like p...    108   8e-25   
ref|XP_009394438.1|  PREDICTED: universal stress protein A-like p...    108   8e-25   
gb|AFK46242.1|  unknown                                                 108   9e-25   
gb|EAY97682.1|  hypothetical protein OsI_19604                          108   9e-25   
ref|XP_003591542.1|  Universal stress protein                           108   9e-25   
ref|XP_006281889.1|  hypothetical protein CARUB_v10028087mg             108   9e-25   
emb|CDP00637.1|  unnamed protein product                                107   9e-25   
ref|XP_008369005.1|  PREDICTED: uncharacterized protein LOC103432...    108   9e-25   
ref|XP_008663115.1|  PREDICTED: universal stress protein A-like p...    108   9e-25   
ref|XP_006382407.1|  hypothetical protein POPTR_0005s01860g             108   1e-24   
ref|XP_003567587.1|  PREDICTED: universal stress protein A-like p...    108   1e-24   
ref|XP_004962797.1|  PREDICTED: uncharacterized protein LOC101782...    108   1e-24   
ref|XP_007035604.1|  Adenine nucleotide alpha hydrolases-like sup...    110   1e-24   
ref|XP_006472184.1|  PREDICTED: universal stress protein A-like p...    108   1e-24   
ref|XP_011008059.1|  PREDICTED: universal stress protein A-like p...    107   1e-24   
ref|XP_007221660.1|  hypothetical protein PRUPE_ppb010253mg             108   1e-24   
ref|XP_006472185.1|  PREDICTED: universal stress protein A-like p...    108   1e-24   
ref|XP_004299064.1|  PREDICTED: universal stress protein Sll1388-...    107   1e-24   
ref|XP_004495908.1|  PREDICTED: universal stress protein A-like p...    107   1e-24   
ref|XP_006658108.1|  PREDICTED: uncharacterized protein LOC102707323    107   1e-24   
ref|XP_010039561.1|  PREDICTED: universal stress protein A-like p...    107   1e-24   
ref|XP_010674179.1|  PREDICTED: universal stress protein A-like p...    107   1e-24   
ref|XP_010038207.1|  PREDICTED: universal stress protein A-like p...    107   1e-24   
ref|XP_010276435.1|  PREDICTED: universal stress protein A-like p...    107   1e-24   
ref|XP_010259333.1|  PREDICTED: universal stress protein A-like p...    107   1e-24   
ref|XP_009795153.1|  PREDICTED: universal stress protein A-like p...    107   1e-24   
ref|XP_007141257.1|  hypothetical protein PHAVU_008G180800g             107   2e-24   
ref|XP_010044261.1|  PREDICTED: universal stress protein A-like p...    107   2e-24   
ref|XP_008243246.1|  PREDICTED: universal stress protein A-like p...    107   2e-24   
gb|ABK21527.1|  unknown                                                 107   2e-24   
ref|XP_009586786.1|  PREDICTED: universal stress protein A-like p...    107   2e-24   
gb|KHG02612.1|  hypothetical protein F383_24945                         107   2e-24   
ref|NP_001148498.1|  ethylene-responsive protein                        107   2e-24   
gb|EAY83459.1|  hypothetical protein OsI_38670                          110   2e-24   
ref|XP_010041104.1|  PREDICTED: universal stress protein A-like p...    107   2e-24   
gb|EYU37238.1|  hypothetical protein MIMGU_mgv1a015255mg                107   2e-24   
ref|XP_011079565.1|  PREDICTED: universal stress protein A-like p...    107   3e-24   
ref|XP_010060094.1|  PREDICTED: uncharacterized protein LOC104448021    107   3e-24   
ref|XP_006468711.1|  PREDICTED: universal stress protein A-like p...    106   3e-24   
gb|EEE63386.1|  hypothetical protein OsJ_18198                          107   3e-24   
ref|XP_011016909.1|  PREDICTED: uncharacterized protein LOC105120...    107   3e-24   
ref|XP_004290788.1|  PREDICTED: universal stress protein MJ0531-like    106   3e-24   
ref|XP_002283390.1|  PREDICTED: universal stress protein A-like p...    106   3e-24   
ref|XP_010921509.1|  PREDICTED: uncharacterized protein LOC105045047    106   3e-24   
ref|XP_006355801.1|  PREDICTED: uncharacterized protein LOC102583766    106   3e-24   
ref|XP_007223620.1|  hypothetical protein PRUPE_ppa012591mg             106   4e-24   
ref|XP_003544826.1|  PREDICTED: uncharacterized protein LOC100805...    107   4e-24   
ref|XP_010264179.1|  PREDICTED: universal stress protein A-like p...    106   4e-24   
ref|XP_009405430.1|  PREDICTED: uncharacterized protein LOC103988576    106   4e-24   
ref|XP_004956772.1|  PREDICTED: uncharacterized protein LOC101762...    106   4e-24   
gb|KHG06374.1|  hypothetical protein F383_32883                         106   4e-24   
ref|XP_006645800.1|  PREDICTED: universal stress protein A-like p...    106   5e-24   
ref|XP_002283402.1|  PREDICTED: universal stress protein A-like p...    106   5e-24   
ref|XP_008369008.1|  PREDICTED: uncharacterized protein LOC103432...    106   5e-24   
ref|XP_006840564.1|  hypothetical protein AMTR_s00045p00225160          106   5e-24   
ref|XP_002314854.1|  hypothetical protein POPTR_0010s13310g             106   5e-24   
gb|ACG37233.1|  universal stress protein                                105   5e-24   
ref|XP_010259730.1|  PREDICTED: uncharacterized protein LOC104599062    106   5e-24   
emb|CDP00636.1|  unnamed protein product                                106   6e-24   
ref|XP_009399264.1|  PREDICTED: uncharacterized protein LOC103983718    106   6e-24   
ref|XP_004956773.1|  PREDICTED: uncharacterized protein LOC101762...    106   6e-24   
gb|KDO35866.1|  hypothetical protein CISIN_1g038513mg                   103   6e-24   
ref|XP_010532403.1|  PREDICTED: universal stress protein A-like p...    105   6e-24   
ref|XP_002465233.1|  hypothetical protein SORBIDRAFT_01g034670          106   6e-24   
ref|XP_010040271.1|  PREDICTED: universal stress protein A-like p...    105   6e-24   
ref|XP_002301477.2|  hypothetical protein POPTR_0002s20670g             107   7e-24   
ref|XP_004240539.1|  PREDICTED: universal stress protein A-like p...    105   7e-24   
ref|XP_006301618.1|  hypothetical protein CARUB_v10022059mg             105   8e-24   
ref|XP_010415445.1|  PREDICTED: universal stress protein A-like p...    105   8e-24   
ref|XP_011082474.1|  PREDICTED: universal stress protein A-like p...    105   9e-24   
ref|XP_009595892.1|  PREDICTED: universal stress protein A-like p...    105   9e-24   
ref|XP_007144994.1|  hypothetical protein PHAVU_007G200700g             105   9e-24   
gb|ABK22555.1|  unknown                                                 105   1e-23   
gb|AFW56490.1|  hypothetical protein ZEAMMB73_742470                    105   1e-23   
ref|XP_010044258.1|  PREDICTED: universal stress protein A-like p...    105   1e-23   
ref|NP_001043170.1|  Os01g0511100                                       105   1e-23   
ref|XP_003615271.1|  Universal stress protein A-like protein            105   1e-23   
gb|EPZ31257.1|  UspA domain-containing protein                          105   1e-23   
ref|XP_006844758.1|  hypothetical protein AMTR_s00016p00256970          105   1e-23   
ref|NP_001042835.1|  Os01g0303800                                       105   1e-23   
emb|CDO98861.1|  unnamed protein product                                105   1e-23   
ref|XP_007163107.1|  hypothetical protein PHAVU_001G206900g             105   1e-23   
ref|XP_004300460.1|  PREDICTED: stress response protein NhaX-like       105   1e-23   
ref|XP_008797807.1|  PREDICTED: universal stress protein A-like p...    105   1e-23   
ref|XP_008243247.1|  PREDICTED: uncharacterized protein C167.05-like    105   1e-23   
gb|KCW86321.1|  hypothetical protein EUGRSUZ_B03010                     105   1e-23   
ref|XP_004135089.1|  PREDICTED: universal stress protein A-like p...    104   1e-23   
gb|EYU46675.1|  hypothetical protein MIMGU_mgv1a015298mg                104   1e-23   
ref|XP_010041145.1|  PREDICTED: universal stress protein A-like p...    105   1e-23   
ref|XP_010066712.1|  PREDICTED: universal stress protein A-like p...    105   2e-23   
ref|XP_010024118.1|  PREDICTED: universal stress protein A-like p...    105   2e-23   
ref|XP_010523936.1|  PREDICTED: universal stress protein A-like p...    104   2e-23   
ref|XP_004136030.1|  PREDICTED: universal stress protein MJ0531-like    104   2e-23   
ref|XP_008446610.1|  PREDICTED: universal stress protein A-like p...    104   2e-23   
ref|XP_009799461.1|  PREDICTED: universal stress protein A-like p...    104   2e-23   
gb|KFK37511.1|  hypothetical protein AALP_AA4G266700                    104   2e-23   
ref|XP_010507861.1|  PREDICTED: universal stress protein A-like p...    104   2e-23   
ref|XP_010264158.1|  PREDICTED: universal stress protein A-like p...    104   2e-23   
ref|XP_002443334.1|  hypothetical protein SORBIDRAFT_08g017660          104   3e-23   
ref|XP_002980442.1|  hypothetical protein SELMODRAFT_112416             104   3e-23   
ref|XP_006604738.1|  PREDICTED: universal stress protein A-like p...    103   3e-23   
ref|XP_008451574.1|  PREDICTED: uncharacterized protein LOC103492814    103   3e-23   
ref|XP_004242313.1|  PREDICTED: uncharacterized protein LOC101246641    103   3e-23   
ref|NP_001150162.1|  fiber protein Fb19                                 104   3e-23   
ref|XP_010110918.1|  Universal stress protein A-like protein            103   3e-23   
ref|XP_010470770.1|  PREDICTED: universal stress protein A-like p...    103   3e-23   
ref|XP_004490436.1|  PREDICTED: universal stress protein Rv2026c/...    104   3e-23   
ref|XP_010269548.1|  PREDICTED: universal stress protein A-like p...    103   3e-23   
ref|XP_004967556.1|  PREDICTED: uncharacterized protein LOC101759...    103   3e-23   
gb|EPS57241.1|  hypothetical protein M569_17579                         103   3e-23   
gb|EYU40765.1|  hypothetical protein MIMGU_mgv1a025375mg                103   4e-23   
gb|KDP29425.1|  hypothetical protein JCGZ_18346                         103   4e-23   
ref|XP_002882129.1|  universal stress protein family protein            103   4e-23   
ref|XP_009797826.1|  PREDICTED: universal stress protein A-like p...    103   4e-23   
gb|ACF84743.1|  unknown                                                 103   4e-23   
ref|XP_010518486.1|  PREDICTED: universal stress protein A-like p...    103   4e-23   
ref|XP_006662377.1|  PREDICTED: universal stress protein A-like p...    103   4e-23   
ref|XP_004490433.1|  PREDICTED: universal stress protein Rv2026c/...    103   5e-23   
ref|XP_007200378.1|  hypothetical protein PRUPE_ppa012449mg             103   5e-23   
ref|XP_006422530.1|  hypothetical protein CICLE_v10030411mg             103   6e-23   
ref|XP_010038209.1|  PREDICTED: uncharacterized protein LOC104426758    103   6e-23   
gb|EEC70489.1|  hypothetical protein OsI_01560                          103   7e-23   
gb|EYU37241.1|  hypothetical protein MIMGU_mgv1a026191mg                103   7e-23   
ref|XP_009133823.1|  PREDICTED: universal stress protein A-like p...    103   7e-23   
emb|CDX95730.1|  BnaC03g26110D                                          102   7e-23   
ref|XP_004494374.1|  PREDICTED: universal stress protein MJ0531-like    102   8e-23   
ref|XP_006486684.1|  PREDICTED: uncharacterized protein C167.05-like    103   8e-23   
ref|XP_006352812.1|  PREDICTED: uncharacterized protein LOC102580875    102   8e-23   
ref|XP_006342804.1|  PREDICTED: uncharacterized protein C167.05-like    102   8e-23   
ref|XP_004144758.1|  PREDICTED: universal stress protein MJ0577-l...    103   8e-23   
ref|XP_011033550.1|  PREDICTED: uncharacterized protein LOC105132002    102   1e-22   
ref|XP_010321386.1|  PREDICTED: universal stress protein A-like p...    102   1e-22   
ref|XP_010096805.1|  Universal stress protein A-like protein            102   1e-22   
ref|XP_010542168.1|  PREDICTED: universal stress protein A-like p...    102   1e-22   
ref|XP_010046100.1|  PREDICTED: universal stress protein A-like p...    102   1e-22   
gb|KDP28148.1|  hypothetical protein JCGZ_13919                         102   1e-22   
ref|XP_010938498.1|  PREDICTED: universal stress protein A-like p...    103   1e-22   
ref|XP_003615270.1|  Universal stress protein A-like protein            102   1e-22   
ref|XP_002523068.1|  conserved hypothetical protein                     102   1e-22   
ref|XP_007163325.1|  hypothetical protein PHAVU_001G225300g             102   1e-22   
ref|XP_008789877.1|  PREDICTED: universal stress protein A-like p...    102   2e-22   
ref|XP_002489071.1|  hypothetical protein SORBIDRAFT_0139s002020        102   2e-22   
ref|NP_566108.1|  adenine nucleotide alpha hydrolases-like protein      102   2e-22   
ref|NP_001066983.1|  Os12g0552500                                       102   2e-22   
dbj|BAJ89788.1|  predicted protein                                      103   2e-22   
ref|XP_010266116.1|  PREDICTED: uncharacterized protein C167.05         103   2e-22   
gb|AAR07598.1|  fiber protein Fb19                                      101   2e-22   
ref|XP_010040948.1|  PREDICTED: universal stress protein A-like p...    101   2e-22   
ref|XP_004136170.1|  PREDICTED: universal stress protein YxiE-like      101   2e-22   
ref|XP_006649957.1|  PREDICTED: uncharacterized protein C167.05-like    102   2e-22   



>ref|XP_009588426.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Nicotiana tomentosiformis]
Length=188

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 129/171 (75%), Gaps = 13/171 (8%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + + +M+A+D+SEESFYALNWALD++  N         E+ + +ITL+NV+PPF P V+ 
Sbjct  30   KRKMIMVAMDESEESFYALNWALDHLLNNS--------EEETTIITLINVQPPFSPLVYP  81

Query  376  TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
             GPVVFA  T+++  +K+QQ+ A  +LS+A  MC QK VKAETL+LEGDPKDK+C+AA+E
Sbjct  82   AGPVVFAAPTMVEAVKKAQQENATTILSRAFHMCTQKRVKAETLILEGDPKDKICQAADE  141

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPRVPR  708
            + VDLLV+GSRGLG I RAFLGSVSDYC HH HCP+LIVKP     P+ P 
Sbjct  142  LHVDLLVMGSRGLGKIKRAFLGSVSDYCAHHVHCPILIVKP-----PKAPH  187



>gb|EYU18171.1| hypothetical protein MIMGU_mgv1a026609mg [Erythranthe guttata]
Length=172

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 124/167 (74%), Gaps = 0/167 (0%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF  372
            E+  +V++ +DDS+ SFYAL WALDN+F N  +            ITL+NV+P FQPF++
Sbjct  4    EKRMKVLVPMDDSDGSFYALKWALDNLFGNHAASEPPLPAAEENFITLLNVQPLFQPFIY  63

Query  373  HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAE  552
              GPVV+AT  VID  +K QQQ A  +LS+AL +CKQ  VKAETL+LEGD KDK+C+AAE
Sbjct  64   PAGPVVYATPAVIDAVKKGQQQNAANILSRALHICKQNKVKAETLMLEGDAKDKICQAAE  123

Query  553  EMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            E+ VDLLV+GSRGLG I RA LGSVS+YC HHA CPVLIVKP P+ +
Sbjct  124  ELHVDLLVLGSRGLGTIKRALLGSVSNYCAHHATCPVLIVKPPPRSA  170



>ref|XP_009758852.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=189

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 129/171 (75%), Gaps = 13/171 (8%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + + +M+A+D+SEESFYAL WALD++  N         E+ + +ITL+NV+PPF P V+ 
Sbjct  31   KRKMIMVAMDESEESFYALKWALDHLLNNS--------EEETTIITLINVQPPFSPMVYP  82

Query  376  TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
             GPVVFA  T+++  +K+QQ+ A  +LS+A +MC QK VKAETL+LEGDPKDK+C+AA+E
Sbjct  83   AGPVVFAAPTMVEAVKKAQQENATTILSRAFRMCTQKRVKAETLILEGDPKDKICQAADE  142

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPRVPR  708
            + VDLLV+GSRGLG I RAFLGSVSDYC HH HCP+LIVKP     P+ P 
Sbjct  143  LHVDLLVMGSRGLGKIKRAFLGSVSDYCAHHVHCPILIVKP-----PKAPH  188



>ref|XP_004229048.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Solanum lycopersicum]
Length=172

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 128/168 (76%), Gaps = 12/168 (7%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + + +M+AID+SEESFY+L WALDN+  N PS           +ITL+NV+ PF P V+ 
Sbjct  15   RKKMIMVAIDESEESFYSLKWALDNLI-NDPSI----------IITLINVQIPFTPMVYP  63

Query  376  TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
             GPVVFAT TV++  RK QQ+ A  +LS+AL +C+QKMVKAETL++EGDPKD +C+ A E
Sbjct  64   AGPVVFATPTVVEAVRKGQQENATRILSRALHLCQQKMVKAETLIVEGDPKDMICQTAHE  123

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPR  699
            + VDLLV+GSRGLG I RAFLGSVSDYC HH  CP+LIVKP PKE+P+
Sbjct  124  LHVDLLVIGSRGLGKIKRAFLGSVSDYCAHHVQCPILIVKP-PKENPK  170



>gb|AIR07400.1| universal stress protein A [Solanum habrochaites]
Length=172

 Score =   210 bits (534),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 128/168 (76%), Gaps = 12/168 (7%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + + +M+AID+S+E+FYAL WALDN+  N PS           +ITL+NV+ PF P V+ 
Sbjct  15   RKKMIMVAIDESDENFYALKWALDNLI-NDPSI----------IITLINVQIPFTPMVYP  63

Query  376  TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
             GPVVFAT TV++  RK QQ+ A  +LS+AL +C+QKMVKAETL++EGDPKD +C+ A E
Sbjct  64   AGPVVFATPTVVEAVRKRQQENATRILSRALHLCQQKMVKAETLIVEGDPKDMICQTAHE  123

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPR  699
            + VDLLV+GSRGLG I RAFLGSVSDYC HH  CP+LIVKP PKE+P+
Sbjct  124  LHVDLLVIGSRGLGKIKRAFLGSVSDYCAHHVQCPILIVKP-PKENPK  170



>ref|XP_011094180.1| PREDICTED: universal stress protein A-like protein [Sesamum indicum]
Length=184

 Score =   208 bits (530),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 125/162 (77%), Gaps = 6/162 (4%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVF-KNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTG  381
            +V++ +D+S+ SFYAL WALD++F  N P             ITLVNV+P FQPF++  G
Sbjct  24   KVLVPVDESDGSFYALRWALDHLFISNEPQDEQEP-----NTITLVNVQPVFQPFIYPAG  78

Query  382  PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMS  561
            PVV+AT  VID+ +K+Q+Q A  +L++AL +CK K VKAETL+LEGDPKD++C+AAE++ 
Sbjct  79   PVVYATPAVIDSVKKAQEQNAANILARALSICKDKKVKAETLILEGDPKDRICQAAEQLQ  138

Query  562  VDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
            VDL+VVGSRGLG I RA LGSVS+YC HHAHCPVLIVKP PK
Sbjct  139  VDLVVVGSRGLGTIKRALLGSVSNYCAHHAHCPVLIVKPPPK  180



>ref|XP_006337956.1| PREDICTED: universal stress protein A-like protein-like [Solanum 
tuberosum]
Length=179

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 124/167 (74%), Gaps = 12/167 (7%)
 Frame = +1

Query  199  NRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHT  378
             + +M+AID+SEESFYAL WALDN+  N PS           +ITL+NV+ PF P V+  
Sbjct  23   KKMIMVAIDESEESFYALKWALDNLI-NDPSI----------IITLINVQLPFTPMVYPA  71

Query  379  GPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEM  558
            GPVVFA  TV++  +K Q + A  +LS+AL +CKQKMVKAETL+L+GDPKD +C+AA E+
Sbjct  72   GPVVFAAPTVVEAVKKGQHENATRILSRALHLCKQKMVKAETLILDGDPKDMICQAAHEL  131

Query  559  SVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPR  699
              DLLVVGSRGLG I RAFLGSVSDYC HH  CP+LIVKP+ KE P+
Sbjct  132  HADLLVVGSRGLGKIKRAFLGSVSDYCAHHVQCPILIVKPS-KEIPK  177



>ref|XP_002266746.3| PREDICTED: universal stress protein A-like protein isoform X1 
[Vitis vinifera]
Length=212

 Score =   201 bits (512),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 128/161 (80%), Gaps = 4/161 (2%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGPV  387
            VM+A+D SE SFYAL WAL+N+F+ +    +  E +  G++T+V+V+ PF  +V   GP 
Sbjct  48   VMVAVDQSESSFYALQWALENLFRRK---GAAVETEEVGMVTVVHVQQPFHNYVLPAGPG  104

Query  388  VFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVD  567
            ++ATSTVI++ RK+Q+Q +  +LS+AL++CK KMVKAETL+L+GDPK+ +C+AAE+M VD
Sbjct  105  IYATSTVIESVRKAQEQNSSVILSRALRLCKDKMVKAETLILDGDPKEMICQAAEQMHVD  164

Query  568  LLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            LL+VGSRGL  + RAFLGSVSDYC HHA CP+LIVKP P+E
Sbjct  165  LLLVGSRGLSKLKRAFLGSVSDYCAHHAKCPILIVKP-PEE  204



>gb|KDO70762.1| hypothetical protein CISIN_1g044973mg [Citrus sinensis]
Length=197

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  178  ESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPF  357
            E  + +   +VM+A+D+S ESFYAL WALDN+F    +      ++ +G +TLV+V+ PF
Sbjct  19   EEMMGKNEMKVMVALDESGESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPF  78

Query  358  QPFVFHTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPK  528
            Q FVF  GP     +ATS+V  + RK+Q++ +  +LS+ALQ+CK K VKAETLVL GDPK
Sbjct  79   QHFVFPAGPGGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPK  138

Query  529  DKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            D +C+AAE+M +DLLVVGSRGLG I RA LGSVSDYC HH  CP++IVKP PK+
Sbjct  139  DMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPIIIVKPPPKQ  192



>ref|XP_006429980.1| hypothetical protein CICLE_v10012835mg [Citrus clementina]
 gb|ESR43220.1| hypothetical protein CICLE_v10012835mg [Citrus clementina]
Length=197

 Score =   199 bits (506),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 124/165 (75%), Gaps = 3/165 (2%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +VM+A+D+S ESFYAL WALDN+F    +      ++ +G +TLV+V+ PFQ FVF  GP
Sbjct  28   KVMVALDESGESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPFQHFVFPAGP  87

Query  385  ---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
                 +ATS+V  + RK+Q++ +  +LS+ALQ+CK K VKAETLVL GDPKD +C+AAE+
Sbjct  88   GGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMICQAAEQ  147

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            M +DLLVVGSRGLG I RA LGSVSDYC HH  CP++IVKP PK+
Sbjct  148  MHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPIIIVKPPPKQ  192



>ref|XP_006481854.1| PREDICTED: universal stress protein A-like protein-like [Citrus 
sinensis]
Length=197

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  178  ESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPF  357
            E  + +   +VM+A+D+S ESFYAL WALDN+F    +      ++ +G +TLV+V+ PF
Sbjct  19   EEMMGKNEMKVMVALDESGESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPF  78

Query  358  QPFVFHTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPK  528
            Q FVF  GP     +ATS+V  + RK+Q++ +  +LS+ALQ+CK K VKAETLVL GDPK
Sbjct  79   QHFVFPAGPGGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPK  138

Query  529  DKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            D +C+AAE++ +DLLVVGSRGLG I RA LGSVSDYC HH  CP++IVKP PK+
Sbjct  139  DMICQAAEQVHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPIIIVKPPPKQ  192



>ref|XP_007029142.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY09644.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
Length=165

 Score =   196 bits (497),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 123/167 (74%), Gaps = 11/167 (7%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF---H  375
            R M+ ID+S+ESFYAL W LDN+F +            +G++TLV+V+ PFQP+ F    
Sbjct  2    RAMVGIDESDESFYALQWFLDNLFPD------LSAALSAGLLTLVHVQQPFQPYGFPAAR  55

Query  376  TGPVVFATSTVI-DTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAE  552
             G   F  STV+ D+ RKSQ+Q +  +LS+ALQMCK K++KAE+L+LEGDPKD LC  +E
Sbjct  56   PGVAAFYPSTVVADSVRKSQEQTSAALLSRALQMCKDKLIKAESLILEGDPKDMLCEISE  115

Query  553  EMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            +M+VDLL+VGSRGLG I RAFLGSVSDYC HHA CP LIVKP PKE+
Sbjct  116  QMNVDLLIVGSRGLGKIKRAFLGSVSDYCAHHAKCPTLIVKP-PKEA  161



>gb|AID16045.1| putative universal stress protein, partial [Catharanthus roseus]
Length=180

 Score =   195 bits (496),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 124/174 (71%), Gaps = 9/174 (5%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPsh-------hsheeeqhsGVITLVNVRPP  354
            +  +VMI +D+SE SFYAL W LD++F +  +            +E    +IT+V+VR P
Sbjct  6    ERMKVMIPLDESEGSFYALKWVLDHLFNSPTAPTTTTTDLAQSSQEAEPHLITIVHVRQP  65

Query  355  FQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCK-QKMVKAETLVLEGDPKD  531
            F PF++  GPVV+AT  V+D  RK+ +++A  + S+AL MCK QKMVKAETLVLEGDPKD
Sbjct  66   FTPFIYPAGPVVYATPMVVDAVRKANEEIATRIFSRALHMCKDQKMVKAETLVLEGDPKD  125

Query  532  KLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            ++C  A+E   DLLV+GSRGLG I RAFLGSVSDYC HH  CP+LIVKP PKES
Sbjct  126  RICEVADEQHFDLLVIGSRGLGKIKRAFLGSVSDYCAHHVKCPILIVKP-PKES  178



>ref|XP_007029143.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY09645.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 2 [Theobroma cacao]
Length=167

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 122/169 (72%), Gaps = 13/169 (8%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHT--  378
            R M+ ID+S+ESFYAL W LDN+F +            +G++TLV+V+ PFQP+ F    
Sbjct  2    RAMVGIDESDESFYALQWFLDNLFPD------LSAALSAGLLTLVHVQQPFQPYGFPAAR  55

Query  379  ----GPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRA  546
                G   + ++ V D+ RKSQ+Q +  +LS+ALQMCK K++KAE+L+LEGDPKD LC  
Sbjct  56   PGVAGKTFYPSTVVADSVRKSQEQTSAALLSRALQMCKDKLIKAESLILEGDPKDMLCEI  115

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            +E+M+VDLL+VGSRGLG I RAFLGSVSDYC HHA CP LIVKP PKE+
Sbjct  116  SEQMNVDLLIVGSRGLGKIKRAFLGSVSDYCAHHAKCPTLIVKP-PKEA  163



>ref|XP_004303418.1| PREDICTED: universal stress protein YxiE-like [Fragaria vesca 
subsp. vesca]
Length=204

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 125/161 (78%), Gaps = 4/161 (2%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            RVM+AID+S+ SFYAL WALD++F N P       E  +G++T+V+V  PFQ FV+  GP
Sbjct  32   RVMVAIDESDSSFYALTWALDHLFIN-PPSTVEGGEGEAGLVTVVHVTQPFQHFVYPAGP  90

Query  385  ---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
                 +A+++V+++ +K+Q++ +  +LS+ALQ+CK +M+KAETL++ GDPKD +C+A E+
Sbjct  91   GGATYYASASVVESVKKAQEESSAAILSRALQICKDRMIKAETLIMTGDPKDVICQATEQ  150

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
            M VDLLVVGSRGLG + RAFLGSVSDYC HHA CPV+IVKP
Sbjct  151  MHVDLLVVGSRGLGMVKRAFLGSVSDYCAHHAACPVVIVKP  191



>ref|XP_010263144.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Nelumbo nucifera]
Length=187

 Score =   194 bits (492),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 125/159 (79%), Gaps = 2/159 (1%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +V++AID+SE SFYAL WA+DN+F    +  + ++      I L++V+ PFQ ++F +GP
Sbjct  30   KVIVAIDESEGSFYALRWAIDNIFTY--AVAAPDQSLELSKIYLLHVQQPFQHYIFPSGP  87

Query  385  VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSV  564
             V+ATS V+D+ +K+Q+Q +  +L++ALQ+CK++M+KAET++L+GDPKD +C+AAE++  
Sbjct  88   AVYATSAVLDSVKKAQEQNSATLLARALQICKERMIKAETIILDGDPKDVICQAAEQIHA  147

Query  565  DLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            D ++VGSRGLG I RAFLGSVSDYC HH  CPVLIVKPT
Sbjct  148  DYVIVGSRGLGKIKRAFLGSVSDYCAHHVKCPVLIVKPT  186



>gb|KDO70763.1| hypothetical protein CISIN_1g046290mg [Citrus sinensis]
Length=197

 Score =   194 bits (492),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 129/172 (75%), Gaps = 6/172 (3%)
 Frame = +1

Query  184  TVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQP  363
            T  ++  +VM+AID+S ESF AL WALDN++       + E     G++T+V+V+ PFQ 
Sbjct  26   TDGKKKMKVMVAIDESAESFNALKWALDNLYG--IVGFTPEAGGGGGILTIVHVQEPFQR  83

Query  364  FVF---HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDK  534
            FV     T    +ATS+++++ RKSQ++ +  +LS+ALQMCK KMVKAE+LVLEGDPKD 
Sbjct  84   FVLPALSTSSAFYATSSMVESVRKSQEENSAALLSRALQMCKDKMVKAESLVLEGDPKDM  143

Query  535  LCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            +C++AE+M +DLLVVGSRGLG I RAFLGSVSDYC HHA CP++IVKP PKE
Sbjct  144  ICQSAEQMHIDLLVVGSRGLGKIKRAFLGSVSDYCAHHAVCPIIIVKP-PKE  194



>ref|XP_004229049.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Solanum lycopersicum]
Length=162

 Score =   192 bits (488),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 120/168 (71%), Gaps = 22/168 (13%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + + +M+AID+SEESFY+L WALDN+  N PS           +ITL+NV+ PF P V+ 
Sbjct  15   RKKMIMVAIDESEESFYSLKWALDNLI-NDPSI----------IITLINVQIPFTPMVYP  63

Query  376  TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
             GP V          RK QQ+ A  +LS+AL +C+QKMVKAETL++EGDPKD +C+ A E
Sbjct  64   AGPAV----------RKGQQENATRILSRALHLCQQKMVKAETLIVEGDPKDMICQTAHE  113

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPR  699
            + VDLLV+GSRGLG I RAFLGSVSDYC HH  CP+LIVKP PKE+P+
Sbjct  114  LHVDLLVIGSRGLGKIKRAFLGSVSDYCAHHVQCPILIVKP-PKENPK  160



>ref|XP_006481852.1| PREDICTED: universal stress protein A-like protein-like [Citrus 
sinensis]
Length=197

 Score =   192 bits (487),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 128/172 (74%), Gaps = 6/172 (3%)
 Frame = +1

Query  184  TVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQP  363
            T  ++  +VM+AID+S ESF AL WALDN++       + E     G++T+V+V+ PFQ 
Sbjct  26   TDGKKKMKVMVAIDESAESFNALKWALDNLYG--IVGFTPEAGGGGGILTIVHVQEPFQR  83

Query  364  FVF---HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDK  534
            FV     T    +ATS+++++ RKSQ++ +  +LS+ALQMCK KMVKAE+LVLEGDPKD 
Sbjct  84   FVLPALSTSSAFYATSSMVESVRKSQEENSAALLSRALQMCKDKMVKAESLVLEGDPKDM  143

Query  535  LCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            +C++AE+M +DLLVVGSRGLG I RAFLGSVSDYC HH  CP++IVKP PKE
Sbjct  144  ICQSAEQMHIDLLVVGSRGLGKIKRAFLGSVSDYCAHHTVCPIIIVKP-PKE  194



>emb|CDP10546.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 124/164 (76%), Gaps = 3/164 (2%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhs---heeeqhsGVITLVNVRPPFQPF  366
            Q  +VM+A+D+SE SFYAL W L++ F   P+  +    E  + S +IT+V+V+ PFQPF
Sbjct  137  QIMKVMVAVDESEGSFYALKWTLNHFFHQLPAAGAVPPEEPGRESSMITIVHVQEPFQPF  196

Query  367  VFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRA  546
            ++  GP V+AT  V+++ +++Q++ A  VLS+AL MCK   +KAETL+LEGDPKD++C A
Sbjct  197  IYPAGPAVYATPMVVESVKRAQEKNAASVLSRALLMCKDYKIKAETLILEGDPKDRICEA  256

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
            AEE+ VDL+VVGSRGLG I RAFLGSVSDYC HH  CPVLIVKP
Sbjct  257  AEELHVDLVVVGSRGLGKIKRAFLGSVSDYCAHHVRCPVLIVKP  300



>ref|XP_006429978.1| hypothetical protein CICLE_v10012833mg [Citrus clementina]
 gb|ESR43218.1| hypothetical protein CICLE_v10012833mg [Citrus clementina]
Length=197

 Score =   191 bits (486),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 128/172 (74%), Gaps = 6/172 (3%)
 Frame = +1

Query  184  TVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQP  363
            T  ++  +VM+AID+S ES  AL WALDN++       + E     G++T+V+V+ PFQ 
Sbjct  26   TDGKKKMKVMVAIDESAESVNALKWALDNLYG--IVGFTPEAGGGGGILTIVHVQQPFQR  83

Query  364  FVF---HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDK  534
            FV     T    +ATS+++++ RKSQ++ +  +LS+ALQMCK KMVKAE+LVLEGDPKD 
Sbjct  84   FVLPALSTSSAFYATSSMVESVRKSQEENSAALLSRALQMCKDKMVKAESLVLEGDPKDM  143

Query  535  LCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            +C++AE+M +DLLVVGSRGLG I RAFLGSVSDYC HHA CP++IVKP PKE
Sbjct  144  ICQSAEQMHIDLLVVGSRGLGKIKRAFLGSVSDYCAHHAVCPIIIVKP-PKE  194



>ref|XP_011047113.1| PREDICTED: uncharacterized protein LOC105141564 isoform X2 [Populus 
euphratica]
Length=203

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 132/189 (70%), Gaps = 9/189 (5%)
 Frame = +1

Query  145  LNREGVTEIMEESTVPEQN----RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheee  312
            L REG+ E M    + E+      R+M+AIDDS  SFYALN ALDN+  +     +   +
Sbjct  7    LEREGMQEQMPHQPLKEKQIRKRLRIMVAIDDSVGSFYALNLALDNLV-DGIVPTTEPSQ  65

Query  313  qhsGVITLVNVRPPFQPFVF---HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ  483
            + S ++TLV+V+ PFQ  V+     G V + +S++I++ RK+Q + A  +LS+AL MCK 
Sbjct  66   EESSLVTLVHVQQPFQHHVYPAGSGGAVFYVSSSIIESVRKAQAENATALLSRALVMCKD  125

Query  484  KMVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPV  663
            KM+KAETL+LEGDPKDK+CRA E+M  D+LVVGSRGLG I RA LGS SDYC HHA CP+
Sbjct  126  KMIKAETLILEGDPKDKICRATEQMQADVLVVGSRGLGKIKRALLGSRSDYCAHHAKCPI  185

Query  664  LIVKPTPKE  690
            LIVKP PKE
Sbjct  186  LIVKP-PKE  193



>ref|XP_011047112.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Populus euphratica]
Length=204

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 132/190 (69%), Gaps = 10/190 (5%)
 Frame = +1

Query  145  LNREGVTEIMEESTVPEQN----RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheee  312
            L REG+ E M    + E+      R+M+AIDDS  SFYALN ALDN+  +     +   +
Sbjct  7    LEREGMQEQMPHQPLKEKQIRKRLRIMVAIDDSVGSFYALNLALDNLV-DGIVPTTEPSQ  65

Query  313  qhsGVITLVNVRPPFQPFVFHTG----PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCK  480
            + S ++TLV+V+ PFQ  V+  G     V + +S++I++ RK+Q + A  +LS+AL MCK
Sbjct  66   EESSLVTLVHVQQPFQHHVYPAGSGGAAVFYVSSSIIESVRKAQAENATALLSRALVMCK  125

Query  481  QKMVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCP  660
             KM+KAETL+LEGDPKDK+CRA E+M  D+LVVGSRGLG I RA LGS SDYC HHA CP
Sbjct  126  DKMIKAETLILEGDPKDKICRATEQMQADVLVVGSRGLGKIKRALLGSRSDYCAHHAKCP  185

Query  661  VLIVKPTPKE  690
            +LIVKP PKE
Sbjct  186  ILIVKP-PKE  194



>gb|KCW48157.1| hypothetical protein EUGRSUZ_K01888 [Eucalyptus grandis]
Length=207

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 129/185 (70%), Gaps = 7/185 (4%)
 Frame = +1

Query  160  VTEIMEESTVPEQN--RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVIT  333
            V  +M+E    E     +VM+A+D+SE SFYAL W LD++ + R S     +     +IT
Sbjct  24   VGMVMQEPVAAETKLKMKVMVAVDESEGSFYALRWTLDHLLR-RSSPALAADGDEVEMIT  82

Query  334  LVNVRPPFQPFVFHTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAET  504
            LV+V+ PFQ + F  GP     +A S+V+++ RK+Q++ +  +LS+AL MCK+ MVKAET
Sbjct  83   LVHVQQPFQHYAFPAGPGGAAFYAASSVVESVRKAQEENSALILSRALHMCKESMVKAET  142

Query  505  LVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
            L+L GDPKD +C+A E+M  DLLVVGSRGLG I RAFLGS SDYC HHA CP+LIVKP P
Sbjct  143  LILIGDPKDMICQATEQMHTDLLVVGSRGLGKIKRAFLGSGSDYCAHHAKCPILIVKP-P  201

Query  685  KESPR  699
            KE+ +
Sbjct  202  KEASK  206



>gb|KDP21925.1| hypothetical protein JCGZ_03063 [Jatropha curcas]
Length=187

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 125/175 (71%), Gaps = 16/175 (9%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFK-----NRPshhsheeeqhsGVITLVNVRPPFQ  360
            Q  +VM+A+D+S+ SFYAL W+LDN+       N PS          G++TLV+V+ PFQ
Sbjct  16   QKMKVMVALDESDGSFYALQWSLDNLIDGVSATNEPSLQES------GLVTLVHVQQPFQ  69

Query  361  PFVFHTGP----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPK  528
            P  +  GP      +  +T++++ RK+Q + +  +LS+AL+MC +KM+KAETL+LEGD K
Sbjct  70   PSFYPVGPGGAAAFYPPTTLMESVRKAQAENSAAILSRALKMCNEKMIKAETLILEGDAK  129

Query  529  DKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            DK+ +A E+M VDLLVVGSRGLG I RAFLGSVSDYC HHA CP+LIVKP PKE+
Sbjct  130  DKISQATEQMDVDLLVVGSRGLGKIKRAFLGSVSDYCAHHAKCPILIVKP-PKET  183



>ref|XP_009376345.1| PREDICTED: uncharacterized protein LOC103965052 [Pyrus x bretschneideri]
Length=205

 Score =   188 bits (478),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 127/175 (73%), Gaps = 13/175 (7%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVF---------KNRPshhsheeeqhsGVITLVNVRPPF  357
            RVM+AID+S+ SFYAL WALD++F             +      +++  ++TLV+V  PF
Sbjct  29   RVMVAIDESDWSFYALKWALDHLFVGATDQVAISTGTATVEAASQENVSMMTLVHVMKPF  88

Query  358  QPFVFHTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPK  528
            Q +V   GP     +AT +V+++ RK+Q++ A  VLS+AL++C +KM+K+ETL+L GDPK
Sbjct  89   QHYVLPAGPGATAFYATPSVLESIRKAQEESAASVLSRALEICNEKMIKSETLILGGDPK  148

Query  529  DKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            D +C+AAE+M VDLLVVGSRGLG + RAFLGSVSDYC HHA CPV+IVKP PKES
Sbjct  149  DMICQAAEQMHVDLLVVGSRGLGMVKRAFLGSVSDYCAHHATCPVVIVKP-PKES  202



>ref|XP_010105075.1| Universal stress protein A-like protein [Morus notabilis]
 gb|EXC03813.1| Universal stress protein A-like protein [Morus notabilis]
Length=189

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 130/172 (76%), Gaps = 8/172 (5%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKN-RPshhsheeeqhsGV--ITLVNVRPPFQPFVFH  375
            RVM+A+D+S+ SF+AL WALD+VF    P+    EE     V  + LV+V+ PF  + F 
Sbjct  19   RVMVAMDESDFSFHALKWALDHVFVTPEPAAEKTEEASPEEVDMVVLVHVQEPFVHYGFP  78

Query  376  TGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQK-MVKAETLVLEGDPKDKLCR  543
             GP    V+AT+TV+++ RK+Q++ +  +LS+ALQMCK+K  +KAETL+LEGDPKD++C+
Sbjct  79   AGPGGTAVYATTTVVESVRKAQEENSAALLSRALQMCKEKPNIKAETLMLEGDPKDRICQ  138

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPR  699
            A E+M VDLLVVGSRGLG I RAFLGSVSDYC HHA CPVLIVKP PKE+ +
Sbjct  139  ATEQMHVDLLVVGSRGLGTIKRAFLGSVSDYCTHHAKCPVLIVKP-PKETAK  189



>ref|XP_010036539.1| PREDICTED: universal stress protein A-like protein [Eucalyptus 
grandis]
Length=250

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 129/185 (70%), Gaps = 7/185 (4%)
 Frame = +1

Query  160  VTEIMEESTVPEQN--RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVIT  333
            V  +M+E    E     +VM+A+D+SE SFYAL W LD++ + R S     +     +IT
Sbjct  67   VGMVMQEPVAAETKLKMKVMVAVDESEGSFYALRWTLDHLLR-RSSPALAADGDEVEMIT  125

Query  334  LVNVRPPFQPFVFHTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAET  504
            LV+V+ PFQ + F  GP     +A S+V+++ RK+Q++ +  +LS+AL MCK+ MVKAET
Sbjct  126  LVHVQQPFQHYAFPAGPGGAAFYAASSVVESVRKAQEENSALILSRALHMCKESMVKAET  185

Query  505  LVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
            L+L GDPKD +C+A E+M  DLLVVGSRGLG I RAFLGS SDYC HHA CP+LIVKP P
Sbjct  186  LILIGDPKDMICQATEQMHTDLLVVGSRGLGKIKRAFLGSGSDYCAHHAKCPILIVKP-P  244

Query  685  KESPR  699
            KE+ +
Sbjct  245  KEASK  249



>ref|XP_006407393.1| hypothetical protein EUTSA_v10021565mg [Eutrema salsugineum]
 gb|ESQ48846.1| hypothetical protein EUTSA_v10021565mg [Eutrema salsugineum]
Length=193

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 130/198 (66%), Gaps = 21/198 (11%)
 Frame = +1

Query  145  LNREGVTEIMEESTVPEQ-----------NRRVMIAIDDSEESFYALNWALDNVFKNRPs  291
            +  +  T  ME +TV +Q            +R+M+AID+S+ SFY L W +D+      S
Sbjct  1    MAEDQATAAMETTTVEKQPEMTETPSVTTTKRIMVAIDESDSSFYVLQWVIDHF-----S  55

Query  292  hhsheeeqhsGVITLVNVRPPFQPF-VFHTGP---VVFATSTVIDTYRKSQQQMAKEVLS  459
                      G++T+++V+ PFQ F  F  GP    V+A+S++I+  +KSQQ+ +  +LS
Sbjct  56   SLLATTLAEGGLLTVIHVQSPFQHFTAFPAGPGSATVYASSSMIEAVKKSQQKASAALLS  115

Query  460  KALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYC  639
            +ALQMC+ K ++ ETLVLEGD KD +C+A E+M VDLL VGSRGLG I RAFLGSVSDYC
Sbjct  116  RALQMCRAKQIRTETLVLEGDAKDMICQAVEQMHVDLLAVGSRGLGKIKRAFLGSVSDYC  175

Query  640  LHHAHCPVLIVKPTPKES  693
             HHA CP+LIVKP PKE+
Sbjct  176  AHHAKCPILIVKP-PKET  192



>ref|XP_006407394.1| hypothetical protein EUTSA_v10021565mg [Eutrema salsugineum]
 gb|ESQ48847.1| hypothetical protein EUTSA_v10021565mg [Eutrema salsugineum]
Length=194

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 130/199 (65%), Gaps = 22/199 (11%)
 Frame = +1

Query  145  LNREGVTEIMEESTVPEQ-----------NRRVMIAIDDSEESFYALNWALDNVFKNRPs  291
            +  +  T  ME +TV +Q            +R+M+AID+S+ SFY L W +D+      S
Sbjct  1    MAEDQATAAMETTTVEKQPEMTETPSVTTTKRIMVAIDESDSSFYVLQWVIDHF-----S  55

Query  292  hhsheeeqhsGVITLVNVRPPFQPF-VFHTGP----VVFATSTVIDTYRKSQQQMAKEVL  456
                      G++T+++V+ PFQ F  F  GP     V+A+S++I+  +KSQQ+ +  +L
Sbjct  56   SLLATTLAEGGLLTVIHVQSPFQHFTAFPAGPGSATAVYASSSMIEAVKKSQQKASAALL  115

Query  457  SKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDY  636
            S+ALQMC+ K ++ ETLVLEGD KD +C+A E+M VDLL VGSRGLG I RAFLGSVSDY
Sbjct  116  SRALQMCRAKQIRTETLVLEGDAKDMICQAVEQMHVDLLAVGSRGLGKIKRAFLGSVSDY  175

Query  637  CLHHAHCPVLIVKPTPKES  693
            C HHA CP+LIVKP PKE+
Sbjct  176  CAHHAKCPILIVKP-PKET  193



>ref|XP_002323356.2| hypothetical protein POPTR_0016s06400g [Populus trichocarpa]
 gb|EEF05117.2| hypothetical protein POPTR_0016s06400g [Populus trichocarpa]
Length=213

 Score =   187 bits (474),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 126/165 (76%), Gaps = 5/165 (3%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            R+M+AID+S+ SFYAL WALD++  +  +  +   ++ S +ITLV+V+ PFQ  V   GP
Sbjct  35   RIMVAIDESDGSFYALKWALDHLV-DGITPTNVPSQEESSLITLVHVQQPFQHSVIPAGP  93

Query  385  ---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
                 +AT +++++ R++Q +    +LS+ALQMCK KM+KAE+L+LEG+PKDK+C+A E+
Sbjct  94   GGAAFYATPSIVESVREAQAENDAALLSRALQMCKDKMIKAESLILEGEPKDKICQATEQ  153

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            M VDLLV+GSRGLG I RAFLGSVSDYC HHA CPVLIVKP PKE
Sbjct  154  MQVDLLVLGSRGLGKIKRAFLGSVSDYCAHHAKCPVLIVKP-PKE  197



>ref|XP_007202546.1| hypothetical protein PRUPE_ppa011155mg [Prunus persica]
 gb|EMJ03745.1| hypothetical protein PRUPE_ppa011155mg [Prunus persica]
Length=221

 Score =   187 bits (475),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 132/196 (67%), Gaps = 15/196 (8%)
 Frame = +1

Query  163  TEIMEESTVPEQNR---RVMIAIDDSEESFYALNWALDNVFKN--------RPshhshee  309
            T++ E++   +Q +   RVM+AID+SE SFYAL WALD++F                   
Sbjct  3    TKVAEQAVEEQQGKKKMRVMVAIDESEWSFYALKWALDHLFVGPNDKAGVAATREAPAVS  62

Query  310  eqhsGVITLVNVRPPFQPFVFHTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCK  480
            +++  + TLV+V PPF  +V   GP     + T  ++++ RK+Q+  A +VLS+AL++CK
Sbjct  63   QENVSMATLVHVMPPFYNYVLPAGPGGAAYYVTPALLESVRKAQEDGAADVLSRALEICK  122

Query  481  QKMVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCP  660
             KM+KAETL+L GDPKD +C A E+  VDLLVVGSRGLG + RAFLGSVSDYC HHA CP
Sbjct  123  DKMIKAETLILRGDPKDMICEATEQSHVDLLVVGSRGLGMVKRAFLGSVSDYCAHHAKCP  182

Query  661  VLIVKPTPKESPRVPR  708
            V+IVKP PKES + P+
Sbjct  183  VVIVKP-PKESGKPPK  197



>ref|XP_008241214.1| PREDICTED: uncharacterized protein LOC103339659 [Prunus mume]
Length=208

 Score =   186 bits (471),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 128/183 (70%), Gaps = 12/183 (7%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNVF--KNRPshhsheeeqhsG------VITLVNVR  348
            E+  RVM+AID+SE SFYAL WALD++F   N  +  +   E  +G      + TLV+V 
Sbjct  22   EKKMRVMVAIDESEWSFYALKWALDHLFVGPNDKAGVAATLEAPAGSQENVSMATLVHVM  81

Query  349  PPFQPFVFHTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEG  519
            PPF  +V   GP     + T  ++++ RK+Q+  A +VLS+AL++CK KM+KAET++L G
Sbjct  82   PPFYNYVLPAGPGGAAYYVTPALLESVRKAQEDGAADVLSRALEICKDKMIKAETVILRG  141

Query  520  DPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPR  699
            DPKD +C A E+  VDLLVVGSRGLG + RAFLGSVSDYC HHA CPV+IVKP PKES +
Sbjct  142  DPKDMICEATEQRHVDLLVVGSRGLGMVKRAFLGSVSDYCAHHAKCPVVIVKP-PKESGK  200

Query  700  VPR  708
             P+
Sbjct  201  PPK  203



>ref|XP_010653225.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Vitis vinifera]
Length=205

 Score =   186 bits (471),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 122/161 (76%), Gaps = 11/161 (7%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGPV  387
            VM+A+D SE SFYAL WAL+N+F+ +    +  E +  G++T+V+V+ PF  +V   GPV
Sbjct  48   VMVAVDQSESSFYALQWALENLFRRK---GAAVETEEVGMVTVVHVQQPFHNYVLPAGPV  104

Query  388  VFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVD  567
                   I++ RK+Q+Q +  +LS+AL++CK KMVKAETL+L+GDPK+ +C+AAE+M VD
Sbjct  105  -------IESVRKAQEQNSSVILSRALRLCKDKMVKAETLILDGDPKEMICQAAEQMHVD  157

Query  568  LLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            LL+VGSRGL  + RAFLGSVSDYC HHA CP+LIVKP P+E
Sbjct  158  LLLVGSRGLSKLKRAFLGSVSDYCAHHAKCPILIVKP-PEE  197



>ref|XP_010263143.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Nelumbo nucifera]
Length=199

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 125/171 (73%), Gaps = 14/171 (8%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +V++AID+SE SFYAL WA+DN+F    +  + ++      I L++V+ PFQ ++F +GP
Sbjct  30   KVIVAIDESEGSFYALRWAIDNIFTY--AVAAPDQSLELSKIYLLHVQQPFQHYIFPSGP  87

Query  385  VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKM------------VKAETLVLEGDPK  528
             V+ATS V+D+ +K+Q+Q +  +L++ALQ+CK++M            +KAET++L+GDPK
Sbjct  88   AVYATSAVLDSVKKAQEQNSATLLARALQICKERMACDTTGVLNPVQIKAETIILDGDPK  147

Query  529  DKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            D +C+AAE++  D ++VGSRGLG I RAFLGSVSDYC HH  CPVLIVKPT
Sbjct  148  DVICQAAEQIHADYVIVGSRGLGKIKRAFLGSVSDYCAHHVKCPVLIVKPT  198



>ref|XP_011042515.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
Length=181

 Score =   182 bits (462),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 125/166 (75%), Gaps = 6/166 (4%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            R+M+AID+S+ SFYAL WALD++  +R +  +   ++ S +ITLV+V+ PFQ  +   GP
Sbjct  2    RIMVAIDESDGSFYALKWALDHLV-DRITPTNVPSQEESSLITLVHVQLPFQHHMIPAGP  60

Query  385  ----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAE  552
                  +AT +++++ RK+Q +    + S+ALQMCK KM+KAE+L+LEG+PK+K+C+A E
Sbjct  61   GGAAAFYATPSIVESVRKAQAENDAALQSRALQMCKDKMIKAESLILEGEPKNKICQATE  120

Query  553  EMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            +M VDLLV+GSRGLG I RA LGSVSDYC HHA CPVLIVKP PKE
Sbjct  121  QMQVDLLVLGSRGLGKIKRAILGSVSDYCAHHAKCPVLIVKP-PKE  165



>ref|XP_006429977.1| hypothetical protein CICLE_v10012833mg [Citrus clementina]
 gb|ESR43217.1| hypothetical protein CICLE_v10012833mg [Citrus clementina]
Length=188

 Score =   182 bits (463),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 123/169 (73%), Gaps = 9/169 (5%)
 Frame = +1

Query  184  TVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQP  363
            T  ++  +VM+AID+S ES  AL WALDN++       + E     G++T+V+V+ PFQ 
Sbjct  26   TDGKKKMKVMVAIDESAESVNALKWALDNLYG--IVGFTPEAGGGGGILTIVHVQQPFQR  83

Query  364  FVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCR  543
            FV        A ST  ++ RKSQ++ +  +LS+ALQMCK KMVKAE+LVLEGDPKD +C+
Sbjct  84   FVLP------ALSTSSESVRKSQEENSAALLSRALQMCKDKMVKAESLVLEGDPKDMICQ  137

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            +AE+M +DLLVVGSRGLG I RAFLGSVSDYC HHA CP++IVKP PKE
Sbjct  138  SAEQMHIDLLVVGSRGLGKIKRAFLGSVSDYCAHHAVCPIIIVKP-PKE  185



>ref|XP_006296619.1| hypothetical protein CARUB_v10014583mg, partial [Capsella rubella]
 gb|EOA29517.1| hypothetical protein CARUB_v10014583mg, partial [Capsella rubella]
Length=220

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 132/194 (68%), Gaps = 18/194 (9%)
 Frame = +1

Query  154  EGVTEIMEESTVPEQ-----------NRRVMIAIDDSEESFYALNWALDNVFKNRPshhs  300
            +G    ME + V +Q            +R+M+AID+S+ SFYAL W +D+ F N     +
Sbjct  26   QGAATAMETTAVEKQPEAEAAPSVPKTKRMMVAIDESDSSFYALQWVIDH-FSNL-LMTT  83

Query  301  heeeqhsGVITLVNVRPPFQPFV-FHTGP---VVFATSTVIDTYRKSQQQMAKEVLSKAL  468
               E   G++T+V+V+ PF  F  F  GP    V+A+ST+I++ +K+QQ+ +  +LS+AL
Sbjct  84   EAAEGDGGMLTVVHVQSPFHHFAAFPAGPGGATVYASSTMIESVKKAQQETSAALLSRAL  143

Query  469  QMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHH  648
            QMC+ K ++ ETLVLEG+ K+ +C A E+M VDLLVVGSRGLG I RAF+GSVSDYC HH
Sbjct  144  QMCRAKQIRTETLVLEGEAKEMICEAVEQMHVDLLVVGSRGLGKIKRAFIGSVSDYCAHH  203

Query  649  AHCPVLIVKPTPKE  690
            A+CP+LIVKP PKE
Sbjct  204  ANCPILIVKP-PKE  216



>ref|XP_006296620.1| hypothetical protein CARUB_v10014583mg, partial [Capsella rubella]
 gb|EOA29518.1| hypothetical protein CARUB_v10014583mg, partial [Capsella rubella]
Length=221

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 132/195 (68%), Gaps = 19/195 (10%)
 Frame = +1

Query  154  EGVTEIMEESTVPEQ-----------NRRVMIAIDDSEESFYALNWALDNVFKNRPshhs  300
            +G    ME + V +Q            +R+M+AID+S+ SFYAL W +D+ F N     +
Sbjct  26   QGAATAMETTAVEKQPEAEAAPSVPKTKRMMVAIDESDSSFYALQWVIDH-FSNL-LMTT  83

Query  301  heeeqhsGVITLVNVRPPFQPFV-FHTGP----VVFATSTVIDTYRKSQQQMAKEVLSKA  465
               E   G++T+V+V+ PF  F  F  GP     V+A+ST+I++ +K+QQ+ +  +LS+A
Sbjct  84   EAAEGDGGMLTVVHVQSPFHHFAAFPAGPGGATAVYASSTMIESVKKAQQETSAALLSRA  143

Query  466  LQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLH  645
            LQMC+ K ++ ETLVLEG+ K+ +C A E+M VDLLVVGSRGLG I RAF+GSVSDYC H
Sbjct  144  LQMCRAKQIRTETLVLEGEAKEMICEAVEQMHVDLLVVGSRGLGKIKRAFIGSVSDYCAH  203

Query  646  HAHCPVLIVKPTPKE  690
            HA+CP+LIVKP PKE
Sbjct  204  HANCPILIVKP-PKE  217



>ref|XP_010524871.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Tarenaya hassleriana]
Length=183

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 124/175 (71%), Gaps = 10/175 (6%)
 Frame = +1

Query  178  ESTVPEQNRRVMIAIDDSEESFYALNWALD---NVFKNRPshhsheeeqhsGVITLVNVR  348
            ES V  +  RV++A+D+SE SFYA+ WA+D   +V    P           G++TL++V 
Sbjct  2    ESEVERKKLRVLVAVDESENSFYAIEWAMDHLRDVISAEPDTGRAG-----GLLTLLHVH  56

Query  349  PPFQPFVFHTG-PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDP  525
            PP+  +V+  G   VFA ++V ++ +K +++    + ++ALQ+C+ KMVKAETLVLEGDP
Sbjct  57   PPYAHYVYPAGSAAVFAATSVPESVKKEREERTAALFTRALQICRGKMVKAETLVLEGDP  116

Query  526  KDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            KD +C+A E+M VDLLV+G+RGLG I RAFLGSVSDYC HHA CP+LIVKP P+E
Sbjct  117  KDVICQAVEQMHVDLLVIGNRGLGMIKRAFLGSVSDYCAHHAKCPILIVKP-PRE  170



>ref|XP_011094181.1| PREDICTED: uncharacterized protein C167.05-like [Sesamum indicum]
Length=178

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 120/183 (66%), Gaps = 10/183 (5%)
 Frame = +1

Query  154  EGVTEIMEESTVPEQNR--RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGV  327
            EG T     ST  E  +   V++AIDDS+ESF+AL W LD + K  P+  +   E    V
Sbjct  2    EGATTGSSGSTAAEVEKAMNVLVAIDDSDESFHALQWVLDKILKRSPATEAAAPESSRPV  61

Query  328  ITLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKM-VKAET  504
            +T+V+V      + FH G VV       D  RK Q+Q A  +LS+A ++C+ K+ + A+T
Sbjct  62   VTIVHVVESLARYAFHGGHVV-------DYGRKEQEQNAARILSRAFEICRDKLSLNAKT  114

Query  505  LVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
            L+LEGDPKDK+CRA EEM ++LLVVGSRGLG I RAFLGSVSDYC HHA CPVL+VKP  
Sbjct  115  LILEGDPKDKICRAVEEMDINLLVVGSRGLGQIKRAFLGSVSDYCAHHAKCPVLVVKPPR  174

Query  685  KES  693
            K +
Sbjct  175  KRT  177



>ref|XP_010486865.1| PREDICTED: uncharacterized protein LOC104764950 isoform X3 [Camelina 
sativa]
Length=200

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 124/169 (73%), Gaps = 5/169 (3%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-F  372
            + +R+M+AID+S+ SFYAL W +D+      +  +   E   G++T+V+V+ PF  F  F
Sbjct  29   RTKRMMVAIDESDSSFYALQWVIDHFSNLLMTTGTEAAESEGGMLTVVHVQSPFHHFAAF  88

Query  373  HTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCR  543
              GP    V+A+ST+I++ +K+QQ+ +  +LS+ALQ+C+ K ++ ETLVLEG+ K+ +C 
Sbjct  89   PAGPGGATVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKEMICE  148

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            A E+M VDLL+VGSRGLG I RAF+GSVSDYC HHA+CP+LIVKP PKE
Sbjct  149  AVEQMHVDLLIVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKP-PKE  196



>ref|XP_002882756.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59015.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=200

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 125/169 (74%), Gaps = 8/169 (5%)
 Frame = +1

Query  199  NRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-FH  375
             +R+++AID+S+ SFYAL W +D+ F N     +   E  SG++T+V+V+ P+  F  F 
Sbjct  32   TKRMVVAIDESDSSFYALQWVIDH-FSNL-LLTTEAAEAESGMLTVVHVQSPYYHFAAFP  89

Query  376  TGP----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCR  543
             GP     V+A+ST+I++ +K+QQ+ +  +LS+ALQMC+ K ++ ETLVLEGD K+ +C 
Sbjct  90   AGPGGATAVYASSTMIESVKKAQQETSAALLSRALQMCRAKQIRTETLVLEGDAKEMICE  149

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            A E+M VDLLVVGSRGLG I RAFLGSVSDYC HHA+CP+LIVKP PKE
Sbjct  150  AVEQMHVDLLVVGSRGLGKIKRAFLGSVSDYCAHHANCPILIVKP-PKE  197



>ref|XP_010498281.1| PREDICTED: uncharacterized protein LOC104775979 isoform X3 [Camelina 
sativa]
Length=204

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 124/169 (73%), Gaps = 5/169 (3%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-F  372
            + +R+M+AID+S+ SFYAL W +D+      +  +   E   G++T+V+V+ PF  F  F
Sbjct  33   RTKRMMVAIDESDSSFYALQWVIDHFSNLLMTTGTEAAESEGGMLTVVHVQSPFHHFAAF  92

Query  373  HTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCR  543
              GP    V+A+ST+I++ +K+QQ+ +  +LS+ALQ+C+ K ++ ETLVLEG+ K+ +C 
Sbjct  93   PAGPGGATVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKEMICE  152

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            A E+M VDLL+VGSRGLG I RAF+GSVSDYC HHA+CP+LIVKP PKE
Sbjct  153  AVEQMHVDLLIVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKP-PKE  200



>ref|XP_010486864.1| PREDICTED: uncharacterized protein LOC104764950 isoform X2 [Camelina 
sativa]
Length=201

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 124/170 (73%), Gaps = 6/170 (4%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-F  372
            + +R+M+AID+S+ SFYAL W +D+      +  +   E   G++T+V+V+ PF  F  F
Sbjct  29   RTKRMMVAIDESDSSFYALQWVIDHFSNLLMTTGTEAAESEGGMLTVVHVQSPFHHFAAF  88

Query  373  HTGP----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLC  540
              GP     V+A+ST+I++ +K+QQ+ +  +LS+ALQ+C+ K ++ ETLVLEG+ K+ +C
Sbjct  89   PAGPGGATAVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKEMIC  148

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
             A E+M VDLL+VGSRGLG I RAF+GSVSDYC HHA+CP+LIVKP PKE
Sbjct  149  EAVEQMHVDLLIVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKP-PKE  197



>ref|NP_566406.1| universal stress protein-like protein [Arabidopsis thaliana]
 gb|AEE75119.1| universal stress protein-like protein [Arabidopsis thaliana]
Length=199

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 129/180 (72%), Gaps = 8/180 (4%)
 Frame = +1

Query  166  EIMEESTVPE-QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVN  342
            E   E+  P    +R+++AID+S+ SFYAL W +D+ F N     +   E  SG++T+++
Sbjct  20   ETTTEAEAPSLTTKRMVVAIDESDSSFYALQWVIDH-FSNL-LLTTAAAEAESGMLTVIH  77

Query  343  VRPPFQPFV-FHTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLV  510
            V+ PF  F  F  GP    V+A+S++I++ +K+QQ+ +  +LS+ALQMC+ K ++ ETLV
Sbjct  78   VQSPFNHFAAFPAGPGGATVYASSSMIESVKKAQQETSAALLSRALQMCRAKQIRTETLV  137

Query  511  LEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            LEG+ K+ +C A E+M VDLLVVGSRGLG I RAFLGSVSDYC HHA+CP+LIVKP PKE
Sbjct  138  LEGEAKEMICEAVEKMHVDLLVVGSRGLGKIKRAFLGSVSDYCAHHANCPILIVKP-PKE  196



>ref|NP_850562.1| universal stress protein-like protein [Arabidopsis thaliana]
 gb|AAF23209.1|AC016795_22 unknown protein [Arabidopsis thaliana]
 gb|AAK49598.1|AF372882_1 MEC18.3/MEC18.3 [Arabidopsis thaliana]
 gb|AAL16217.1|AF428448_1 At3g11930/MEC18.3 [Arabidopsis thaliana]
 dbj|BAB03102.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK91376.1| MEC18.3/MEC18.3 [Arabidopsis thaliana]
 gb|AAL15351.1| AT3g11930/MEC18.3 [Arabidopsis thaliana]
 gb|AEE75121.1| universal stress protein-like protein [Arabidopsis thaliana]
Length=200

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 129/181 (71%), Gaps = 9/181 (5%)
 Frame = +1

Query  166  EIMEESTVPE-QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVN  342
            E   E+  P    +R+++AID+S+ SFYAL W +D+ F N     +   E  SG++T+++
Sbjct  20   ETTTEAEAPSLTTKRMVVAIDESDSSFYALQWVIDH-FSNL-LLTTAAAEAESGMLTVIH  77

Query  343  VRPPFQPFV-FHTGP----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETL  507
            V+ PF  F  F  GP     V+A+S++I++ +K+QQ+ +  +LS+ALQMC+ K ++ ETL
Sbjct  78   VQSPFNHFAAFPAGPGGATAVYASSSMIESVKKAQQETSAALLSRALQMCRAKQIRTETL  137

Query  508  VLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
            VLEG+ K+ +C A E+M VDLLVVGSRGLG I RAFLGSVSDYC HHA+CP+LIVKP PK
Sbjct  138  VLEGEAKEMICEAVEKMHVDLLVVGSRGLGKIKRAFLGSVSDYCAHHANCPILIVKP-PK  196

Query  688  E  690
            E
Sbjct  197  E  197



>ref|XP_010498273.1| PREDICTED: uncharacterized protein LOC104775979 isoform X2 [Camelina 
sativa]
Length=205

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 124/170 (73%), Gaps = 6/170 (4%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-F  372
            + +R+M+AID+S+ SFYAL W +D+      +  +   E   G++T+V+V+ PF  F  F
Sbjct  33   RTKRMMVAIDESDSSFYALQWVIDHFSNLLMTTGTEAAESEGGMLTVVHVQSPFHHFAAF  92

Query  373  HTGP----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLC  540
              GP     V+A+ST+I++ +K+QQ+ +  +LS+ALQ+C+ K ++ ETLVLEG+ K+ +C
Sbjct  93   PAGPGGATAVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKEMIC  152

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
             A E+M VDLL+VGSRGLG I RAF+GSVSDYC HHA+CP+LIVKP PKE
Sbjct  153  EAVEQMHVDLLIVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKP-PKE  201



>ref|XP_010486863.1| PREDICTED: uncharacterized protein LOC104764950 isoform X1 [Camelina 
sativa]
Length=202

 Score =   181 bits (459),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 124/171 (73%), Gaps = 7/171 (4%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-F  372
            + +R+M+AID+S+ SFYAL W +D+      +  +   E   G++T+V+V+ PF  F  F
Sbjct  29   RTKRMMVAIDESDSSFYALQWVIDHFSNLLMTTGTEAAESEGGMLTVVHVQSPFHHFAAF  88

Query  373  HTGP-----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKL  537
              GP      V+A+ST+I++ +K+QQ+ +  +LS+ALQ+C+ K ++ ETLVLEG+ K+ +
Sbjct  89   PAGPGGATAAVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKEMI  148

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            C A E+M VDLL+VGSRGLG I RAF+GSVSDYC HHA+CP+LIVKP PKE
Sbjct  149  CEAVEQMHVDLLIVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKP-PKE  198



>ref|XP_009121035.1| PREDICTED: uncharacterized protein LOC103845875 isoform X2 [Brassica 
rapa]
Length=199

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 124/168 (74%), Gaps = 7/168 (4%)
 Frame = +1

Query  199  NRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-FH  375
             +R+M+AID+S+ SFYAL W +D+ F N     +   E   G++T+V+V+ P   F  F 
Sbjct  32   TKRMMVAIDESDSSFYALQWVIDH-FSNL-LMTTEAAEAEGGLLTVVHVQSPSHHFAAFP  89

Query  376  TGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRA  546
             GP    V+A+S++I++ +K+QQ+ +  +LS+ALQMC+ K ++ ETLVLEG+ KD +C+A
Sbjct  90   AGPGGATVYASSSMIESVKKAQQEASAALLSRALQMCRAKQIRTETLVLEGEAKDMICQA  149

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
             E+M VDLLVVGSRGLG I RAF+GSVSDYC HHA+CP+LIVKP PKE
Sbjct  150  VEQMHVDLLVVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKP-PKE  196



>ref|XP_010498264.1| PREDICTED: uncharacterized protein LOC104775979 isoform X1 [Camelina 
sativa]
Length=206

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 124/171 (73%), Gaps = 7/171 (4%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-F  372
            + +R+M+AID+S+ SFYAL W +D+      +  +   E   G++T+V+V+ PF  F  F
Sbjct  33   RTKRMMVAIDESDSSFYALQWVIDHFSNLLMTTGTEAAESEGGMLTVVHVQSPFHHFAAF  92

Query  373  HTGP-----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKL  537
              GP      V+A+ST+I++ +K+QQ+ +  +LS+ALQ+C+ K ++ ETLVLEG+ K+ +
Sbjct  93   PAGPGGATAAVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKEMI  152

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            C A E+M VDLL+VGSRGLG I RAF+GSVSDYC HHA+CP+LIVKP PKE
Sbjct  153  CEAVEQMHVDLLIVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKP-PKE  202



>ref|NP_001030675.1| universal stress protein-like protein [Arabidopsis thaliana]
 gb|AEE75122.1| universal stress protein-like protein [Arabidopsis thaliana]
Length=201

 Score =   181 bits (458),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 129/182 (71%), Gaps = 10/182 (5%)
 Frame = +1

Query  166  EIMEESTVPE-QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVN  342
            E   E+  P    +R+++AID+S+ SFYAL W +D+ F N     +   E  SG++T+++
Sbjct  20   ETTTEAEAPSLTTKRMVVAIDESDSSFYALQWVIDH-FSNL-LLTTAAAEAESGMLTVIH  77

Query  343  VRPPFQPFV-FHTGP-----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAET  504
            V+ PF  F  F  GP      V+A+S++I++ +K+QQ+ +  +LS+ALQMC+ K ++ ET
Sbjct  78   VQSPFNHFAAFPAGPGGATAAVYASSSMIESVKKAQQETSAALLSRALQMCRAKQIRTET  137

Query  505  LVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
            LVLEG+ K+ +C A E+M VDLLVVGSRGLG I RAFLGSVSDYC HHA+CP+LIVKP P
Sbjct  138  LVLEGEAKEMICEAVEKMHVDLLVVGSRGLGKIKRAFLGSVSDYCAHHANCPILIVKP-P  196

Query  685  KE  690
            KE
Sbjct  197  KE  198



>ref|XP_009121027.1| PREDICTED: uncharacterized protein LOC103845875 isoform X1 [Brassica 
rapa]
Length=200

 Score =   181 bits (458),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 124/169 (73%), Gaps = 8/169 (5%)
 Frame = +1

Query  199  NRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-FH  375
             +R+M+AID+S+ SFYAL W +D+ F N     +   E   G++T+V+V+ P   F  F 
Sbjct  32   TKRMMVAIDESDSSFYALQWVIDH-FSNL-LMTTEAAEAEGGLLTVVHVQSPSHHFAAFP  89

Query  376  TGP----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCR  543
             GP     V+A+S++I++ +K+QQ+ +  +LS+ALQMC+ K ++ ETLVLEG+ KD +C+
Sbjct  90   AGPGGATAVYASSSMIESVKKAQQEASAALLSRALQMCRAKQIRTETLVLEGEAKDMICQ  149

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            A E+M VDLLVVGSRGLG I RAF+GSVSDYC HHA+CP+LIVKP PKE
Sbjct  150  AVEQMHVDLLVVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKP-PKE  197



>ref|XP_009393020.1| PREDICTED: universal stress protein A-like protein [Musa acuminata 
subsp. malaccensis]
Length=179

 Score =   179 bits (455),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 128/187 (68%), Gaps = 22/187 (12%)
 Frame = +1

Query  172  MEESTVP-----EQNRRVMIAIDDSEESFYALNWALDNVF-------KNRPshhsheeeq  315
            MEE+  P      +   V++A+D+SE S YAL+WALDN+F        N+P         
Sbjct  1    MEETKEPVATEGREKMTVLVAVDESEGSLYALSWALDNLFVAAVGGAPNKPQPL------  54

Query  316  hsGVITLVNVRPPFQPFVFH-TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMV  492
              G + LV+ + P Q F+ H  GP V+ATS+VID+ +K+Q+Q +++V+ +A  +C++++V
Sbjct  55   --GRLVLVHAQQPLQQFIMHPIGPAVYATSSVIDSVKKAQEQNSRDVIERAKGICRRRLV  112

Query  493  KAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIV  672
            +AE +V+ GDPK+ +C+AAE+M  DLLVVGSRGL  I RA LGSVSDYC HHA+CPVLIV
Sbjct  113  EAEAVVVAGDPKETICQAAEQMQTDLLVVGSRGLSKIRRAILGSVSDYCAHHANCPVLIV  172

Query  673  KPTPKES  693
            KP PK S
Sbjct  173  KP-PKTS  178



>ref|XP_010464928.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Camelina sativa]
Length=185

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 124/171 (73%), Gaps = 7/171 (4%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-F  372
            + +R+M+AID+S+ SFYAL W +D+      +  +   E   G++T+V+V+ PF  F  F
Sbjct  12   RTKRMMVAIDESDSSFYALQWVIDHFSNLLMTTGTEAAESEGGMLTVVHVQSPFHHFAAF  71

Query  373  HTGP-----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKL  537
              GP      V+A+ST+I++ +K+QQ+ +  +LS+ALQ+C+ K ++ ETLVLEG+ K+ +
Sbjct  72   PAGPGGATAAVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKEMI  131

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            C A E+M VDLL+VGSRGLG I RAF+GSVSDYC HHA+CP+LIVKP PKE
Sbjct  132  CEAVEKMHVDLLIVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKP-PKE  181



>emb|CDY47907.1| BnaAnng09390D [Brassica napus]
 emb|CDY08481.1| BnaA05g27170D [Brassica napus]
Length=200

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 124/169 (73%), Gaps = 8/169 (5%)
 Frame = +1

Query  199  NRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-FH  375
             +R+M+AID+S+ SFYAL W +D+ F N     +   E   G++T+V+V+ P   F  F 
Sbjct  32   TKRMMVAIDESDSSFYALQWVIDH-FSNL-LMTTEAAEAEGGLLTVVHVQSPSHHFAAFP  89

Query  376  TGP----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCR  543
             GP     V+A+S++I++ +K+QQ+ +  +LS+ALQMC+ K ++ ETL+LEG+ KD +C+
Sbjct  90   AGPGGATAVYASSSMIESVKKAQQEASAALLSRALQMCRAKQIRTETLILEGEAKDMICQ  149

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            A E+M VDLLVVGSRGLG I RAF+GSVSDYC HHA+CP+LIVKP PKE
Sbjct  150  AVEQMHVDLLVVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKP-PKE  197



>ref|XP_010464927.1| PREDICTED: uncharacterized protein LOC104745401 isoform X1 [Camelina 
sativa]
 ref|XP_010464929.1| PREDICTED: uncharacterized protein LOC104745401 isoform X3 [Camelina 
sativa]
Length=206

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 124/171 (73%), Gaps = 7/171 (4%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-F  372
            + +R+M+AID+S+ SFYAL W +D+      +  +   E   G++T+V+V+ PF  F  F
Sbjct  33   RTKRMMVAIDESDSSFYALQWVIDHFSNLLMTTGTEAAESEGGMLTVVHVQSPFHHFAAF  92

Query  373  HTGP-----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKL  537
              GP      V+A+ST+I++ +K+QQ+ +  +LS+ALQ+C+ K ++ ETLVLEG+ K+ +
Sbjct  93   PAGPGGATAAVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKEMI  152

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            C A E+M VDLL+VGSRGLG I RAF+GSVSDYC HHA+CP+LIVKP PKE
Sbjct  153  CEAVEKMHVDLLIVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKP-PKE  202



>ref|XP_007029144.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
 gb|EOY09646.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
Length=171

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 118/170 (69%), Gaps = 8/170 (5%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPP-----FQPFV  369
            RVM+ ID S+ SFYAL W LDN+F    S         + ++TLV+V  P     F P  
Sbjct  2    RVMVGIDGSDASFYALQWTLDNLFNGLISPAPAVVGGEATLLTLVHVHQPIKHYGFAPSA  61

Query  370  FHTGPVV--FATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCR  543
            F  GP V  +A++T++D+ RKSQ+Q++  +LS+AL+MCK K +KAETL+LEGDP D +C 
Sbjct  62   FPAGPGVLAYASTTLVDSVRKSQEQISAGILSRALKMCKDK-IKAETLILEGDPTDMICD  120

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
             +E+M+VDLLVVGSRGLG I RA LGSVSDYC H+A CP LIVKP  + S
Sbjct  121  ISEQMNVDLLVVGSRGLGKIKRALLGSVSDYCAHYAKCPTLIVKPLKEAS  170



>ref|XP_010524887.1| PREDICTED: universal stress protein A-like protein isoform X3 
[Tarenaya hassleriana]
Length=180

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 123/174 (71%), Gaps = 11/174 (6%)
 Frame = +1

Query  178  ESTVPEQNRRVMIAIDDSEESFYALNWALD---NVFKNRPshhsheeeqhsGVITLVNVR  348
            ES V  +  RV++A+D+SE SFYA+ WA+D   +V    P           G++TL++V 
Sbjct  2    ESEVERKKLRVLVAVDESENSFYAIEWAMDHLRDVISAEPDTGRAG-----GLLTLLHVH  56

Query  349  PPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPK  528
            PP+  +V+     VFA ++V ++ +K +++    + ++ALQ+C+ KMVKAETLVLEGDPK
Sbjct  57   PPYAHYVYPAA--VFAATSVPESVKKEREERTAALFTRALQICRGKMVKAETLVLEGDPK  114

Query  529  DKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            D +C+A E+M VDLLV+G+RGLG I RAFLGSVSDYC HHA CP+LIVKP P+E
Sbjct  115  DVICQAVEQMHVDLLVIGNRGLGMIKRAFLGSVSDYCAHHAKCPILIVKP-PRE  167



>ref|XP_002308342.2| hypothetical protein POPTR_0006s21250g [Populus trichocarpa]
 gb|EEE91865.2| hypothetical protein POPTR_0006s21250g [Populus trichocarpa]
Length=186

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 125/192 (65%), Gaps = 20/192 (10%)
 Frame = +1

Query  145  LNREGVTEIMEESTVPE----QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheee  312
            L RE + E M    + E    +  R+M+AIDDS+ SFYALNWALDN+  +     +   +
Sbjct  7    LEREVMQEQMLHQPLKEMQIRKRLRIMVAIDDSDGSFYALNWALDNLV-DGIVPTTEPSQ  65

Query  313  qhsGVITLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMV  492
            + SG++TLV+V+ PFQ  ++  G      +T +              LS+ALQMCK KM+
Sbjct  66   EESGLVTLVHVQQPFQHHMYPAGSGGAENATAL--------------LSRALQMCKDKMI  111

Query  493  KAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIV  672
            KAETL+LEGDPKDK+CRA E+M  D+LVVGSRGLG I RA LGS+SDYC HHA CP+LIV
Sbjct  112  KAETLILEGDPKDKICRATEQMQADVLVVGSRGLGKIKRALLGSISDYCAHHAKCPILIV  171

Query  673  KPTPKESPRVPR  708
            KP PKE  +  R
Sbjct  172  KP-PKEITKEKR  182



>ref|XP_004504522.1| PREDICTED: universal stress protein A-like protein-like [Cicer 
arietinum]
Length=184

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 123/176 (70%), Gaps = 8/176 (5%)
 Frame = +1

Query  172  MEESTVPEQNRRV----MIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLV  339
            MEE     + RR+    M+AID+S+ SFYAL WALDN+F N  +       Q+ G++ LV
Sbjct  1    MEELGGGAEKRRMKMKAMVAIDESDGSFYALKWALDNLF-NVMTTTEATTSQNEGMLFLV  59

Query  340  NVRPPFQPFVFHTGPV---VFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLV  510
            +V P F  +V   GP     +  S V+D+ +K+QQ+ +  +LS+ALQMCK K+VKAE+++
Sbjct  60   HVEPIFHNYVHPIGPAGAAFYPASLVVDSVKKAQQEKSASILSRALQMCKDKLVKAESVI  119

Query  511  LEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
            L GDP++ +C+AAE+M VD+L++GSRGLG + RAFLGSVSDYC HH   P+LIVKP
Sbjct  120  LTGDPREMICQAAEQMQVDILIMGSRGLGTLKRAFLGSVSDYCAHHVKAPILIVKP  175



>ref|XP_009135196.1| PREDICTED: uncharacterized protein LOC103859417 isoform X2 [Brassica 
rapa]
Length=198

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 123/177 (69%), Gaps = 8/177 (5%)
 Frame = +1

Query  175  EESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPP  354
            E+  V    +R+M+AID+S+ SFYAL W +D+   +     +        ++T+V+V+ P
Sbjct  22   EQPRVMTTTKRMMVAIDESDSSFYALQWVIDHF--SSLLMTTEAAGAEGDLLTVVHVQSP  79

Query  355  FQPFV-FHTGP----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEG  519
            F  F  F  GP     V+A++ +I++ +K+QQ+ +  +LS+ LQMC+ K ++AETLVLEG
Sbjct  80   FYHFAAFPAGPGGATAVYASTAMIESVKKAQQETSAALLSRVLQMCRAKQIRAETLVLEG  139

Query  520  DPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            D KD +C+A E+M VDLLVVGSRGLG I RAFLGSVSDYC HHA CP+LIV+P PKE
Sbjct  140  DAKDMICQAVEQMHVDLLVVGSRGLGKIKRAFLGSVSDYCAHHAKCPILIVRP-PKE  195



>ref|XP_009135195.1| PREDICTED: uncharacterized protein LOC103859417 isoform X1 [Brassica 
rapa]
Length=199

 Score =   178 bits (451),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 123/178 (69%), Gaps = 9/178 (5%)
 Frame = +1

Query  175  EESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPP  354
            E+  V    +R+M+AID+S+ SFYAL W +D+   +     +        ++T+V+V+ P
Sbjct  22   EQPRVMTTTKRMMVAIDESDSSFYALQWVIDHF--SSLLMTTEAAGAEGDLLTVVHVQSP  79

Query  355  FQPFV-FHTGP-----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLE  516
            F  F  F  GP      V+A++ +I++ +K+QQ+ +  +LS+ LQMC+ K ++AETLVLE
Sbjct  80   FYHFAAFPAGPGGATAAVYASTAMIESVKKAQQETSAALLSRVLQMCRAKQIRAETLVLE  139

Query  517  GDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            GD KD +C+A E+M VDLLVVGSRGLG I RAFLGSVSDYC HHA CP+LIV+P PKE
Sbjct  140  GDAKDMICQAVEQMHVDLLVVGSRGLGKIKRAFLGSVSDYCAHHAKCPILIVRP-PKE  196



>gb|KEH41787.1| adenine nucleotide alpha hydrolase superfamily protein [Medicago 
truncatula]
Length=190

 Score =   177 bits (450),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 4/161 (2%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +VM+AID+S+ SFYAL WALDN+F N  +       ++ G++ LV+V P F  +V   GP
Sbjct  23   KVMVAIDESDGSFYALKWALDNLF-NVMTTMEGTSSENEGMVFLVHVEPIFHNYVHPIGP  81

Query  385  ---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
                 +  S V+D+ +K QQ+ +  +LS+ALQMCK K VKAE+++L GDP++ +C+A+E+
Sbjct  82   GGAAFYPASVVVDSVKKGQQERSAVILSRALQMCKDKQVKAESVILNGDPREMICQASEQ  141

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
            M VDLL++GSRGLG + RAFLGSVSDYC HHA  P+LIVKP
Sbjct  142  MQVDLLIMGSRGLGTLKRAFLGSVSDYCAHHAKAPILIVKP  182



>ref|XP_010464931.1| PREDICTED: universal stress protein A-like protein isoform X5 
[Camelina sativa]
Length=168

 Score =   177 bits (448),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 121/165 (73%), Gaps = 5/165 (3%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-FHTGP  384
            +M+AID+S+ SFYAL W +D+      +  +   E   G++T+V+V+ PF  F  F  GP
Sbjct  1    MMVAIDESDSSFYALQWVIDHFSNLLMTTGTEAAESEGGMLTVVHVQSPFHHFAAFPAGP  60

Query  385  ---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
                V+A+ST+I++ +K+QQ+ +  +LS+ALQ+C+ K ++ ETLVLEG+ K+ +C A E+
Sbjct  61   GGATVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKEMICEAVEK  120

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            M VDLL+VGSRGLG I RAF+GSVSDYC HHA+CP+LIVKP PKE
Sbjct  121  MHVDLLIVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKP-PKE  164



>ref|XP_010464930.1| PREDICTED: universal stress protein A-like protein isoform X4 
[Camelina sativa]
Length=169

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 121/166 (73%), Gaps = 6/166 (4%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-FHTGP  384
            +M+AID+S+ SFYAL W +D+      +  +   E   G++T+V+V+ PF  F  F  GP
Sbjct  1    MMVAIDESDSSFYALQWVIDHFSNLLMTTGTEAAESEGGMLTVVHVQSPFHHFAAFPAGP  60

Query  385  ----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAE  552
                 V+A+ST+I++ +K+QQ+ +  +LS+ALQ+C+ K ++ ETLVLEG+ K+ +C A E
Sbjct  61   GGATAVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKEMICEAVE  120

Query  553  EMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            +M VDLL+VGSRGLG I RAF+GSVSDYC HHA+CP+LIVKP PKE
Sbjct  121  KMHVDLLIVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKP-PKE  165



>gb|AAM66054.1| ethylene-responsive protein, putative [Arabidopsis thaliana]
Length=199

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 124/168 (74%), Gaps = 7/168 (4%)
 Frame = +1

Query  199  NRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-FH  375
             +R+++AID+S+ SFYAL   +D+ F N     +   E  SG++T+++V+ PF  F  F 
Sbjct  32   TKRMVVAIDESDSSFYALQLVIDH-FSNL-LLTTAAAEAESGMLTVIHVQSPFNHFAAFP  89

Query  376  TGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRA  546
             GP    V+A+S++I++ +K+QQ+ +  +LS+ALQMC+ K ++ ETLVLEG+ K+ +C A
Sbjct  90   AGPGGATVYASSSMIESVKKAQQETSAALLSRALQMCRAKQIRTETLVLEGEAKEMICEA  149

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
             E+M VDLLVVGSRGLG I RAFLGSVSDYC HHA+CP+LIVKP PKE
Sbjct  150  VEKMHVDLLVVGSRGLGKIKRAFLGSVSDYCAHHANCPILIVKP-PKE  196



>ref|XP_007202545.1| hypothetical protein PRUPE_ppa011155mg [Prunus persica]
 gb|EMJ03744.1| hypothetical protein PRUPE_ppa011155mg [Prunus persica]
Length=221

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 122/184 (66%), Gaps = 14/184 (8%)
 Frame = +1

Query  163  TEIMEESTVPEQNR---RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVI-  330
            T++ E++   +Q +   RVM+AID+SE SFYAL WALD++F            + +  + 
Sbjct  3    TKVAEQAVEEQQGKKKMRVMVAIDESEWSFYALKWALDHLFVGPNDKAGVAATREAPAVS  62

Query  331  -------TLVNVRPPFQPFVFHTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCK  480
                   TLV+V PPF  +V   GP     + T  ++++ RK+Q+  A +VLS+AL++CK
Sbjct  63   QENVSMATLVHVMPPFYNYVLPAGPGGAAYYVTPALLESVRKAQEDGAADVLSRALEICK  122

Query  481  QKMVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCP  660
             KM+KAETL+L GDPKD +C A E+  VDLLVVGSRGLG + RAFLGSVSDYC HHA CP
Sbjct  123  DKMIKAETLILRGDPKDMICEATEQSHVDLLVVGSRGLGMVKRAFLGSVSDYCAHHAKCP  182

Query  661  VLIV  672
            V+IV
Sbjct  183  VVIV  186



>ref|XP_010524879.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Tarenaya hassleriana]
Length=182

 Score =   175 bits (443),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 123/174 (71%), Gaps = 9/174 (5%)
 Frame = +1

Query  178  ESTVPEQNRRVMIAIDDSEESFYALNWALD---NVFKNRPshhsheeeqhsGVITLVNVR  348
            ES V  +  RV++A+D+SE SFYA+ WA+D   +V    P           G++TL++V 
Sbjct  2    ESEVERKKLRVLVAVDESENSFYAIEWAMDHLRDVISAEPDTGRAG-----GLLTLLHVH  56

Query  349  PPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPK  528
            PP+  +V+     VFA ++V ++ +K +++    + ++ALQ+C+ KMVKAETLVLEGDPK
Sbjct  57   PPYAHYVYPAAAAVFAATSVPESVKKEREERTAALFTRALQICRGKMVKAETLVLEGDPK  116

Query  529  DKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            D +C+A E+M VDLLV+G+RGLG I RAFLGSVSDYC HHA CP+LIVKP P+E
Sbjct  117  DVICQAVEQMHVDLLVIGNRGLGMIKRAFLGSVSDYCAHHAKCPILIVKP-PRE  169



>ref|XP_006481853.1| PREDICTED: universal stress protein A-like protein-like [Citrus 
sinensis]
Length=198

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 118/158 (75%), Gaps = 7/158 (4%)
 Frame = +1

Query  217  AIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGPVVFA  396
            AID+S ESFYAL WALDN++    +  + E    S V+T+V+ + PF P     G   +A
Sbjct  36   AIDESAESFYALKWALDNLY--VITDITPEASSGSNVLTIVHAQQPFIP----AGAAFYA  89

Query  397  TSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVDLLV  576
            TST+++  +K+++Q +  +LS+ALQ+CK+KMV A+TL+L+GD +D +C+A E+M +DLLV
Sbjct  90   TSTLVENVKKAEEQSSAALLSRALQVCKEKMVNAQTLILDGDTRDVICQAVEQMHIDLLV  149

Query  577  VGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            VGSRGLG + RAFLGSVSDYC HHA CP+LIVKP PKE
Sbjct  150  VGSRGLGKVKRAFLGSVSDYCAHHAVCPILIVKP-PKE  186



>ref|XP_010677621.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=171

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 118/162 (73%), Gaps = 5/162 (3%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +VM+A+D+S+ S YALNW L NV K        EEEQ    + L++V  PFQ +V+  GP
Sbjct  2    KVMVALDESKRSLYALNWVLSNVIK----PVGQEEEQSDSFVCLLHVNLPFQTYVYPAGP  57

Query  385  VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSV  564
            V++ T +V+D+ R++Q+Q++  + ++A++ C++K +K E + L GDPK+ +C+A EE  V
Sbjct  58   VIYTTPSVVDSVRQAQEQISAGIFARAIRCCEEKKIKTEAVSLRGDPKEVICQAIEERHV  117

Query  565  DLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            DLLVVGSRGLG + RAFLGSVSDYC HHA CPVLIVKP PKE
Sbjct  118  DLLVVGSRGLGMLKRAFLGSVSDYCAHHAKCPVLIVKP-PKE  158



>ref|XP_003519020.1| PREDICTED: universal stress protein A-like protein-like [Glycine 
max]
 gb|KHN00015.1| Universal stress protein A-like protein [Glycine soja]
Length=191

 Score =   172 bits (437),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +VM+AID+SE SFYAL WALDN+F    +       ++ G++ LV+V P    +V+  GP
Sbjct  23   KVMVAIDESEGSFYALKWALDNLFTTMATVGEASSPENDGMVFLVHVEPKVHNYVYPIGP  82

Query  385  ---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
                 +  + V+D+ +K+QQ+ +  +LS+AL+MC  K+VK E+++L GD ++ +C AAE+
Sbjct  83   GGAAFYPATVVVDSVKKAQQERSAAILSRALKMCHDKLVKGESIILHGDAREMICEAAEQ  142

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            M ++LLV+GSRGLG + R FLGSVSDYC HHA  P+LIVKP  + S
Sbjct  143  MQINLLVLGSRGLGTLKRTFLGSVSDYCAHHAKTPILIVKPPSEHS  188



>ref|XP_006429979.1| hypothetical protein CICLE_v10013408mg [Citrus clementina]
 gb|ESR43219.1| hypothetical protein CICLE_v10013408mg [Citrus clementina]
Length=198

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 117/158 (74%), Gaps = 7/158 (4%)
 Frame = +1

Query  217  AIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGPVVFA  396
            AID+S ESFYAL WALDN++    +  + E    S V+T+V+ + PF P     G   +A
Sbjct  36   AIDESAESFYALKWALDNLY--VITDITPEAGSGSNVLTIVHAQQPFIP----AGAAFYA  89

Query  397  TSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVDLLV  576
            TST+++  +K+++Q +  +LS+ALQ+CK+ MV A+TL+L+GD +D +C+A E+M +DLLV
Sbjct  90   TSTLVENVKKAEEQSSAALLSRALQVCKENMVNAQTLILDGDARDVICQAVEQMHIDLLV  149

Query  577  VGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            VGSRGLG + RAFLGSVSDYC HHA CP+LIVKP PKE
Sbjct  150  VGSRGLGKVKRAFLGSVSDYCAHHAVCPILIVKP-PKE  186



>gb|KFK38558.1| hypothetical protein AALP_AA3G129200 [Arabis alpina]
Length=199

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 127/181 (70%), Gaps = 9/181 (5%)
 Frame = +1

Query  166  EIMEESTVPEQ-NRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVN  342
            E   E+  PE   +R+M+AID+S+ SFYAL W +D+   +     +   E   G++T+V+
Sbjct  20   ETTTEAEAPEVITKRMMVAIDESDSSFYALQWVIDHF--SSLLMTTEAAEAEGGLLTVVH  77

Query  343  VRPPFQPFV-FHTGP----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETL  507
            V+PPFQ F  F  GP     V+A++ + ++ +K+QQ+ +  +L++ALQMC+ K ++ ETL
Sbjct  78   VQPPFQHFAAFPAGPGGATAVYASTNMRESVKKAQQEASAALLARALQMCRAKQIRTETL  137

Query  508  VLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
            V+EGD KD +C  AE+M VDLLVVGSRGLG I RAFLGSVSDYC HH +CP+LIVKP PK
Sbjct  138  VVEGDTKDMICEVAEQMHVDLLVVGSRGLGKIKRAFLGSVSDYCAHHVNCPILIVKP-PK  196

Query  688  E  690
            E
Sbjct  197  E  197



>ref|XP_009588427.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Nicotiana tomentosiformis]
Length=170

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 107/141 (76%), Gaps = 8/141 (6%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + + +M+A+D+SEESFYALNWALD++  N         E+ + +ITL+NV+PPF P V+ 
Sbjct  30   KRKMIMVAMDESEESFYALNWALDHLLNNS--------EEETTIITLINVQPPFSPLVYP  81

Query  376  TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
             GPVVFA  T+++  +K+QQ+ A  +LS+A  MC QK VKAETL+LEGDPKDK+C+AA+E
Sbjct  82   AGPVVFAAPTMVEAVKKAQQENATTILSRAFHMCTQKRVKAETLILEGDPKDKICQAADE  141

Query  556  MSVDLLVVGSRGLGNITRAFL  618
            + VDLLV+GSRGLG I RA +
Sbjct  142  LHVDLLVMGSRGLGKIKRAVI  162



>gb|KDP21924.1| hypothetical protein JCGZ_03062 [Jatropha curcas]
Length=180

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 116/164 (71%), Gaps = 11/164 (7%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGPV  387
            VM+A+D+S+ SFYAL W LDN+             Q S ++TLV+V+  FQ  +   GP 
Sbjct  22   VMVALDESDTSFYALKWTLDNLI-------IKGVSQDSDMVTLVHVQHSFQTSIVPLGPA  74

Query  388  ---VFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEM  558
               ++  S++ D+ +K+QQ+ +  ++S+AL+MC +KMVKAE+L+LEGD KD +C+A E+M
Sbjct  75   GAALYTPSSIADSVKKAQQENSAAIVSRALKMCDEKMVKAESLILEGDAKDMICKATEQM  134

Query  559  SVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
             VDL+VVGSRGLG I RA LGSVS YC HHA CP+LIVKP PKE
Sbjct  135  QVDLVVVGSRGLGKIKRALLGSVSYYCAHHAKCPILIVKP-PKE  177



>ref|XP_011094182.1| PREDICTED: universal stress protein A-like protein [Sesamum indicum]
Length=194

 Score =   170 bits (431),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 115/170 (68%), Gaps = 9/170 (5%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNVF---------KNRPshhsheeeqhsGVITLVNV  345
            E+  RVM+A+D+S+ESFYAL+W L+N+F         +    H          ++TL++V
Sbjct  18   EEKMRVMVAMDESDESFYALHWVLNNLFSPGIVATETQTHYHHDDSNSNNTMNMLTLIHV  77

Query  346  RPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDP  525
              PF  +VF     VF T++VI +  K+Q++ A  +L++AL MC Q+MVKA+T +LEGDP
Sbjct  78   MEPFPHYVFPGMQAVFPTTSVIQSVNKAQEETASAMLTQALHMCAQRMVKAKTCILEGDP  137

Query  526  KDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            K+ +C  AE+M +DL+ +GSRGLG I RAF+GSVSDY  HHA CPVL++K
Sbjct  138  KEMICDVAEQMQIDLIAIGSRGLGKIKRAFMGSVSDYVTHHAKCPVLVIK  187



>ref|XP_009593917.1| PREDICTED: uncharacterized protein LOC104090515 isoform X1 [Nicotiana 
tomentosiformis]
Length=155

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 115/159 (72%), Gaps = 11/159 (7%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            RV++AID+SEESF AL W LD  F  +PSH + EE++ S  ++LV+V  PF  + +    
Sbjct  2    RVLVAIDNSEESFNALKWILD-YFLRQPSHTTEEEKEPSTKLSLVHVMEPFPQYAY----  56

Query  385  VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSV  564
                   VI++  ++Q Q A  +L++A +MCK KMVKAETL+LEGDPK+ LC A E+M++
Sbjct  57   ------PVIESATRAQAQEAARILARASEMCKDKMVKAETLILEGDPKNMLCEATEKMNI  110

Query  565  DLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            DLL VGSRGLG I RAFLGSVSDYC HHA CP+LIVKPT
Sbjct  111  DLLAVGSRGLGQIKRAFLGSVSDYCAHHAKCPMLIVKPT  149



>emb|CDY08484.1| BnaA05g27200D [Brassica napus]
Length=200

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 120/169 (71%), Gaps = 7/169 (4%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-F  372
            + +R+M+AID+S+ SFYAL W +D+   +     +   E   G++T+V+V+P F  F  F
Sbjct  32   RTKRIMVAIDESDSSFYALQWVIDHF--STLLLTTEGAEAERGLLTVVHVQPTFHHFAPF  89

Query  373  HTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCR  543
              GP    V+  S +I++ +K+QQ+ +  +L +ALQMC+ K +++ETLV EG+ K+ +C+
Sbjct  90   PAGPGATAVYPPSLMIESVKKTQQETSAALLLRALQMCRAKQIRSETLVFEGEAKEMICQ  149

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            A E+M VDLLVVGSRGLG I RA +GSVSDYC HHA+CP+LIVKP PKE
Sbjct  150  AVEQMHVDLLVVGSRGLGKIRRALIGSVSDYCAHHANCPILIVKP-PKE  197



>ref|XP_009146670.1| PREDICTED: uncharacterized protein LOC103870298 [Brassica rapa]
Length=200

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 120/169 (71%), Gaps = 7/169 (4%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-F  372
            + +R+M+AID+S+ SFYAL W +D+   +     +   E   G++T+V+V+P F  F  F
Sbjct  32   RTKRIMVAIDESDSSFYALQWVIDHF--STLLLTTEGAEAERGLLTVVHVQPTFHHFAPF  89

Query  373  HTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCR  543
              GP    V+  S +I++ +K+QQ+ +  +L +ALQMC+ K +++ETLV EG+ K+ +C+
Sbjct  90   PAGPGATAVYPPSLMIESVKKTQQETSAALLLRALQMCRAKQIRSETLVFEGEAKEMICQ  149

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            A E+M VDLLVVGSRGLG I RA +GSVSDYC HHA+CP+LIVKP PKE
Sbjct  150  AVEQMPVDLLVVGSRGLGKIRRALIGSVSDYCAHHANCPILIVKP-PKE  197



>ref|XP_010519995.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Tarenaya hassleriana]
Length=198

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 117/179 (65%), Gaps = 16/179 (9%)
 Frame = +1

Query  190  PEQNRR-----VMIAIDDSEESFYALNWALDNV-------FKNRPshhsheeeqhsGVIT  333
            PE +RR     VM+AID+S+ SFYAL W +D+                S       G++T
Sbjct  14   PEVHRRPLATKVMVAIDESDNSFYALQWVIDHFSSLVVPQPPPEAEEESPAAATDGGMLT  73

Query  334  LVNVRPPFQPFVFHTGP----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAE  501
            +V+V+ PFQ F F  GP     V+ TS++++  RK+Q++ A  + ++ALQ+C++  V  E
Sbjct  74   VVHVQQPFQQFAFPAGPGGATAVYMTSSMMEAVRKAQRETATALFARALQICRKNKVNVE  133

Query  502  TLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
            TL++EGDPKD +C+A EEM V LLV+GSRGLG I RAFLGSVSDYC HHA C +LIVKP
Sbjct  134  TLLMEGDPKDVICQAVEEMRVQLLVMGSRGLGKIKRAFLGSVSDYCAHHAKCAILIVKP  192



>ref|XP_010519994.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Tarenaya hassleriana]
Length=199

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 117/180 (65%), Gaps = 17/180 (9%)
 Frame = +1

Query  190  PEQNRR-----VMIAIDDSEESFYALNWALDNV-------FKNRPshhsheeeqhsGVIT  333
            PE +RR     VM+AID+S+ SFYAL W +D+                S       G++T
Sbjct  14   PEVHRRPLATKVMVAIDESDNSFYALQWVIDHFSSLVVPQPPPEAEEESPAAATDGGMLT  73

Query  334  LVNVRPPFQPFVFHTGP-----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKA  498
            +V+V+ PFQ F F  GP      V+ TS++++  RK+Q++ A  + ++ALQ+C++  V  
Sbjct  74   VVHVQQPFQQFAFPAGPGGATAAVYMTSSMMEAVRKAQRETATALFARALQICRKNKVNV  133

Query  499  ETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
            ETL++EGDPKD +C+A EEM V LLV+GSRGLG I RAFLGSVSDYC HHA C +LIVKP
Sbjct  134  ETLLMEGDPKDVICQAVEEMRVQLLVMGSRGLGKIKRAFLGSVSDYCAHHAKCAILIVKP  193



>ref|XP_010534373.1| PREDICTED: universal stress protein A-like protein [Tarenaya 
hassleriana]
Length=190

 Score =   167 bits (423),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 122/181 (67%), Gaps = 10/181 (6%)
 Frame = +1

Query  154  EGVTEIMEESTVPE-QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVI  330
            +   ++ E  T PE +N ++M+A+DDSE SFYAL WA+D+     P+  + E+    G++
Sbjct  8    KAAEKLTEVKTRPETKNMKLMVAMDDSENSFYALQWAIDHFSGLIPAEDTAEQ----GIL  63

Query  331  TLVNVRPPFQPFVFHTGPV-----VFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVK  495
             +V+V+ PF  F F  GP      V+ +S+ ++  RK+Q++M+  + ++ LQMC+ K + 
Sbjct  64   AVVHVQQPFHHFSFPAGPGGAAAAVYISSSTMEAVRKTQREMSAALFARVLQMCRGKKIN  123

Query  496  AETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
             +T  LEGDPKD +C+A EEM V LLVVGSRGLG I RAFLGSVSDYC HHA C VLIVK
Sbjct  124  VKTAALEGDPKDMICQAIEEMHVQLLVVGSRGLGKIKRAFLGSVSDYCAHHAKCSVLIVK  183

Query  676  P  678
            P
Sbjct  184  P  184



>emb|CBI39085.3| unnamed protein product [Vitis vinifera]
Length=129

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  325  VITLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAET  504
            ++T+V+V+ PF  +V   GP ++ATSTVI++ RK+Q+Q +  +LS+AL++CK KMVKAET
Sbjct  1    MVTVVHVQQPFHNYVLPAGPGIYATSTVIESVRKAQEQNSSVILSRALRLCKDKMVKAET  60

Query  505  LVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
            L+L+GDPK+ +C+AAE+M VDLL+VGSRGL  + RAFLGSVSDYC HHA CP+LIVKP P
Sbjct  61   LILDGDPKEMICQAAEQMHVDLLLVGSRGLSKLKRAFLGSVSDYCAHHAKCPILIVKP-P  119

Query  685  KE  690
            +E
Sbjct  120  EE  121



>ref|XP_010504799.1| PREDICTED: uncharacterized protein LOC104781757 isoform X1 [Camelina 
sativa]
Length=200

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 126/192 (66%), Gaps = 14/192 (7%)
 Frame = +1

Query  142  YLNREGVTEIMEESTVPEQNRR--VMIAIDDSEESFYALNWA---LDNVFKNRPshhshe  306
            Y++  GV E   E+ V +  ++  VM+AID+S+ SF AL W    L +V    P      
Sbjct  4    YVDASGVDETAAETAVEKHKKKLKVMVAIDESKNSFDALQWVVEHLRDVISAEPETGQEG  63

Query  307  eeqhsGVITLVNVRPPFQPFVFHTG---PVVFATSTVIDTYRKSQQQMAKEVLSKALQMC  477
                 G++TLV+V P +  +++ +G     V+AT +V +  RK++++    + ++AL++C
Sbjct  64   -----GLLTLVHVHPTYLQYIYPSGGTASAVYATDSVPEQVRKAREESTTNLFTRALEIC  118

Query  478  KQKMVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHC  657
            + KMVK ET++LEGDPK+ +C+A E+  VDLLVVGSRGLG I RAFLGSVSDYC  HA C
Sbjct  119  RGKMVKTETMILEGDPKEMICQAVEQTHVDLLVVGSRGLGMIKRAFLGSVSDYCAQHAKC  178

Query  658  PVLIVKPTPKES  693
            P+LIV+P P+E+
Sbjct  179  PILIVRP-PRET  189



>ref|XP_010917884.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=190

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 116/164 (71%), Gaps = 2/164 (1%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +VM  +D+SE S +AL WALD++F         ++ Q  G + L++ + P   FV   GP
Sbjct  29   KVMAGVDESEGSMHALCWALDHLF-TATGGEVPDKTQALGRLILLHAQQPLYHFVHPMGP  87

Query  385  VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSV  564
             V+AT T +++ R +Q++ +  VL +A Q+C +++VKAET++++GDPKD +C+A EEMS+
Sbjct  88   AVYATLTAMESMRNAQKENSIWVLERASQICIERLVKAETIIIDGDPKDVICQATEEMSI  147

Query  565  DLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESP  696
            DLL++GSRGLG + RA LGSVSDYC HHA CP+LIVKP PK  P
Sbjct  148  DLLIMGSRGLGKVKRAILGSVSDYCAHHAKCPILIVKP-PKVHP  190



>ref|XP_007145748.1| hypothetical protein PHAVU_007G264400g [Phaseolus vulgaris]
 gb|ESW17742.1| hypothetical protein PHAVU_007G264400g [Phaseolus vulgaris]
Length=182

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 120/176 (68%), Gaps = 8/176 (5%)
 Frame = +1

Query  172  MEESTVPEQNRR----VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLV  339
            MEES   E+ RR    VM+ +D+S+ S YAL WA+DN+F    +      E++ G++ L+
Sbjct  1    MEESGGAEEQRRMRMKVMVGVDESDGSLYALKWAIDNLFTAM-ATVGEATEENEGMVFLL  59

Query  340  NVRPPFQPFVFHTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLV  510
            +V P    FV+  GP     +  + V+++ +K+Q++ +  VLS+AL+MC  K+VKAE+++
Sbjct  60   HVEPKVHNFVYPVGPGGAAFYPANVVVESVKKAQEEKSASVLSRALKMCHDKLVKAESMI  119

Query  511  LEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
            L GDP++ +C AA++M V+LLV+GSRGLG + R  LGSVSD+C HHA  PVLIVKP
Sbjct  120  LNGDPREMICEAADQMQVNLLVLGSRGLGALKRTLLGSVSDHCAHHARTPVLIVKP  175



>ref|NP_850563.1| universal stress protein-like protein [Arabidopsis thaliana]
 dbj|BAH19740.1| AT3G11930 [Arabidopsis thaliana]
 gb|AEE75120.1| universal stress protein-like protein [Arabidopsis thaliana]
Length=226

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 129/207 (62%), Gaps = 35/207 (17%)
 Frame = +1

Query  166  EIMEESTVPE-QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVN  342
            E   E+  P    +R+++AID+S+ SFYAL W +D+ F N     +   E  SG++T+++
Sbjct  20   ETTTEAEAPSLTTKRMVVAIDESDSSFYALQWVIDH-FSNL-LLTTAAAEAESGMLTVIH  77

Query  343  VRPPFQPFV-FHTGP----VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETL  507
            V+ PF  F  F  GP     V+A+S++I++ +K+QQ+ +  +LS+ALQMC+ K ++ ETL
Sbjct  78   VQSPFNHFAAFPAGPGGATAVYASSSMIESVKKAQQETSAALLSRALQMCRAKQIRTETL  137

Query  508  VLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNIT--------------------------R  609
            VLEG+ K+ +C A E+M VDLLVVGSRGLG I                           R
Sbjct  138  VLEGEAKEMICEAVEKMHVDLLVVGSRGLGKIKRYCIINNFFLYINLSAYYFVCFVRFGR  197

Query  610  AFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            AFLGSVSDYC HHA+CP+LIVKP PKE
Sbjct  198  AFLGSVSDYCAHHANCPILIVKP-PKE  223



>ref|XP_009795288.1| PREDICTED: uncharacterized protein LOC104242017 [Nicotiana sylvestris]
Length=227

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 114/159 (72%), Gaps = 8/159 (5%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            RV++AID+SEESF AL W LD + + +P H + E ++    ++LV+V  PF  + +    
Sbjct  67   RVLVAIDNSEESFNALKWILDYLLR-QPYHTTEEVKEPCIKLSLVHVMEPFPQYAY----  121

Query  385  VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSV  564
                 + VI++  ++Q Q A  +L++A +MCK KM+KAETL+LEGDPK+ LC A E+M++
Sbjct  122  ---PGTHVIESATRAQAQEAARILARASEMCKDKMIKAETLILEGDPKNILCEATEKMNI  178

Query  565  DLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            DLL VGSRGLG I RAFLGSVSDYC HHA CP+LIVKPT
Sbjct  179  DLLAVGSRGLGQIKRAFLGSVSDYCAHHAKCPLLIVKPT  217



>ref|XP_007145747.1| hypothetical protein PHAVU_007G264400g [Phaseolus vulgaris]
 gb|ESW17741.1| hypothetical protein PHAVU_007G264400g [Phaseolus vulgaris]
Length=175

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 118/173 (68%), Gaps = 9/173 (5%)
 Frame = +1

Query  172  MEESTVPEQNRR----VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLV  339
            MEES   E+ RR    VM+ +D+S+ S YAL WA+DN+F    +      E++ G++ L+
Sbjct  1    MEESGGAEEQRRMRMKVMVGVDESDGSLYALKWAIDNLFTAM-ATVGEATEENEGMVFLL  59

Query  340  NVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEG  519
            +V P    FV+  GP       V+++ +K+Q++ +  VLS+AL+MC  K+VKAE+++L G
Sbjct  60   HVEPKVHNFVYPVGP----GGAVVESVKKAQEEKSASVLSRALKMCHDKLVKAESMILNG  115

Query  520  DPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
            DP++ +C AA++M V+LLV+GSRGLG + R  LGSVSD+C HHA  PVLIVKP
Sbjct  116  DPREMICEAADQMQVNLLVLGSRGLGALKRTLLGSVSDHCAHHARTPVLIVKP  168



>ref|XP_010516491.1| PREDICTED: uncharacterized protein LOC104792132 isoform X1 [Camelina 
sativa]
Length=200

 Score =   162 bits (411),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 126/192 (66%), Gaps = 14/192 (7%)
 Frame = +1

Query  142  YLNREGVTEIMEESTVPEQNRR--VMIAIDDSEESFYALNWA---LDNVFKNRPshhshe  306
            Y++  GV E   ES+V +  ++  VM+AID+S+ SF AL W    L +V    P      
Sbjct  4    YVDASGVDETAAESSVEKHKKKLKVMVAIDESKNSFDALQWVVEHLRDVISAEPETGQEG  63

Query  307  eeqhsGVITLVNVRPPFQPFVFHTG---PVVFATSTVIDTYRKSQQQMAKEVLSKALQMC  477
                 G++TLV+V P +  +++ +G     V+AT +V +  RK++++    + ++AL++C
Sbjct  64   -----GLLTLVHVHPTYLQYIYPSGGTASAVYATDSVPEQVRKAREESTTNLFTRALEIC  118

Query  478  KQKMVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHC  657
            + KMVK ET++LEGDPK+ +C+A E+  VDLLV+GSRGLG I RAFLGSVSDYC  HA  
Sbjct  119  RGKMVKTETMILEGDPKEMICQAVEQTHVDLLVLGSRGLGMIKRAFLGSVSDYCAQHAKR  178

Query  658  PVLIVKPTPKES  693
            P+LIV+P P+E+
Sbjct  179  PILIVRP-PRET  189



>ref|XP_006402787.1| hypothetical protein EUTSA_v10006473mg [Eutrema salsugineum]
 gb|ESQ44240.1| hypothetical protein EUTSA_v10006473mg [Eutrema salsugineum]
Length=204

 Score =   162 bits (411),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 118/168 (70%), Gaps = 12/168 (7%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWA---LDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHT  378
            VM+AID+S+ SFYA+ WA   L +V  + P           G++TLV+V P +  +++ +
Sbjct  34   VMVAIDESKNSFYAVEWAVQHLRDVISSEPETGQEG-----GLLTLVHVHPTYLQYIYPS  88

Query  379  G---PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAA  549
            G     ++AT +V ++ +K++++    + ++AL++C+ KMVK ET++LEGDPK+ +C+A 
Sbjct  89   GGTASALYATDSVPESMKKAREESTTRMFTRALEICRGKMVKTETMILEGDPKEMICQAV  148

Query  550  EEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            E+  VDLLVVGSRGLG I RAFLGSVSDYC  HA CP+LIV+P P+E+
Sbjct  149  EQTHVDLLVVGSRGLGMIKRAFLGSVSDYCAQHAKCPILIVRP-PRET  195



>ref|XP_007202660.1| hypothetical protein PRUPE_ppa012339mg [Prunus persica]
 gb|EMJ03859.1| hypothetical protein PRUPE_ppa012339mg [Prunus persica]
Length=173

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 115/181 (64%), Gaps = 26/181 (14%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsG----------------VITL  336
            RVM+AID S+ES YAL WALD +    P  ++ +    +G                ++TL
Sbjct  2    RVMVAIDGSDESLYALKWALDLLLVG-PKDNADDVATSTGTATLEAPHAGSHENVSMVTL  60

Query  337  VNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLE  516
            ++V  PFQ +V    P   +        RK Q++ A  +L++AL++CK KM+KAETL+L 
Sbjct  61   IHVMQPFQNYVL---PAAGSAE-----LRKEQEEKAAAILARALEICKDKMIKAETLILR  112

Query  517  GDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESP  696
            GDPKD++C A E+  VDLLVVGSRGLG + RAFLGSVS YC HHA CPV+IVKP PKES 
Sbjct  113  GDPKDRICEATEQRHVDLLVVGSRGLGMVKRAFLGSVSSYCAHHAKCPVVIVKP-PKESG  171

Query  697  R  699
            +
Sbjct  172  K  172



>ref|XP_009389841.1| PREDICTED: universal stress protein A-like protein [Musa acuminata 
subsp. malaccensis]
Length=187

 Score =   162 bits (409),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 123/189 (65%), Gaps = 16/189 (8%)
 Frame = +1

Query  172  MEESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP  351
            M +    ++  +V++A++++E S YAL+WALDN+F +  +    ++ +  G + L++ + 
Sbjct  1    MADGGGEDKKMKVLVAVEETEGSLYALSWALDNLFTS--ASDVPDKTESLGRLVLIHAQQ  58

Query  352  PFQPFVFHTGP--------------VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKM  489
            P Q F+   GP               V+ATS+VID+ R++Q+Q ++ +L +A Q+C+ K+
Sbjct  59   PLQHFMHPVGPCMTDPHHRSFSVLFAVYATSSVIDSVRRAQEQNSRNLLERATQVCRSKL  118

Query  490  VKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLI  669
            V+AE ++++GDPK+ +C+ AE+M  DLLVVGSRGL  I RA LGSVS YC HHA CPVLI
Sbjct  119  VEAEMVIVDGDPKEMICQFAEQMQADLLVVGSRGLSKIRRAILGSVSGYCAHHATCPVLI  178

Query  670  VKPTPKESP  696
            VKP     P
Sbjct  179  VKPPKGNHP  187



>ref|XP_010504800.1| PREDICTED: uncharacterized protein LOC104781757 isoform X2 [Camelina 
sativa]
Length=193

 Score =   162 bits (410),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 123/189 (65%), Gaps = 15/189 (8%)
 Frame = +1

Query  142  YLNREGVTEIMEESTVPEQNRR--VMIAIDDSEESFYALNWA---LDNVFKNRPshhshe  306
            Y++  GV E   E+ V +  ++  VM+AID+S+ SF AL W    L +V    P      
Sbjct  4    YVDASGVDETAAETAVEKHKKKLKVMVAIDESKNSFDALQWVVEHLRDVISAEPETGQEG  63

Query  307  eeqhsGVITLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQK  486
                 G++TLV+V P +  +++ +G     T +V +  RK++++    + ++AL++C+ K
Sbjct  64   -----GLLTLVHVHPTYLQYIYPSG----GTDSVPEQVRKAREESTTNLFTRALEICRGK  114

Query  487  MVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVL  666
            MVK ET++LEGDPK+ +C+A E+  VDLLVVGSRGLG I RAFLGSVSDYC  HA CP+L
Sbjct  115  MVKTETMILEGDPKEMICQAVEQTHVDLLVVGSRGLGMIKRAFLGSVSDYCAQHAKCPIL  174

Query  667  IVKPTPKES  693
            IV+P P+E+
Sbjct  175  IVRP-PRET  182



>emb|CDX67744.1| BnaA07g17840D [Brassica napus]
Length=201

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 124/180 (69%), Gaps = 15/180 (8%)
 Frame = +1

Query  181  STVPEQNRR---VMIAIDDSEESFYALNWA---LDNVFKNRPshhsheeeqhsGVITLVN  342
            +T  +QN++   VM+A+D+S+ SFYAL WA   L +V    P           G++TLV+
Sbjct  16   TTTAKQNKKKLKVMVAMDESKNSFYALEWAVEHLRDVISAEPETDQAG-----GLLTLVH  70

Query  343  VRPPFQPFVFHTG---PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVL  513
            V P +  +++ +G     ++A  +V ++ +K++++   ++ +++L++C+ K+VK ET++L
Sbjct  71   VHPTYLQYIYPSGGTASAMYAVDSVPESMKKAREESTTKLFTRSLEICRGKLVKTETMIL  130

Query  514  EGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            EGDPK+ +C+A E+  VDLLVVGSRGLG I RAFLGSVSDYC  HA CP+LIV+P P+E+
Sbjct  131  EGDPKEMICQAVEQTHVDLLVVGSRGLGMIKRAFLGSVSDYCAQHAKCPILIVRP-PRET  189



>emb|CDY01070.1| BnaC05g41300D [Brassica napus]
Length=164

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 115/164 (70%), Gaps = 7/164 (4%)
 Frame = +1

Query  211  MIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV-FHTGP-  384
            M+AID+S+ SFYAL W +D+   +     +   E   G++T+V+V+P F  F  F  GP 
Sbjct  1    MLAIDESDSSFYALQWVIDHF--STLLMTTEGAEAEGGLLTVVHVQPTFHHFAPFPAGPG  58

Query  385  --VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEM  558
               V+  S +I++ +K+QQ+ +  ++ +ALQMC+ K +++ETLV EG  K+ +C+A E+M
Sbjct  59   ATAVYPPSLMIESVKKTQQETSAALVLRALQMCRAKQIRSETLVFEGKAKEIICQAVEQM  118

Query  559  SVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
             VDLLVVGSRGLG I RA +GSVSDYC HHA+CP+LIVKP PKE
Sbjct  119  HVDLLVVGSRGLGKIRRALIGSVSDYCAHHANCPILIVKP-PKE  161



>ref|XP_002876463.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52722.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=194

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 116/169 (69%), Gaps = 11/169 (7%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDN---VFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            +VM+AID+S+ SF AL WA+D+   V    P           G++TLV+V P +  +++ 
Sbjct  30   KVMVAIDESKNSFDALEWAVDHLRVVISAEPETGQEG-----GLLTLVHVHPTYLQYIYP  84

Query  376  TG---PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRA  546
            +G     V+AT +V +  RK++++    + ++AL++C+ KMVK ET++LEGDPK+ +C+A
Sbjct  85   SGGTASAVYATDSVPEPMRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQA  144

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
             E+  VDLLVVGSRGLG I RAFLGSVSDYC  HA CP+LIV+P+  +S
Sbjct  145  VEQTHVDLLVVGSRGLGMIKRAFLGSVSDYCAQHAKCPILIVRPSLGKS  193



>ref|XP_006293247.1| hypothetical protein CARUB_v10019581mg [Capsella rubella]
 gb|EOA26145.1| hypothetical protein CARUB_v10019581mg [Capsella rubella]
Length=203

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 117/169 (69%), Gaps = 12/169 (7%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWA---LDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            +VM+AID+S+ SF AL WA   L +V    P  +        G++TLV+V P +  +++ 
Sbjct  30   KVMVAIDESKNSFDALQWAVEHLRDVISAEPETNQEG-----GLLTLVHVHPTYLQYIYP  84

Query  376  TG---PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRA  546
            +G     V+AT +V +  RK++++    + ++AL++C+ KMVK ET++LEGDPK+ +C+A
Sbjct  85   SGGTASAVYATDSVPEQVRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQA  144

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
             E+  +DLLVVGSRGLG I RAFLGSVSDYC  HA CP+LIV+P P+E+
Sbjct  145  VEQTHIDLLVVGSRGLGMIKRAFLGSVSDYCAQHARCPILIVRP-PRET  192



>ref|XP_008241135.1| PREDICTED: universal stress protein A-like protein [Prunus mume]
Length=173

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 114/181 (63%), Gaps = 26/181 (14%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsG----------------VITL  336
            +V++AID SEESFYAL WALD +    P  ++ +    +G                ++TL
Sbjct  2    KVIVAIDGSEESFYALKWALDFLLVG-PKDNADDVATSTGTATLEAPQAGSHENVSMVTL  60

Query  337  VNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLE  516
            V V  PFQ +V    P   +        RK Q++ A  +L++AL++CK KM+KAETL+L 
Sbjct  61   VYVMQPFQNYVL---PAAGSAE-----LRKEQEEKAAAILARALEICKDKMIKAETLILR  112

Query  517  GDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESP  696
            GDPKD +C A E+  VDLLVVGSRGLG + RAFLGSVS YC HHA CPV+IVKP PKES 
Sbjct  113  GDPKDMICEATEQRHVDLLVVGSRGLGMVKRAFLGSVSSYCAHHAKCPVVIVKP-PKESG  171

Query  697  R  699
            +
Sbjct  172  K  172



>ref|NP_191404.2| adenine nucleotide alpha hydrolases-like superfamily protein 
[Arabidopsis thaliana]
 gb|AAO42062.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50593.1| unknown protein [Arabidopsis thaliana]
 gb|AEE79782.1| universal stress protein family protein [Arabidopsis thaliana]
Length=204

 Score =   160 bits (405),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 116/168 (69%), Gaps = 12/168 (7%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDN---VFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHT  378
            VM+AID+S+ SF AL WA+D+   V    P           G++TL++V P +  +++ +
Sbjct  32   VMVAIDESKNSFDALEWAVDHLRVVISAEPETGQEG-----GLLTLLHVHPTYLQYIYPS  86

Query  379  G---PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAA  549
            G     V+AT +V +  RK++++    + ++AL++C+ KMVK ET++LEGDPK+ +C+A 
Sbjct  87   GGTASAVYATDSVPEPMRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQAV  146

Query  550  EEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            E+  VDLLVVGSRGLG I RAFLGSVSDYC  HA CP+LIV+P P+E+
Sbjct  147  EQTHVDLLVVGSRGLGMIKRAFLGSVSDYCAQHAKCPILIVRP-PRET  193



>gb|AFK43196.1| unknown [Lotus japonicus]
Length=193

 Score =   159 bits (403),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 113/162 (70%), Gaps = 4/162 (2%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhs--heeeqhsGVITLVNVRPPFQPFVFHT  378
            +VM+A+D+S+ SF+AL WALDNV  N  +  +     E   G++ LV+V P F P V+  
Sbjct  23   KVMVAVDESDCSFHALKWALDNVLNNMTTTATPDENIEDGGGMVFLVHVEPAFHPAVYPI  82

Query  379  GPVVF--ATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAE  552
            G      A++++ D  RK+Q++ +   LS+ALQMC+   +KAE+++L GD ++ +C+AA+
Sbjct  83   GTSALYPASASLEDLMRKAQREKSTSTLSRALQMCRDNQIKAESIILTGDAREMICQAAD  142

Query  553  EMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
            +M VDLL++GSRGL  + RAFLGSVSDYC HHA  P+LIVKP
Sbjct  143  QMHVDLLIMGSRGLSVLKRAFLGSVSDYCAHHAKTPILIVKP  184



>gb|KEH41788.1| adenine nucleotide alpha hydrolase superfamily protein [Medicago 
truncatula]
Length=177

 Score =   159 bits (402),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 112/166 (67%), Gaps = 8/166 (5%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFK--NRPshhsheeeqhsGVITLVNVRPPFQPFVFHT  378
            +VM+AID+S+ S YAL WALDN+F      + +    E   G++ LV+V P F  + +  
Sbjct  4    KVMVAIDESDGSLYALKWALDNLFNIMATDTMNGTTSENEEGIVFLVHVEPNFHTYAYPI  63

Query  379  --GP--VVFATS--TVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLC  540
              GP  V F  S   V D+ +K+QQ+ +  + S+ALQMCK K VKAE+++L GD ++ +C
Sbjct  64   PMGPAGVAFYPSIPEVGDSLKKAQQEKSAAIASQALQMCKDKQVKAESVILNGDAREMIC  123

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
             A E+M VDLL++GSRGLG + RAFLGSVSDYC HHA  P+LIVKP
Sbjct  124  EATEKMQVDLLIMGSRGLGKLKRAFLGSVSDYCAHHAKAPILIVKP  169



>ref|XP_007029145.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
 gb|EOY09647.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
Length=172

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 118/172 (69%), Gaps = 8/172 (5%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhs----heeeqhsGVITLVNVRPPFQPFVF  372
            RVM+ ID+S+ESF+AL W LD +F    +  +      +E+ + ++TL++V+  F  +  
Sbjct  2    RVMVGIDESDESFHALRWTLDKLFDGMSTRTAPPEEANQEEAANLLTLLHVQKAFHNYGI  61

Query  373  HTGP---VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCR  543
              G      +   ++ ++ RKSQ Q++KE+L  A QMCK K +K ++L+LEGDPK+K+C+
Sbjct  62   PVGAGASAFYVPYSIEESVRKSQNQISKELLFHASQMCKDKSIKVKSLILEGDPKEKICQ  121

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPR  699
              E+M VDLLVVGSR LG I RA LGSVSDYC H+A+CPVLIVKP P+E+ +
Sbjct  122  VIEQMQVDLLVVGSRKLGKIKRALLGSVSDYCAHNANCPVLIVKP-PQEASK  172



>gb|KFK35112.1| hypothetical protein AALP_AA5G237800 [Arabis alpina]
Length=207

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 123/182 (68%), Gaps = 13/182 (7%)
 Frame = +1

Query  166  EIMEESTVPE---QNRRVMIAIDDSEESFYALNWA---LDNVFKNRPshhsheeeqhsGV  327
            ++ME +T  +   +  +VM+AID+S+ SFYAL WA   L +V    P  +        G+
Sbjct  28   KMMETATAAKPIKKKLKVMVAIDESKNSFYALEWAVEHLRDVISAEPETNQEG-----GL  82

Query  328  ITLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETL  507
            +TLV+V P +  +++ TG    A S V ++ RK++++   ++ ++AL++C+ KMVK ET+
Sbjct  83   LTLVHVHPTYLQYIYPTGGTASADS-VPESMRKAREENTTKLFTRALEICRGKMVKTETM  141

Query  508  VLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
            ++EGD K+ +C+A E+  VDLLVVGSRGLG I RA LGSVSDYC  HA CP+LIV+P PK
Sbjct  142  IIEGDAKEMICQAVEQTHVDLLVVGSRGLGMIKRALLGSVSDYCAQHAKCPILIVRP-PK  200

Query  688  ES  693
            E+
Sbjct  201  ET  202



>gb|KFK35113.1| hypothetical protein AALP_AA5G237800 [Arabis alpina]
Length=204

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 123/182 (68%), Gaps = 16/182 (9%)
 Frame = +1

Query  166  EIMEESTVPE---QNRRVMIAIDDSEESFYALNWA---LDNVFKNRPshhsheeeqhsGV  327
            ++ME +T  +   +  +VM+AID+S+ SFYAL WA   L +V    P  +        G+
Sbjct  28   KMMETATAAKPIKKKLKVMVAIDESKNSFYALEWAVEHLRDVISAEPETNQEG-----GL  82

Query  328  ITLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETL  507
            +TLV+V P +  +++ TG     T +V ++ RK++++   ++ ++AL++C+ KMVK ET+
Sbjct  83   LTLVHVHPTYLQYIYPTG----GTDSVPESMRKAREENTTKLFTRALEICRGKMVKTETM  138

Query  508  VLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
            ++EGD K+ +C+A E+  VDLLVVGSRGLG I RA LGSVSDYC  HA CP+LIV+P PK
Sbjct  139  IIEGDAKEMICQAVEQTHVDLLVVGSRGLGMIKRALLGSVSDYCAQHAKCPILIVRP-PK  197

Query  688  ES  693
            E+
Sbjct  198  ET  199



>ref|XP_008241215.1| PREDICTED: uncharacterized protein LOC103339661 [Prunus mume]
Length=220

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 26/191 (14%)
 Frame = +1

Query  175  EESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsG----------  324
            +E    ++  RV++AID SE SFYAL WALD +    P  ++ +    +G          
Sbjct  39   DEQQRKKEKMRVVVAIDGSEGSFYALKWALDLLLVG-PKDNADDVATSTGTATLEAPHAG  97

Query  325  ------VITLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQK  486
                  ++TLV V  PFQ +V         ++ V    RK Q++ A  +L+ AL++CK K
Sbjct  98   SHENVSMVTLVYVMQPFQNYVL--------SAAVSGELRKEQEERATAILAHALEICKDK  149

Query  487  MVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVL  666
             +KA+TL+L GDP D +C+A E+M VDLLVVGSRGLG + R F+GSVSDYC HHA CPV+
Sbjct  150  KIKAQTLILSGDPNDMICQATEQMHVDLLVVGSRGLGMVKRTFIGSVSDYCAHHAKCPVV  209

Query  667  IVKPTPKESPR  699
            IVKP PKES +
Sbjct  210  IVKP-PKESGK  219



>ref|XP_010516493.1| PREDICTED: uncharacterized protein LOC104792132 isoform X2 [Camelina 
sativa]
Length=193

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 123/189 (65%), Gaps = 15/189 (8%)
 Frame = +1

Query  142  YLNREGVTEIMEESTVPEQNRR--VMIAIDDSEESFYALNWA---LDNVFKNRPshhshe  306
            Y++  GV E   ES+V +  ++  VM+AID+S+ SF AL W    L +V    P      
Sbjct  4    YVDASGVDETAAESSVEKHKKKLKVMVAIDESKNSFDALQWVVEHLRDVISAEPETGQEG  63

Query  307  eeqhsGVITLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQK  486
                 G++TLV+V P +  +++ +G     T +V +  RK++++    + ++AL++C+ K
Sbjct  64   -----GLLTLVHVHPTYLQYIYPSG----GTDSVPEQVRKAREESTTNLFTRALEICRGK  114

Query  487  MVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVL  666
            MVK ET++LEGDPK+ +C+A E+  VDLLV+GSRGLG I RAFLGSVSDYC  HA  P+L
Sbjct  115  MVKTETMILEGDPKEMICQAVEQTHVDLLVLGSRGLGMIKRAFLGSVSDYCAQHAKRPIL  174

Query  667  IVKPTPKES  693
            IV+P P+E+
Sbjct  175  IVRP-PRET  182



>ref|XP_009104144.1| PREDICTED: universal stress protein A-like protein [Brassica 
rapa]
Length=204

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 122/176 (69%), Gaps = 15/176 (9%)
 Frame = +1

Query  193  EQNRR---VMIAIDDSEESFYALNWA---LDNVFKNRPshhsheeeqhsGVITLVNVRPP  354
            +QN++   VM+A+D+S+ SFYAL WA   L +V    P           G++TLV+V P 
Sbjct  23   KQNKKKLKVMVAMDESKNSFYALEWAVEHLRDVISAEPETDQAG-----GLLTLVHVHPT  77

Query  355  FQPFVFHTG---PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDP  525
            +  +++ +G     ++A  +V ++ +K++++   ++ +++L++C+ K++K ET++LEGDP
Sbjct  78   YLQYIYPSGGTASAMYAIDSVPESMKKAREESTTKLFTRSLEICRGKLMKTETMILEGDP  137

Query  526  KDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            K+ +C+A E+  VDLLVVGSRGLG I RAFLGSVSDYC  HA CP+LIV+P P+E+
Sbjct  138  KEMICQAVEQTHVDLLVVGSRGLGMIKRAFLGSVSDYCAQHAKCPILIVRP-PRET  192



>emb|CDP10547.1| unnamed protein product [Coffea canephora]
Length=185

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 114/176 (65%), Gaps = 20/176 (11%)
 Frame = +1

Query  187  VPEQNR--RVMIAIDDSEESFYALNWALDNVFKN----------RPshhsheeeqhsGVI  330
            +P++ +  R M+A+DDSEESFYALNW LD  F N              H H+    S ++
Sbjct  13   LPQERKKMRAMVAVDDSEESFYALNWVLDKFFSNIVMSTLPTGTETPDHQHDHRVESNLV  72

Query  331  TLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLV  510
            +LV+V      +VF  G        V+++  K+++Q A ++LS+A QMCK + V AETL+
Sbjct  73   SLVHVMDRLPHYVFPGG-------YVVESATKAREQNAAKILSQASQMCKDRKVAAETLI  125

Query  511  LEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITR-AFLGSVSDYCLHHAHCPVLIVK  675
            LEGDPK+ +C A E M VD+LVVGSRGLG I R AFLGSVSDYC HHA CPV+IVK
Sbjct  126  LEGDPKEMICEAVERMHVDVLVVGSRGLGQIKRQAFLGSVSDYCAHHAKCPVVIVK  181



>ref|NP_850717.1| adenine nucleotide alpha hydrolases-like superfamily protein 
[Arabidopsis thaliana]
 gb|AEE79783.1| universal stress protein family protein [Arabidopsis thaliana]
Length=197

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 113/165 (68%), Gaps = 13/165 (8%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDN---VFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHT  378
            VM+AID+S+ SF AL WA+D+   V    P           G++TL++V P +  +++ +
Sbjct  32   VMVAIDESKNSFDALEWAVDHLRVVISAEPETGQEG-----GLLTLLHVHPTYLQYIYPS  86

Query  379  GPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEM  558
            G     T +V +  RK++++    + ++AL++C+ KMVK ET++LEGDPK+ +C+A E+ 
Sbjct  87   G----GTDSVPEPMRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQAVEQT  142

Query  559  SVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
             VDLLVVGSRGLG I RAFLGSVSDYC  HA CP+LIV+P P+E+
Sbjct  143  HVDLLVVGSRGLGMIKRAFLGSVSDYCAQHAKCPILIVRP-PRET  186



>ref|XP_006650590.1| PREDICTED: universal stress protein A-like protein-like [Oryza 
brachyantha]
Length=159

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 111/162 (69%), Gaps = 12/162 (7%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGV-ITLVNVRPPFQPFVFHTG  381
            +V++A+D SEES  AL WALDNV   R         +  GV + +++ +     FV+   
Sbjct  2    KVVVAVDASEESLRALAWALDNVIGRR---------RAGGVSVVVLHAQHGADHFVYPVA  52

Query  382  P--VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
               V +A ++ I++ RK+Q++++++V+S+AL +CKQ+ V A   ++EGD K+ +C+A EE
Sbjct  53   AHAVAYAPTSAIESMRKAQEEISRKVVSRALDVCKQREVNAMGAIVEGDAKEAICQAVEE  112

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            M  D+LV+GSRGLG I RAFLGSVSDY +HHA CPVL+VKPT
Sbjct  113  MHADMLVLGSRGLGKIKRAFLGSVSDYLVHHACCPVLVVKPT  154



>gb|AAR87267.1| putative stress-related protein [Oryza sativa Japonica Group]
 gb|ABF98894.1| universal stress protein family protein, expressed [Oryza sativa 
Japonica Group]
Length=182

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 110/166 (66%), Gaps = 21/166 (13%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQP--FVFHT  378
            +V++A+D SEES  AL+WALDNV   R           +G +++V V     P  FV+  
Sbjct  26   KVVVAVDASEESLNALSWALDNVIGRR-----------AGAVSVVVVHAQHGPDHFVY--  72

Query  379  GPVVFATS-----TVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCR  543
             PV          + I++ RK+Q++++++V+S+AL +CKQ+ V A   ++EGD K+ +C+
Sbjct  73   -PVAAHAIAYAPASAIESMRKAQEEISRKVVSRALDVCKQREVSATGAIVEGDAKEAICQ  131

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            A EEM  D+LV+GSRGLG I RAFLGSVSDY +HHA CPVL+VKPT
Sbjct  132  AVEEMHADMLVLGSRGLGKIKRAFLGSVSDYLVHHACCPVLVVKPT  177



>ref|XP_007202608.1| hypothetical protein PRUPE_ppa011744mg [Prunus persica]
 gb|EMJ03807.1| hypothetical protein PRUPE_ppa011744mg [Prunus persica]
Length=198

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 119/191 (62%), Gaps = 26/191 (14%)
 Frame = +1

Query  175  EESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsG----------  324
            +E    ++  RV++AID SE SFYAL WALD +    P  ++ +    +G          
Sbjct  17   DEQQRKKEKMRVVVAIDGSEGSFYALKWALD-LLLVLPKDNADDVATSTGTATLEAPLAG  75

Query  325  ------VITLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQK  486
                  ++TLV V  PFQ +V         ++ V    RK Q++ A  +L++AL++CK K
Sbjct  76   SHENVSMVTLVYVMQPFQNYVL--------SAAVSGELRKEQEERAAAILARALEICKDK  127

Query  487  MVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVL  666
             +KAETL+L GDPKD +C+A E+M VDLLVVGSRGLG I R F+GSVSDYC HHA CPV+
Sbjct  128  KIKAETLILGGDPKDMICQATEQMHVDLLVVGSRGLGIIKRTFIGSVSDYCAHHAKCPVV  187

Query  667  IVKPTPKESPR  699
            IVKP PKES +
Sbjct  188  IVKP-PKESGK  197



>ref|XP_002467191.1| hypothetical protein SORBIDRAFT_01g021200 [Sorghum bicolor]
 gb|EER94189.1| hypothetical protein SORBIDRAFT_01g021200 [Sorghum bicolor]
Length=174

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 113/171 (66%), Gaps = 6/171 (4%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHT--  378
            +V++A+DDS+ S +AL W LD++F   P+     +E+    + LV+ + P +  + +   
Sbjct  4    KVLVAVDDSDGSRHALAWVLDHLF---PAAEQPHQEEPQPALVLVHAQEPLRHVMMYPVG  60

Query  379  -GPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
             G  V+   ++++  R +Q + A+ +L +A Q+C ++ V AE +V+EGDP++ LCRAA++
Sbjct  61   PGSAVYGAPSMMERVRAAQAENARNLLDRANQICHRRGVSAECVVVEGDPREALCRAAQD  120

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPRVPR  708
            M   LLVVGSRGLG I RAFLGSVSDYC  HA CP+++VKP P+E+    R
Sbjct  121  MGAGLLVVGSRGLGAIKRAFLGSVSDYCAQHASCPIMVVKPPPRENEHAHR  171



>gb|EMT31581.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=183

 Score =   149 bits (375),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 106/161 (66%), Gaps = 12/161 (7%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +V++A+D SEES +AL+WALDNV ++ P             + +++ +     FV H   
Sbjct  31   KVVVAVDASEESLHALSWALDNVVRHHPGAS----------VVVLHAQHRVDHFVAHG--  78

Query  385  VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSV  564
            + +A  T +D+ R++Q++ ++ V+++AL +C+QK   A   V+EGDPK+ + +A EEM  
Sbjct  79   LAYAPPTALDSMRRAQEENSRRVVARALDVCRQKQASATAAVVEGDPKEAIYQAVEEMRA  138

Query  565  DLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
            DLLV+GSRGLG I RA LGSVSDY  HHA CPVLIVKP  K
Sbjct  139  DLLVLGSRGLGMIKRALLGSVSDYLAHHACCPVLIVKPPNK  179



>gb|ADB54817.1| universal stress protein 9308 [Hordeum vulgare subsp. vulgare]
Length=181

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 105/163 (64%), Gaps = 12/163 (7%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +V+ A+D SEES +AL+WALDNV ++ P             + +V+ + P   FV+    
Sbjct  25   KVVAAVDASEESLHALSWALDNVVRHHPGAS----------VVVVHAQHPVDHFVYPVAA  74

Query  385  --VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEM  558
              + +A  T +D+ R++Q + +++ +++AL +C+QK V A   V+EGD K+ +C+A E+ 
Sbjct  75   HGLAYAPPTAMDSMRRAQAENSRKAVARALDVCRQKQVSATAAVVEGDAKEAICQAVEDA  134

Query  559  SVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
              DLLV+GSRGLG I RA LGSVSDY  HHA CPVLIVKP  K
Sbjct  135  RADLLVLGSRGLGMIKRALLGSVSDYLAHHASCPVLIVKPPNK  177



>ref|XP_003559418.1| PREDICTED: universal stress protein A-like protein [Brachypodium 
distachyon]
Length=208

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 101/161 (63%), Gaps = 8/161 (5%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +V++A+D SEES +AL+WALD+V +  P           G    V       P   H   
Sbjct  52   KVVVAVDASEESLHALSWALDHVVRFHPGASVVVLHAQHGADHFV------YPIAAHG--  103

Query  385  VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSV  564
            + +A  T +D  RK Q++++ +V+S+AL +C QK V A  +V+EGDPK+ +C+AAE M  
Sbjct  104  LAYAPPTSLDAVRKDQEELSSKVVSRALDVCNQKQVNASAVVVEGDPKEAICQAAEVMHA  163

Query  565  DLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
             LLV+GSRGLG I RA LGSVSDY  HHA CPVLIVKP  K
Sbjct  164  GLLVLGSRGLGMIKRALLGSVSDYLAHHARCPVLIVKPPHK  204



>gb|ADB54816.1| universal stress protein 9308 [Hordeum vulgare subsp. vulgare]
Length=181

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 105/163 (64%), Gaps = 12/163 (7%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +V+ A+D SEES +AL+WALDNV ++ P             + +V+ + P   FV+    
Sbjct  25   KVVAAVDASEESLHALSWALDNVVQHHPGAS----------VVVVHAQHPVDHFVYPVAA  74

Query  385  --VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEM  558
              + +A  T +D+ R++Q + +++ +++AL +C+QK V A   V+EGD K+ +C+A E+ 
Sbjct  75   HGLAYAPPTAMDSMRRAQAENSRKAVARALDVCRQKQVSATAAVVEGDAKEAICQAVEDA  134

Query  559  SVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
              DLLV+GSRGLG I RA LGSVSDY  HHA CPVLIVKP  K
Sbjct  135  RADLLVLGSRGLGMIKRALLGSVSDYLAHHASCPVLIVKPPNK  177



>ref|XP_009116521.1| PREDICTED: uncharacterized protein C167.05-like isoform X1 [Brassica 
rapa]
 emb|CDY06041.1| BnaA09g37390D [Brassica napus]
Length=190

 Score =   146 bits (368),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 121/197 (61%), Gaps = 28/197 (14%)
 Frame = +1

Query  142  YLNREGVTEIMEESTVPEQNRR---VMIAIDDSEESFYALNWA---LDNVFKNRPshhsh  303
            Y++  GV     E+T   +N++   VM+AID+S+ SFYAL WA   L +V    P     
Sbjct  5    YVDAVGVDTTTTETTASSKNKKKLKVMVAIDESKNSFYALEWAVEHLKDVMSAEPETDQE  64

Query  304  eeeqhsGVITLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ  483
                  G++TLV+V P        +G    AT +V +  +K+  Q +  + + AL++C+ 
Sbjct  65   G-----GLLTLVHVNP--------SGATASATDSVPELMKKAGVQ-STNLFTPALELCRA  110

Query  484  KMV-------KAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCL  642
            KMV       K ET++LEGDPK+ +C+A E+  VDLLVVGSRGLG I RAFLGSVSDYC+
Sbjct  111  KMVGDLRTCVKTETMILEGDPKEMICQAVEQNHVDLLVVGSRGLGMIKRAFLGSVSDYCV  170

Query  643  HHAHCPVLIVKPTPKES  693
             HA CPVLIV+P PKE+
Sbjct  171  QHAQCPVLIVRP-PKET  186



>ref|XP_010431458.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=167

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 106/159 (67%), Gaps = 12/159 (8%)
 Frame = +1

Query  235  ESFYALNWA---LDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTG---PVVFA  396
            ++F AL W    L +V    P           G++TLV+V P +  +++ +G     V+A
Sbjct  4    QNFDALQWVVEHLRDVISAEPETGQEG-----GLLTLVHVHPTYLQYIYPSGGTASAVYA  58

Query  397  TSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVDLLV  576
            T +V +  RK++++    + ++AL++C+ KMVK ET++LEGDPK+ +C+A E+  VDLLV
Sbjct  59   TDSVPEQVRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQAVEQTHVDLLV  118

Query  577  VGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            VGSRGLG I RAFLGSVSDYC  HA CP+LIV+P P+E+
Sbjct  119  VGSRGLGMIKRAFLGSVSDYCAQHAKCPILIVRP-PRET  156



>gb|EMS53028.1| Universal stress protein A-like protein [Triticum urartu]
Length=288

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 104/163 (64%), Gaps = 12/163 (7%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +V++A+D SEES +AL+WALDNV +  P             + +V+ +     FV+    
Sbjct  29   KVVVAVDASEESLHALSWALDNVVRLHPGAS----------VAVVHAQHSVDHFVYPVAA  78

Query  385  --VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEM  558
              + +A  T +D+ R++Q++ ++  +++AL +C+QK   A   V+EGDPK+ +C A EEM
Sbjct  79   HGLAYAPPTALDSMRRAQEENSRRAVARALDVCRQKQASATAAVVEGDPKEAICEAVEEM  138

Query  559  SVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
              DLLV+GSRGLG + RA LGSVSDY  HHA CPVLIVKP  K
Sbjct  139  RADLLVLGSRGLGMVKRALLGSVSDYLAHHACCPVLIVKPPNK  181



>emb|CDX71957.1| BnaC08g29170D [Brassica napus]
Length=191

 Score =   144 bits (362),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 110/173 (64%), Gaps = 25/173 (14%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWA---LDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            +VM+AID+S+ SFYAL WA   L +V    P           G++TLV+V P        
Sbjct  30   KVMVAIDESKNSFYALEWAVEHLKDVMSAEPETDQEG-----GLLTLVHVNP--------  76

Query  376  TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMV-------KAETLVLEGDPKDK  534
            +G    AT +V +  +K+  Q +  + + AL++C+ KMV       K ET++LEGDPK+ 
Sbjct  77   SGATASATDSVPELMKKAGVQ-STNLFTPALELCRAKMVGDLRTCVKTETMILEGDPKEM  135

Query  535  LCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            +C+A E+  VDLLVVGSRGLG I RAF+GSVSDYC+ HA CPVLIV+P PKE+
Sbjct  136  ICQAVEQNHVDLLVVGSRGLGMIKRAFIGSVSDYCVQHAQCPVLIVRP-PKET  187



>ref|XP_004981765.1| PREDICTED: universal stress protein A-like protein-like [Setaria 
italica]
Length=184

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 102/161 (63%), Gaps = 12/161 (7%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF--HT  378
            +V+ A+D SEES  AL+WALDNV +  P             + +V+ +     FV+   T
Sbjct  29   KVVAAVDASEESLQALSWALDNVVRCHPDAS----------LVVVHAQHAVDHFVYPIAT  78

Query  379  GPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEM  558
              + +A    +++ RK+Q++ ++ +L++AL MCK++ V A   V+EGD K+ +C+A E  
Sbjct  79   HGIAYAPPAAVESMRKAQEENSRRILARALGMCKERQVDATAAVVEGDAKEAICQAVERF  138

Query  559  SVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
               LLV+GSRGLG I RAFLGSVSDY  HHA CPVL+VKPT
Sbjct  139  QAGLLVLGSRGLGKIKRAFLGSVSDYLSHHACCPVLVVKPT  179



>ref|XP_009116522.1| PREDICTED: uncharacterized protein C167.05-like isoform X2 [Brassica 
rapa]
Length=187

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 118/197 (60%), Gaps = 31/197 (16%)
 Frame = +1

Query  142  YLNREGVTEIMEESTVPEQNRR---VMIAIDDSEESFYALNWA---LDNVFKNRPshhsh  303
            Y++  GV     E+T   +N++   VM+AID+S+ SFYAL WA   L +V    P     
Sbjct  5    YVDAVGVDTTTTETTASSKNKKKLKVMVAIDESKNSFYALEWAVEHLKDVMSAEPETDQE  64

Query  304  eeeqhsGVITLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ  483
                  G++TLV           H  P   AT +V +  +K+  Q +  + + AL++C+ 
Sbjct  65   G-----GLLTLV-----------HVNPSASATDSVPELMKKAGVQ-STNLFTPALELCRA  107

Query  484  KMV-------KAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCL  642
            KMV       K ET++LEGDPK+ +C+A E+  VDLLVVGSRGLG I RAFLGSVSDYC+
Sbjct  108  KMVGDLRTCVKTETMILEGDPKEMICQAVEQNHVDLLVVGSRGLGMIKRAFLGSVSDYCV  167

Query  643  HHAHCPVLIVKPTPKES  693
             HA CPVLIV+P PKE+
Sbjct  168  QHAQCPVLIVRP-PKET  183



>ref|XP_004983044.1| PREDICTED: universal stress protein A-like protein-like [Setaria 
italica]
Length=175

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 104/160 (65%), Gaps = 2/160 (1%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +V++A+DDS+ S +AL W LD++F    +      E+    + LV+   P +  ++  GP
Sbjct  2    KVLVAVDDSDFSRHALAWVLDHLFPFPAAAADQPAEEPRPALVLVHALEPLRHIMYPIGP  61

Query  385  --VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEM  558
               V+   +++ +   +Q + A+ +L +A + C Q+ V AE +V+EG+P++ LCRAA +M
Sbjct  62   GSAVYGAPSMMQSVWAAQAENARSLLDRAKRTCHQRGVSAEVVVVEGEPREALCRAAADM  121

Query  559  SVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
               LLVVGSRGLG I RAFLGSVSDYC HHA CP+++VKP
Sbjct  122  GAGLLVVGSRGLGAIKRAFLGSVSDYCAHHASCPIMVVKP  161



>ref|XP_008679881.1| PREDICTED: ethylene-responsive protein isoform X2 [Zea mays]
Length=182

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 106/164 (65%), Gaps = 15/164 (9%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF----  372
            +V+ A+D SEES +AL+WALDNV +  P             + +V+ +     F +    
Sbjct  28   KVVAAVDASEESLHALSWALDNVVRCHPD----------ATLVVVHAQHAADHFAYPVAA  77

Query  373  HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAE  552
            H G +V+A S+ +++ R +Q++ ++ V+++AL +CK++ V A   V+EGD K+ + +A E
Sbjct  78   HEG-IVYAPSSAVESVRAAQEESSRRVVARALDICKERQVDATGAVVEGDAKEAIRQAVE  136

Query  553  EMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
             M   LLV+GSRGLG I RAFLGSVSDY +HHA CPVL+V+P P
Sbjct  137  RMQAGLLVLGSRGLGAIKRAFLGSVSDYLIHHACCPVLVVRPRP  180



>ref|XP_009116523.1| PREDICTED: uncharacterized protein C167.05-like isoform X3 [Brassica 
rapa]
Length=186

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 119/197 (60%), Gaps = 32/197 (16%)
 Frame = +1

Query  142  YLNREGVTEIMEESTVPEQNRR---VMIAIDDSEESFYALNWA---LDNVFKNRPshhsh  303
            Y++  GV     E+T   +N++   VM+AID+S+ SFYAL WA   L +V    P     
Sbjct  5    YVDAVGVDTTTTETTASSKNKKKLKVMVAIDESKNSFYALEWAVEHLKDVMSAEPETDQE  64

Query  304  eeeqhsGVITLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ  483
                  G++TLV+V P              AT +V +  +K+  Q +  + + AL++C+ 
Sbjct  65   G-----GLLTLVHVNPSG------------ATDSVPELMKKAGVQ-STNLFTPALELCRA  106

Query  484  KMV-------KAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCL  642
            KMV       K ET++LEGDPK+ +C+A E+  VDLLVVGSRGLG I RAFLGSVSDYC+
Sbjct  107  KMVGDLRTCVKTETMILEGDPKEMICQAVEQNHVDLLVVGSRGLGMIKRAFLGSVSDYCV  166

Query  643  HHAHCPVLIVKPTPKES  693
             HA CPVLIV+P PKE+
Sbjct  167  QHAQCPVLIVRP-PKET  182



>ref|XP_008679887.1| PREDICTED: ethylene-responsive protein isoform X3 [Zea mays]
 tpg|DAA51381.1| TPA: hypothetical protein ZEAMMB73_051712 [Zea mays]
Length=181

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 104/162 (64%), Gaps = 12/162 (7%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +V+ A+D SEES +AL+WALDNV +  P             + +V+ +     F +    
Sbjct  28   KVVAAVDASEESLHALSWALDNVVRCHPD----------ATLVVVHAQHAADHFAYPVAA  77

Query  385  --VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEM  558
              +V+A S+ +++ R +Q++ ++ V+++AL +CK++ V A   V+EGD K+ + +A E M
Sbjct  78   HGIVYAPSSAVESVRAAQEESSRRVVARALDICKERQVDATGAVVEGDAKEAIRQAVERM  137

Query  559  SVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
               LLV+GSRGLG I RAFLGSVSDY +HHA CPVL+V+P P
Sbjct  138  QAGLLVLGSRGLGAIKRAFLGSVSDYLIHHACCPVLVVRPRP  179



>ref|XP_008679878.1| PREDICTED: ethylene-responsive protein isoform X1 [Zea mays]
Length=186

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 103/169 (61%), Gaps = 21/169 (12%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP---------PF  357
            +V+ A+D SEES +AL+WALDNV +  P              TLV V           P 
Sbjct  28   KVVAAVDASEESLHALSWALDNVVRCHPDA------------TLVVVHAQHAADHFAYPV  75

Query  358  QPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKL  537
                  T  +V+A S+ +++ R +Q++ ++ V+++AL +CK++ V A   V+EGD K+ +
Sbjct  76   AAHGIGTEGIVYAPSSAVESVRAAQEESSRRVVARALDICKERQVDATGAVVEGDAKEAI  135

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
             +A E M   LLV+GSRGLG I RAFLGSVSDY +HHA CPVL+V+P P
Sbjct  136  RQAVERMQAGLLVLGSRGLGAIKRAFLGSVSDYLIHHACCPVLVVRPRP  184



>ref|XP_009593918.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Nicotiana tomentosiformis]
Length=111

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 82/109 (75%), Gaps = 4/109 (4%)
 Frame = +1

Query  355  FQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDK  534
             +PF  +  P     + VI++  ++Q Q A  +L++A +MCK KMVKAETL+LEGDPK+ 
Sbjct  1    MEPFPQYAYP----GTHVIESATRAQAQEAARILARASEMCKDKMVKAETLILEGDPKNM  56

Query  535  LCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            LC A E+M++DLL VGSRGLG I RAFLGSVSDYC HHA CP+LIVKPT
Sbjct  57   LCEATEKMNIDLLAVGSRGLGQIKRAFLGSVSDYCAHHAKCPMLIVKPT  105



>tpg|DAA51379.1| TPA: ethylene-responsive protein isoform 1 [Zea mays]
 tpg|DAA51380.1| TPA: ethylene-responsive protein isoform 2 [Zea mays]
Length=185

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 104/169 (62%), Gaps = 22/169 (13%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP---------PF  357
            +V+ A+D SEES +AL+WALDNV +  P              TLV V           P 
Sbjct  28   KVVAAVDASEESLHALSWALDNVVRCHPDA------------TLVVVHAQHAADHFAYPV  75

Query  358  QPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKL  537
                  TG +V+A S+ +++ R +Q++ ++ V+++AL +CK++ V A   V+EGD K+ +
Sbjct  76   AAHGIGTG-IVYAPSSAVESVRAAQEESSRRVVARALDICKERQVDATGAVVEGDAKEAI  134

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
             +A E M   LLV+GSRGLG I RAFLGSVSDY +HHA CPVL+V+P P
Sbjct  135  RQAVERMQAGLLVLGSRGLGAIKRAFLGSVSDYLIHHACCPVLVVRPRP  183



>gb|EPS58073.1| hypothetical protein M569_16744, partial [Genlisea aurea]
Length=106

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 85/106 (80%), Gaps = 2/106 (2%)
 Frame = +1

Query  385  VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSV  564
            VV AT  VI++ +K Q++ A  +L++AL MCK KMV AE++++EGDPKDK+C AAE+++V
Sbjct  1    VVHATPAVIESVKKGQEEFASRILARALNMCKGKMVNAESIIVEGDPKDKICEAAEQLNV  60

Query  565  DLLVVGSRGLGNITR-AFLGSVSDYCLHHAHCPVLIVKPTPKESPR  699
            +L+++GSRGLG I R A LGSVSDYC HH HCPVLIVKP P+ + R
Sbjct  61   ELVILGSRGLGAIKRWALLGSVSDYCAHHLHCPVLIVKP-PRRAAR  105



>ref|XP_009116524.1| PREDICTED: universal stress protein A-like protein isoform X4 
[Brassica rapa]
Length=183

 Score =   138 bits (347),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 118/197 (60%), Gaps = 35/197 (18%)
 Frame = +1

Query  142  YLNREGVTEIMEESTVPEQNRR---VMIAIDDSEESFYALNWA---LDNVFKNRPshhsh  303
            Y++  GV     E+T   +N++   VM+AID+S+ SFYAL WA   L +V    P     
Sbjct  5    YVDAVGVDTTTTETTASSKNKKKLKVMVAIDESKNSFYALEWAVEHLKDVMSAEPETDQE  64

Query  304  eeeqhsGVITLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ  483
                  G++TLV+V P               + +V +  +K+  Q +  + + AL++C+ 
Sbjct  65   G-----GLLTLVHVNP---------------SDSVPELMKKAGVQ-STNLFTPALELCRA  103

Query  484  KMV-------KAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCL  642
            KMV       K ET++LEGDPK+ +C+A E+  VDLLVVGSRGLG I RAFLGSVSDYC+
Sbjct  104  KMVGDLRTCVKTETMILEGDPKEMICQAVEQNHVDLLVVGSRGLGMIKRAFLGSVSDYCV  163

Query  643  HHAHCPVLIVKPTPKES  693
             HA CPVLIV+P PKE+
Sbjct  164  QHAQCPVLIVRP-PKET  179



>gb|AGT17355.1| hypothetical protein SHCRBa_260_G18_F_60 [Saccharum hybrid cultivar 
R570]
Length=173

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 106/161 (66%), Gaps = 4/161 (2%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHT--  378
            +V++A+DDS+ S +AL W LD++F         EE Q   V+ LV+ + P +  + +   
Sbjct  2    KVLVAVDDSDGSRHALAWVLDHLFPAA-EKQHEEEPQPPPVLVLVHAQEPLRHVMMYPVG  60

Query  379  -GPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
             G  V+   + ++  R +Q + A+ +L +A ++C ++ V +E +V+EGDP++ LCRAA++
Sbjct  61   PGSAVYGAPSTMEWVRAAQAENARNLLDRANRICHRRGVSSEGVVVEGDPREALCRAAQD  120

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
            M   LLVVGSRGLG I RAFLGSVSDYC  HA CP+L+VKP
Sbjct  121  MGAGLLVVGSRGLGAIKRAFLGSVSDYCAQHASCPILVVKP  161



>ref|XP_002463873.1| hypothetical protein SORBIDRAFT_01g007990 [Sorghum bicolor]
 gb|EER90871.1| hypothetical protein SORBIDRAFT_01g007990 [Sorghum bicolor]
Length=186

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 103/168 (61%), Gaps = 21/168 (13%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +++ A+D SEES +AL+WALDN+ +  P             + +V+ +     F +   P
Sbjct  30   KLVAAVDSSEESLHALSWALDNIVRCHPD----------ATLVVVHAQHAVDHFAY---P  76

Query  385  VVF--------ATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLC  540
            V            ST  ++ RK+Q++ ++ ++++AL +CK++ V A   V+EGD K+ +C
Sbjct  77   VAAHGINILPSCKSTAAESMRKAQEENSRRIVARALDICKERQVGATGTVVEGDAKEAIC  136

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
            +A E M   LLV+GSRGLG I RAFLGSVSDY +HHA CPVL+V+P P
Sbjct  137  QAVERMHAGLLVLGSRGLGRIKRAFLGSVSDYLIHHACCPVLVVRPRP  184



>ref|XP_010668291.1| PREDICTED: universal stress protein A-like protein [Beta vulgaris 
subsp. vulgaris]
Length=125

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +1

Query  391  FATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVDL  570
            FA S+V+++ +K+Q +++  +L +A  +CKQ MV+ ETL+ EGDPK+++C+A E++ +D+
Sbjct  25   FAASSVVESVKKAQAEISAAILQRAFSICKQNMVRVETLIFEGDPKEEICKAVEQVHMDM  84

Query  571  LVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
            LV+GSRGLG I RAFLGSVSDYC HHA CPVLIVKP PK
Sbjct  85   LVIGSRGLGGIKRAFLGSVSDYCAHHAGCPVLIVKP-PK  122



>ref|NP_001151646.1| ethylene-responsive protein [Zea mays]
 gb|ACG43644.1| ethylene-responsive protein [Zea mays]
Length=185

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 102/169 (60%), Gaps = 22/169 (13%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP---------PF  357
            +V+ A+D SEES +AL+WALDNV +  P              TLV V           P 
Sbjct  28   KVVAAVDASEESLHALSWALDNVVRCHPDA------------TLVVVHAQHAADHFAYPV  75

Query  358  QPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKL  537
                  TG +V+A S+ + + R +Q + ++ V+++AL +CK++ V A   V+EGD K+ +
Sbjct  76   AAHGIGTG-IVYAPSSAVXSVRAAQXESSRRVVARALDICKERQVDATGAVVEGDAKEAI  134

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
             +A E M   LLV+GSRGLG I RAFLGSVSDY +HHA CPVL+V+P P
Sbjct  135  RQAVERMQAGLLVLGSRGLGAIKRAFLGSVSDYLIHHACCPVLVVRPRP  183



>ref|NP_001064677.1| Os10g0437500 [Oryza sativa Japonica Group]
 gb|AAP53941.1| universal stress protein family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26591.1| Os10g0437500 [Oryza sativa Japonica Group]
 gb|EAZ16194.1| hypothetical protein OsJ_31643 [Oryza sativa Japonica Group]
 dbj|BAG97974.1| unnamed protein product [Oryza sativa Japonica Group]
Length=181

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 107/168 (64%), Gaps = 10/168 (6%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGV------ITLVNVRPPFQPF  366
            +V++A+DDS  S  AL+W LD++F   P+  + +  +   V      + LV+   P    
Sbjct  2    KVLVAVDDSRGSHRALSWVLDHLFF--PAAATGDGGEEEQVPRPAPELVLVHAIEPLHHV  59

Query  367  VFHTGP--VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLC  540
            +F  GP   V+  +++++  R +Q + A+ +L +A  +C+++ V A T+ +EG+P++ LC
Sbjct  60   MFPVGPGSAVYGAASMMEAVRAAQAENARNLLVRARLICERRGVAAATVAVEGEPREALC  119

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
            RAAE+    LLVVGSRGLG + RAFLGSVSDYC H A CP+++VKP P
Sbjct  120  RAAEDAGAGLLVVGSRGLGALKRAFLGSVSDYCAHRASCPIMVVKPPP  167



>gb|EMS48379.1| Universal stress protein A-like protein [Triticum urartu]
Length=205

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 100/163 (61%), Gaps = 13/163 (8%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGP  384
            +V++A+D SEES + L+WALD+V ++ P             + +++ +       +    
Sbjct  53   KVVVAVDASEESLHTLSWALDHVVRHHPGAS----------VVVLHAQHRVDRSAY--AG  100

Query  385  VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSV  564
            + +   T +D  R++Q +  ++ +S+AL  CKQK   A   V+ GD K+ +C+A E+M  
Sbjct  101  LAYVPPTAMDAMRRTQAENTRKAVSRALDACKQKQASATAAVVVGDAKEAICQAVEDMRA  160

Query  565  DLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            DLLV+GSRGLG + RAFLGSVSDY  HHA CPVLIVKP P E+
Sbjct  161  DLLVLGSRGLGMVKRAFLGSVSDYLAHHARCPVLIVKP-PNEA  202



>gb|EMT31582.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=183

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 103/171 (60%), Gaps = 13/171 (8%)
 Frame = +1

Query  175  EESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPP  354
            E +  P    +V++A+D SEES +AL+WALD+V +  P             + +V+ +  
Sbjct  22   EATRSPAATMKVVVAVDASEESLHALSWALDHVVRLHPGAS----------VVVVHAQHR  71

Query  355  FQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDK  534
                 +    + +   T +D  R++Q +  ++V+S+AL +CKQK   A  +++ GD K+ 
Sbjct  72   VDRSAY---GLAYVPPTAMDAMRRTQAENTRKVVSRALDVCKQKQASATAVLVVGDAKEA  128

Query  535  LCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
            +C+A E+M  DLLV+GSRGLG + RA LGSVSDY  +HA CPVLIVKP  K
Sbjct  129  ICQAVEDMRADLLVLGSRGLGMVRRALLGSVSDYLANHARCPVLIVKPPNK  179



>gb|EEC76183.1| hypothetical protein OsI_13519 [Oryza sativa Indica Group]
Length=177

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 105/167 (63%), Gaps = 28/167 (17%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQP--FVFHT  378
            +V++A+D SEES  AL+WALDNV   R           +G +++V V     P  FV+  
Sbjct  26   KVVVAVDASEESLNALSWALDNVIGRR-----------AGAVSVVVVHAQHGPDHFVY--  72

Query  379  GPVVFATSTV------IDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLC  540
             PV    +        I++ RK+Q++++++V+S+AL       V A   ++EGD K+ +C
Sbjct  73   -PVAAHAAIAYAPASAIESMRKAQEEISRKVVSRALD------VSATGAIVEGDAKEAIC  125

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            +A EEM  D+LV+GSRGLG I RAFLGSVSDY +HHA CPVL+VKPT
Sbjct  126  QAVEEMHADMLVLGSRGLGKIKRAFLGSVSDYLVHHACCPVLVVKPT  172



>gb|EAY78646.1| hypothetical protein OsI_33745 [Oryza sativa Indica Group]
Length=181

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 106/168 (63%), Gaps = 10/168 (6%)
 Frame = +1

Query  205  RVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGV------ITLVNVRPPFQPF  366
            +V++A+DDS  S  AL+W LD++F   P+  + +  +   V      + LV+   P    
Sbjct  2    KVLVAVDDSRGSHRALSWVLDHLFF--PAAATGDGGEEEQVPRPAPELVLVHAIEPLHHV  59

Query  367  VFHTGP--VVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLC  540
            +F  GP   V+  +++++  R +Q + A  +L +A  +C+++ V A T+ +EG+P++ LC
Sbjct  60   MFPVGPGSAVYGAASMMEAVRAAQAENALNLLVRARLICERRGVAAATVAVEGEPREALC  119

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
            RAAE+    LLVVGSRGLG + RAFLGSVSDYC H A CP+++VKP P
Sbjct  120  RAAEDAGAGLLVVGSRGLGALKRAFLGSVSDYCAHRASCPIMVVKPPP  167



>gb|EYU18168.1| hypothetical protein MIMGU_mgv1a023549mg, partial [Erythranthe 
guttata]
Length=101

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  388  VFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVD  567
            VF T++VI +  K+Q++ A  +L+ AL +C Q+MVKA+T ++EGDPK+ +C  A++M VD
Sbjct  1    VFPTTSVIQSVNKAQEEDASAILTHALDICTQRMVKAKTSIVEGDPKEMICNVADQMGVD  60

Query  568  LLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            L+ +GSRGLG + RAF+GSVSDY +HHA CPVL++KP+
Sbjct  61   LIAIGSRGLGKVKRAFMGSVSDYVIHHASCPVLVIKPS  98



>emb|CDX98295.1| BnaC06g16560D [Brassica napus]
Length=194

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 113/180 (63%), Gaps = 28/180 (16%)
 Frame = +1

Query  181  STVPEQNRR---VMIAIDDSEESFYALNWALD---NVFKNRPshhsheeeqhsGVITLVN  342
            +T+ + N++   VM+A+D+S+ SFYAL WA++   +V    P           G++TLV+
Sbjct  16   TTMGKHNKKKLKVMVAMDESKNSFYALEWAVEHLRDVISAEPETDQAG-----GLLTLVH  70

Query  343  VRPPFQPFVFHTG---PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVL  513
            V P +  +++ +G     V+AT +V ++ +K++++   ++ +++L++C+ KM        
Sbjct  71   VHPTYLQYIYPSGGTASAVYATDSVPESMKKAREESTIKLFTRSLEICRGKM--------  122

Query  514  EGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
                 + +C+A E+  VDLLVVGSRGLG I R FLGSVSDYC  HA CP+LIV+P P+E+
Sbjct  123  -----EMICQAVEQTHVDLLVVGSRGLGMIKRVFLGSVSDYCAQHAKCPILIVRP-PRET  176



>gb|AFK41746.1| unknown [Lotus japonicus]
Length=165

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 92/169 (54%), Gaps = 11/169 (7%)
 Frame = +1

Query  172  MEESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP  351
            M  S+  E+ + ++I IDDSE S YA+NW LD+ F   PS            + LV+ RP
Sbjct  1    MATSSDSEKKQVMVIGIDDSEHSVYAINWTLDHFFAKNPSFK----------LVLVHARP  50

Query  352  PFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMC-KQKMVKAETLVLEGDPK  528
                 V   GPV    + V+       +++A  VL  A Q+C K  +       +EGDP+
Sbjct  51   SATSAVGFAGPVYAGAAEVLPIVDSDLKKIAARVLENAKQICIKNNITDVVVEAVEGDPR  110

Query  529  DKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            + LC A E+    +LVVGS G G + RA LGSVSDYC HHAHC V+IVK
Sbjct  111  NVLCEAVEKYHASVLVVGSHGYGALKRAVLGSVSDYCAHHAHCSVMIVK  159



>ref|XP_011023763.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
Length=171

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 105/171 (61%), Gaps = 12/171 (7%)
 Frame = +1

Query  172  MEESTVPEQNRRVMIAIDDSEESFYALNWALDNVF-KNRPshhsheeeqhsGVITLVNVR  348
            M +     + R++++A+D+SEES +AL+W L NV   N PS            + L+ V+
Sbjct  1    MADEMGAAKERKILVAVDESEESMHALSWCLKNVLVSNNPSR---------DTLILLYVK  51

Query  349  PPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKM--VKAETLVLEGD  522
            PP   +    G     +S ++ T +K    +A  V+ KA +MC++++  VK ET++  GD
Sbjct  52   PPRVVYSALDGTGYLLSSDIMATMQKYNNDIADCVIEKAKRMCREQVQDVKVETIIEHGD  111

Query  523  PKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            P+D +C+AAE++ VD+LV+GS G G I RAFLGSVS++C  +  CPVLIVK
Sbjct  112  PRDLICQAAEKLHVDMLVMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVK  162



>ref|XP_006588416.1| PREDICTED: uncharacterized protein LOC100527357 isoform X1 [Glycine 
max]
Length=164

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 95/169 (56%), Gaps = 12/169 (7%)
 Frame = +1

Query  172  MEESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP  351
            M  S+   + + V+I IDDSE+S YALNWALD+ F + P             + L++ RP
Sbjct  1    MAASSSSSEKQVVLIGIDDSEQSTYALNWALDHFFPS-PIFK----------LVLIHSRP  49

Query  352  PFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETL-VLEGDPK  528
                 V   GPV    + ++       +++A  VL  A Q+C  K V   T  V+EGDP+
Sbjct  50   TATSAVGFAGPVYAGAAEILPIVDSDLRKIAARVLETAKQLCFNKSVNDVTAEVVEGDPR  109

Query  529  DKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            + LC A ++    +LVVGS G G I RA LGSVSDYC HHAHC V+IVK
Sbjct  110  NVLCDAVDKYRAAILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK  158



>ref|XP_006338073.1| PREDICTED: universal stress protein A-like protein-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006338074.1| PREDICTED: universal stress protein A-like protein-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006338075.1| PREDICTED: universal stress protein A-like protein-like isoform 
X3 [Solanum tuberosum]
Length=170

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 98/168 (58%), Gaps = 10/168 (6%)
 Frame = +1

Query  202  RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPP------FQP  363
             RV++++D SEES  ALNW LDN+ K +P     +E Q  G I +++V+ P        P
Sbjct  6    NRVIVSVDGSEESMNALNWTLDNI-KLKPHDPDSQESQ--GSIVILHVQSPPSIAAGLNP  62

Query  364  FVF-HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLC  540
                  GP               Q+++ + +L  AL++C  K    +T V+ GDPK+K+C
Sbjct  63   RAIPFGGPSDIEVPAFTAAIEAHQKRITQAILDHALEICANKNANVKTQVVIGDPKEKIC  122

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
             A EEM+ DLLV+GSR  G I R FLGSVS+YC +HA CPV+IVK TP
Sbjct  123  DAVEEMNADLLVMGSRAFGPIKRMFLGSVSNYCTNHAQCPVIIVKATP  170



>ref|XP_004495667.1| PREDICTED: universal stress protein A-like protein-like [Cicer 
arietinum]
Length=166

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 100/172 (58%), Gaps = 14/172 (8%)
 Frame = +1

Query  181  STVPEQNRRVMIAIDDSEESFYALNWALDN-VFKNRPshhsheeeqhsGVITLVNVRPPF  357
            + V E  RR+M+AID+ +ES YAL+W L N +F+N   H           + L  V+PP 
Sbjct  2    AGVTENGRRIMVAIDEGDESMYALSWCLKNLIFQNSKDH-----------LILFYVKPPR  50

Query  358  QPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKL  537
              +    G     +S +  T  K  QQ+A  VL KA ++CK  +   ET +  GDP+D +
Sbjct  51   AVYSAFDGTGYLFSSDITATMEKYSQQVADCVLEKAKRVCKD-LQNVETKIENGDPRDVI  109

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            C A +++ VD+LV+GS G G I RAFLGSVS++C  +  CPVLIVK  PK +
Sbjct  110  CHAVQKLGVDILVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKK-PKST  160



>gb|KDP23405.1| hypothetical protein JCGZ_23238 [Jatropha curcas]
Length=168

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 98/169 (58%), Gaps = 14/169 (8%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + R++++A+D SEES YAL+W L NV  +               I L+  RPP   +   
Sbjct  7    KARKILVAVDQSEESIYALSWCLKNVVSHNSE----------DTIILLYARPPTTVYTAL  56

Query  376  TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQK---MVKAETLVLEGDPKDKLCRA  546
             G     +S +I T  K  + +A+ ++ KA +MCK++    VK ET V  GDP++ +CR 
Sbjct  57   DGTGYLFSSDIISTMEKYSRDVAECIVEKAKKMCKEQEALSVKVETRVENGDPREVICRE  116

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            AE++ VD+LV+GS G G I RA LGSVS +C  +  CPVLIVK  PK +
Sbjct  117  AEKLCVDVLVMGSHGYGLIKRALLGSVSSHCAQNVKCPVLIVKK-PKST  164



>gb|ADB54810.1| universal stress protein 23267 [Hordeum vulgare subsp. vulgare]
 dbj|BAK03155.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 100/167 (60%), Gaps = 21/167 (13%)
 Frame = +1

Query  190  PEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV  369
            P   +++M+AID+SE S YAL WAL N+   R              + L  V+P F P  
Sbjct  6    PPPEQKMMVAIDESECSHYALEWALRNLAPRR--------------LVLFTVQP-FSPLS  50

Query  370  F-----HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDK  534
            +       GP V A+  +I +  + Q+Q+A+ ++ KA  +C    V AET++  GDPK+ 
Sbjct  51   YLPAGSPLGPSV-ASPELIRSVTEHQRQLAQALVDKAKAICADHGVDAETVIEVGDPKET  109

Query  535  LCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            +C AA++++VDLL++GS   G I R FLGSVS+YC HHA CPVL+VK
Sbjct  110  ICEAADKLNVDLLILGSHSRGPIQRFFLGSVSNYCSHHAKCPVLVVK  156



>ref|XP_010265105.1| PREDICTED: universal stress protein A-like protein [Nelumbo nucifera]
Length=166

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 103/166 (62%), Gaps = 22/166 (13%)
 Frame = +1

Query  193  EQNRRV--MIAIDDSEESFYALNWALDNV---FKNRPshhsheeeqhsGVITLVNVRPPF  357
            E++R+V  ++A+D+SE S YAL+WALDN+   F   P             +T+   +P  
Sbjct  15   EESRKVNVLVAVDESECSTYALHWALDNLRHCFSVSP-------------LTIFTAQPAA  61

Query  358  QPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKL  537
              + +  G    A   +ID+ R+ QQ+   E+ +KA ++C ++ V A+T+   GDPK+ +
Sbjct  62   D-YNYLYG---VANPELIDSVREWQQKAVSEMFAKAKEICARRGVTAKTITANGDPKEAI  117

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            C A E+ ++DLLV+G+ G G I RA LGSVSDYC+HHA CP+L+V+
Sbjct  118  CEAVEKFNIDLLVLGNHGRGIIKRALLGSVSDYCVHHAKCPILVVR  163



>ref|XP_003591211.1| Universal stress protein A-like protein [Medicago truncatula]
 gb|AES61462.1| universal stress family protein [Medicago truncatula]
Length=165

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 99/172 (58%), Gaps = 14/172 (8%)
 Frame = +1

Query  181  STVPEQNRRVMIAIDDSEESFYALNWALDN-VFKNRPshhsheeeqhsGVITLVNVRPPF  357
            + + E  RR+M+AID+ EES YAL W L N VF+N   H           + L+ V+PP 
Sbjct  2    AGITENGRRIMVAIDEGEESIYALTWCLKNLVFQNSKDH-----------LILLYVKPPR  50

Query  358  QPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKL  537
              +    G     +S +  T  K  QQ+A  VL KA  +C   +   ET +  GDP+D +
Sbjct  51   VVYSAFDGTGYLFSSDITATMEKYSQQVADCVLEKAKIVCND-VQNVETRIENGDPRDVI  109

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            C+A ++M VD+LV+GS G G I RAFLGSVS++C  +  CPVLIVK  PK +
Sbjct  110  CQAVQKMGVDILVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKK-PKST  160



>ref|XP_004237985.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
 ref|XP_010320202.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
Length=170

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 101/166 (61%), Gaps = 10/166 (6%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVR-PPFQPFVFHTGP  384
            V++++D SEES  ALNW LDN+ K +P      E Q  G I +++V+ PP      + G 
Sbjct  8    VIVSVDGSEESMNALNWTLDNI-KLKPHDPDSPESQ--GFIVILHVQSPPSIAAGLNPGA  64

Query  385  VVFATSTVID------TYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRA  546
            + F   + ++           Q+++ + +L  AL +C +K    +T V+ GDPK+K+C A
Sbjct  65   IPFGGPSDVEVPAFTAAIEAHQKRITQAILDHALGICAKKNANVKTQVVIGDPKEKICDA  124

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
             EEM+ DLLV+GSR  G I R FLGSVS+YC +HA CPV+IVK TP
Sbjct  125  VEEMNADLLVMGSRAFGPIKRMFLGSVSNYCTNHAQCPVIIVKATP  170



>gb|AAD46412.1|AF096262_1 ER6 protein [Solanum lycopersicum]
Length=168

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 101/166 (61%), Gaps = 10/166 (6%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVR-PPFQPFVFHTGP  384
            V++++D SEES  ALNW LDN+ K +P      E Q  G I +++V+ PP      + G 
Sbjct  6    VIVSVDGSEESMNALNWTLDNI-KLKPHDPDSPESQ--GFIVILHVQSPPSIAAGLNPGA  62

Query  385  VVFATSTVID------TYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRA  546
            + F   + ++           Q+++ + +L  AL +C +K    +T V+ GDPK+K+C A
Sbjct  63   IPFGGPSDVEVPAFTAAIEAHQKRITQAILDHALGICAKKNANVKTQVVIGDPKEKICDA  122

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
             EEM+ DLLV+GSR  G I R FLGSVS+YC +HA CPV+IVK TP
Sbjct  123  VEEMNADLLVMGSRAFGPIKRMFLGSVSNYCTNHAQCPVIIVKATP  168



>gb|ADB54809.1| universal stress protein 23267 [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 99/167 (59%), Gaps = 21/167 (13%)
 Frame = +1

Query  190  PEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFV  369
            P   +++M+AID+SE S YAL WAL N+   R              + L  V+P F P  
Sbjct  6    PPPEQKMMVAIDESECSHYALEWALRNLAPRR--------------LVLFTVQP-FSPLS  50

Query  370  F-----HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDK  534
            +       GP V A+  +I +  + Q+Q+A+ +  KA  +C    V AET++  GDPK+ 
Sbjct  51   YLPAGSPLGPSV-ASPELIRSVTEHQRQLAQALADKAKAICADHGVDAETVIEVGDPKET  109

Query  535  LCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            +C AA++++VDLL++GS   G I R FLGSVS+YC HHA CPVL+VK
Sbjct  110  ICEAADKLNVDLLILGSHSRGPIQRFFLGSVSNYCSHHAKCPVLVVK  156



>gb|EMT14537.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=164

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 100/166 (60%), Gaps = 23/166 (14%)
 Frame = +1

Query  199  NRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF--  372
             +++M+AID+SE S YAL WAL N+   R              + L  V+P F P  +  
Sbjct  12   EQKMMVAIDESECSHYALEWALRNLAPRR--------------LILFTVQP-FSPLSYLP  56

Query  373  -----HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKL  537
                   GP V A+  +I +  + Q+Q+A+ ++ KA  +C +  V AET++  GDPK+ +
Sbjct  57   VGSPRAVGPSV-ASPELIRSVTEHQRQLAQALVDKAKAICAEHGVDAETVIEVGDPKETI  115

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            C AAE+++VDLL++GS   G + R FLGSVS+YC HHA CPVL+VK
Sbjct  116  CEAAEKLNVDLLILGSHSRGPVQRFFLGSVSNYCSHHAKCPVLVVK  161



>ref|NP_001240086.1| uncharacterized protein LOC100816212 [Glycine max]
 gb|ACU16200.1| unknown [Glycine max]
Length=162

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 91/162 (56%), Gaps = 12/162 (7%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF  372
             + + V+I IDDSE+S YALNWALDN F + P             + L++ RP     V 
Sbjct  6    SEKQVVVIGIDDSEQSTYALNWALDNFFPS-PIFK----------LVLIHSRPTATSAVG  54

Query  373  HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETL-VLEGDPKDKLCRAA  549
              GPV    + V+       +++   VL  A Q+C  K V   T  V+EGDP++ LC A 
Sbjct  55   FAGPVFAGAAEVLPIVDSDLRKIGARVLETAKQLCINKSVNDVTAEVVEGDPRNVLCDAV  114

Query  550  EEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            ++    +LVVGS G G I RA LGSVSDYC HHAHC V+IVK
Sbjct  115  DKYRAAMLVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK  156



>ref|XP_008389277.1| PREDICTED: universal stress protein A-like protein [Malus domestica]
Length=185

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 102/179 (57%), Gaps = 8/179 (4%)
 Frame = +1

Query  166  EIMEESTVPEQNRRVMIAIDDSEESFYALNWALDNV---FKNRPshhsheeeqhsGVITL  336
            E M E       ++VM+AID+SE S YAL W LDN+     N P      +   +G IT 
Sbjct  10   ERMGEVVAKGAEKKVMVAIDESECSHYALMWVLDNLKDSITNSPLIIFMAQTPSNGNITF  69

Query  337  VNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLE  516
                   + +   +    F     +++ +++Q++ A  +L KA Q+C  + V AET+   
Sbjct  70   SASLGAARMYCPMSSSQEF-----VNSSQENQRKFALALLEKAKQICASRGVNAETVTEV  124

Query  517  GDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            GDPK+ +C A ++  + LLVVG RGLG I RA LGSVSDYC+ HA+CPVL+VK +  ++
Sbjct  125  GDPKEAICDAVKKHGIKLLVVGERGLGKIKRAILGSVSDYCVQHANCPVLVVKKSQADA  183



>gb|KHG27977.1| hypothetical protein F383_14126 [Gossypium arboreum]
Length=161

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 110/175 (63%), Gaps = 16/175 (9%)
 Frame = +1

Query  172  MEESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP  351
            MEE+ +    ++VM+AID+SE S +AL WAL+N+               +  + + N +P
Sbjct  1    MEENKM---KKKVMVAIDESEYSHWALQWALENL----------GHTISASQLFIFNAQP  47

Query  352  PFQPFVFHTGPVVFATST-VIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPK  528
                F + +G    A    +I+T +++Q+++A  +L KA  +C  + V AET+   GDPK
Sbjct  48   -LPNFAYLSGSTYGAPPVDLINTVQENQKKLALALLEKAKGICANRGVNAETMTEVGDPK  106

Query  529  DKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIV-KPTPKE  690
            +K+C A E+++++LL++GS G G I RAFLGSVS++C+H+A CPVL+V KP  K+
Sbjct  107  EKICEAVEKLNIELLILGSHGRGAIQRAFLGSVSNHCVHNAKCPVLVVRKPDWKD  161



>gb|ABK26351.1| unknown [Picea sitchensis]
Length=153

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 103/163 (63%), Gaps = 17/163 (10%)
 Frame = +1

Query  202  RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPF-VFHT  378
            +++M+A+DDSE S YAL WAL+N+                  ++LV      QP  VF++
Sbjct  5    KKIMVAVDDSEFSHYALQWALNNLH------------LFGSDVSLVLFHA--QPLAVFNS  50

Query  379  GPVVFATS-TVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
              +V  TS  +I+T    Q+Q+++E+L++A  +C +K V  ETL   GDPKD +C A E+
Sbjct  51   AAIVGVTSPGLIETILLQQKQVSEEILARAKGICAKKNVIVETLSEIGDPKDVICDATEK  110

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIV-KPT  681
            + +DLL+ GS G G + RAFLGSVS+YC+ +A CPVL++ KP+
Sbjct  111  LQIDLLITGSHGYGMLKRAFLGSVSNYCVQYAKCPVLVIRKPS  153



>ref|XP_010107691.1| Universal stress protein A-like protein [Morus notabilis]
 gb|EXC16664.1| Universal stress protein A-like protein [Morus notabilis]
Length=169

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 98/162 (60%), Gaps = 8/162 (5%)
 Frame = +1

Query  202  RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVR-PPFQPFVFHT  378
            R V++A+D SE S  AL WALDN+    P+  S       G   +++V+ PP      + 
Sbjct  7    RCVIVAVDGSESSMDALRWALDNLKLQSPAPDSTSG----GSFVVLHVQSPPSIAAGLNP  62

Query  379  GPVVF---ATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAA  549
            G + F   A   ++      Q+++ + VL  AL +C +K VK +T V+ GDPK+K+C  A
Sbjct  63   GAIPFCDVAVPAIMAAIEAHQRRITEAVLEHALNICSEKNVKVKTEVVIGDPKEKICEVA  122

Query  550  EEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            E+++ DLLV+GSR  G I R FLGSVS+YC +HA CPV+IVK
Sbjct  123  EKLNADLLVMGSRAFGPIKRMFLGSVSNYCTNHAQCPVVIVK  164



>ref|NP_001051280.1| Os03g0750000 [Oryza sativa Japonica Group]
 dbj|BAF13194.1| Os03g0750000, partial [Oryza sativa Japonica Group]
Length=128

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +1

Query  409  IDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSR  588
            I++ RK+Q++++++V+S+AL +CKQ+ V A   ++EGD K+ +C+A EEM  D+LV+GSR
Sbjct  33   IESMRKAQEEISRKVVSRALDVCKQREVSATGAIVEGDAKEAICQAVEEMHADMLVLGSR  92

Query  589  GLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            GLG I RAFLGSVSDY +HHA CPVL+VKPT
Sbjct  93   GLGKIKRAFLGSVSDYLVHHACCPVLVVKPT  123



>ref|XP_003580727.1| PREDICTED: universal stress protein A-like protein [Brachypodium 
distachyon]
Length=159

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 98/165 (59%), Gaps = 10/165 (6%)
 Frame = +1

Query  181  STVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQ  360
            +  P Q +++M+AIDDSE S YAL WAL N+   R    + +     G I      P   
Sbjct  2    AAAPAQ-QKMMVAIDDSECSQYALEWALRNLAPGRLVLLTVQPYAPLGYIPAAAGSP---  57

Query  361  PFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLC  540
                  GP V  +  +I +  + Q+Q+A+ ++ KA  +C    V AET++  G+PK+ +C
Sbjct  58   -----LGPSVV-SPELIRSVTEHQRQLAQALVDKAKAICADHGVDAETIIEVGEPKETIC  111

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
             AAE+++VDLL++GS   G I R FLGSVS+YC HHA CPVL+VK
Sbjct  112  EAAEKLNVDLLILGSHSRGPIQRFFLGSVSNYCTHHAKCPVLVVK  156



>ref|XP_007206031.1| hypothetical protein PRUPE_ppa012501mg [Prunus persica]
 gb|EMJ07230.1| hypothetical protein PRUPE_ppa012501mg [Prunus persica]
Length=167

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 95/167 (57%), Gaps = 12/167 (7%)
 Frame = +1

Query  181  STVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQ  360
            + V E  RR+++A+D+ EES +AL+W L NV                  + L+  +PP  
Sbjct  2    ADVAESERRILVAVDEGEESMHALSWCLKNVVSQNSKD----------TLILLYAKPPRA  51

Query  361  PFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCK--QKMVKAETLVLEGDPKDK  534
             +    G     +S ++    K   ++A  V+ KA +MCK  Q+ VK ET V  GDP+D 
Sbjct  52   VYTALDGTGYLFSSDILAAMEKYGAEVAACVIEKAKKMCKDLQQDVKVETRVENGDPRDV  111

Query  535  LCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            +C+ AE++  D+LV+GS G G I RAFLGSVS++C  +  CPVLIVK
Sbjct  112  ICQMAEQLGADVLVMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVK  158



>gb|KHN23151.1| Universal stress protein A-like protein [Glycine soja]
Length=163

 Score =   122 bits (305),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 99/171 (58%), Gaps = 16/171 (9%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNV-FKNRPshhsheeeqhsGVITLVNVRPPFQPFV  369
            E+ RR+++A+D+ EES YAL+W L N+ F+N               + L+ V+PP   + 
Sbjct  5    EEERRILVAVDEGEESMYALSWCLKNLSFQNSKD-----------TLILLYVKPPRVTYS  53

Query  370  FHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAA  549
               G   F  S +  T  +  QQ+A  VL KA+++CK  +   ET V  GD +D +C+  
Sbjct  54   AFDGTGYFFASDITATMERYSQQVADCVLEKAMKLCKN-IENVETRVENGDTRDVICQMV  112

Query  550  EEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIV---KPTPKES  693
            +++  D+LV+GS G G I RAFLGSVS++C  +  CPVLIV   KPT  E+
Sbjct  113  QKLGADVLVMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVKKPKPTAGET  163



>gb|ABK23398.1| unknown [Picea sitchensis]
 gb|ABK26205.1| unknown [Picea sitchensis]
Length=153

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 95/160 (59%), Gaps = 16/160 (10%)
 Frame = +1

Query  202  RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTG  381
            +++M+A+DDSE S YAL WAL+N+                  ++LV      QP      
Sbjct  5    KKIMVAVDDSEFSHYALQWALNNLH------------LFGSDVSLVLFHA--QPVAVFNS  50

Query  382  PVVFATST--VIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
            P     ++  +I+T    Q+Q+++E+L++A  +C QK V  ETL   GDPKD +C A E+
Sbjct  51   PATMGVTSPGLIETIFHQQKQVSEEILARAKGICAQKNVIVETLSEIGDPKDAICDAIEK  110

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            + +DLL+ GS G G + RAFLGSVS+YC+ +A CPVL+ +
Sbjct  111  LQIDLLITGSHGYGMLKRAFLGSVSNYCVQYAKCPVLVTR  150



>ref|XP_002319486.1| hypothetical protein POPTR_0013s01110g [Populus trichocarpa]
 gb|EEE95409.1| hypothetical protein POPTR_0013s01110g [Populus trichocarpa]
Length=171

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 102/171 (60%), Gaps = 12/171 (7%)
 Frame = +1

Query  172  MEESTVPEQNRRVMIAIDDSEESFYALNWALDNVF-KNRPshhsheeeqhsGVITLVNVR  348
            M +     + R++++A+D+SEES +AL+W L NV   N PS            + L+ V+
Sbjct  1    MADEMGAAEERKILVAVDESEESMHALSWCLKNVLVSNNPSK---------DTLILLYVK  51

Query  349  PPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKM--VKAETLVLEGD  522
            PP   +    G     +S ++ T +K    +A  V+ KA +MC++++  VK ET++  GD
Sbjct  52   PPRVVYSSLDGTGYLLSSDIMATMQKYSNDIADCVIEKAKRMCREQVQDVKVETIIEHGD  111

Query  523  PKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
             +D +C+ AE++  D+LV+GS G G I RAFLGSVS++C  +  CPVLIVK
Sbjct  112  ARDLICQTAEKLHADMLVMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVK  162



>gb|EEE59934.1| hypothetical protein OsJ_12581 [Oryza sativa Japonica Group]
Length=498

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 98/158 (62%), Gaps = 27/158 (17%)
 Frame = +1

Query  229  SEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQP--FVFHTGPVVFATS  402
            SEES  AL+WALDNV   R           +G +++V V     P  FV+   PV     
Sbjct  356  SEESLNALSWALDNVIGRR-----------AGAVSVVVVHAQHGPDHFVY---PVAAHAI  401

Query  403  -----TVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVD  567
                 + I++ RK+Q++++++V+S+AL       V A   ++EGD K+ +C+A EEM  D
Sbjct  402  AYAPASAIESMRKAQEEISRKVVSRALD------VSATGAIVEGDAKEAICQAVEEMHAD  455

Query  568  LLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            +LV+GSRGLG I RAFLGSVSDY +HHA CPVL+VKPT
Sbjct  456  MLVLGSRGLGKIKRAFLGSVSDYLVHHACCPVLVVKPT  493



>ref|XP_002285692.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 ref|XP_010664379.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 ref|XP_010664380.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 ref|XP_010664381.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 ref|XP_010664382.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 emb|CBI19251.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 98/167 (59%), Gaps = 12/167 (7%)
 Frame = +1

Query  202  RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVR-PPFQPFVFHT  378
            +RV++A+D SEES  AL WALDN+    P  H+       G   +++V+ PP      + 
Sbjct  6    QRVIVAVDGSEESMKALRWALDNIKLRSPPSHAEA-----GSFVILHVQSPPSIATGLNP  60

Query  379  GPVVFATSTVID------TYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLC  540
            G + F   T ++           Q+++ + +L  AL++C  K V  +T V+ GDPK+K+C
Sbjct  61   GAIPFGGPTDLEVPAFTAAIEAHQRRITEAILDHALKICSDKNVNVKTDVVIGDPKEKIC  120

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
             AA  +  DLLV+GSR  G I R FLGSVS+YC +HA CPV+IVK T
Sbjct  121  EAAVNLHADLLVMGSRAFGPIRRMFLGSVSNYCTNHAQCPVMIVKDT  167



>emb|CDP18238.1| unnamed protein product [Coffea canephora]
Length=173

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 98/173 (57%), Gaps = 18/173 (10%)
 Frame = +1

Query  181  STVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQ  360
            S V E+ R++++A+D+ EES YAL+W L N+                  + LV  RPP  
Sbjct  3    SEVAEKERKILVAVDEGEESSYALSWCLSNIVNENSKD----------TLVLVYARPPRA  52

Query  361  PFVFHTG-------PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ-KMVKAETLVLE  516
             +    G       P    +S ++ +  K   ++A+ VL KA ++CK    +K ET V  
Sbjct  53   VYSTLDGSGEEGRLPGYLFSSDILASMEKYSHEVAECVLEKAHRICKDFNAIKVETKVEH  112

Query  517  GDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            GDP+D +C+ AE+++VDL+V+GS G G I RAFLGSVS +C  +  CPVLIVK
Sbjct  113  GDPRDVICQVAEKLNVDLVVMGSHGYGLIKRAFLGSVSHHCAQNLKCPVLIVK  165



>gb|ABR16994.1| unknown [Picea sitchensis]
Length=153

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 101/163 (62%), Gaps = 17/163 (10%)
 Frame = +1

Query  202  RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPF-VFHT  378
            +++M+A+DDSE S YAL WAL+N+                  ++LV      QP  VF++
Sbjct  5    KKIMVAVDDSEFSHYALQWALNNLH------------LFGSDVSLVLFHA--QPLAVFNS  50

Query  379  GPVVFATS-TVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
               +  TS  +I+T    Q+Q+++E+L++A  +C +K V  ETL   GDPKD +C A E+
Sbjct  51   AATMGVTSPGLIETILHQQKQVSEEILARAKGICAKKNVIVETLSEIGDPKDAICDATEK  110

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIV-KPT  681
            + +DLL+ GS G G + RAFLGSVS+YC+ +A CPVL+  KP+
Sbjct  111  LQIDLLITGSHGYGMLKRAFLGSVSNYCVQYAKCPVLVTRKPS  153



>ref|NP_001237625.1| uncharacterized protein LOC100305594 [Glycine max]
 gb|ACU13353.1| unknown [Glycine max]
 gb|KHN16068.1| Universal stress protein A-like protein [Glycine soja]
Length=162

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 98/171 (57%), Gaps = 16/171 (9%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNV-FKNRPshhsheeeqhsGVITLVNVRPPFQPFV  369
            EQ RR+++A+D+ EES YAL+W L N+ F+N               + L+ V+PP   + 
Sbjct  4    EQQRRILVAVDEGEESMYALSWCLKNLAFQN-----------SKDTLLLLYVKPPRVTYS  52

Query  370  FHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAA  549
               G     +S +  T  +  QQ+A  VL KA ++C   +   ET V  GDP+D +C+  
Sbjct  53   AFDGTGYLFSSDITATMERYSQQVADCVLEKAKKLCNN-IENVETRVENGDPRDVICQMV  111

Query  550  EEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIV---KPTPKES  693
            +++  D+LV+GS G G I RAFLGSVS++C  +  CPVLIV   KPT  E+
Sbjct  112  QKLGADVLVMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVKKPKPTTGET  162



>ref|XP_009356255.1| PREDICTED: universal stress protein A-like protein [Pyrus x bretschneideri]
Length=185

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 100/182 (55%), Gaps = 14/182 (8%)
 Frame = +1

Query  166  EIMEESTVPEQNRRVMIAIDDSEESFYALNWALDNV---FKNRPshhsheeeqhsGVITL  336
            E M E+      ++VM+AID+SE S YAL W LDN+     + P      +   +G IT 
Sbjct  10   ERMGEAVAKGAEKKVMVAIDESESSHYALMWVLDNLKDSITDSPLTIFMAQTPSNGNITF  69

Query  337  VNVRPPFQPFVFHTGPVVFATST---VIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETL  507
                            + + TS+    ++  ++S ++ A  +L KA Q+C  + V AET+
Sbjct  70   --------SASLGAARMYYPTSSSQEFVNCSQESHRKFALALLEKAKQICASRGVNAETV  121

Query  508  VLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
               GDPK  +C A ++  + LL+VG RGLG I RA LGSVSDYC+ +A CPVL+VK +  
Sbjct  122  TEVGDPKAAICDAVKKHGIKLLIVGERGLGKIQRAILGSVSDYCVQYAKCPVLVVKKSKA  181

Query  688  ES  693
            E+
Sbjct  182  EA  183



>ref|XP_009770125.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
 ref|XP_009770126.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
 ref|XP_009770127.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
 ref|XP_009770128.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=170

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 97/164 (59%), Gaps = 8/164 (5%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGPV  387
            V++++D SEES  ALNWALDN+ K +P      E Q S VI  V   PP      +   +
Sbjct  8    VIVSVDGSEESMNALNWALDNI-KLKPHDPDSGEPQGSFVILHVQ-SPPSIAAGLNPAAI  65

Query  388  VFATSTVID------TYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAA  549
             F   + I+           Q+++ + +L+ A ++C  K    +T VL GDPK+K+C A 
Sbjct  66   PFGGPSDIEVPAFNAAIEAHQKRITQAILNHATEICASKNANFKTQVLIGDPKEKICDAV  125

Query  550  EEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            EEM VDLLV+GSR  G I R FLGSVS+YC +HA CPV+IVK T
Sbjct  126  EEMHVDLLVMGSRAFGPIKRMFLGSVSNYCSNHAQCPVIIVKGT  169



>gb|ABB13620.1| USP-like protein [Astragalus sinicus]
Length=179

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 93/165 (56%), Gaps = 13/165 (8%)
 Frame = +1

Query  181  STVPEQNRRVMIAIDDSEESFYALNWALDN-VFKNRPshhsheeeqhsGVITLVNVRPPF  357
            +   E  RR+M+A+D+ +ES YAL+W+L N VF+N              V+ L+ V+PP 
Sbjct  2    AVTTENGRRIMVAVDEGDESMYALSWSLKNLVFQNSK-----------DVLILLYVKPPR  50

Query  358  QPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKL  537
              +    G     +S +  T  K  QQMA  VL KA  +C   +   ET +  GDP+D +
Sbjct  51   VVYSAFDGTGYLFSSDITATMEKYSQQMADCVLEKAKMVCND-VQNVETRIENGDPRDVI  109

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIV  672
            C   + + VD+LV+GS G G I RAFLGSVS++C  +  CPVLIV
Sbjct  110  CEMVQRVGVDILVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIV  154



>ref|XP_008370382.1| PREDICTED: universal stress protein A-like protein [Malus domestica]
Length=167

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 93/167 (56%), Gaps = 12/167 (7%)
 Frame = +1

Query  181  STVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQ  360
            + V E  RR+++A+D+ EES +AL+W L NV                  + L++ +PP  
Sbjct  2    TDVAESERRILVAVDEGEESMHALSWCLKNVAGQN----------SKDTLVLLHAKPPRA  51

Query  361  PFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCK--QKMVKAETLVLEGDPKDK  534
             F    G     +S ++    K    +A  V+ KA +MCK  Q  +KAET V  GDP+D 
Sbjct  52   VFTALDGTAYLFSSDILAATEKYGADVADCVMEKARKMCKDLQPDLKAETKVESGDPRDV  111

Query  535  LCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            +C+  E +  D+LV+GS G G I RAFLGSVS++C  +  CPVLIVK
Sbjct  112  ICQMVERVRADVLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVK  158



>ref|XP_010475820.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=171

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 92/159 (58%), Gaps = 5/159 (3%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNV--FKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTG  381
            V++A+D SE S  AL WALDN+    + P                  V P   PF   +G
Sbjct  10   VVVAVDGSEVSMEALRWALDNLKLSSSSPDSSFVILHVQPSPSVAAGVSPGTIPFGGPSG  69

Query  382  PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMS  561
              V A +  I+ +   Q+++   +L  ALQ+C QK V  +T V+ GDPK K+C A EE+ 
Sbjct  70   LEVPAFTAAIEQH---QKRITDTILEHALQICAQKSVTVKTQVVVGDPKYKICEAVEELH  126

Query  562  VDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
             DLLV+GSR  G I R FLGSVS+YC +HAHCPV+I+KP
Sbjct  127  ADLLVMGSRAYGRIKRMFLGSVSNYCTNHAHCPVVIIKP  165



>ref|XP_004230297.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Solanum lycopersicum]
Length=166

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 101/172 (59%), Gaps = 12/172 (7%)
 Frame = +1

Query  187  VPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPF  366
            V  + R+++IA+D+SEES YAL+W ++N+     +           +I L +V PP   +
Sbjct  4    VAAKERKILIAVDESEESIYALSWCIENILTGNSNDT---------LILLYSV-PPRAVY  53

Query  367  VFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ-KMVKAETLVLEGDPKDKLCR  543
                G     +S ++ T  +    +A+ V+ KA + C+    VK ET+V  GD +D +C+
Sbjct  54   STLDGSGYLFSSDILATMERYSSGVAQCVMEKAKRACEALNGVKVETIVEHGDARDVICQ  113

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPR  699
            AAE++ VD+LV+GS G G I RAFLGSVS++C  +  CPVLIVK  PK   R
Sbjct  114  AAEKLHVDMLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKK-PKTDGR  164



>ref|XP_009804591.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Nicotiana sylvestris]
Length=167

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 101/168 (60%), Gaps = 11/168 (7%)
 Frame = +1

Query  187  VPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPF  366
            V  + R++++A+D+SEES YAL+W ++N+F             +  +I L ++ PP   +
Sbjct  4    VAAKARKILVAVDESEESTYALSWCIENIFTG--------GNTNDALILLYSI-PPRAVY  54

Query  367  VFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ-KMVKAETLVLEGDPKDKLCR  543
                G     +S ++ T  +    +A+ V+ KA ++CK    VK ET+V  GD +D +C+
Sbjct  55   SSLDGTGYLFSSDILATMERYSNDVAQCVMEKAKRLCKDLDGVKVETIVERGDARDVICQ  114

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
            AAE + VD+LV+GS G G I RAFLGSVS++C  +  CPVLIVK  PK
Sbjct  115  AAERLHVDMLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKK-PK  161



>gb|ADE77419.1| unknown [Picea sitchensis]
Length=153

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 99/160 (62%), Gaps = 16/160 (10%)
 Frame = +1

Query  202  RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPF-VFHT  378
            +++M+A+DDSE S +AL WAL N+              +   ++LV      QP  VF++
Sbjct  5    KKIMVAVDDSECSHHALQWALSNLH------------LYGSDVSLVVFHA--QPLAVFNS  50

Query  379  GPVVFATS-TVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEE  555
               +  TS  +I+     Q+Q+++ +L++A +MC QK V  ET+   GDPKD +C A ++
Sbjct  51   AATMGVTSPELIEIIVNQQRQVSEAILARAKEMCAQKNVTVETVSEIGDPKDGICDAIDK  110

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            + VDLL++GS G G + RAFLGSVS+YC+ HA CPVL+ K
Sbjct  111  LQVDLLIIGSHGYGMLKRAFLGSVSNYCVLHAKCPVLVTK  150



>gb|EYU37243.1| hypothetical protein MIMGU_mgv1a023360mg [Erythranthe guttata]
Length=167

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 95/163 (58%), Gaps = 11/163 (7%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + R++++A+D+SEES YAL+W L N+  +   ++         ++      P   P V  
Sbjct  4    KGRKILVAVDESEESTYALSWCLKNLVSDNQQNYKDTL-----ILLFAKTHPLIYPVVDT  58

Query  376  TGPVVFATS-TVIDTYRKSQQQMAKEVLSKALQMCK--QKMVKAETLVLEGDPKDKLCRA  546
            TG   +ATS ++I    K   ++A++V++ A Q+CK     +  ET+V  GDP+D +C  
Sbjct  59   TG---YATSPSIIAIMEKYANELAEKVMADATQICKDFNDQITVETMVEHGDPRDVICDV  115

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            AE   VD LVVGS G G I RAFLGSVS +C  +  CPVLIVK
Sbjct  116  AERFKVDFLVVGSHGYGIIKRAFLGSVSSHCAQNVKCPVLIVK  158



>ref|XP_004302247.1| PREDICTED: universal stress protein A-like protein-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=167

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 96/169 (57%), Gaps = 16/169 (9%)
 Frame = +1

Query  181  STVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQ  360
            + V E+ RR+++A+D+ EES YAL+W L NV  ++              + LV V+PP  
Sbjct  2    ADVAEKERRILVAVDEGEESMYALSWCLGNVVSSKD------------TLILVYVKPPKA  49

Query  361  PFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCK----QKMVKAETLVLEGDPK  528
             ++   G     +S +  T      ++A  V+ KA   C+    ++ VK ET +  GDP+
Sbjct  50   VYMPLDGTGYMFSSDLYATMENYSNEVANSVIEKAKNKCRDVLQEQDVKVETRIENGDPR  109

Query  529  DKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            D +C   E++   +LV+GSRG G I RAFLGSVS++C  + +CPVLIVK
Sbjct  110  DVICHLVEQLGAHILVMGSRGYGLIKRAFLGSVSNHCAQNVNCPVLIVK  158



>ref|XP_010268015.1| PREDICTED: universal stress protein A-like protein [Nelumbo nucifera]
Length=172

 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 98/166 (59%), Gaps = 15/166 (9%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF  372
            ++ R++++A+D+ EES YAL+W L+NV  +   H           + L+ V+PP   +  
Sbjct  7    DKERKIVVAVDEGEESMYALSWCLNNVICDNSKH----------TLILLYVKPPRVLYTA  56

Query  373  HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ-----KMVKAETLVLEGDPKDKL  537
              G     +S +I T  K  + +A  V+ KA ++C +     + VK ET V  GDP+D +
Sbjct  57   LDGTGYLFSSDIIATMEKYSKDVADCVIEKAKKLCSETENDLQNVKVETKVESGDPRDVI  116

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            C  AE++S D+LV+G+ G G I RAFLGSVS++C  +  CPVLIVK
Sbjct  117  CEMAEKLSADMLVMGNHGYGLIKRAFLGSVSNHCAQNVKCPVLIVK  162



>ref|XP_006574464.1| PREDICTED: uncharacterized protein LOC100816212 isoform X1 [Glycine 
max]
 gb|ACU20991.1| unknown [Glycine max]
 gb|KHN46570.1| Universal stress protein A-like protein [Glycine soja]
Length=159

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 91/162 (56%), Gaps = 15/162 (9%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF  372
             + + V+I IDDSE+S YALNWALDN F + P             + L++ RP     V 
Sbjct  6    SEKQVVVIGIDDSEQSTYALNWALDNFFPS-PIFK----------LVLIHSRPTATSAVG  54

Query  373  HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETL-VLEGDPKDKLCRAA  549
              GP       ++D+     +++   VL  A Q+C  K V   T  V+EGDP++ LC A 
Sbjct  55   FAGPGAAEVLPIVDS---DLRKIGARVLETAKQLCINKSVNDVTAEVVEGDPRNVLCDAV  111

Query  550  EEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            ++    +LVVGS G G I RA LGSVSDYC HHAHC V+IVK
Sbjct  112  DKYRAAMLVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK  153



>ref|XP_002512499.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49951.1| conserved hypothetical protein [Ricinus communis]
Length=173

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 98/174 (56%), Gaps = 15/174 (9%)
 Frame = +1

Query  169  IMEESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVR  348
            + + +    + R++M+A+D+SEES  AL+W L NV                  + L+  +
Sbjct  1    MADSAAATAKQRKIMVAVDESEESMNALSWCLKNVISQ----------DSKDTLILLYAK  50

Query  349  PPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKM-----VKAETLVL  513
            PP   +    G     +S ++ T  K  + +A  ++ KA ++C+++      VK ET V 
Sbjct  51   PPRAVYTALDGTGYLFSSDIVATMEKYSKDVADCIIEKAKKICREQAAAASDVKVETRVE  110

Query  514  EGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
             GDP+D +C+ AE++ VD+LV+GS G G I RAFLGSVS++C  +  CPVLIVK
Sbjct  111  NGDPRDVICQMAEKLRVDVLVMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVK  164



>ref|XP_008388484.1| PREDICTED: universal stress protein A-like protein [Malus domestica]
Length=169

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 92/167 (55%), Gaps = 12/167 (7%)
 Frame = +1

Query  181  STVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQ  360
            + V E  RR+++A+D+ EES YAL+W L N+                  + L+  +PP  
Sbjct  2    TDVAEGERRILVAVDEGEESMYALSWCLKNIVAQNSKD----------TLILLYAKPPRA  51

Query  361  PFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCK--QKMVKAETLVLEGDPKDK  534
             F    G     +S       K    +A  V+ KA + C+  ++ VK ET V  GDP+D 
Sbjct  52   VFTALDGTGYLFSSETWAAMEKYAADVADCVMEKAKKTCRDLRQDVKVETKVENGDPRDV  111

Query  535  LCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            +C+ AE++  D+LVVGS G G I RAFLGSVS++C  + +CPVLIVK
Sbjct  112  ICQMAEKLRADVLVVGSHGYGGIKRAFLGSVSNHCAQNVNCPVLIVK  158



>ref|XP_002455517.1| hypothetical protein SORBIDRAFT_03g012520 [Sorghum bicolor]
 gb|EES00637.1| hypothetical protein SORBIDRAFT_03g012520 [Sorghum bicolor]
Length=165

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 92/165 (56%), Gaps = 12/165 (7%)
 Frame = +1

Query  199  NRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHT  378
             RR+M+A+D+ EES +ALNW L NV                  + LV+ R P   +    
Sbjct  12   GRRIMVAVDEGEESLHALNWCLANVVS----------PAGGDTLVLVHARRPRPVYAAMD  61

Query  379  GPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCK-QKMVKAETLVLEGDPKDKLCRAAEE  555
                  TS V+ +  +    ++   + KA ++C     VK ET+V  GDP+D +C AA++
Sbjct  62   SAGYMMTSDVLASVERHANAISAAAVDKAKRVCAGHPHVKVETMVESGDPRDVICDAADK  121

Query  556  MSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            M+ DLLV+GS G G I RAFLGSVS++C  +  CPVLIVK  PKE
Sbjct  122  MAADLLVMGSHGYGFIQRAFLGSVSNHCAQNCKCPVLIVK-RPKE  165



>ref|XP_009373274.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Pyrus x bretschneideri]
Length=169

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 95/173 (55%), Gaps = 13/173 (8%)
 Frame = +1

Query  181  STVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQ  360
            + V E  RR+++A+D+ EES +AL+W L N+                  + L+  +PP  
Sbjct  2    TDVAEGERRILVAVDEGEESMHALSWCLKNIVAQNSKD----------TLILLYAKPPRA  51

Query  361  PFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCK--QKMVKAETLVLEGDPKDK  534
             F    G     +S       K    +A  V+ KA + C+  ++ VK ET V +GDP+D 
Sbjct  52   VFTALDGTGYLFSSETWAAMEKYAADVADCVMEKAKKTCRDLRQDVKVETKVEDGDPRDV  111

Query  535  LCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            +C+ AE++  D+LVVGS G G I RAFLGSVS++C  +  CPVLIVK  PK S
Sbjct  112  ICQMAEQLRADVLVVGSHGYGGIKRAFLGSVSNHCAQNVKCPVLIVKK-PKTS  163



>ref|NP_001238718.1| uncharacterized protein LOC100527357 [Glycine max]
 gb|ACU16442.1| unknown [Glycine max]
 gb|KHN03724.1| Universal stress protein A-like protein [Glycine soja]
Length=160

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 92/162 (57%), Gaps = 15/162 (9%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF  372
             + + V+I IDDSE+S YALNWALD+ F + P             + L++ RP     V 
Sbjct  7    SEKQVVLIGIDDSEQSTYALNWALDHFFPS-PIFK----------LVLIHSRPTATSAVG  55

Query  373  HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETL-VLEGDPKDKLCRAA  549
              GP       ++D+     +++A  VL  A Q+C  K V   T  V+EGDP++ LC A 
Sbjct  56   FAGPGAAEILPIVDS---DLRKIAARVLETAKQLCFNKSVNDVTAEVVEGDPRNVLCDAV  112

Query  550  EEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            ++    +LVVGS G G I RA LGSVSDYC HHAHC V+IVK
Sbjct  113  DKYRAAILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK  154



>emb|CDP11494.1| unnamed protein product [Coffea canephora]
Length=163

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 83/156 (53%), Gaps = 3/156 (2%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGPV  387
            V++A+D SEES   L WALDNV               S       + P   PF    GP 
Sbjct  8    VIVAVDGSEESMSGLKWALDNVKLKSEDGSFVVLHVQSPPSIATGLNPGPIPF---GGPS  64

Query  388  VFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVD  567
             F            Q+++   +   ALQ+C +K VK ET V+ GDPK+K+C   EE+  D
Sbjct  65   DFQVPAFTAAIEAHQKRITHAIFQHALQICSEKNVKVETKVVIGDPKEKICEVVEELHAD  124

Query  568  LLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            LLV+GSR  G I R FLGSVS+YC + A CPV+IVK
Sbjct  125  LLVMGSRAFGPIKRMFLGSVSNYCSNRAQCPVMIVK  160



>ref|XP_002526986.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35358.1| conserved hypothetical protein [Ricinus communis]
Length=169

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 100/177 (56%), Gaps = 19/177 (11%)
 Frame = +1

Query  172  MEESTVP----EQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLV  339
            MEE  V     E  R+VMIAID+SE S YAL WALDN+ ++               + + 
Sbjct  1    MEEVVVTANGEEAERKVMIAIDESEYSHYALMWALDNLKES----------LTKSPLFIF  50

Query  340  NVRPPFQ----PFVFHTGPVVFATST-VIDTYRKSQQQMAKEVLSKALQMCKQKMVKAET  504
              +PP +    P  F +  +  A ST  +D+ +   +++A   L KA ++C  + V AE 
Sbjct  51   MAQPPARNINFPANFGSARMYCAVSTDYVDSVKDKNKKLALAFLEKAKEICASRGVDAEI  110

Query  505  LVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            L  EGDPK  +C   +++++ +LV+G  GLG I RA +GSVS YC+ +A CPVL+VK
Sbjct  111  LTEEGDPKTTICNVVQKLNISMLVLGECGLGKIKRAIIGSVSSYCIQYAKCPVLVVK  167



>gb|ACF74293.1| universal stress protein [Arachis hypogaea]
Length=181

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 92/167 (55%), Gaps = 10/167 (6%)
 Frame = +1

Query  181  STVPEQNRRVMI-AIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPF  357
            +T     ++VMI A+DDSE S YAL W LD+ F   P+            + L++ +P  
Sbjct  2    ATTSSDEKQVMIVAVDDSEHSSYALQWTLDHFFTTLPNPIFK--------LVLLHAKPSA  53

Query  358  QPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMC-KQKMVKAETLVLEGDPKDK  534
               V   GP     + V+       +++A  V+  A Q+C K+ +    T V+EGDP++ 
Sbjct  54   TSAVGLAGPAYAGAAEVLPIVDSDLKKIAARVVDNAKQICSKRSVTDVITEVVEGDPRNV  113

Query  535  LCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            LC A E+    +LVVGS G G I RA LG+VSDYC HHAHC V+IVK
Sbjct  114  LCDAVEKYHASILVVGSHGYGAIKRAVLGNVSDYCAHHAHCTVMIVK  160



>gb|KDP41468.1| hypothetical protein JCGZ_15875 [Jatropha curcas]
Length=188

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 96/163 (59%), Gaps = 10/163 (6%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVR-PPFQPFVFHTGP  384
            V++A+D SEES YAL WALDN+   +    + +  + +G   +++V+ PP      + G 
Sbjct  9    VIVAVDGSEESMYALRWALDNL---KLRSSAPDSTETAGYFLILHVQSPPSIAAGLNPGA  65

Query  385  VVFATSTVID------TYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRA  546
            + F   T ++           Q+++ + VL  ALQ+C +K    +T V+ GDPK+K+C A
Sbjct  66   IPFGGPTDLEVPAFTAAIEAHQKRITEAVLEHALQICSEKNANVKTQVVVGDPKEKICEA  125

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
             E    DLLV+G R  G I R FLGSVS+YC +HA CPV+IVK
Sbjct  126  VENSGADLLVMGCRSYGPIKRMFLGSVSNYCTNHAQCPVVIVK  168



>ref|XP_007031134.1| USP-like protein isoform 3 [Theobroma cacao]
 gb|EOY11636.1| USP-like protein isoform 3 [Theobroma cacao]
Length=166

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 95/163 (58%), Gaps = 11/163 (7%)
 Frame = +1

Query  187  VPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPF  366
            VP++ R++++A+D+ EES YAL+W L NV                  + L+  +PP   +
Sbjct  5    VPKE-RKILVAVDEGEESMYALSWCLKNVISQN----------SKDTLILLYAKPPRAVY  53

Query  367  VFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRA  546
                G     ++ ++ T  K    +A  V+ KA +MC+++  + E  V  GDP+D +C+ 
Sbjct  54   SALDGTGYLFSADILATMEKYSNDVAACVIEKAKRMCREQADEVEVRVESGDPRDVICQV  113

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            AE+++ D+LV+GS G G I RAFLGSVS++C  +  CPVLIVK
Sbjct  114  AEKINADVLVMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVK  156



>ref|XP_009588034.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
 ref|XP_009588035.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
 gb|AIS71910.1| ER6 protein [Nicotiana tabacum]
Length=170

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 98/166 (59%), Gaps = 12/166 (7%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLV--------NVRPPFQP  363
            V++++D SEES  ALNWALDN+ K +P      E Q S VI  V         + P   P
Sbjct  8    VILSVDGSEESMNALNWALDNI-KLKPHDPDSGEPQGSFVILHVQSPPSIAAGLNPAAIP  66

Query  364  FVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCR  543
            F   +   V A +  I+ +   Q+++ + +L+ A ++C  K    +T VL GDPK+K+C 
Sbjct  67   FGGPSDIEVPAFNAAIEAH---QKRITQAILNHATEICASKNANVKTQVLIGDPKEKICD  123

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            A EEM  DLLV+GSR  G   R FLGSVS+YC +HA CPV+IVK T
Sbjct  124  AVEEMHADLLVMGSRAFGPFKRMFLGSVSNYCSNHAQCPVIIVKGT  169



>gb|ACG26484.1| universal stress protein [Zea mays]
 gb|ACG37860.1| universal stress protein [Zea mays]
Length=165

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 91/164 (55%), Gaps = 12/164 (7%)
 Frame = +1

Query  202  RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTG  381
            RR+M+A+D+ EES +ALNW L NV                  + LV+ R P   +     
Sbjct  13   RRIMVAVDEGEESLHALNWCLANVVS----------PAGGDTLVLVHARRPRPVYAAMDS  62

Query  382  PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQK-MVKAETLVLEGDPKDKLCRAAEEM  558
                 TS V+ +  +    ++   + KA ++C     VK ET+V  GDP+D +C AA +M
Sbjct  63   AGYMMTSDVLASVERHANAVSAAAVDKAKRVCADHPHVKVETMVESGDPRDVICDAANKM  122

Query  559  SVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            + DLLV+GS G G I RAFLGSVS++C  +  CPVLIVK  PKE
Sbjct  123  AADLLVMGSHGYGFIQRAFLGSVSNHCAQNCKCPVLIVK-RPKE  165



>ref|XP_006344751.1| PREDICTED: uncharacterized protein C167.05-like [Solanum tuberosum]
Length=166

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 101/169 (60%), Gaps = 12/169 (7%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + R++++A+D+SEES YAL+W ++N+     +           +I L ++ PP   +   
Sbjct  7    KERKILVAVDESEESSYALSWCIENIITGNSNDT---------LILLYSI-PPRAVYSTL  56

Query  376  TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ-KMVKAETLVLEGDPKDKLCRAAE  552
             G     +S ++ T  +   ++A+ V+ KA + C+    VK ET+V  GD +D +C+AAE
Sbjct  57   DGTGYLFSSDILATMERYSSEVAQCVMEKAKRACEALNGVKVETIVEHGDARDVICQAAE  116

Query  553  EMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPR  699
            ++ VD+LV+GS G G I RAFLGSVS++C  +  CPVLIVK  PK   R
Sbjct  117  KLHVDMLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKK-PKTDGR  164



>ref|XP_006842311.1| hypothetical protein AMTR_s00079p00131240 [Amborella trichopoda]
 gb|ERN03986.1| hypothetical protein AMTR_s00079p00131240 [Amborella trichopoda]
Length=161

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 101/178 (57%), Gaps = 34/178 (19%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF  372
            E  ++VM+A+DDSE + YA  W L+N+  +  +                      Q +VF
Sbjct  3    EGEKKVMVAVDDSECNRYAFEWFLENLLPSLST----------------------QLYVF  40

Query  373  HTGPV-----VFATS------TVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEG  519
            H  P+      +A S       +I+  +  Q+++ K ++ K  ++C ++ + AE + + G
Sbjct  41   HVEPLDNISYAYAASLGAAPPQLIEALQDQQRKITKVLVDKIKEICTKRSITAEIITVRG  100

Query  520  DPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            +PKD +C A E+  ++LLV+GS G G + RAFLGSVS+YC+HHA CPVL+VK  PK++
Sbjct  101  EPKDAICEAVEKYQIELLVLGSHGRGALQRAFLGSVSNYCVHHAKCPVLVVK-KPKQT  157



>gb|EYU18169.1| hypothetical protein MIMGU_mgv11b0160062mg, partial [Erythranthe 
guttata]
Length=70

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  490  VKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLI  669
            VKA+TL+LEGDPKD++CRA EEM+V+LLV+GSRGLG I RAFLGSVSDYC HHA CPVL+
Sbjct  1    VKAKTLILEGDPKDRICRAVEEMNVNLLVIGSRGLGQIKRAFLGSVSDYCSHHAKCPVLV  60

Query  670  VKPTPKE  690
            VKP  K+
Sbjct  61   VKPPAKK  67



>gb|KDP29423.1| hypothetical protein JCGZ_18344 [Jatropha curcas]
Length=164

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 96/168 (57%), Gaps = 16/168 (10%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF  372
            E  ++VMIAID+SE S+YAL W LDN+ ++          Q + ++  +   PP   + F
Sbjct  4    EVEKKVMIAIDESEYSYYALMWVLDNLKES---------LQKTSLVVFMAQPPPRNSYTF  54

Query  373  HTG-------PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKD  531
                        V       ++ +++ +++A   L KA ++C  + V AE +  EGDPK 
Sbjct  55   AAALGSARLYSPVLTPPDFNNSVKENNKKLALAFLEKAKEICASRGVSAEIITEEGDPKS  114

Query  532  KLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
             +C   +++++ +LV+G RGLG I RA LGSVS+YC+ +A CPVL+VK
Sbjct  115  AICNVVQKLNISMLVLGERGLGKIKRALLGSVSNYCVQYAKCPVLVVK  162



>emb|CAB68183.1| putative protein [Arabidopsis thaliana]
Length=174

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 92/140 (66%), Gaps = 11/140 (8%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDN---VFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHT  378
            VM+AID+S+ SF AL WA+D+   V    P           G++TL++V P +  +++ +
Sbjct  32   VMVAIDESKNSFDALEWAVDHLRVVISAEPETGQEG-----GLLTLLHVHPTYLQYIYPS  86

Query  379  G---PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAA  549
            G     V+AT +V +  RK++++    + ++AL++C+ KMVK ET++LEGDPK+ +C+A 
Sbjct  87   GGTASAVYATDSVPEPMRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQAV  146

Query  550  EEMSVDLLVVGSRGLGNITR  609
            E+  VDLLVVGSRGLG I R
Sbjct  147  EQTHVDLLVVGSRGLGMIKR  166



>ref|XP_009395576.1| PREDICTED: universal stress protein A-like protein [Musa acuminata 
subsp. malaccensis]
Length=161

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 99/172 (58%), Gaps = 14/172 (8%)
 Frame = +1

Query  172  MEESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP  351
            M E     + +RVM+AID+SE S YAL W L N+  +  S              +  V+P
Sbjct  1    MAEGGAEGKAKRVMVAIDESESSHYALEWVLSNLRSSLSSSPL----------VVFTVQP  50

Query  352  PFQPFVFHTGPVVFATS--TVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDP  525
               P + +     F      +I T ++ Q+++A  +L KA ++C Q  V AET+   GDP
Sbjct  51   --YPEISYLNAASFGAPPMELIQTVQQHQKELALSLLEKAKEICIQHGVVAETISEVGDP  108

Query  526  KDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            K+ +C A E++ +DLL+VGS G G I R FLGSVS+YC+H+A CPVL+VK +
Sbjct  109  KEAICEAVEKLKIDLLIVGSHGKGAIQRVFLGSVSNYCVHNAKCPVLVVKKS  160



>ref|XP_003591417.1| Universal stress protein A-like protein [Medicago truncatula]
 gb|AES61668.1| universal stress family protein [Medicago truncatula]
Length=158

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 98/164 (60%), Gaps = 13/164 (8%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF  372
            ++ R++M+AID+SEES YAL+W++ N+  +  +++          + L+ V+PP   +  
Sbjct  3    KRERKIMVAIDESEESMYALSWSISNLIADTNNNNK---------LVLLYVKPPSAVYSL  53

Query  373  HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ---KMVKAETLVLEGDPKDKLCR  543
             +   +F+  T IDT      Q+AK V+ +A  + +      +  E +V  GD K+ +C 
Sbjct  54   DSAGYIFSNDT-IDTLENYSSQLAKSVMKRAEAIYRNFDDTDINIEKVVGTGDAKNVICN  112

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            AA+++  D LV+GS G G I RA LGSVSDYC+ +A CPV+IVK
Sbjct  113  AAKKLGADTLVMGSHGYGFIKRALLGSVSDYCVKNAKCPVVIVK  156



>ref|NP_001132550.1| universal stress protein [Zea mays]
 gb|ACF81436.1| unknown [Zea mays]
 gb|ACG24368.1| universal stress protein [Zea mays]
 gb|ACG26259.1| universal stress protein [Zea mays]
 gb|AFW80623.1| universal stress protein [Zea mays]
Length=165

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 95/176 (54%), Gaps = 14/176 (8%)
 Frame = +1

Query  172  MEESTVPEQN--RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNV  345
            ME + V   +  RR+M+A+D+ EES +ALNW L NV                  + LV+ 
Sbjct  1    METAAVAASSAGRRIMVAVDEGEESLHALNWCLANVVS----------PAGGDTLVLVHA  50

Query  346  RPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQK-MVKAETLVLEGD  522
            R P   +          TS V+ +  +    ++   + KA ++C     VK ET V  GD
Sbjct  51   RRPRPVYAAMDSAGYMMTSDVLASVERHANAVSAAAVDKAKRVCADHPHVKVETTVESGD  110

Query  523  PKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKE  690
            P+D +C AA +M+ DLLV+GS G G I RAFLGSVS++C  +  CPVLIVK  PKE
Sbjct  111  PRDVICDAANKMAADLLVMGSHGYGFIQRAFLGSVSNHCAQNCKCPVLIVK-RPKE  165



>ref|XP_010264150.1| PREDICTED: universal stress protein A-like protein [Nelumbo nucifera]
Length=160

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 94/161 (58%), Gaps = 10/161 (6%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF  372
            E  ++VMIAID++E S YAL WALDN  ++R           +  + +   +P       
Sbjct  7    ENGKKVMIAIDENECSLYALRWALDN-LQDR---------LTTSSLVIFTAQPMADYGYI  56

Query  373  HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAE  552
            +   +  A   +    ++ Q++++  +L KA  +C  + V AET+   GDPK+ +C A E
Sbjct  57   YAASLGSAHPQLTKAIQEHQKKVSLSLLEKAKDICANQGVTAETITEIGDPKEAICNAVE  116

Query  553  EMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            +  ++LL++G R  G + RAFLGSVS+YC+HHA CPVL+VK
Sbjct  117  KFKINLLILGCRSRGVLQRAFLGSVSNYCVHHAKCPVLVVK  157



>ref|XP_010490289.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=171

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 91/159 (57%), Gaps = 5/159 (3%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNV--FKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTG  381
            V++A+D SE S  AL WALDN+    + P                  V P   PF   +G
Sbjct  10   VVVAVDGSEVSMEALRWALDNLKLSSSSPDSSFVILHVQPSPSVAAGVSPGTIPFGGPSG  69

Query  382  PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMS  561
              V A +  I+ +   Q+++   +L  A Q+C +K V  +T V+ GDPK K+C A EE+ 
Sbjct  70   LEVPAFTAAIEQH---QKRITDTILEHAHQICAEKSVTVKTQVVVGDPKYKICEAVEELH  126

Query  562  VDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
             DLLV+GSR  G I R FLGSVS+YC +HAHCPV+I+KP
Sbjct  127  ADLLVIGSRAFGRIKRMFLGSVSNYCTNHAHCPVVIIKP  165



>ref|XP_002514027.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48610.1| conserved hypothetical protein [Ricinus communis]
Length=176

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 100/165 (61%), Gaps = 11/165 (7%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVR-PPFQPFVFHTGP  384
            V++A+D SEES YAL WA++N+    P+  S E     G   +++V+ PP      + G 
Sbjct  8    VIVAVDGSEESMYALRWAIENLKLRSPAPDSTETPP--GSFFILHVQSPPTIATGLNPGA  65

Query  385  VVFATSTVID------TYRKSQQQMAKEVLSKALQMCKQKMVKA--ETLVLEGDPKDKLC  540
            + F   + ++           Q+++ + VL  AL +C+QK V+A  +T V+ GDPK+K+C
Sbjct  66   IPFGGPSDLEVPAFTAAIEAHQRRITEAVLEHALDICRQKNVEANVKTQVVIGDPKEKIC  125

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
              AE+M  DLLV+G R  G I R FLGSVS+YC +HA CPV+IVK
Sbjct  126  EVAEKMHADLLVMGCRAFGPIKRMFLGSVSNYCTNHAECPVIIVK  170



>gb|KHG02297.1| hypothetical protein F383_24645 [Gossypium arboreum]
Length=173

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 98/171 (57%), Gaps = 13/171 (8%)
 Frame = +1

Query  172  MEESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP  351
            M E  V  ++R++++A+D+ EES  AL+W L NV  +               + L+  +P
Sbjct  1    MAEDDVVSKDRKILVAVDEGEESTNALSWCLKNVISH----------TSKDTLVLLYAKP  50

Query  352  PFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKM---VKAETLVLEGD  522
            P   +    G     +S ++ T  K    +A  V+ KA +MC+++    VK E ++  GD
Sbjct  51   PRAVYTSLDGTGYLFSSDILATMDKYSNDVADCVIEKAKRMCREQGDPEVKVEVIIESGD  110

Query  523  PKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            P+D +C+ A++++ D+LV+GS G G I RAFLGSVS++C  +  CPVLIVK
Sbjct  111  PRDVICQVADKINADVLVMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVK  161



>ref|XP_007031132.1| USP-like protein isoform 1 [Theobroma cacao]
 gb|EOY11634.1| USP-like protein isoform 1 [Theobroma cacao]
Length=168

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 96/165 (58%), Gaps = 13/165 (8%)
 Frame = +1

Query  187  VPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPF  366
            VP++ R++++A+D+ EES YAL+W L NV                  + L+  +PP   +
Sbjct  5    VPKE-RKILVAVDEGEESMYALSWCLKNVISQN----------SKDTLILLYAKPPRAVY  53

Query  367  VFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKM--VKAETLVLEGDPKDKLC  540
                G     ++ ++ T  K    +A  V+ KA +MC+++   VK E  V  GDP+D +C
Sbjct  54   SALDGTGYLFSADILATMEKYSNDVAACVIEKAKRMCREQADEVKVEVRVESGDPRDVIC  113

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            + AE+++ D+LV+GS G G I RAFLGSVS++C  +  CPVLIVK
Sbjct  114  QVAEKINADVLVMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVK  158



>ref|XP_010099245.1| Universal stress protein A-like protein [Morus notabilis]
 gb|EXB77509.1| Universal stress protein A-like protein [Morus notabilis]
Length=166

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 100/172 (58%), Gaps = 13/172 (8%)
 Frame = +1

Query  172  MEESTVPEQNRRVMIAIDDSEESFYALNWAL----DNVFKNRPshhsheeeqhsGVITLV  339
            MEE    ++ +RVM+AID+SE S YALNW L    D +F ++    + +     G     
Sbjct  1    MEEEIQKKKKKRVMVAIDESEYSHYALNWTLEKLHDTIFNSQLFILAVQSNADLGSAYAS  60

Query  340  NVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEG  519
            +         F +   V  T  ++ + ++  ++ A  +L +A ++CK    +AET+   G
Sbjct  61   S---------FGSAHFVSTTHELVTSIQERNKKAALALLERAKEICKMHGTEAETITEFG  111

Query  520  DPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            +PK+ +C A E+ +++LLV+GSRG G I R FLGSVS YC+H+A CPVL+VK
Sbjct  112  NPKEVICEAVEKYNIELLVLGSRGKGAIKRTFLGSVSSYCVHNAKCPVLVVK  163



>ref|XP_009630150.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Nicotiana tomentosiformis]
Length=166

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 100/168 (60%), Gaps = 12/168 (7%)
 Frame = +1

Query  187  VPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPF  366
            V  + R++++A+D+SEES YAL+W ++N+     +           +I L ++ PP   +
Sbjct  4    VAAKARKILVAVDESEESTYALSWCIENIITGNTND---------ALILLYSI-PPRAVY  53

Query  367  VFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ-KMVKAETLVLEGDPKDKLCR  543
                G     +S ++ T  +   ++A+ V+ KA ++CK    VK ET+V  GD +D +C+
Sbjct  54   SSLDGTGYLFSSDILATMERYSNEVAQCVMEKAKRLCKDLDGVKVETIVERGDARDVICQ  113

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
             AE + VD+LV+GS G G I RAFLGSVS++C  +  CPVLIVK  PK
Sbjct  114  VAERLHVDMLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKK-PK  160



>ref|XP_003554619.1| PREDICTED: universal stress protein A-like protein-like [Glycine 
max]
 gb|KHN43342.1| Universal stress protein A-like protein [Glycine soja]
Length=177

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 105/183 (57%), Gaps = 24/183 (13%)
 Frame = +1

Query  172  MEESTVPEQNRRVMIAIDDSEESFYALNWALDNV-FKNRPshhsheeeqhsGVITLVNVR  348
            M E+T     RRV++A+D+ EES YAL+W+L N+ F+N            S  + L+ V+
Sbjct  1    MSEATT-RNERRVLVAVDEGEESMYALSWSLKNIIFQN-----------SSDTLILLYVK  48

Query  349  PP---FQPF-----VFH-TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ-KMVKA  498
            PP   + P      + H   P    +S V     K  Q++A  VL KA ++CK  + VK 
Sbjct  49   PPHAVYSPLDSTARIDHPETPGYLFSSDVSAAIEKYGQEVADCVLEKAKKLCKDLQNVKV  108

Query  499  ETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIV-K  675
            ET V  GDP+D +C  ++++  DLL++GS G G + RAFLGSVS+YC  +  CP+LIV K
Sbjct  109  ETRVEIGDPRDVICDMSQKLGADLLIMGSHGYGVVKRAFLGSVSNYCSQNVKCPILIVKK  168

Query  676  PTP  684
            P P
Sbjct  169  PKP  171



>ref|XP_002962652.1| hypothetical protein SELMODRAFT_79236 [Selaginella moellendorffii]
 gb|EFJ36115.1| hypothetical protein SELMODRAFT_79236 [Selaginella moellendorffii]
Length=187

 Score =   117 bits (292),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 94/163 (58%), Gaps = 17/163 (10%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQP--FV  369
            + ++V++AID+S+ES  AL +ALD V +                  LV +   F P  +V
Sbjct  38   KAKKVIVAIDESQESIRALRYALDTVVQPGD--------------GLVLLHSQFMPHSYV  83

Query  370  FHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVK-AETLVLEGDPKDKLCRA  546
               GP  + T  ++   RK Q+  +K +L KA ++C    V   E L+  GDP+D +C A
Sbjct  84   GPGGPGFYITPDLVAATRKHQENSSKVLLDKAKRICGDANVHHPELLMATGDPRDSICDA  143

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
             E++  DLLV+GSRG G I R FLGSVSDYC H+A CPVLIV+
Sbjct  144  VEKIHADLLVMGSRGHGAIKRTFLGSVSDYCTHNAKCPVLIVR  186



>ref|XP_010659697.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Vitis vinifera]
 emb|CBI39583.3| unnamed protein product [Vitis vinifera]
Length=167

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 98/170 (58%), Gaps = 13/170 (8%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + R++++A+D+ EES YAL+W L N+            +     I L+  +PP   +   
Sbjct  7    KGRKILVAVDEGEESMYALSWCLGNI----------TIQNSKDTIVLLYAKPPLAVYSGL  56

Query  376  TGPVV-FATSTVIDTYRKSQQQMAKEVLSKALQMCKQKM-VKAETLVLEGDPKDKLCRAA  549
             G  V   +S ++ T    + ++A+ V+ KA  +C Q   +K ET++  GD +D +C AA
Sbjct  57   DGTAVHLFSSNIMLTMESYRNEVAQGVMQKAKNLCWQHGDIKVETMIENGDARDVICGAA  116

Query  550  EEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPR  699
            E++ VD++V+GS G G I RAFLGSVS++C  +  CPVLIVK  PK +  
Sbjct  117  EKLGVDMVVMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVK-RPKSTAE  165



>ref|XP_010544073.1| PREDICTED: uncharacterized protein C167.05 [Tarenaya hassleriana]
 ref|XP_010544074.1| PREDICTED: uncharacterized protein C167.05 [Tarenaya hassleriana]
Length=172

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 90/158 (57%), Gaps = 5/158 (3%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNV--FKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTG  381
            V++A+D SE S  AL WALDN+    + P          S       + P   PF   +G
Sbjct  10   VIVAVDGSEASMEALRWALDNLKLSPSSPDSSFVVLHVQSPPSIAAGLNPGTIPFGGPSG  69

Query  382  PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMS  561
              V A +  I+ +   Q+++   +L  ALQ+C  K V  +T+V+ GDPK+K+C A E + 
Sbjct  70   LEVPAFAAAIEAH---QKRITDAILKHALQICSDKSVNVKTIVIVGDPKEKICEAVENLH  126

Query  562  VDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
             DLLV+G R +G I R FLGSVS+YC +HA CPV+I K
Sbjct  127  ADLLVMGCRAIGPIKRMFLGSVSNYCTNHARCPVIIAK  164



>gb|EMT03450.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=180

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 92/162 (57%), Gaps = 10/162 (6%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGPV  387
            V++ +DDS+ S+ AL WA+  V +   +    E       + +V+ +P     V   GP 
Sbjct  28   VLVGVDDSDHSYRALEWAVRYVAETAGAGAPVE-------LVVVHAKPAVSSVVTLGGPA  80

Query  388  VFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVD  567
              A   V+       ++ A+EV+ +A ++C    V+    V++G+P+  LC A E+   D
Sbjct  81   --AAGDVVRYVDADLRRRAEEVVDRARRLCAGNSVQGVVEVIDGEPRFVLCNAVEKHHAD  138

Query  568  LLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK-PTPKE  690
            LLVVGS G G I RAFLGSVSDYC HHAHC V+IVK P PKE
Sbjct  139  LLVVGSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKPKE  180



>ref|XP_009338192.1| PREDICTED: universal stress protein A-like protein [Pyrus x bretschneideri]
Length=167

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 91/167 (54%), Gaps = 12/167 (7%)
 Frame = +1

Query  181  STVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQ  360
            + V E  RR+++A+D+ EES +AL+W L NV                  + L+  +PP  
Sbjct  2    TDVAESERRILVAVDEGEESMHALSWCLKNVAGQNSKD----------TVVLLYAKPPRV  51

Query  361  PFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCK--QKMVKAETLVLEGDPKDK  534
             F    G     +S ++    K    +A  V+ KA +MCK  Q  +K ET V  GDP+D 
Sbjct  52   VFTALDGTGYLFSSDILAAMEKYGADVADCVMDKAKKMCKDLQPDLKVETKVESGDPRDV  111

Query  535  LCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            +C+  E +  D+LV+GS G G I RAFLGSVS++C  +  CPVLIVK
Sbjct  112  ICQMVERLRADVLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVK  158



>ref|XP_008781084.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Phoenix dactylifera]
Length=168

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 94/162 (58%), Gaps = 1/162 (1%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF  372
            E+ RR+++A+D+ +ES YAL W L NV    P+  + E++     + L++VRP    F  
Sbjct  3    EKGRRIVVAVDEGDESMYALTWCLQNVVSPPPAAAAEEDDDVKDTLILLHVRPSRFLFPA  62

Query  373  HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ-KMVKAETLVLEGDPKDKLCRAA  549
              G     +S ++    +     A+ V+ KA ++C     VK ET V  GDP+D +C   
Sbjct  63   MDGTGYLFSSDMMAAMERFGNAAAEAVMEKAKRICADFPDVKMETRVETGDPRDVICEVV  122

Query  550  EEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            E+M  ++LV+G+ G G I RAFLGSVS++C   A CPVLIVK
Sbjct  123  EKMGANMLVMGNHGYGPIKRAFLGSVSNHCAQRAKCPVLIVK  164



>gb|KHG14939.1| hypothetical protein F383_18523 [Gossypium arboreum]
Length=171

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 101/178 (57%), Gaps = 20/178 (11%)
 Frame = +1

Query  181  STVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQ  360
            + V +++R++++A+D+ EES YAL+W L N+                  + L+ VR    
Sbjct  2    ADVVDKDRKILVAVDEGEESMYALSWCLKNIISQ----------CCKDTLFLLYVRSAQ-  50

Query  361  PFVFHT---GPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQK---MVKAETLVLEGD  522
               FH+   G     ++ V+ T  K    +A  ++ KA +MC++K    VK E ++  GD
Sbjct  51   --AFHSSLDGTGYLFSADVLATVDKYSNDVANCIIEKAKRMCREKGDDEVKVEVIIESGD  108

Query  523  PKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESP  696
            P+D +CR AE ++ D+LV+GS G G I RAFLGSVS++C  +  CPVLIVK  PK S 
Sbjct  109  PRDVICRVAENINADVLVMGSHGYGLIQRAFLGSVSNHCAQNVKCPVLIVKK-PKSSS  165



>gb|EMS51706.1| Universal stress protein A-like protein [Triticum urartu]
Length=180

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 91/162 (56%), Gaps = 10/162 (6%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGPV  387
            V++ +DDS+ S+ AL WA+  V +        E       + +V+ +P     V   GP 
Sbjct  28   VLVGVDDSDHSYRALEWAVRYVAETAGPGAPVE-------LVVVHAKPAVSSVVTLGGPA  80

Query  388  VFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVD  567
              A   V+       ++ A+EV+ +A ++C    V+    V++G+P+  LC A E+   D
Sbjct  81   --AAGDVVRYVDADLRRRAEEVVDRARRLCAANSVQGVVKVIDGEPRYVLCNAVEKHHAD  138

Query  568  LLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK-PTPKE  690
            LLVVGS G G I RAFLGSVSDYC HHAHC V+IVK P PKE
Sbjct  139  LLVVGSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKPKE  180



>ref|XP_003570587.1| PREDICTED: uncharacterized protein C167.05 isoform X2 [Brachypodium 
distachyon]
Length=164

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 99/165 (60%), Gaps = 18/165 (11%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP-PFQPFVFHTGP  384
            V++A+D SEES  AL WALD+V + RP           G + +++V+P P      + GP
Sbjct  11   VVVAVDGSEESMKALRWALDSV-RLRPD----------GALVVLHVQPRPGIAAGLNPGP  59

Query  385  VVFATSTVID------TYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRA  546
            + F     ++           Q+++ + +L  AL++C +K V+ +T V+ GDPK+K+C  
Sbjct  60   IPFGGPREVEVPAFTQAIEAHQRRITEAILEHALKICAEKNVEVKTEVVVGDPKEKICEV  119

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            A E+  DLLV+GSR +G + R FLGSVS+YC++   CPV+++K T
Sbjct  120  AAELKADLLVMGSRAIGPVKRMFLGSVSNYCINSVGCPVVVIKGT  164



>ref|XP_010259332.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Nelumbo nucifera]
Length=166

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 94/167 (56%), Gaps = 12/167 (7%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + RR+++A+D+ EES YAL+W L N+            E     + L+ V+PP   +   
Sbjct  7    KERRILVAVDEGEESMYALSWCLKNLI----------CESSKDTLILLYVKPPRVVYTAL  56

Query  376  TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ-KMVKAETLVLEGDPKDKLCRAAE  552
             G     +S +I T  K    +A  V+ KA  +C+  + VK ET V  GDP+D +C    
Sbjct  57   DGTGYMFSSDIITTMEKYSNDVAGCVIEKAKTLCRDLQNVKVETKVEHGDPRDVICEMTG  116

Query  553  EMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            ++  D+LV+GS G G I RAFLGSVS++C  +A CPVLIVK  PK +
Sbjct  117  KLGADMLVMGSHGYGLIKRAFLGSVSNHCAQNASCPVLIVK-RPKST  162



>gb|AFK39818.1| unknown [Medicago truncatula]
Length=154

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 93/162 (57%), Gaps = 14/162 (9%)
 Frame = +1

Query  211  MIAIDDSEESFYALNWALDN-VFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGPV  387
            M+AID+ EES YAL W L N VF+N   H           + L+ V+PP   +    G  
Sbjct  1    MVAIDEGEESIYALTWCLKNLVFQNSKDH-----------LILLYVKPPRVVYSAFDGTG  49

Query  388  VFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVD  567
               +S +  T  K  QQ+A  VL KA  +C   +   ET +  GDP+D +C+A ++M VD
Sbjct  50   YLFSSDITATMEKYSQQVADCVLEKAKIVCND-VQNVETRIENGDPRDVICQAVQKMGVD  108

Query  568  LLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
            +LV+GS G G I RAFLGSVS++C  +  CPVLIVK  PK +
Sbjct  109  ILVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKK-PKST  149



>ref|XP_010044257.1| PREDICTED: universal stress protein A-like protein [Eucalyptus 
grandis]
 gb|KCW86318.1| hypothetical protein EUGRSUZ_B03008 [Eucalyptus grandis]
Length=158

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 99/168 (59%), Gaps = 13/168 (8%)
 Frame = +1

Query  172  MEESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP  351
            MEE       +++M+AIDDSE S YAL WALDN+  +               + + +V+P
Sbjct  1    MEEGNA---KKKIMVAIDDSECSHYALEWALDNLGHSIAGSE----------LIVFSVQP  47

Query  352  PFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKD  531
                   +      A   +I +  ++++++   +L KA ++C Q  V AET+   GDPK+
Sbjct  48   SSNYGSVYAASYGAAPVDLIRSLDENRKKLTLGLLEKAKEICSQHGVNAETMTEVGDPKE  107

Query  532  KLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            ++C+A +++++ LLV+GS   G I RAFLGSVS+YC+H+A  PVL+VK
Sbjct  108  EICKAVDKLNIQLLVLGSHSRGAIKRAFLGSVSNYCVHNAKGPVLVVK  155



>ref|XP_002282460.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 emb|CBI39584.3| unnamed protein product [Vitis vinifera]
Length=170

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 98/173 (57%), Gaps = 16/173 (9%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + R++++A+D+ EES YAL+W L N+            +     I L++ +PP   +   
Sbjct  7    KGRKILVAVDEGEESMYALSWCLGNI----------SIQNSKDTIVLLDAKPPLAVYSGL  56

Query  376  TGPVVFA----TSTVIDTYRKSQQQMAKEVLSKALQMCKQKM-VKAETLVLEGDPKDKLC  540
             G         +S ++ T    +  +A+ V+ KA  +C+Q   +K ET++  GD +D +C
Sbjct  57   DGTAGMGVHLFSSDIMLTMESYRNAVAQGVMQKAKNLCRQHGDIKVETMIENGDARDVIC  116

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPR  699
             AAE++ VD++V+GS G G I RAFLGSVS++C  +  CPVLIVK  PK +  
Sbjct  117  GAAEKLGVDMVVMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVK-RPKSTAE  168



>ref|XP_008800823.1| PREDICTED: universal stress protein A-like protein [Phoenix dactylifera]
Length=167

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 87/171 (51%), Gaps = 27/171 (16%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGPV  387
            +++ IDDSE SFYAL W L + F                        PPF+  V H  PV
Sbjct  14   MVVGIDDSEHSFYALQWTLLHFFSGGR-----------------GSNPPFKLVVVHAKPV  56

Query  388  VF--------ATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVK-AETLVLEGDPKDKLC  540
                      A + V+       +++A  V+ KA ++C    V   E  V+EGDP++ LC
Sbjct  57   ATSVVGLAGPAAADVLPFLESDLKRIAARVMEKAKELCTANSVADIEYEVVEGDPRNVLC  116

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIV-KPTPKE  690
               E+   D+LVVGS G G I RA LGSVSDYC HHAHC V+IV KP PK 
Sbjct  117  ETVEKHHADMLVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKPKH  167



>ref|XP_008389279.1| PREDICTED: universal stress protein A-like protein [Malus domestica]
Length=160

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 98/178 (55%), Gaps = 31/178 (17%)
 Frame = +1

Query  172  MEESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP  351
            MEE    E+ ++VM+AID+SE S YA NWAL+N                     L     
Sbjct  1    MEEQGKNEERKKVMVAIDESEFSLYAFNWALEN---------------------LRETIQ  39

Query  352  PFQPFVFHTGPVVFATS----------TVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAE  501
              Q  VF   P+ FA++           ++ +  ++ +++A  +L +A ++C +  +  E
Sbjct  40   SSQLVVFTAQPIDFASTYAASYGAAPAQLVTSLLENHKKVALALLERAKEICAKHGIVPE  99

Query  502  TLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            T+   GDPK  +C A E+ ++ LLV+GS G G I RAFLGSVS+YC+H+A CPVL+V+
Sbjct  100  TVTEVGDPKVVICEAVEKHNIQLLVLGSHGRGGIQRAFLGSVSNYCVHNAKCPVLVVR  157



>emb|CAN69650.1| hypothetical protein VITISV_010535 [Vitis vinifera]
Length=170

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 98/173 (57%), Gaps = 16/173 (9%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + R++++A+D+ EES YAL+W L N+            +     I L++ +PP   +   
Sbjct  7    KGRKILVAVDEGEESMYALSWCLGNI----------SIQNSKDTIVLLDAKPPLAVYSGL  56

Query  376  TGPVVFA----TSTVIDTYRKSQQQMAKEVLSKALQMCKQKM-VKAETLVLEGDPKDKLC  540
             G         +S ++ T    + ++A+ V+ KA  +C Q   +K ET++  GD +D +C
Sbjct  57   DGTAGMGVHLFSSNIMLTMESYRNEVAQGVMQKAKNLCWQHGDIKVETMIENGDARDVIC  116

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPR  699
             AAE++ VD++V+GS G G I RAFLGSVS++C  +  CPVLIVK  PK +  
Sbjct  117  GAAEKLGVDMVVMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVK-RPKSTAE  168



>gb|EYU37244.1| hypothetical protein MIMGU_mgv1a026749mg [Erythranthe guttata]
Length=167

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 96/164 (59%), Gaps = 11/164 (7%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP-PFQPFV  369
            E+ R++++A+D  EES YAL+W L+N+      ++         +I L    P P    +
Sbjct  3    EKGRKILVAVDKGEESSYALSWCLENLLSENHQNYKDT------LILLFAKTPLPIYSGM  56

Query  370  FHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCK--QKMVKAETLVLEGDPKDKLCR  543
              TG V   + ++I +  K   ++A++V+ KA Q+CK     +  ET+V  GDP+D +C 
Sbjct  57   DTTGHV--TSPSIIASVEKYANEVAEKVMCKATQICKDFNDQITMETMVEHGDPRDVICD  114

Query  544  AAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
             AE   VD LVVGSRG G I RAFLGSVS++C  +  CPV+IVK
Sbjct  115  VAERFKVDFLVVGSRGYGIIKRAFLGSVSNHCAQNVKCPVVIVK  158



>gb|ACU19158.1| unknown [Glycine max]
Length=177

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 104/183 (57%), Gaps = 24/183 (13%)
 Frame = +1

Query  172  MEESTVPEQNRRVMIAIDDSEESFYALNWALDNV-FKNRPshhsheeeqhsGVITLVNVR  348
            M E+T     RRV++A+D+ EES YAL+W+L N+ F+N            S  + L+ V+
Sbjct  1    MSEATT-RNERRVLVAVDEGEESMYALSWSLKNIIFQN-----------SSDTLILLYVK  48

Query  349  PP---FQPF-----VFH-TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ-KMVKA  498
            PP   + P      + H   P     S V     K  Q++A  VL KA ++CK  + VK 
Sbjct  49   PPHAVYSPLDSTARIDHPETPGYLFLSDVSAAIEKYGQEVADCVLEKAKKLCKDFQNVKV  108

Query  499  ETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIV-K  675
            ET V  GDP+D +C  ++++  DLL++GS G G + RAFLGSVS+YC  +  CP+LIV K
Sbjct  109  ETRVEIGDPRDVICDMSQKLGADLLIMGSHGYGVVKRAFLGSVSNYCSQNVKCPILIVKK  168

Query  676  PTP  684
            P P
Sbjct  169  PKP  171



>ref|XP_009356876.1| PREDICTED: universal stress protein A-like protein [Pyrus x bretschneideri]
Length=187

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 103/193 (53%), Gaps = 36/193 (19%)
 Frame = +1

Query  166  EIMEESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNV  345
            E M E+      +RVM+AID+SE S YAL WALDN+  +               IT    
Sbjct  11   ERMGEAIARGAEKRVMVAIDESECSHYALMWALDNLKDS---------------IT----  51

Query  346  RPPFQPFVFHT---GPVVFATS--------------TVIDTYRKSQQQMAKEVLSKALQM  474
            + P   F   T   G V+F+ S                +++ +++ ++ A  +L KA ++
Sbjct  52   KSPLIIFTAQTPSAGNVIFSASLGSARMYYPMSSSQEFVNSSQENHRKFALGLLEKAKEI  111

Query  475  CKQKMVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAH  654
            C    V AET+   GDPK  +C A ++ +++LL++G RGLG I RA LGSVS+YC+ +A 
Sbjct  112  CANHGVNAETVTEVGDPKAAICDAVQKHNINLLILGERGLGKIKRAILGSVSNYCVQNAK  171

Query  655  CPVLIVKPTPKES  693
            CPVL+VK +  E 
Sbjct  172  CPVLVVKKSQAEG  184



>ref|XP_011087485.1| PREDICTED: universal stress protein A-like protein [Sesamum indicum]
Length=169

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 94/166 (57%), Gaps = 12/166 (7%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + R++++A+D+ EES YAL+W L+N    R              + L+  + P   +   
Sbjct  5    KGRKILVAVDEGEESAYALSWCLNNFISPR---------NSKDTLILLFAKKPLAVYSAM  55

Query  376  TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ--KMVKAETLVLEGDPKDKLCRAA  549
                   +S++I +  +   ++A+ V+ KA ++CK+    VK ET+V  GDP+D +C  A
Sbjct  56   DSTGYIFSSSIIASMERYGNEVAERVMDKATRICKEFSDEVKVETMVENGDPRDVICEVA  115

Query  550  EEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPK  687
            E + V+ LV+GS G G I RAFLGSVS +C  +  CPVLIVK  PK
Sbjct  116  ERLKVEFLVMGSHGYGLIKRAFLGSVSSHCAQNVTCPVLIVK-NPK  160



>ref|XP_008797667.1| PREDICTED: universal stress protein A-like protein [Phoenix dactylifera]
Length=160

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 98/160 (61%), Gaps = 11/160 (7%)
 Frame = +1

Query  202  RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTG  381
            +R M+AID+SE S +AL+WAL N+  +            S  + +  V+P     +    
Sbjct  11   KRAMVAIDESECSHHALDWALANLRDS-----------LSSPLIIFTVQPLQSISILAAA  59

Query  382  PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMS  561
                    +I + ++ QQ+++  +L KA ++C ++ V AET+   GDPK+ +C+A E+  
Sbjct  60   SYGSPAPELIRSVQEHQQKVSVALLEKAKEICSERGVVAETITEVGDPKEAICQAVEKFD  119

Query  562  VDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            V+LL++G++G G + RAFLGSVS+YC+H+A CPVL+VK +
Sbjct  120  VNLLILGNQGKGTLQRAFLGSVSNYCVHNAKCPVLVVKKS  159



>ref|XP_002454587.1| hypothetical protein SORBIDRAFT_04g033920 [Sorghum bicolor]
 gb|EES07563.1| hypothetical protein SORBIDRAFT_04g033920 [Sorghum bicolor]
Length=162

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 99/168 (59%), Gaps = 24/168 (14%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQ---------  360
            V++A+D SEES  AL WALDN  + RP           G + +++V+PP           
Sbjct  9    VVVAVDGSEESMNALRWALDN-LRLRPD----------GELVVLHVQPPPNIAAGLNPAP  57

Query  361  -PFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKL  537
             PF   +G  V A +  I+ +   Q+++ + +L  AL++C +K V+ +T V+ GDPK+K+
Sbjct  58   IPFGGPSGVEVPAFTQAIEAH---QRRITQAILEHALKICSEKNVEVKTEVVVGDPKEKI  114

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            C  A     DLLV+G R +G + R FLGSVS+YC++H  CPV+++K T
Sbjct  115  CEVAANSKADLLVMGCRAIGPLKRVFLGSVSNYCINHVGCPVVVIKGT  162



>ref|XP_010458272.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=171

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 91/159 (57%), Gaps = 5/159 (3%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNV--FKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTG  381
            V++A+D SE S  AL WALDN+    + P                  V P   PF   +G
Sbjct  10   VVVAVDGSEVSMEALRWALDNLKLSSSSPDSSFVVLHVQPSPSVAAGVSPGTIPFGGPSG  69

Query  382  PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMS  561
              V A +  I+ +   Q+++   +L  A ++C +K V  +T V+ GDPK K+C A EE+ 
Sbjct  70   LEVPAFTAAIEQH---QKRITDTILEHAHRICAEKSVTVKTQVVVGDPKYKICEAVEELH  126

Query  562  VDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
             DLLV+GSR  G I R FLGSVS+YC +HAHCPV+I+KP
Sbjct  127  ADLLVIGSRAYGRIKRMFLGSVSNYCTNHAHCPVVIIKP  165



>emb|CDY31068.1| BnaA08g26180D [Brassica napus]
Length=171

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 89/159 (56%), Gaps = 5/159 (3%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNV--FKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTG  381
            V++A+D SE S  AL WALDN+    + P                  V P   PF   +G
Sbjct  10   VVVAVDGSEVSMEALKWALDNLKLSPSSPDSSFVVLHVQPSPSIAAGVSPGTIPFGGPSG  69

Query  382  PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMS  561
              V A +  I+ +   Q+++   +L  A Q+   + V  +T V+ GDPKDK+C   E ++
Sbjct  70   VEVPAFAAAIEQH---QKRITDAILGHARQIYADRSVNVKTQVVVGDPKDKICETVENLN  126

Query  562  VDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKP  678
             DLLV+GSR  G I R FLGSVS+YC +HAHCPV+I+KP
Sbjct  127  ADLLVLGSRAYGPIKRMFLGSVSNYCTNHAHCPVVIIKP  165



>ref|XP_009791886.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=165

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 99/163 (61%), Gaps = 10/163 (6%)
 Frame = +1

Query  193  EQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVF  372
            E+ ++VM+AID+SE SFYAL W L+N++ +  +            I L   +P       
Sbjct  12   EKKKKVMVAIDESECSFYALEWTLNNLYNSLLNSE----------IVLFTGQPIADYSYI  61

Query  373  HTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAE  552
            +       +  +I + +++Q+++   +L KA  +C Q  + AET+   GDPK+ +C AAE
Sbjct  62   YASSFGVTSPELITSIQENQRKVTNALLKKAKDVCGQHGIVAETMTQVGDPKETICEAAE  121

Query  553  EMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            ++ V+LLV+GS   G I RAFLGSVS+YC+H+A CPVL+V+ T
Sbjct  122  KVHVNLLVLGSHNKGAIQRAFLGSVSNYCVHNAKCPVLVVRRT  164



>ref|XP_007223587.1| hypothetical protein PRUPE_ppa012379mg [Prunus persica]
 gb|EMJ24786.1| hypothetical protein PRUPE_ppa012379mg [Prunus persica]
Length=172

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 97/163 (60%), Gaps = 10/163 (6%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITL-------VNVRPPFQPF  366
            V++A+D SEES  AL+WALDN+    P+  S     H  V+ +         + PP  PF
Sbjct  8    VIVAVDGSEESMNALSWALDNLKLRSPAPDSTTSAGHFVVLHVQSPPSIAAGLSPPAIPF  67

Query  367  VFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRA  546
               +   V A +  I+ +   Q+++ + +L  AL++C +K V  +T V+ GDPK+K+  A
Sbjct  68   GGPSDVEVPAFNAAIEAH---QRRITEAILEYALRICSEKKVNVKTQVVVGDPKEKIGEA  124

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            AE +  DLLV+GSR  G + R FLGSVS+YC +H  CP++I+K
Sbjct  125  AENLHADLLVMGSRAFGPLKRMFLGSVSNYCANHVQCPIIIIK  167



>gb|EPS60930.1| hypothetical protein M569_13873, partial [Genlisea aurea]
Length=117

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 73/116 (63%), Gaps = 25/116 (22%)
 Frame = +1

Query  406  VIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVDLLVVGS  585
            V+++  K+Q+  A  +LS+A ++C++K +   T +LEGDPKDK+C+A EEM +DLL+VGS
Sbjct  1    VVESASKAQEDNAARILSRAFEICREKSINPNTRILEGDPKDKICKAVEEMKIDLLLVGS  60

Query  586  RGLGNITR-------------------------AFLGSVSDYCLHHAHCPVLIVKP  678
            RGLG I R                         A LGSVSDYC+HHA CPVL+VKP
Sbjct  61   RGLGQIKRFFFFLINNLLLLFYLFINLFIFFGWALLGSVSDYCVHHATCPVLVVKP  116



>ref|XP_004953997.1| PREDICTED: uncharacterized protein C167.05-like [Setaria italica]
Length=162

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 99/168 (59%), Gaps = 24/168 (14%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQ---------  360
            V++A+D SEES  AL WALDN  + RP           G + +++V+PP           
Sbjct  9    VVVAVDGSEESMNALRWALDN-LRLRPD----------GELVVLHVQPPPNIAAGLNPAP  57

Query  361  -PFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKL  537
             PF   +G  V A +  I+ +   Q+++ + +L  AL++C  K V+ +T V+ GDPK+K+
Sbjct  58   IPFGGPSGLEVPAFTQAIEAH---QRRITQAILEHALKICSAKNVEVKTEVIVGDPKEKI  114

Query  538  CRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPT  681
            C A    + DLLV+G R +G + R FLGSVS+YC++H  CPV+++K T
Sbjct  115  CEATANRNADLLVMGCRAIGPLQRMFLGSVSNYCINHVGCPVVVIKGT  162



>ref|XP_009373939.1| PREDICTED: uncharacterized protein C167.05-like [Pyrus x bretschneideri]
 ref|XP_009373948.1| PREDICTED: uncharacterized protein C167.05-like [Pyrus x bretschneideri]
 ref|XP_009342557.1| PREDICTED: uncharacterized protein C167.05-like [Pyrus x bretschneideri]
 ref|XP_009342558.1| PREDICTED: uncharacterized protein C167.05-like [Pyrus x bretschneideri]
Length=172

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 94/165 (57%), Gaps = 10/165 (6%)
 Frame = +1

Query  202  RRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPP-------FQ  360
            R V++A+D SEES  AL WALDN+   +    + +    +G + +++V+PP         
Sbjct  6    RCVIVAVDGSEESMNALTWALDNL---KLRSSAPDSTTSAGHLVVLHVQPPPSIAAGLSP  62

Query  361  PFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLC  540
            P +   GP               Q+++ + ++  AL++C +K V  +T V+ GDPK+K+ 
Sbjct  63   PAIPFGGPNDLEVPAFTAAIEAHQRRITEVIIEHALKICSEKKVNVKTQVVVGDPKEKIG  122

Query  541  RAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
             A E +  DLLV+GSR  G I R FLGSVS++C +H  CPVLIVK
Sbjct  123  EAVENLHADLLVMGSRAFGPIKRMFLGSVSNFCANHVQCPVLIVK  167



>ref|NP_001060607.1| Os07g0673400 [Oryza sativa Japonica Group]
 dbj|BAC16006.1| universal stress protein USP1-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF22521.1| Os07g0673400 [Oryza sativa Japonica Group]
 gb|EAZ41056.1| hypothetical protein OsJ_25543 [Oryza sativa Japonica Group]
 dbj|BAG88992.1| unnamed protein product [Oryza sativa Japonica Group]
Length=171

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 93/170 (55%), Gaps = 13/170 (8%)
 Frame = +1

Query  193  EQNRRVMI-AIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP-PFQPF  366
            EQ + V++  +DDSE S YAL W + ++          E       + +V+ +P P    
Sbjct  7    EQGKTVVVVGVDDSEHSNYALEWTMQHLASGMAGSGGAE-------LVIVHAKPSPSSVV  59

Query  367  VFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRA  546
             F  GP    +  V+       ++ A++V+ KA ++C    + A   V+EG+P+  LC A
Sbjct  60   GFGAGP---GSGEVVRYVEADLRKTAEDVVEKARRLCIANAMHALIEVIEGEPRYVLCNA  116

Query  547  AEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK-PTPKES  693
             E+ S  LLVVGS G G I RAFLGSVSDYC HHAHC V+IVK P  K S
Sbjct  117  VEKHSAGLLVVGSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKAKRS  166



>ref|XP_010921510.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=167

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 92/164 (56%), Gaps = 7/164 (4%)
 Frame = +1

Query  196  QNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFH  375
            + RR+++A+D+SEES YAL W L N+  +     + E       + LV  RPP   +   
Sbjct  8    EERRIVVAVDESEESIYALQWCLHNLIHS-----AGEGATARNTLILVYARPPPPVYSPL  62

Query  376  TGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQ-KMVKAETLVLEGDPKDKLCRAAE  552
             G     +  V  +  K  + +A  V+ +A  +CK    +K E  V  GD +D +C  A+
Sbjct  63   DGTGYLFSDEVTASIDKYSKDLAVSVMERARNICKDYSNMKVEEKVCVGDARDVICEMAQ  122

Query  553  EMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK-PT  681
            ++  DLLV+GS G G I RAFLGSVSDYC  +A CPVLIVK PT
Sbjct  123  KLGADLLVMGSHGYGFIKRAFLGSVSDYCARNAKCPVLIVKRPT  166



>ref|NP_172445.2| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
 gb|AAO64778.1| At1g09740 [Arabidopsis thaliana]
 dbj|BAF00178.1| putative ER6 protein [Arabidopsis thaliana]
 gb|AEE28487.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
Length=171

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 90/164 (55%), Gaps = 5/164 (3%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNV--FKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTG  381
            V++A+D SE S  AL WALDN+    +                    V P   PF   +G
Sbjct  10   VVVAVDGSEVSMEALRWALDNLKLSSSSSDSSFVVLHVQPSPSVAAGVSPGTIPFGGPSG  69

Query  382  PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMS  561
              V A +  I+ +   Q+++   +L  A Q+C +K V  +T V+ GDPK K+C A E + 
Sbjct  70   LEVPAFTAAIEQH---QKRITDTILEHASQICAEKSVNVKTQVVIGDPKYKICEAVENLH  126

Query  562  VDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKES  693
             DLLV+GSR  G I R FLGSVS+YC +HAHCPV+I+KP    S
Sbjct  127  ADLLVMGSRAYGRIKRMFLGSVSNYCTNHAHCPVVIIKPKEDSS  170



>gb|EMS51705.1| Universal stress protein A-like protein [Triticum urartu]
Length=177

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 91/161 (57%), Gaps = 8/161 (5%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTGPV  387
            V++A+DDS+ S+ AL WA+ +V        +   E     + +V+ +P   P V   GP 
Sbjct  23   VLVAVDDSDHSYRALEWAVRHVAATAGVPGARAVE-----LVVVHAKPSPSPVVTMGGPG  77

Query  388  VFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMSVD  567
            V  +  V+       ++ A  V+ +A ++C    V+    V++G+P+  LC A E+   D
Sbjct  78   V--SGDVVRLVEADLRKKADGVVDRARRLCVANSVQGVVEVVDGEPRHVLCNAVEKHHAD  135

Query  568  LLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK-PTPK  687
            LLVVGS G G I RA LGSVSDYC HHAHC V+IVK P PK
Sbjct  136  LLVVGSHGYGAIKRALLGSVSDYCAHHAHCSVMIVKQPKPK  176



>ref|XP_008339660.1| PREDICTED: universal stress protein A-like protein [Malus domestica]
Length=187

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 103/183 (56%), Gaps = 16/183 (9%)
 Frame = +1

Query  166  EIMEESTVPEQNRRVMIAIDDSEESFYALNWALDNV---FKNRPshhsheeeqhsGVI--  330
            E M E+      +RVM+AID+S+ S YAL W LDN+     N P      +   +G +  
Sbjct  11   ERMGEAIARGAEKRVMVAIDESDCSHYALMWVLDNLKDSITNSPLIIFTAQTPSAGNVIF  70

Query  331  --TLVNVRPPFQPFVFHTGPVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAET  504
              +L N R  + P          +    +++ +++ +++A  +L KA ++C    V AET
Sbjct  71   SASLGNARM-YYPM--------SSNQEFVNSSQENHRKLALGLLEKAKEICANHGVNAET  121

Query  505  LVLEGDPKDKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTP  684
            +   GDPK  +C A ++ +++LL++G RGLG I RA LGSVS+YC+ +A CPVL+VK + 
Sbjct  122  VTEVGDPKAAICDAVQKHNINLLILGERGLGKIKRAILGSVSNYCVQNAKCPVLVVKKSQ  181

Query  685  KES  693
             E 
Sbjct  182  AEG  184



>ref|XP_007044293.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Theobroma cacao]
 gb|EOY00125.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Theobroma cacao]
Length=158

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 97/169 (57%), Gaps = 15/169 (9%)
 Frame = +1

Query  172  MEESTVPEQNRRVMIAIDDSEESFYALNWALDNVFKNRPshhsheeeqhsGVITLVNVRP  351
            MEE+ +    ++VM+AID+SE S +AL WAL+N+     +               +    
Sbjct  1    MEENKM---KKKVMVAIDESECSHHALQWALENLGDTLAASQ-----------VFIFTAQ  46

Query  352  PFQPFVFHTGPVVFATS-TVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPK  528
            P   F + +     A    +I T +++Q+++   +L KA  +C    V  ET+   GDPK
Sbjct  47   PLPNFAYLSASTYGAAPLDLITTVQENQKKLTLALLEKAKDICATHGVDGETMTEIGDPK  106

Query  529  DKLCRAAEEMSVDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVK  675
            DK+C A E++ + LL++GS G G + RAFLGSVS++C+H+A CPVL+V+
Sbjct  107  DKICEAVEKLKIQLLILGSHGRGALQRAFLGSVSNHCVHNAKCPVLVVR  155



>emb|CDY20676.1| BnaC08g13820D [Brassica napus]
Length=171

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 92/166 (55%), Gaps = 6/166 (4%)
 Frame = +1

Query  208  VMIAIDDSEESFYALNWALDNV--FKNRPshhsheeeqhsGVITLVNVRPPFQPFVFHTG  381
            V++A+D SE S  AL WALDN+    + P                  V P   PF   +G
Sbjct  10   VVVAVDGSEVSMEALKWALDNLKLSPSSPDSSFVVLHVQPSPSITAGVSPGTIPFGGPSG  69

Query  382  PVVFATSTVIDTYRKSQQQMAKEVLSKALQMCKQKMVKAETLVLEGDPKDKLCRAAEEMS  561
              V A +  I+ +   Q+++   +L  A Q+   + V  +T V+ GDPKDK+C   E ++
Sbjct  70   VEVPAFAAAIEQH---QKRITDAILEHARQIYADRSVNVKTQVVVGDPKDKICETVENLN  126

Query  562  VDLLVVGSRGLGNITRAFLGSVSDYCLHHAHCPVLIVKPTPKESPR  699
             DLLV+GSR  G I R FLGSVS YC +HAHCPV+I+KP  ++SP 
Sbjct  127  ADLLVLGSRAYGPIKRMFLGSVSSYCTNHAHCPVVIIKPK-EDSPE  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1969537411332