BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25419_g1_i1 len=2116 path=[3797:0-225 744:226-253 996:254-284
1027:285-308 1051:309-455 1198:456-483 4282:484-536 78:537-566
4364:567-1082 4880:1083-1107 4905:1108-1176 4974:1177-1234
5032:1235-1242 5040:1243-1285 5083:1286-1292 5090:1293-1348
5146:1349-1362 5160:1363-1405 7924:1406-1412 5210:1413-1445
5243:1446-1541 5339:1542-1571 8434:1572-1573 5371:1574-1586
5384:1587-1651 8451:1652-1659 8459:1660-1677 8010:1678-1680
5477:1681-1694 8482:1695-1712 8035:1713-1736 5533:1737-1816
1223:1817-1936 1343:1937-2115]

Length=2116
                                                                      Score     E

ref|XP_009770446.1|  PREDICTED: L-type lectin-domain containing r...    732   0.0      
ref|XP_006366898.1|  PREDICTED: L-type lectin-domain containing r...    728   0.0      
ref|XP_009794260.1|  PREDICTED: L-type lectin-domain containing r...    717   0.0      
gb|KDO44170.1|  hypothetical protein CISIN_1g042831mg                   698   0.0      
ref|XP_006487682.1|  PREDICTED: L-type lectin-domain containing r...    699   0.0      
ref|XP_006423640.1|  hypothetical protein CICLE_v10027962mg             698   0.0      
ref|XP_006363961.1|  PREDICTED: L-type lectin-domain containing r...    696   0.0      
ref|XP_006369691.1|  hypothetical protein POPTR_0001s29080g             688   0.0      
ref|XP_007042796.1|  Concanavalin A-like lectin protein kinase fa...    687   0.0      
ref|XP_010327615.1|  PREDICTED: L-type lectin-domain containing r...    683   0.0      
gb|KHN46238.1|  L-type lectin-domain containing receptor kinase IX.1    682   0.0      
ref|XP_006369692.1|  Chain H family protein                             679   0.0      
ref|XP_003532590.1|  PREDICTED: L-type lectin-domain containing r...    674   0.0      
ref|XP_003532592.1|  PREDICTED: L-type lectin-domain containing r...    674   0.0      
ref|XP_002300009.2|  hypothetical protein POPTR_0001s29000g             672   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003608364.1|  Class I heat shock protein                         671   0.0      
gb|AES90561.2|  receptor lectin kinase                                  671   0.0      
ref|XP_003532595.2|  PREDICTED: L-type lectin-domain containing r...    662   0.0      
ref|XP_003528401.2|  PREDICTED: L-type lectin-domain containing r...    655   0.0      
ref|XP_006487681.1|  PREDICTED: L-type lectin-domain containing r...    652   0.0      
gb|EYU18393.1|  hypothetical protein MIMGU_mgv1a026214mg                647   0.0      
ref|XP_004155489.1|  PREDICTED: L-type lectin-domain containing r...    644   0.0      
gb|KGN43786.1|  hypothetical protein Csa_7G067410                       644   0.0      
ref|XP_002262748.2|  PREDICTED: L-type lectin-domain containing r...    644   0.0      Vitis vinifera
ref|XP_004155490.1|  PREDICTED: L-type lectin-domain containing r...    639   0.0      
gb|KDP35960.1|  hypothetical protein JCGZ_09932                         638   0.0      
ref|XP_006351840.1|  PREDICTED: L-type lectin-domain containing r...    637   0.0      
ref|XP_004504938.1|  PREDICTED: uncharacterized protein LOC101491058    656   0.0      
ref|XP_002518332.1|  kinase, putative                                   629   0.0      Ricinus communis
ref|XP_004137070.1|  PREDICTED: L-type lectin-domain containing r...    629   0.0      
ref|XP_008226563.1|  PREDICTED: L-type lectin-domain containing r...    628   0.0      
ref|XP_008798729.1|  PREDICTED: L-type lectin-domain containing r...    626   0.0      
gb|KDP35961.1|  hypothetical protein JCGZ_09933                         625   0.0      
ref|XP_008352687.1|  PREDICTED: L-type lectin-domain containing r...    624   0.0      
ref|XP_008455115.1|  PREDICTED: L-type lectin-domain containing r...    623   0.0      
ref|XP_002522044.1|  kinase, putative                                   619   0.0      Ricinus communis
ref|XP_002518333.1|  kinase, putative                                   620   0.0      Ricinus communis
ref|XP_006431666.1|  hypothetical protein CICLE_v10003436mg             618   0.0      
ref|XP_010027976.1|  PREDICTED: L-type lectin-domain containing r...    615   0.0      
ref|XP_004295836.1|  PREDICTED: L-type lectin-domain containing r...    616   0.0      
gb|EYU18391.1|  hypothetical protein MIMGU_mgv1a022316mg                616   0.0      
gb|KCW54632.1|  hypothetical protein EUGRSUZ_I00577                     612   0.0      
ref|XP_004137071.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...    611   0.0      
ref|XP_008351551.1|  PREDICTED: L-type lectin-domain containing r...    612   0.0      
ref|XP_007213565.1|  hypothetical protein PRUPE_ppa015760mg             611   0.0      
ref|XP_007214163.1|  hypothetical protein PRUPE_ppa018959mg             607   0.0      
gb|ADN34262.1|  putative kinase                                         607   0.0      
ref|XP_008226497.1|  PREDICTED: L-type lectin-domain containing r...    607   0.0      
ref|XP_006426233.1|  hypothetical protein CICLE_v10027393mg             606   0.0      
emb|CBI35559.3|  unnamed protein product                                606   0.0      
ref|XP_010648103.1|  PREDICTED: L-type lectin-domain containing r...    605   0.0      
ref|XP_006466572.1|  PREDICTED: L-type lectin-domain containing r...    605   0.0      
ref|XP_002310341.1|  hypothetical protein POPTR_0007s15010g             604   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008367124.1|  PREDICTED: L-type lectin-domain containing r...    604   0.0      
ref|XP_009339309.1|  PREDICTED: L-type lectin-domain containing r...    605   0.0      
ref|XP_004293018.1|  PREDICTED: L-type lectin-domain containing r...    603   0.0      
ref|XP_008383483.1|  PREDICTED: L-type lectin-domain containing r...    603   0.0      
ref|XP_007212833.1|  hypothetical protein PRUPE_ppa020749mg             602   0.0      
ref|XP_009340630.1|  PREDICTED: L-type lectin-domain containing r...    602   0.0      
ref|XP_008226559.1|  PREDICTED: L-type lectin-domain containing r...    602   0.0      
ref|XP_009339306.1|  PREDICTED: L-type lectin-domain containing r...    602   0.0      
emb|CAN70210.1|  hypothetical protein VITISV_007747                     601   0.0      Vitis vinifera
ref|XP_002265338.1|  PREDICTED: L-type lectin-domain containing r...    601   0.0      Vitis vinifera
ref|XP_009340621.1|  PREDICTED: L-type lectin-domain containing r...    600   0.0      
ref|XP_008386207.1|  PREDICTED: L-type lectin-domain containing r...    600   0.0      
ref|XP_007047726.1|  Concanavalin A-like lectin protein kinase fa...    597   0.0      
ref|XP_007212582.1|  hypothetical protein PRUPE_ppa015892mg             598   0.0      
ref|XP_010910292.1|  PREDICTED: L-type lectin-domain containing r...    597   0.0      
ref|XP_007212415.1|  hypothetical protein PRUPE_ppa016555mg             595   0.0      
ref|XP_009365634.1|  PREDICTED: L-type lectin-domain containing r...    597   0.0      
ref|XP_007206302.1|  hypothetical protein PRUPE_ppa020680mg             596   0.0      
ref|XP_002265301.1|  PREDICTED: L-type lectin-domain containing r...    595   0.0      Vitis vinifera
ref|XP_002518336.1|  kinase, putative                                   596   0.0      Ricinus communis
ref|XP_008237269.1|  PREDICTED: L-type lectin-domain containing r...    594   0.0      
ref|XP_008237618.1|  PREDICTED: L-type lectin-domain containing r...    594   0.0      
ref|XP_008392173.1|  PREDICTED: uncharacterized protein LOC103454355    612   0.0      
ref|XP_008365117.1|  PREDICTED: L-type lectin-domain containing r...    593   0.0      
ref|XP_010648102.1|  PREDICTED: L-type lectin-domain containing r...    592   0.0      
ref|XP_008226418.1|  PREDICTED: L-type lectin-domain containing r...    594   0.0      
gb|EYU18390.1|  hypothetical protein MIMGU_mgv1a022756mg                590   0.0      
ref|XP_008345115.1|  PREDICTED: L-type lectin-domain containing r...    591   0.0      
ref|XP_002264871.2|  PREDICTED: L-type lectin-domain containing r...    590   0.0      Vitis vinifera
ref|XP_010254613.1|  PREDICTED: L-type lectin-domain containing r...    587   0.0      
ref|XP_009339300.1|  PREDICTED: L-type lectin-domain containing r...    589   0.0      
ref|XP_008338483.1|  PREDICTED: L-type lectin-domain containing r...    588   0.0      
ref|XP_008245320.1|  PREDICTED: L-type lectin-domain containing r...    588   0.0      
ref|XP_011031283.1|  PREDICTED: L-type lectin-domain containing r...    586   0.0      
ref|XP_008226556.1|  PREDICTED: L-type lectin-domain containing r...    585   0.0      
ref|XP_003532589.1|  PREDICTED: L-type lectin-domain containing r...    585   0.0      
ref|XP_007156452.1|  hypothetical protein PHAVU_003G287100g             586   0.0      
ref|XP_010242792.1|  PREDICTED: L-type lectin-domain containing r...    587   0.0      
ref|XP_010646858.1|  PREDICTED: L-type lectin-domain containing r...    596   0.0      
ref|XP_009412467.1|  PREDICTED: L-type lectin-domain containing r...    585   0.0      
ref|XP_009364824.1|  PREDICTED: L-type lectin-domain containing r...    586   0.0      
ref|XP_003631707.1|  PREDICTED: L-type lectin-domain containing r...    584   0.0      
ref|XP_010273740.1|  PREDICTED: L-type lectin-domain containing r...    583   0.0      
ref|XP_010273739.1|  PREDICTED: L-type lectin-domain containing r...    583   0.0      
ref|XP_009412463.1|  PREDICTED: L-type lectin-domain containing r...    583   0.0      
gb|EYU18392.1|  hypothetical protein MIMGU_mgv1a002656mg                580   0.0      
ref|XP_010273726.1|  PREDICTED: L-type lectin-domain containing r...    582   0.0      
ref|XP_003530584.2|  PREDICTED: L-type lectin-domain containing r...    582   0.0      
ref|XP_007159175.1|  hypothetical protein PHAVU_002G215400g             580   0.0      
ref|XP_010090632.1|  L-type lectin-domain containing receptor kin...    580   0.0      
gb|KDP41147.1|  hypothetical protein JCGZ_03641                         578   0.0      
ref|XP_010096782.1|  L-type lectin-domain containing receptor kin...    581   0.0      
ref|XP_002527242.1|  kinase, putative                                   577   0.0      Ricinus communis
ref|XP_008244616.1|  PREDICTED: L-type lectin-domain containing r...    577   0.0      
ref|XP_009412464.1|  PREDICTED: L-type lectin-domain containing r...    577   0.0      
ref|XP_010273784.1|  PREDICTED: L-type lectin-domain containing r...    578   0.0      
ref|XP_008367553.1|  PREDICTED: L-type lectin-domain containing r...    577   0.0      
gb|KHN46235.1|  L-type lectin-domain containing receptor kinase IX.1    584   0.0      
ref|XP_003562911.1|  PREDICTED: L-type lectin-domain containing r...    577   0.0      
emb|CAN76415.1|  hypothetical protein VITISV_038497                     574   0.0      Vitis vinifera
ref|XP_004494968.1|  PREDICTED: L-type lectin-domain containing r...    574   0.0      
ref|XP_004301118.1|  PREDICTED: L-type lectin-domain containing r...    572   0.0      
ref|XP_003551295.1|  PREDICTED: L-type lectin-domain containing r...    572   0.0      
ref|XP_007148345.1|  hypothetical protein PHAVU_006G200500g             571   0.0      
ref|XP_010265513.1|  PREDICTED: L-type lectin-domain containing r...    572   0.0      
gb|KCW59671.1|  hypothetical protein EUGRSUZ_H02425                     570   0.0      
ref|XP_004958075.1|  PREDICTED: L-type lectin-domain containing r...    572   0.0      
ref|XP_009412945.1|  PREDICTED: L-type lectin-domain containing r...    572   0.0      
ref|XP_010026583.1|  PREDICTED: L-type lectin-domain containing r...    570   0.0      
ref|XP_010068312.1|  PREDICTED: L-type lectin-domain containing r...    569   0.0      
gb|EMS67946.1|  L-type lectin-domain containing receptor kinase IX.1    570   0.0      
dbj|BAC79695.1|  putative lectin-like protein kinase                    569   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009605385.1|  PREDICTED: L-type lectin-domain containing r...    567   0.0      
ref|XP_003608367.1|  Lectin receptor-like kinase Tg-20                  568   0.0      
gb|KDP41155.1|  hypothetical protein JCGZ_03649                         567   0.0      
ref|XP_002527230.1|  kinase, putative                                   568   0.0      Ricinus communis
ref|XP_004134270.1|  PREDICTED: L-type lectin-domain containing r...    568   0.0      
ref|XP_008670494.1|  PREDICTED: L-type lectin-domain containing r...    568   0.0      
ref|XP_007214191.1|  hypothetical protein PRUPE_ppa021403mg             568   0.0      
ref|XP_010026577.1|  PREDICTED: L-type lectin-domain containing r...    566   0.0      
ref|XP_006364032.1|  PREDICTED: L-type lectin-domain containing r...    566   0.0      
ref|XP_006856583.1|  hypothetical protein AMTR_s00046p00199100          567   0.0      
ref|XP_010668420.1|  PREDICTED: L-type lectin-domain containing r...    567   0.0      
ref|XP_010026585.1|  PREDICTED: L-type lectin-domain containing r...    565   0.0      
ref|XP_007211329.1|  hypothetical protein PRUPE_ppa022345mg             566   0.0      
ref|XP_010254612.1|  PREDICTED: L-type lectin-domain containing r...    568   0.0      
ref|XP_008386331.1|  PREDICTED: L-type lectin-domain containing r...    566   0.0      
ref|XP_009772390.1|  PREDICTED: L-type lectin-domain containing r...    564   0.0      
gb|AES82675.2|  concanavalin A-like lectin kinase family protein,...    564   0.0      
ref|XP_008450172.1|  PREDICTED: L-type lectin-domain containing r...    565   0.0      
ref|XP_010099408.1|  L-type lectin-domain containing receptor kin...    563   0.0      
ref|XP_011028142.1|  PREDICTED: L-type lectin-domain containing r...    563   0.0      
ref|XP_007214100.1|  hypothetical protein PRUPE_ppa015941mg             563   0.0      
ref|XP_010273782.1|  PREDICTED: L-type lectin-domain containing r...    565   0.0      
ref|XP_004234636.1|  PREDICTED: L-type lectin-domain containing r...    563   0.0      
ref|XP_003628872.1|  Lectin receptor-like kinase Tg-20                  563   0.0      
gb|KCW59667.1|  hypothetical protein EUGRSUZ_H02420                     560   0.0      
ref|XP_004289510.1|  PREDICTED: L-type lectin-domain containing r...    563   0.0      
gb|KEH24603.1|  lectin receptor kinase                                  562   0.0      
ref|XP_004155273.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...    562   0.0      
ref|XP_007047725.1|  Concanavalin A-like lectin protein kinase fa...    561   0.0      
ref|XP_009412465.1|  PREDICTED: L-type lectin-domain containing r...    558   0.0      
ref|XP_010026580.1|  PREDICTED: L-type lectin-domain containing r...    560   0.0      
gb|KCW59668.1|  hypothetical protein EUGRSUZ_H02421                     558   0.0      
ref|XP_010273743.1|  PREDICTED: L-type lectin-domain containing r...    561   0.0      
ref|XP_010026581.1|  PREDICTED: L-type lectin-domain containing r...    559   0.0      
emb|CAN64356.1|  hypothetical protein VITISV_020633                     591   0.0      Vitis vinifera
ref|XP_010054304.1|  PREDICTED: L-type lectin-domain containing r...    560   0.0      
ref|XP_004295778.1|  PREDICTED: L-type lectin-domain containing r...    564   0.0      
ref|XP_009371363.1|  PREDICTED: L-type lectin-domain containing r...    556   0.0      
gb|KCW76070.1|  hypothetical protein EUGRSUZ_D00438                     557   0.0      
ref|XP_010695030.1|  PREDICTED: L-type lectin-domain containing r...    560   0.0      
ref|XP_011012057.1|  PREDICTED: L-type lectin-domain containing r...    557   0.0      
ref|XP_006657862.1|  PREDICTED: L-type lectin-domain containing r...    558   0.0      
ref|XP_010054306.1|  PREDICTED: L-type lectin-domain containing r...    558   0.0      
ref|XP_007211327.1|  hypothetical protein PRUPE_ppa024926mg             557   0.0      
ref|XP_008352704.1|  PREDICTED: L-type lectin-domain containing r...    558   0.0      
ref|XP_003528400.2|  PREDICTED: L-type lectin-domain containing r...    558   0.0      
ref|XP_008226465.1|  PREDICTED: L-type lectin-domain containing r...    557   0.0      
gb|KCW59665.1|  hypothetical protein EUGRSUZ_H02418                     555   0.0      
gb|EAZ40356.1|  hypothetical protein OsJ_24802                          564   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010023419.1|  PREDICTED: L-type lectin-domain containing r...    555   0.0      
ref|XP_007047724.1|  Concanavalin A-like lectin protein kinase fa...    555   0.0      
ref|XP_011031284.1|  PREDICTED: L-type lectin-domain containing r...    554   0.0      
ref|XP_002304348.2|  hypothetical protein POPTR_0003s09340g             555   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007214773.1|  hypothetical protein PRUPE_ppa023993mg             554   0.0      
ref|XP_010255179.1|  PREDICTED: L-type lectin-domain containing r...    555   0.0      
ref|XP_003608369.1|  Heat shock protein 17a.17                          558   0.0      
ref|XP_007047716.1|  Concanavalin A-like lectin protein kinase fa...    553   0.0      
emb|CAN70208.1|  hypothetical protein VITISV_007745                     550   0.0      Vitis vinifera
ref|XP_006380831.1|  hypothetical protein POPTR_0007s14980g             551   0.0      
ref|XP_011073633.1|  PREDICTED: L-type lectin-domain containing r...    550   0.0      
gb|KDP35962.1|  hypothetical protein JCGZ_09934                         547   0.0      
gb|KCW76071.1|  hypothetical protein EUGRSUZ_D00439                     551   0.0      
ref|XP_009144293.1|  PREDICTED: L-type lectin-domain containing r...    550   0.0      
gb|KEH20097.1|  L-type lectin-domain receptor kinase IX.1               551   0.0      
ref|XP_011073632.1|  PREDICTED: L-type lectin-domain containing r...    551   0.0      
ref|XP_004504942.1|  PREDICTED: L-type lectin-domain containing r...    549   0.0      
ref|XP_010052170.1|  PREDICTED: L-type lectin-domain containing r...    550   0.0      
ref|XP_003541778.2|  PREDICTED: L-type lectin-domain containing r...    554   0.0      
ref|XP_007047722.1|  Concanavalin A-like lectin protein kinase fa...    548   0.0      
ref|XP_003628861.1|  Cysteine-rich receptor-like protein kinase         548   0.0      
ref|XP_008811470.1|  PREDICTED: L-type lectin-domain containing r...    549   0.0      
ref|XP_010054312.1|  PREDICTED: L-type lectin-domain containing r...    548   0.0      
ref|XP_004509794.1|  PREDICTED: L-type lectin-domain containing r...    547   0.0      
ref|XP_003608363.1|  Lectin-domain containing receptor kinase A4.1      547   0.0      
ref|XP_003628854.1|  Cysteine-rich receptor-like protein kinase         546   0.0      
ref|XP_010093477.1|  L-type lectin-domain containing receptor kin...    546   0.0      
ref|XP_010090631.1|  L-type lectin-domain containing receptor kin...    545   0.0      
ref|XP_007047721.1|  Concanavalin A-like lectin protein kinase fa...    545   0.0      
ref|XP_003628848.1|  Wall-associated receptor kinase-like protein       544   0.0      
emb|CAN80079.1|  hypothetical protein VITISV_041810                     545   0.0      Vitis vinifera
ref|XP_006856580.1|  hypothetical protein AMTR_s00046p00196890          545   0.0      
ref|XP_006584952.1|  PREDICTED: L-type lectin-domain containing r...    545   0.0      
ref|XP_003532593.1|  PREDICTED: L-type lectin-domain containing r...    545   0.0      
ref|XP_003532594.1|  PREDICTED: L-type lectin-domain containing r...    544   0.0      
ref|XP_008363633.1|  PREDICTED: L-type lectin-domain containing r...    543   2e-180   
ref|XP_006380832.1|  hypothetical protein POPTR_0007s15000g             539   5e-180   
ref|XP_008226463.1|  PREDICTED: L-type lectin-domain containing r...    542   6e-180   
ref|XP_002527233.1|  kinase, putative                                   540   6e-180   Ricinus communis
ref|XP_003628853.1|  Lectin-domain containing receptor kinase A4.2      539   2e-179   
ref|XP_007206505.1|  hypothetical protein PRUPE_ppa019242mg             541   2e-179   
ref|XP_007047720.1|  Concanavalin A-like lectin protein kinase fa...    544   3e-179   
ref|XP_004509713.1|  PREDICTED: L-type lectin-domain containing r...    538   4e-179   
ref|XP_002310340.2|  hypothetical protein POPTR_0007s14990g             538   6e-179   Populus trichocarpa [western balsam poplar]
ref|XP_004292023.1|  PREDICTED: L-type lectin-domain containing r...    548   6e-179   
ref|XP_010052163.1|  PREDICTED: L-type lectin-domain containing r...    538   2e-178   
ref|XP_008459178.1|  PREDICTED: L-type lectin-domain containing r...    536   2e-178   
ref|XP_010065734.1|  PREDICTED: L-type lectin-domain containing r...    536   4e-178   
ref|XP_004148108.1|  PREDICTED: L-type lectin-domain containing r...    535   6e-178   
ref|XP_008459179.1|  PREDICTED: L-type lectin-domain containing r...    535   7e-178   
ref|XP_010919002.1|  PREDICTED: L-type lectin-domain containing r...    535   1e-177   
ref|XP_009420627.1|  PREDICTED: L-type lectin-domain containing r...    535   1e-177   
gb|KCW63377.1|  hypothetical protein EUGRSUZ_G01016                     533   3e-177   
ref|XP_009131168.1|  PREDICTED: L-type lectin-domain containing r...    533   3e-177   
ref|XP_010905487.1|  PREDICTED: L-type lectin-domain containing r...    535   3e-177   
gb|ACL53102.1|  unknown                                                 534   5e-177   Zea mays [maize]
ref|XP_006856581.1|  hypothetical protein AMTR_s00046p00197110          533   8e-177   
gb|EYU41346.1|  hypothetical protein MIMGU_mgv1a020039mg                532   9e-177   
gb|AFW84902.1|  LOW QUALITY PROTEIN: putative lectin-domain recep...    534   9e-177   
ref|XP_010232431.1|  PREDICTED: L-type lectin-domain containing r...    533   1e-176   
ref|XP_002527235.1|  kinase, putative                                   531   1e-176   Ricinus communis
ref|XP_006466350.1|  PREDICTED: L-type lectin-domain containing r...    531   2e-176   
ref|XP_003608360.1|  Receptor-like protein kinase                       531   3e-176   
ref|XP_006856579.1|  hypothetical protein AMTR_s00046p00196610          531   3e-176   
ref|XP_010518988.1|  PREDICTED: L-type lectin-domain containing r...    530   4e-176   
ref|NP_001147903.1|  protein kinase                                     532   6e-176   Zea mays [maize]
gb|KCW63383.1|  hypothetical protein EUGRSUZ_G01024                     527   6e-176   
emb|CDY10744.1|  BnaA05g11920D                                          528   6e-176   
ref|XP_006426230.1|  hypothetical protein CICLE_v10027339mg             528   4e-175   
ref|XP_004970179.1|  PREDICTED: L-type lectin-domain containing r...    528   4e-175   
ref|XP_010273724.1|  PREDICTED: L-type lectin-domain containing r...    529   5e-175   
ref|XP_006426232.1|  hypothetical protein CICLE_v10027177mg             528   5e-175   
ref|XP_008459183.1|  PREDICTED: L-type lectin-domain containing r...    527   7e-175   
gb|KHN33572.1|  L-type lectin-domain containing receptor kinase IX.1    527   9e-175   
dbj|BAK02100.1|  predicted protein                                      528   1e-174   
gb|KCW63380.1|  hypothetical protein EUGRSUZ_G01019                     527   1e-174   
gb|KGN63413.1|  hypothetical protein Csa_2G439210                       526   1e-174   
ref|XP_004148084.1|  PREDICTED: L-type lectin-domain containing r...    526   2e-174   
gb|KCW76079.1|  hypothetical protein EUGRSUZ_D00454                     524   2e-174   
ref|XP_010519030.1|  PREDICTED: L-type lectin-domain containing r...    526   3e-174   
ref|XP_010905481.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...    526   3e-174   
gb|KCW63373.1|  hypothetical protein EUGRSUZ_G01009                     525   8e-174   
ref|XP_002456443.1|  hypothetical protein SORBIDRAFT_03g036370          525   9e-174   Sorghum bicolor [broomcorn]
ref|XP_010068308.1|  PREDICTED: L-type lectin-domain containing r...    522   2e-173   
gb|KDP32174.1|  hypothetical protein JCGZ_12635                         523   2e-173   
ref|XP_004156774.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...    523   2e-173   
gb|KGN63406.1|  hypothetical protein Csa_2G439150                       523   4e-173   
gb|EMS45957.1|  L-type lectin-domain containing receptor kinase IX.1    522   8e-173   
ref|XP_010068305.1|  PREDICTED: L-type lectin-domain containing r...    524   8e-173   
ref|XP_004172477.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...    522   1e-172   
emb|CDM84469.1|  unnamed protein product                                522   1e-172   
gb|KEH31198.1|  L-type lectin-domain receptor kinase                    519   1e-172   
emb|CDP02693.1|  unnamed protein product                                521   1e-172   
ref|XP_010905486.1|  PREDICTED: L-type lectin-domain containing r...    526   1e-172   
gb|AAZ66951.1|  117M18_32                                               520   2e-172   Brassica rapa
ref|XP_002518350.1|  kinase, putative                                   521   2e-172   Ricinus communis
ref|XP_004148110.1|  PREDICTED: L-type lectin-domain containing r...    521   3e-172   
emb|CDX83879.1|  BnaC08g17660D                                          518   7e-172   
gb|EMT05205.1|  Lectin-domain containing receptor kinase A4.3           520   1e-171   
gb|AET03326.2|  L-type lectin-domain receptor kinase IX.1               520   1e-171   
ref|XP_003628850.1|  Lectin-domain containing receptor kinase A4.2      518   3e-171   
ref|XP_007159169.1|  hypothetical protein PHAVU_002G214900g             519   3e-171   
ref|XP_010054310.1|  PREDICTED: L-type lectin-domain containing r...    515   4e-171   
ref|XP_007042786.1|  Concanavalin A lectin protein kinase family ...    518   5e-171   
ref|XP_010519056.1|  PREDICTED: L-type lectin-domain containing r...    516   1e-170   
gb|KCW63375.1|  hypothetical protein EUGRSUZ_G01011                     514   2e-170   
ref|XP_006289807.1|  hypothetical protein CARUB_v10003411mg             516   2e-170   
ref|XP_009418911.1|  PREDICTED: L-type lectin-domain containing r...    517   3e-170   
gb|KDP37609.1|  hypothetical protein JCGZ_06952                         511   4e-170   
gb|KDP41161.1|  hypothetical protein JCGZ_03655                         515   4e-170   
ref|XP_008459177.1|  PREDICTED: L-type lectin-domain containing r...    515   5e-170   
ref|XP_010491728.1|  PREDICTED: L-type lectin-domain containing r...    514   6e-170   
ref|XP_002873464.1|  hypothetical protein ARALYDRAFT_909009             514   6e-170   
ref|NP_196615.1|  L-type lectin-domain containing receptor kinase...    514   8e-170   
emb|CAN78671.1|  hypothetical protein VITISV_009245                     513   2e-169   
gb|EYU41342.1|  hypothetical protein MIMGU_mgv1a024299mg                513   2e-169   
ref|XP_010491726.1|  PREDICTED: L-type lectin-domain containing r...    513   2e-169   
ref|XP_010453082.1|  PREDICTED: L-type lectin-domain containing r...    513   2e-169   
ref|NP_001044432.1|  Os01g0779300                                       514   2e-169   
ref|XP_004136901.1|  PREDICTED: L-type lectin-domain containing r...    514   2e-169   
ref|XP_004155429.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...    514   3e-169   
ref|XP_009418794.1|  PREDICTED: L-type lectin-domain containing r...    516   3e-169   
ref|XP_007042789.1|  Concanavalin A lectin protein kinase family ...    511   5e-169   
ref|XP_008779645.1|  PREDICTED: L-type lectin-domain containing r...    511   5e-169   
gb|EYU41344.1|  hypothetical protein MIMGU_mgv1a017960mg                512   6e-169   
ref|XP_004136900.1|  PREDICTED: L-type lectin-domain containing r...    513   1e-168   
ref|XP_010040314.1|  PREDICTED: L-type lectin-domain containing r...    509   2e-168   
gb|AET03324.2|  lectin receptor kinase                                  509   2e-168   
ref|XP_009339308.1|  PREDICTED: L-type lectin-domain containing r...    514   2e-168   
ref|XP_010474348.1|  PREDICTED: L-type lectin-domain containing r...    510   4e-168   
ref|XP_006281670.1|  hypothetical protein CARUB_v10027807mg             508   4e-168   
ref|XP_007021026.1|  Concanavalin A lectin protein kinase family ...    509   6e-168   
ref|XP_009125293.1|  PREDICTED: L-type lectin-domain containing r...    508   3e-167   
ref|XP_010054301.1|  PREDICTED: L-type lectin-domain containing r...    505   3e-167   
emb|CAN70209.1|  hypothetical protein VITISV_007746                     505   3e-167   
gb|KCW76068.1|  hypothetical protein EUGRSUZ_D00436                     504   5e-167   
ref|XP_008811475.1|  PREDICTED: L-type lectin-domain containing r...    509   5e-167   
ref|XP_006661134.1|  PREDICTED: L-type lectin-domain containing r...    507   8e-167   
ref|XP_010905484.1|  PREDICTED: L-type lectin-domain containing r...    508   9e-167   
ref|XP_010689135.1|  PREDICTED: L-type lectin-domain containing r...    506   1e-166   
ref|XP_008811472.1|  PREDICTED: uncharacterized protein LOC103722629    526   2e-166   
gb|KCW63366.1|  hypothetical protein EUGRSUZ_G01001                     504   2e-166   
gb|KGN43778.1|  hypothetical protein Csa_7G066840                       505   5e-166   
ref|XP_010519047.1|  PREDICTED: L-type lectin-domain containing r...    504   6e-166   
ref|XP_008777396.1|  PREDICTED: L-type lectin-domain containing r...    505   6e-166   
ref|NP_001183366.1|  uncharacterized LOC100501776 precursor             505   1e-165   
ref|XP_004504940.1|  PREDICTED: L-type lectin-domain containing r...    508   5e-165   
ref|XP_010068309.1|  PREDICTED: L-type lectin-domain containing r...    499   1e-164   
ref|XP_002864299.1|  hypothetical protein ARALYDRAFT_331749             499   2e-164   
ref|XP_010446208.1|  PREDICTED: L-type lectin-domain containing r...    499   3e-164   
ref|XP_010689174.1|  PREDICTED: L-type lectin-domain containing r...    499   5e-164   
ref|XP_010689175.1|  PREDICTED: L-type lectin-domain containing r...    499   6e-164   
ref|XP_010068306.1|  PREDICTED: L-type lectin-domain containing r...    500   1e-163   
gb|ADN34266.1|  putative kinase                                         499   1e-163   
ref|XP_010905474.1|  PREDICTED: L-type lectin-domain containing r...    498   2e-163   
ref|XP_010065736.1|  PREDICTED: L-type lectin-domain containing r...    500   2e-163   
ref|XP_010256288.1|  PREDICTED: L-type lectin-domain containing r...    499   3e-163   
ref|XP_006399551.1|  hypothetical protein EUTSA_v10012947mg             497   3e-163   
ref|XP_008455117.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...    499   4e-163   
ref|XP_008244617.1|  PREDICTED: L-type lectin-domain containing r...    492   5e-163   
gb|KGN63414.1|  hypothetical protein Csa_2G439220                       493   3e-162   
ref|XP_010519018.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...    494   3e-162   
ref|XP_008777395.1|  PREDICTED: L-type lectin-domain containing r...    500   4e-162   
ref|XP_006584953.1|  PREDICTED: L-type lectin-domain containing r...    494   1e-161   
gb|KFK44812.1|  hypothetical protein AALP_AA1G306000                    490   2e-161   
ref|XP_002527232.1|  kinase, putative                                   489   6e-161   
ref|XP_007042795.1|  Concanavalin A-like lectin protein kinase fa...    493   6e-161   
emb|CAN64986.1|  hypothetical protein VITISV_035640                     490   6e-161   
gb|KCW76069.1|  hypothetical protein EUGRSUZ_D00437                     492   7e-161   
gb|KEH24604.1|  lectin receptor kinase                                  489   7e-161   
emb|CDY40104.1|  BnaC02g00260D                                          491   7e-161   
gb|KCW63376.1|  hypothetical protein EUGRSUZ_G01015                     489   1e-160   
ref|XP_010905344.1|  PREDICTED: L-type lectin-domain containing r...    489   7e-160   
gb|KDP41152.1|  hypothetical protein JCGZ_03646                         487   1e-159   
ref|XP_007042788.1|  Concanavalin A lectin protein kinase family ...    484   1e-159   
gb|EEE67970.1|  hypothetical protein OsJ_25877                          488   7e-159   
ref|XP_008377506.1|  PREDICTED: L-type lectin-domain containing r...    482   1e-157   
dbj|BAD09243.1|  putative receptor-type protein kinase LRK1             484   1e-157   
gb|AGT16631.1|  hypothetical protein SHCRBa_265_I24_R_60                485   1e-157   
ref|XP_003608361.1|  Receptor-like protein kinase                       482   2e-157   
ref|XP_008377505.1|  PREDICTED: L-type lectin-domain containing r...    481   3e-157   
gb|EYU41345.1|  hypothetical protein MIMGU_mgv1a026022mg                481   3e-157   
ref|XP_002527231.1|  kinase, putative                                   480   5e-157   
ref|XP_007159174.1|  hypothetical protein PHAVU_002G215300g             479   6e-156   
ref|XP_003560058.1|  PREDICTED: L-type lectin-domain containing r...    482   7e-156   
gb|EEC82842.1|  hypothetical protein OsI_27654                          479   1e-155   
ref|XP_007159173.1|  hypothetical protein PHAVU_002G215200g             477   1e-155   
ref|XP_006659079.1|  PREDICTED: L-type lectin-domain containing r...    478   2e-155   
gb|EAZ05441.1|  hypothetical protein OsI_27655                          477   3e-155   
ref|XP_002298811.2|  hypothetical protein POPTR_0001s29090g             478   1e-154   
ref|XP_006302010.1|  hypothetical protein CARUB_v10019987mg             474   1e-154   
ref|XP_007148350.1|  hypothetical protein PHAVU_006G200800g             474   1e-154   
ref|XP_006281940.1|  hypothetical protein CARUB_v10028148mg             475   1e-154   
ref|XP_007042797.1|  Kinase, putative                                   476   2e-154   
ref|XP_010905329.1|  PREDICTED: L-type lectin-domain containing r...    475   3e-154   
dbj|BAK02902.1|  predicted protein                                      476   3e-154   
gb|KDO36791.1|  hypothetical protein CISIN_1g038118mg                   464   4e-154   
ref|XP_002866681.1|  predicted protein                                  473   2e-153   
ref|XP_010026576.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...    471   4e-153   
ref|NP_001060891.1|  Os08g0124500                                       472   5e-153   
ref|XP_010453084.1|  PREDICTED: L-type lectin-domain containing r...    468   2e-152   
ref|XP_010315489.1|  PREDICTED: L-type lectin-domain containing r...    469   3e-152   
emb|CBI35556.3|  unnamed protein product                                465   3e-152   
ref|XP_009363431.1|  PREDICTED: L-type lectin-domain containing r...    466   4e-152   
gb|KGN43788.1|  hypothetical protein Csa_7G067430                       470   5e-152   
ref|XP_003563144.1|  PREDICTED: L-type lectin-domain containing r...    470   6e-152   
ref|XP_004137072.1|  PREDICTED: L-type lectin-domain containing r...    470   7e-152   
gb|EAY76046.1|  hypothetical protein OsI_03974                          464   8e-151   
ref|XP_004504941.1|  PREDICTED: L-type lectin-domain containing r...    466   1e-150   
ref|XP_008374817.1|  PREDICTED: L-type lectin-domain containing r...    463   2e-150   
emb|CDX96258.1|  BnaC02g13930D                                          461   2e-150   
ref|XP_009359180.1|  PREDICTED: L-type lectin-domain containing r...    464   4e-150   
gb|KDP35963.1|  hypothetical protein JCGZ_09935                         463   7e-150   
ref|XP_010491730.1|  PREDICTED: L-type lectin-domain containing r...    460   9e-150   
ref|XP_008377767.1|  PREDICTED: L-type lectin-domain containing r...    462   1e-149   
ref|XP_010453085.1|  PREDICTED: L-type lectin-domain containing r...    461   1e-149   
gb|EMT32089.1|  Lectin-domain containing receptor kinase A4.2           464   2e-149   
ref|XP_009781157.1|  PREDICTED: L-type lectin-domain containing r...    464   2e-149   
ref|XP_010491729.1|  PREDICTED: L-type lectin-domain containing r...    460   2e-149   
ref|XP_003571340.1|  PREDICTED: L-type lectin-domain containing r...    462   4e-149   
dbj|BAD09250.1|  putative receptor-type protein kinase LRK1             462   4e-149   
ref|XP_003576432.2|  PREDICTED: L-type lectin-domain containing r...    463   4e-149   
ref|NP_201363.1|  concanavalin A-like lectin kinase-like protein        459   4e-148   
ref|XP_009359175.1|  PREDICTED: L-type lectin-domain containing r...    456   5e-148   
ref|XP_008793992.1|  PREDICTED: L-type lectin-domain containing r...    458   7e-148   
gb|EMT06702.1|  Lectin-domain containing receptor kinase A4.3           460   1e-147   
ref|XP_007008873.1|  Concanavalin A-like lectin protein kinase fa...    454   1e-147   
emb|CDX85755.1|  BnaA02g00580D                                          453   2e-147   
ref|XP_010927449.1|  PREDICTED: L-type lectin-domain containing r...    457   2e-147   
gb|EAZ41364.1|  hypothetical protein OsJ_25879                          458   6e-147   
ref|XP_008361117.1|  PREDICTED: L-type lectin-domain containing r...    446   7e-147   
ref|XP_009359097.1|  PREDICTED: L-type lectin-domain containing r...    455   8e-147   
ref|XP_010927448.1|  PREDICTED: L-type lectin-domain containing r...    454   2e-146   
ref|XP_002438637.1|  hypothetical protein SORBIDRAFT_10g023375          452   2e-146   
ref|XP_004308346.1|  PREDICTED: L-type lectin-domain containing r...    453   4e-146   
ref|XP_010042596.1|  PREDICTED: L-type lectin-domain containing r...    454   6e-146   
ref|XP_009359136.1|  PREDICTED: L-type lectin-domain containing r...    453   6e-146   
ref|XP_009589837.1|  PREDICTED: L-type lectin-domain containing r...    454   7e-146   
gb|KHN46239.1|  L-type lectin-domain containing receptor kinase IX.1    442   9e-146   
ref|XP_006659078.1|  PREDICTED: L-type lectin-domain containing r...    454   1e-145   
ref|XP_009359176.1|  PREDICTED: L-type lectin-domain containing r...    454   2e-145   
ref|XP_007199282.1|  hypothetical protein PRUPE_ppa022890mg             449   3e-145   
ref|XP_008811466.1|  PREDICTED: LOW QUALITY PROTEIN: L-type lecti...    446   3e-145   
gb|EAZ41358.1|  hypothetical protein OsJ_25872                          449   5e-145   
ref|XP_004516659.1|  PREDICTED: L-type lectin-domain containing r...    439   2e-144   
ref|NP_001060889.1|  Os08g0124000                                       451   2e-144   
ref|XP_006394009.1|  hypothetical protein EUTSA_v10003759mg             449   2e-144   
ref|XP_008236668.1|  PREDICTED: L-type lectin-domain containing r...    449   2e-144   
ref|XP_010265512.1|  PREDICTED: L-type lectin-domain containing r...    447   3e-144   
dbj|BAD10609.1|  putative receptor kinase Lecrk                         451   3e-144   
dbj|BAK06746.1|  predicted protein                                      450   4e-144   
emb|CDX70354.1|  BnaC03g04380D                                          446   6e-144   
gb|EAZ05439.1|  hypothetical protein OsI_27653                          449   7e-144   
ref|XP_010446215.1|  PREDICTED: L-type lectin-domain containing r...    445   1e-143   
ref|XP_008367585.1|  PREDICTED: L-type lectin-domain containing r...    436   2e-143   
ref|XP_004516072.1|  PREDICTED: L-type lectin-domain containing r...    437   2e-143   
emb|CDX78388.1|  BnaA03g03000D                                          444   3e-143   
emb|CDY14007.1|  BnaC09g38190D                                          442   3e-143   
ref|XP_010463402.1|  PREDICTED: L-type lectin-domain containing r...    445   5e-143   
gb|KCW90446.1|  hypothetical protein EUGRSUZ_A02576                     444   8e-143   
ref|XP_010024537.1|  PREDICTED: L-type lectin-domain containing r...    444   1e-142   
gb|EEE67968.1|  hypothetical protein OsJ_25875                          451   1e-142   
gb|KCW76072.1|  hypothetical protein EUGRSUZ_D00441                     433   1e-142   
ref|XP_009359178.1|  PREDICTED: L-type lectin-domain containing r...    444   2e-142   
ref|XP_002524065.1|  kinase, putative                                   443   2e-142   
ref|XP_004516073.1|  PREDICTED: L-type lectin-domain containing r...    434   3e-142   
ref|XP_004308350.1|  PREDICTED: L-type lectin-domain containing r...    442   5e-142   
emb|CDX92524.1|  BnaA10g15630D                                          441   5e-142   
ref|XP_009341310.1|  PREDICTED: L-type lectin-domain containing r...    447   2e-141   
ref|XP_003550213.1|  PREDICTED: L-type lectin-domain containing r...    439   1e-140   
ref|XP_010054305.1|  PREDICTED: L-type lectin-domain containing r...    436   2e-140   
ref|XP_010905330.1|  PREDICTED: L-type lectin-domain containing r...    437   3e-140   
gb|EEE67966.1|  hypothetical protein OsJ_25873                          437   4e-140   
dbj|BAD09249.1|  putative receptor-type protein kinase LRK1             438   5e-140   
gb|EMT26325.1|  Lectin-domain containing receptor kinase A4.2           443   6e-140   
ref|XP_008669555.1|  PREDICTED: L-type lectin-domain containing r...    440   7e-140   
gb|EMS66709.1|  L-type lectin-domain containing receptor kinase IX.1    439   2e-139   
ref|XP_003588877.1|  Lectin-like receptor kinase                        436   3e-139   
ref|XP_004975217.1|  PREDICTED: L-type lectin-domain containing r...    437   3e-139   
ref|XP_004968918.1|  PREDICTED: L-type lectin-domain containing r...    437   4e-139   
ref|XP_010518996.1|  PREDICTED: L-type lectin-domain containing r...    428   5e-139   
gb|EMT13949.1|  Lectin-domain containing receptor kinase A4.2           455   5e-139   
ref|XP_006596638.1|  PREDICTED: L-type lectin-domain containing r...    434   5e-139   
ref|XP_008646273.1|  PREDICTED: L-type lectin-domain containing r...    422   1e-138   
ref|XP_008661993.1|  PREDICTED: L-type lectin-domain containing r...    434   2e-138   
ref|XP_006659080.1|  PREDICTED: L-type lectin-domain containing r...    436   2e-138   
ref|XP_010244705.1|  PREDICTED: L-type lectin-domain containing r...    428   3e-138   
ref|XP_008379240.1|  PREDICTED: L-type lectin-domain containing r...    429   5e-138   
gb|KHN37076.1|  L-type lectin-domain containing receptor kinase IX.1    432   6e-138   
gb|EMS66706.1|  L-type lectin-domain containing receptor kinase IX.1    449   1e-137   
ref|XP_010244704.1|  PREDICTED: L-type lectin-domain containing r...    427   1e-137   
ref|XP_010069045.1|  PREDICTED: L-type lectin-domain containing r...    431   1e-137   
gb|EEE67440.1|  hypothetical protein OsJ_24804                          428   4e-137   
dbj|BAJ85196.1|  predicted protein                                      432   4e-137   
ref|NP_001060041.1|  Os07g0569800                                       427   5e-137   
ref|NP_001060894.1|  Os08g0125200                                       426   5e-137   
ref|XP_010025806.1|  PREDICTED: L-type lectin-domain containing r...    434   5e-137   
ref|XP_009150650.1|  PREDICTED: L-type lectin-domain containing r...    430   7e-137   
ref|XP_004504939.1|  PREDICTED: L-type lectin-domain containing r...    428   9e-137   
ref|XP_006596640.1|  PREDICTED: L-type lectin-domain containing r...    429   1e-136   
gb|EAZ41363.1|  hypothetical protein OsJ_25878                          429   1e-136   
ref|XP_007161076.1|  hypothetical protein PHAVU_001G040800g             427   2e-136   
gb|EAY83835.1|  hypothetical protein OsI_39052                          428   4e-136   
gb|KHN04262.1|  L-type lectin-domain containing receptor kinase IX.1    427   4e-136   
ref|XP_006664179.1|  PREDICTED: L-type lectin-domain containing r...    429   5e-136   
ref|XP_010025804.1|  PREDICTED: L-type lectin-domain containing r...    427   5e-136   
gb|EMT01122.1|  Lectin-domain containing receptor kinase A4.2           429   5e-136   
gb|EEE53578.1|  hypothetical protein OsJ_36818                          416   9e-136   
gb|EMT30055.1|  Cysteine-rich receptor-like protein kinase 25           427   1e-135   
ref|XP_003579168.1|  PREDICTED: L-type lectin-domain containing r...    427   3e-135   
gb|KCW76075.1|  hypothetical protein EUGRSUZ_D00447                     412   3e-135   
ref|XP_002465761.1|  hypothetical protein SORBIDRAFT_01g045360          425   4e-135   
ref|NP_001067236.1|  Os12g0608500                                       426   5e-135   
ref|NP_001235240.1|  lectin-like receptor kinase                        432   6e-135   
ref|NP_001067239.1|  Os12g0608900                                       425   7e-135   
ref|XP_006596643.1|  PREDICTED: L-type lectin-domain containing r...    423   9e-135   
gb|EAY73912.1|  hypothetical protein OsI_01797                          424   3e-134   
gb|EMT05743.1|  Cysteine-rich receptor-like protein kinase 25           422   8e-134   
ref|XP_010025808.1|  PREDICTED: L-type lectin-domain containing r...    422   8e-134   
ref|XP_007161073.1|  hypothetical protein PHAVU_001G040500g             421   1e-133   
gb|EMT01989.1|  Cysteine-rich receptor-like protein kinase 25           422   2e-133   
gb|KHN04263.1|  L-type lectin-domain containing receptor kinase IX.1    418   3e-133   
ref|XP_007161071.1|  hypothetical protein PHAVU_001G040300g             419   5e-133   
gb|EEC69645.1|  hypothetical protein OsI_39046                          420   7e-133   
gb|KHN15007.1|  L-type lectin-domain containing receptor kinase IX.1    418   9e-133   
gb|KEH20098.1|  lectin receptor kinase                                  416   1e-132   



>ref|XP_009770446.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Nicotiana sylvestris]
Length=679

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/637 (60%), Positives = 457/637 (72%), Gaps = 34/637 (5%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSL-VNNSIQITPNQRN-----CIGRATYSEPL  192
             I P    LSFNFD F PS+ QN+T+ER +   + +IQ+T +  N      IGRATYS+PL
Sbjct  19    ITPFATSLSFNFDSFRPSD-QNVTYERDAYPADGAIQLTIDLINRHVNASIGRATYSKPL  77

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
             HLWDK +G ++ F+THF+F I+S G  +YGDG AFFLAP GSR P N T+GG  GL ++ 
Sbjct  78    HLWDKASGNVTDFSTHFSFSINSKGRTRYGDGLAFFLAPSGSRTPENTTRGGSLGLTSNT  137

Query  373   ERLN-SSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWIN  546
             +RLN SSN FVAVEFD Y N  YD +  HVGID++S+QSVV   W   I  G  ++AWI+
Sbjct  138   QRLNTSSNHFVAVEFDTYQNVQYDPKGDHVGIDINSMQSVVNVTWFSSIPNGRRTDAWIS  197

Query  547   YDPRSMNLSVVFRNFGSYGHV------SYILDLRKYLPERVTFGFAGATGKDTALQMINS  708
             Y+  S NL+VVF  F     V      S+ LDLR+YLPE VTFGF G  G   ALQ I S
Sbjct  198   YNSTSKNLTVVFTGFKDNSTVTVLQSLSHNLDLREYLPEWVTFGFTGGAGLVFALQSIYS  257

Query  709   WIFTSALDISEN--------------QADTKSTgkglviglvvggcfliggS-MAFSFLA  843
             W FTS+L++++N               A +K+    +V  +  G   +     M F+F  
Sbjct  258   WNFTSSLEVNDNITNPGVVLPRPKPEHAQSKNKLGLVVGLVSGGYVLVFVCVLMLFAF--  315

Query  844   WRKRKMREEFDDDIFGN--IGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYK  1017
             WRKRK+RE+ D+DIF      E     GPK+F YRELAR TNSF+Q++KLGEGGFG VYK
Sbjct  316   WRKRKLREDEDNDIFDGSMTHEFERSTGPKKFLYRELARCTNSFAQENKLGEGGFGGVYK  375

Query  1018  GYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEF  1197
             GYL+EL SYVAVKRVSR SKQGIKEYASEV +ISR+RH++LV LIGWCHE ++LLLVYEF
Sbjct  376   GYLRELNSYVAVKRVSRESKQGIKEYASEVSIISRLRHRHLVQLIGWCHEKRELLLVYEF  435

Query  1198  LSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNL  1377
             + NGSLD HL+KGKS LTWP+RYKI Q LAS LLYLHEE E+C+VHRDIKSSNIMLDSN 
Sbjct  436   MPNGSLDFHLFKGKSHLTWPIRYKIAQGLASTLLYLHEEWEQCVVHRDIKSSNIMLDSNF  495

Query  1378  NAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACG  1557
             NAKLGDFGLARLVDHEKGS+TT LAGT GY+A EC ++GKASKETD+YSFG+V LEIACG
Sbjct  496   NAKLGDFGLARLVDHEKGSQTTVLAGTRGYMAPECFITGKASKETDVYSFGVVALEIACG  555

Query  1558  RKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDC  1737
             RK IDP AEE  V +VDWVW LYG G L +AADP L  +FN  E + ++IVGLWCAHPD 
Sbjct  556   RKAIDPKAEEDQVKLVDWVWSLYGMGNLNEAADPKLLSEFNEMETKHLLIVGLWCAHPDS  615

Query  1738  SLRPSIRQAIQVLNFEAPLPDLPETMPVATFWPQRNV  1848
               RPSIRQAI VLNFEAPLP LP  MPV T+    +V
Sbjct  616   KCRPSIRQAIHVLNFEAPLPTLPPNMPVPTYCSHYSV  652



>ref|XP_006366898.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Solanum tuberosum]
Length=701

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/627 (60%), Positives = 443/627 (71%), Gaps = 37/627 (6%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFER-TSLVNNSIQITPNQRN-----CIGRATYSEPLHLWD  204
             V  LSFNFD FTP N  N+T+ER  S  N +I +T N  N      IGRA YS+PLHLWD
Sbjct  22    VTSLSFNFDTFTP-NDHNVTYERDASPENGAILLTKNLLNRDINASIGRAIYSKPLHLWD  80

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
             K +  L+ F THF+F I+S G  KYGDGFAFFLAP GS IP N T+GG  GL +++ERLN
Sbjct  81    KASRNLTDFTTHFSFSINSQGITKYGDGFAFFLAPAGSTIPYNTTRGGSLGLTSNNERLN  140

Query  385   SS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
             SS N FVAVEFD Y N YD +  HVG+D++S+QSVV   W   I  G  ++AWI+Y+  S
Sbjct  141   SSSNHFVAVEFDTYQNPYDPKGDHVGVDINSMQSVVNVTWFSSIPNGTKTDAWISYNSNS  200

Query  562   MNLSVVFRNFGSYGH---------VSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
              NL+VVF  F   G+         +SY LDLR+YLPE VTFGF G  G+  A Q I SW 
Sbjct  201   KNLTVVFTGFQLQGNNITVTVLQNLSYNLDLREYLPEWVTFGFTGGAGRRFAFQRIYSWK  260

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFS-------------FLAWRKR  855
             FTS+LD   N  DT  T    +         L       S             F  WRK 
Sbjct  261   FTSSLD---NMTDTGVTLSNTLPKDAPTKTKLGLVVGLISGGCVLVAVCALVLFAFWRKS  317

Query  856   KMREEFDDDIFGN--IGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLK  1029
             K+RE  DD +F      E    AGPK+F Y ELAR TN+FSQ++ LG GGFG VYKGYL 
Sbjct  318   KVRE--DDYVFDGSMTNEFQKSAGPKKFLYSELARCTNNFSQEEMLGRGGFGGVYKGYLS  375

Query  1030  ELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNG  1209
             E  SY+AVKRVSR S+QGIKEY SEVR++SR+RHK+LV LIGWCH+ ++LLLVYEF+ NG
Sbjct  376   ESNSYIAVKRVSRESQQGIKEYVSEVRIVSRLRHKHLVQLIGWCHQKRELLLVYEFMPNG  435

Query  1210  SLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKL  1389
             SLD H++ GKS L WPLR+KI Q LASALLYLHEE E+C+VHRDIKSSNIMLDSN NAKL
Sbjct  436   SLDHHIFSGKSHLAWPLRFKIAQGLASALLYLHEEWEQCVVHRDIKSSNIMLDSNFNAKL  495

Query  1390  GDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPI  1569
             GDFGLARLVDH+KGS+TT LAGTMGY+A ECV +GKA+KETD+YSFGIV LEI CGRKPI
Sbjct  496   GDFGLARLVDHDKGSQTTVLAGTMGYMAPECVTTGKANKETDVYSFGIVVLEIGCGRKPI  555

Query  1570  DPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRP  1749
             DP AEE  VNIVDWVW+LYG   +L+A DP LS +FN  E+E +++VGLWCAHPD + RP
Sbjct  556   DPKAEEHRVNIVDWVWRLYGMRSILEAVDPKLSSEFNEEEMEHLLVVGLWCAHPDNNCRP  615

Query  1750  SIRQAIQVLNFEAPLPDLPETMPVATF  1830
             SIRQA+QVLNFEAPLP LP +MPV T+
Sbjct  616   SIRQAVQVLNFEAPLPTLPRSMPVPTY  642



>ref|XP_009794260.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Nicotiana sylvestris]
Length=707

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/633 (60%), Positives = 454/633 (72%), Gaps = 35/633 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSL-VNNSIQITPNQRN-----CIGRATYSEPL  192
             IIP V  LSFNFD F P N QN+T+E  +   N  IQ+T NQ +      IGRATY + L
Sbjct  20    IIPFVTSLSFNFDSFNP-NGQNVTYEEDAFSANGVIQLTKNQLDRGSGVSIGRATYFKTL  78

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
             HLWDK +G L+ F THF+F I+S G   YGDG AFFLAP GSRIP N T GG  GL  D 
Sbjct  79    HLWDKASGNLTDFTTHFSFSINSQGRTAYGDGLAFFLAPAGSRIPENTTIGGSLGLTIDT  138

Query  373   ERLNSSNP-FVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
             ++LN+SN  FVAVEFD + N YD +  HVGID++S+QSVV + W   I  G  ++AWI+Y
Sbjct  139   QQLNTSNNHFVAVEFDTFKNWYDPQGDHVGIDINSMQSVVNSTWLSSIPNGNRTDAWISY  198

Query  550   DPRSMNLSVVFRNFGSYGHV------SYILDLRKYLPERVTFGFAGATGKDTALQMINSW  711
             +  S NL+VVF  F +   V      S+ LDLR+YLPERVTFGF GATG   ALQ I+SW
Sbjct  199   NSTSKNLTVVFTGFRANSTVTVQQSLSHNLDLREYLPERVTFGFTGATGGLFALQSISSW  258

Query  712   IFTSALDISENQAD--------------TKSTgkglviglvvggcfliggSMAFSFLAWR  849
              FTS+L+I++N  D              +KS    ++  +  G   +    +      WR
Sbjct  259   NFTSSLEINDNITDPGVALPIPKPEETPSKSKLGLVIGLVSGGCVLVAVSVLVLFVF-WR  317

Query  850   KRKMREEFDDDIFGNIG-----ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVY  1014
             KRK+RE+ D D   +       E     GPK+F Y ELAR TN+F+Q++KLGEGGFG VY
Sbjct  318   KRKLREDEDADDDDSFDSSMADEFERSTGPKKFLYGELARCTNNFAQEEKLGEGGFGGVY  377

Query  1015  KGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYE  1194
             KGYLKE  SYVAVKRVSRGS+QGIKE+ASEVR+ISR+RH++LV LIGWC E ++LLLVYE
Sbjct  378   KGYLKEPNSYVAVKRVSRGSRQGIKEFASEVRIISRLRHRHLVQLIGWCQEKRELLLVYE  437

Query  1195  FLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSN  1374
             F+ NGSLD HL+KGKS LTWP+RYKI Q LASALLYLHEE E+C+VHRDIKSSNIMLDSN
Sbjct  438   FMPNGSLDFHLFKGKSHLTWPIRYKIAQGLASALLYLHEEWEQCVVHRDIKSSNIMLDSN  497

Query  1375  LNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIAC  1554
              NAKLGDFGLARLVDHEKGS+TT LAGTMGY+A EC  +GKASKETD+YSFGIV LEIAC
Sbjct  498   FNAKLGDFGLARLVDHEKGSQTTVLAGTMGYMAPECATTGKASKETDVYSFGIVALEIAC  557

Query  1555  GRKPIDPTAE-ECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHP  1731
             GR+PID  AE E  VNIV+WVW LY  G L +AADP LS +FN  E++ ++IVGLWCAHP
Sbjct  558   GRRPIDRKAESERQVNIVEWVWSLYRMGNLNEAADPKLSLEFNEMEMKHLLIVGLWCAHP  617

Query  1732  DCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             D + RPSIRQAI VLNFEAPLP LP  MPV T+
Sbjct  618   DSNCRPSIRQAIHVLNFEAPLPTLPPNMPVPTY  650



>gb|KDO44170.1| hypothetical protein CISIN_1g042831mg, partial [Citrus sinensis]
Length=645

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/616 (58%), Positives = 437/616 (71%), Gaps = 18/616 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNCIGRATYSEPLHLWDKP  210
             IIPL   L+FN+  F+P    NIT+ER    +N +   P  R   GRATY++ + LWDK 
Sbjct  28    IIPLASALTFNYTSFSPQYDDNITYERAYPDSNRVIQLPANRETAGRATYNQSMRLWDKA  87

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGG-FGLANDDERLNS  387
             TG L+ F THF+FVIDS  S+ Y DG AFFLAP GS+IP N  KGGG FGL  D+E LNS
Sbjct  88    TGNLTDFTTHFSFVIDSRNSSYYADGLAFFLAPQGSKIPTN--KGGGSFGLTKDNEPLNS  145

Query  388   SNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMN  567
             S PFVAVEFDVY+N +D    HVGID++S++S     W  D++ G  +EAWI+Y+  + N
Sbjct  146   SIPFVAVEFDVYVNSWDPTFSHVGIDINSVKSKKNVSWWSDVKSGRRNEAWISYNSSTHN  205

Query  568   LSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDI  735
             LSV F  F +       + Y +DLR++LPE VTFGF+ ATG D A+  I SW F S+L++
Sbjct  206   LSVAFTGFRNNLVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEM  265

Query  736   SENQ----ADTKSTgkglviglvvggcfliggSMAFSFLAW-----RKRKMREEFDDDIF  888
              +      ++ K   K     +V               + W     RKRK  +E D+  F
Sbjct  266   DDETTNPVSNPKRRRKNRTALVVGLSLGGGVLVGGVVLIIWLAGIGRKRKEGDEEDNQGF  325

Query  889   GNI--GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRV  1062
                   E   GAGPKRF Y+ELA ATN F+   KLG+GGFG VYKG+ +E  SY+AVKRV
Sbjct  326   SEYIDDEFERGAGPKRFPYKELALATNDFNDDQKLGQGGFGGVYKGFFRETNSYIAVKRV  385

Query  1063  SRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKS  1242
             S+GSKQGIKEYASEV++ISR+RH+NLV L+GWCHE K+LLLVYEF+ NGSLDSHL+K  S
Sbjct  386   SQGSKQGIKEYASEVKIISRLRHRNLVQLLGWCHEKKELLLVYEFMPNGSLDSHLFKENS  445

Query  1243  LLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDH  1422
             LLTW  RYKI QDLAS LLYL EE E+C+VHRDIKSSNIMLDSN NAK+GDFGLARLV+H
Sbjct  446   LLTWEFRYKIAQDLASGLLYLQEEWEQCVVHRDIKSSNIMLDSNFNAKIGDFGLARLVEH  505

Query  1423  EKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNI  1602
              KGS+TT LAGTMGY+A EC  +GKASKE+D+YSFGIV LEIACGRKPI+P A +  V++
Sbjct  506   AKGSQTTVLAGTMGYMAPECATTGKASKESDVYSFGIVALEIACGRKPINPKAPQGQVSL  565

Query  1603  VDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNF  1782
             + WVW LYG G+LL+A DP L  DF+G+++E++MIVGLWCAHPD +LRPSIRQ I VLNF
Sbjct  566   LQWVWDLYGNGKLLEAVDPRLCRDFDGQQIERLMIVGLWCAHPDENLRPSIRQVIHVLNF  625

Query  1783  EAPLPDLPETMPVATF  1830
             EAPLP LP  MPV T+
Sbjct  626   EAPLPALPPKMPVPTY  641



>ref|XP_006487682.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Citrus sinensis]
Length=693

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/616 (58%), Positives = 437/616 (71%), Gaps = 18/616 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNCIGRATYSEPLHLWDKP  210
             IIPL   L+FN+  F+P    NIT+ER    +N +   P  R   GRATY++ + LWDK 
Sbjct  28    IIPLASALTFNYTSFSPQYDDNITYERAYPDSNRVIQLPANRETAGRATYNQSMRLWDKA  87

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGG-FGLANDDERLNS  387
             TG L+ F THF+FVIDS  S+ Y DG AFFLAP GS+IP N  KGGG FGL  D+E LNS
Sbjct  88    TGNLTDFTTHFSFVIDSRNSSYYADGLAFFLAPQGSKIPTN--KGGGSFGLTKDNEPLNS  145

Query  388   SNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMN  567
             S PFVAVEFDVY+N +D    HVGID++S++S     W  D++ G  +EAWI+Y+  + N
Sbjct  146   SIPFVAVEFDVYVNSWDPTFSHVGIDINSVKSKKNVSWWSDVKSGRRNEAWISYNSSTHN  205

Query  568   LSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDI  735
             LSV F  F +       + Y +DLR++LPE VTFGF+ ATG D A+  I SW F S+L++
Sbjct  206   LSVAFTGFRNNLVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEM  265

Query  736   SENQ----ADTKSTgkglviglvvggcfliggSMAFSFLAW-----RKRKMREEFDDDIF  888
              +      ++ K   K     +V               + W     RKRK  +E D+  F
Sbjct  266   DDETTNPVSNPKRRRKNRTALVVGLSLGGGVLVGGVVLIIWLAGIGRKRKEGDEEDNQGF  325

Query  889   GNI--GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRV  1062
                   E   GAGPKRF Y+ELA ATN F+   KLG+GGFG VYKG+ +E  SY+AVKRV
Sbjct  326   SEYIDDEFERGAGPKRFPYKELALATNDFNDDQKLGQGGFGGVYKGFFRETNSYIAVKRV  385

Query  1063  SRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKS  1242
             S+GSKQGIKEYASEV++ISR+RH+NLV L+GWCHE K+LLLVYEF+ NGSLDSHL+K  S
Sbjct  386   SQGSKQGIKEYASEVKIISRLRHRNLVQLLGWCHEKKELLLVYEFMPNGSLDSHLFKENS  445

Query  1243  LLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDH  1422
             LLTW  RYKI QDLAS LLYL EE E+C+VHRDIKSSNIMLDSN NAK+GDFGLARLV+H
Sbjct  446   LLTWEFRYKIAQDLASGLLYLQEEWEQCVVHRDIKSSNIMLDSNFNAKIGDFGLARLVEH  505

Query  1423  EKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNI  1602
              KGS+TT LAGTMGY+A EC  +GKASKE+D+YSFGIV LEIACGRKPI+P A +  V++
Sbjct  506   AKGSQTTVLAGTMGYMAPECATTGKASKESDVYSFGIVALEIACGRKPINPKAPQGQVSL  565

Query  1603  VDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNF  1782
             + WVW LYG G+LL+A DP L  DF+G+++E++MIVGLWCAHPD +LRPSIRQ I VLNF
Sbjct  566   LQWVWDLYGNGKLLEAVDPRLCRDFDGQQIERLMIVGLWCAHPDENLRPSIRQVIHVLNF  625

Query  1783  EAPLPDLPETMPVATF  1830
             EAPLP LP  MPV T+
Sbjct  626   EAPLPALPPKMPVPTY  641



>ref|XP_006423640.1| hypothetical protein CICLE_v10027962mg [Citrus clementina]
 gb|ESR36880.1| hypothetical protein CICLE_v10027962mg [Citrus clementina]
Length=667

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/607 (58%), Positives = 434/607 (71%), Gaps = 26/607 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNCIGRATYSEPLHLWDKP  210
             IIPL   L+FN+  F+P    NIT+ER    +N +   P  R   GRATY++ + LWDK 
Sbjct  28    IIPLASALTFNYTSFSPQYDDNITYERAYPDSNRVIQLPANRETAGRATYNQSMRLWDKA  87

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGG-FGLANDDERLNS  387
             TG L+ F THF+FVIDS   + Y DG AFFLAP GS+IP N  KGGG FGL  D+E LNS
Sbjct  88    TGNLTDFTTHFSFVIDSGNRSYYADGLAFFLAPQGSKIPTN--KGGGSFGLTKDNEPLNS  145

Query  388   SNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMN  567
             S PFVAVEFDVY+N +D    HVGID++S+QS     WS D++ G  +EAWI+Y+  + N
Sbjct  146   SIPFVAVEFDVYVNSWDPTFSHVGIDINSVQSKKNVYWSSDVKSGRRNEAWISYNSSTHN  205

Query  568   LSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDI  735
             LSV F  F +       + Y +DLR++LPE VTFGF+ ATG D A+  I SW F S+L++
Sbjct  206   LSVAFTGFRNNLVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEM  265

Query  736   SENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNI--GELG  909
              +   +  S  K       +                W KRK  ++ D+  F      E  
Sbjct  266   DDETTNPVSNPKRRRKTEQL----------------W-KRKEGDQEDNQGFSEYIDDEFE  308

Query  910   GGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIK  1089
              GAGPKRF Y++LA ATN F+   KLG+GGFG VYKG+L+E  SY+AVKRVS+GSKQGIK
Sbjct  309   RGAGPKRFPYKDLALATNDFNDDQKLGQGGFGGVYKGFLRETNSYIAVKRVSQGSKQGIK  368

Query  1090  EYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYK  1269
             EYASEV++ISR+RH+NLV L+GWCHE K+LLLVYEF+ NGSLDSHL+K  SLLTW  RYK
Sbjct  369   EYASEVKIISRLRHRNLVQLLGWCHEKKELLLVYEFMPNGSLDSHLFKENSLLTWEFRYK  428

Query  1270  IVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTAL  1449
             I QDLAS LLYL EE E+C+VHRDIKSSNIMLDSN NAK+GDFGLARLV+H KGS+TT L
Sbjct  429   IAQDLASGLLYLQEEWEQCVVHRDIKSSNIMLDSNFNAKIGDFGLARLVEHAKGSQTTVL  488

Query  1450  AGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYG  1629
             AGTMGY+A EC  +GKASKE+D+YSFGIV LEIACGRKPI+P A +  V+++ WVW LYG
Sbjct  489   AGTMGYMAPECATTGKASKESDVYSFGIVALEIACGRKPINPKAPQGQVSLLQWVWDLYG  548

Query  1630  TGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPE  1809
              G+LL+A DP L  DF+G+++E++MIVGLWCAHPD +LRPSIRQ I VLNFEAPLP LP 
Sbjct  549   NGRLLEAVDPRLCRDFDGQQIERLMIVGLWCAHPDENLRPSIRQVIHVLNFEAPLPALPP  608

Query  1810  TMPVATF  1830
              MPV T+
Sbjct  609   KMPVPTY  615



>ref|XP_006363961.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Solanum tuberosum]
Length=715

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/647 (58%), Positives = 448/647 (69%), Gaps = 48/647 (7%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQR-----NCIGRATYSEPLH  195
             IIP V  LSFNFD F P N QNIT+E  +  N  IQ+T N++     + IGRATYS+ L+
Sbjct  13    IIPFVTSLSFNFDSFNP-NDQNITYEADAYPNGVIQLTKNEQGSGLNDSIGRATYSKTLY  71

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIP-PNATKGGGFGLANDD  372
             LWDK +G ++ F THF+F I+S G   Y DG AFFLAP GSRIP   +  GGG GLA D 
Sbjct  72    LWDKASGNITDFTTHFSFGINSLGKNLYADGLAFFLAPAGSRIPDKKSAAGGGLGLAIDS  131

Query  373   ERLNSSN-PFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
              +  S N PFVAVEFD + N+YD    HVG++++S+ SVV   W   I  G  ++AWI Y
Sbjct  132   RQNTSKNHPFVAVEFDTFKNYYDPPGDHVGVNINSMVSVVNVTWFSSIPNGKRTDAWITY  191

Query  550   DPRSMNLSVVFRNFGSYGH--------VSYILDLRKYLPERVTFGFAGATGKDTALQMIN  705
             +  S NLSVVF  F   G+        +SY +DLR YLPE VTFGF+GATG   ALQ I 
Sbjct  192   NSTSKNLSVVFTGFQPQGNTTVTFLQTLSYNIDLRDYLPEWVTFGFSGATGSLFALQTIY  251

Query  706   SWIFTSALDISENQAD---------------------------TKSTgkglviglvvggc  804
             SW FTS+L  ++N  D                           +     GLVIGL+ GGC
Sbjct  252   SWNFTSSLKYNDNITDPFVPLPSPVPHPDVSLPTPDPDPDPDPSSKKLSGLVIGLISGGC  311

Query  805   fliggSMAFSFLAWRKRKMREEFDDDIFGN-----IGELGGGAGPKRFTYRELARATNSF  969
               +  S+   F  WRKRK+RE  D+D           E     GPK+F Y EL R TN F
Sbjct  312   VSVALSVLILFAFWRKRKVREYEDEDEDDIIDSSMTNEFERSTGPKKFLYSELVRCTNYF  371

Query  970   SQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHL  1149
             S+++ LG+GGFG VYKGYL E  SY+AVKRVSR SKQGIKEYASEVR+ISR+RHK+LV L
Sbjct  372   SREEMLGQGGFGGVYKGYLSESNSYIAVKRVSRESKQGIKEYASEVRIISRLRHKHLVQL  431

Query  1150  IGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCI  1329
             IGWCH+ ++LLLVYEF+ NGSLD  L+KG+S LTW +R+KI Q LASALLYLH+E E+C+
Sbjct  432   IGWCHQKRELLLVYEFMPNGSLDYDLFKGRSHLTWSIRFKIAQGLASALLYLHDEWEQCV  491

Query  1330  VHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKE  1509
             VHRDIKSSNIMLDSN NAKLGDFGLARLVDH+KGS+TT LAGTMGY+A EC+ +GKASKE
Sbjct  492   VHRDIKSSNIMLDSNFNAKLGDFGLARLVDHDKGSQTTVLAGTMGYMAPECLTTGKASKE  551

Query  1510  TDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGRE  1689
             TD+YSFG+V LEIACGRKPIDP AEE  VNIVDWVW+LYG G + +A DP LS + N  E
Sbjct  552   TDVYSFGVVALEIACGRKPIDPKAEEHQVNIVDWVWRLYGMGNIREAVDPRLSSEINEEE  611

Query  1690  VEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             VE ++IVGLWCAHPD + RPSIRQA QVLNFEAPLP LP  MPV T+
Sbjct  612   VEHLLIVGLWCAHPDNNCRPSIRQATQVLNFEAPLPTLPPNMPVPTY  658



>ref|XP_006369691.1| hypothetical protein POPTR_0001s29080g [Populus trichocarpa]
 gb|ERP66260.1| hypothetical protein POPTR_0001s29080g [Populus trichocarpa]
Length=683

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/617 (57%), Positives = 442/617 (72%), Gaps = 24/617 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNC-----IGRATYSEPLH  195
             IIP    LSFNF  F     QNI++E     + +IQ+T N RN       GRATY +P+ 
Sbjct  20    IIPSASGLSFNFTSFIVGADQNISYEEAYPADGAIQLTKNLRNANMNSSSGRATYYKPMQ  79

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             LWD+ +G L+ F THF+F IDS     YGDG AFFLAP GS++P N ++G G GL   D+
Sbjct  80    LWDEASGNLTDFTTHFSFSIDSQRRTAYGDGLAFFLAPEGSKLPSNLSEGAGLGLTRRDQ  139

Query  376   RLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
              LN++ N FVAVEFD+Y N++D   +HVGID++S+QSV    W  DI GG  +EAWI+Y+
Sbjct  140   LLNTTANHFVAVEFDIYPNYFDPPGEHVGIDINSMQSVNNITWPCDISGGRITEAWISYN  199

Query  553   PRSMNLSVVF----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFT  720
               + NLSV F     N      +S I+ LR YLPERV+FGF+ +TG  +AL  + SW F+
Sbjct  200   SSTHNLSVAFTGYRNNTVEMQFLSQIVSLRDYLPERVSFGFSASTGSASALHTLYSWDFS  259

Query  721   SALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKR-----KMREEFDDDI  885
             S+L+I +N  +      GL +G            +   F+   +       + EE+ DD 
Sbjct  260   SSLEIDDN--NRTGLAVGLGVGGGAIVVGAALVGIVIKFMRGHEEDEGDGHVLEEYMDD-  316

Query  886   FGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVS  1065
                  E   G GPK+F+Y+ELARATN+F  ++KLGEGGFG VYKG+LK ++S+VAVKRVS
Sbjct  317   -----EFERGTGPKKFSYQELARATNNFKDEEKLGEGGFGGVYKGFLKGIDSFVAVKRVS  371

Query  1066  RGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSL  1245
             RGSKQGIKEYA+EV++ISR+RH+NLV LIGWCHE K+LLLVYEF+ +GSLDSHL+K  SL
Sbjct  372   RGSKQGIKEYAAEVKIISRLRHRNLVQLIGWCHERKELLLVYEFMPHGSLDSHLFKETSL  431

Query  1246  LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHE  1425
             LTW +RYKIVQ LAS LLYLHEE E+C+VHRDIKSSNIMLDS  NAKLGDFGLARLVDH 
Sbjct  432   LTWEVRYKIVQGLASGLLYLHEEWEQCVVHRDIKSSNIMLDSEFNAKLGDFGLARLVDHG  491

Query  1426  KGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAE-ECHVNI  1602
             KGS+TT LAGTMGY+A EC ++GKAS+E+D+YSFGIV LEIACGRKPI+P A  E  V++
Sbjct  492   KGSQTTVLAGTMGYMAPECAMTGKASRESDVYSFGIVALEIACGRKPINPKASNEDQVSM  551

Query  1603  VDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNF  1782
             V WVW+LYG G+LL+A DP L GDFN  ++E++MIVGL CAHPD  LRPSIRQA+ VLNF
Sbjct  552   VQWVWELYGEGKLLEAVDPRLCGDFNKTQMERLMIVGLSCAHPDEHLRPSIRQALHVLNF  611

Query  1783  EAPLPDLPETMPVATFW  1833
             +APLP LP  MPV +++
Sbjct  612   DAPLPILPSKMPVPSYF  628



>ref|XP_007042796.1| Concanavalin A-like lectin protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOX98627.1| Concanavalin A-like lectin protein kinase family protein, putative 
[Theobroma cacao]
Length=708

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/629 (56%), Positives = 450/629 (72%), Gaps = 24/629 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSL-VNNSIQITPNQRNC-----IGRATYSEPL  192
             I P  + LSFNF  F P N  NIT+ER++   N  IQ+T NQR+      +GRATYS+ L
Sbjct  32    ITPYTNALSFNFTSFYP-NDNNITYERSAYPANEVIQLTTNQRDVLMTASVGRATYSKTL  90

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
             HLWDK +G L+ F+T F FVIDS   + YGDG AFFLAP GS+IP N TKGG  GLA+D 
Sbjct  91    HLWDKASGNLTDFSTSFTFVIDSQNRSAYGDGIAFFLAPAGSKIPDNVTKGGTLGLASDG  150

Query  373   ERLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
               LN++ N FVAVEFD+Y N +D E +HVGI+++S++S+    W  DI  G  +EAWI+Y
Sbjct  151   MELNTTVNRFVAVEFDIYKNSWDPEHEHVGININSMKSMTNITWWGDIMAGKTNEAWISY  210

Query  550   DPRSMNLSVVF----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
             D  + NLSV F     N     H++ I+DLR +LPE VTFGF+ ATG  ++L  I SW F
Sbjct  211   DSSTQNLSVAFTGSRNNTKVMQHLNSIIDLRLHLPEPVTFGFSAATGNASSLHQIPSWAF  270

Query  718   TSALDISENQAD-------TKSTgkglviglvvggcfliggSMAFSFLA--WRKRKMREE  870
             TS+L+I  N  D        +       + + +G    + G M   +LA  +RK+  ++E
Sbjct  271   TSSLEIDNNITDPDPNLNRNRRRKNRTGLAVGLGVTGALVGGMVLVWLASLYRKKLGKDE  330

Query  871   FDDDIFGNIGELGG--GAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESY  1044
              +  +     E     G GP++F+Y ELA AT++F    KLG+GGFG+VYKG+L++   Y
Sbjct  331   EEGHVIDEEIEDEFERGTGPRKFSYNELAHATDNFKDVGKLGQGGFGAVYKGFLRDSSYY  390

Query  1045  VAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSH  1224
             VA+KRVS GSKQGIKEYASEV++ISR+RH+NLV LIGWCH+ K+LLLVYEF+ NGSLDSH
Sbjct  391   VAIKRVSSGSKQGIKEYASEVKIISRLRHRNLVQLIGWCHDKKELLLVYEFMPNGSLDSH  450

Query  1225  LYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGL  1404
             L+   SLLTW +RYKI Q LAS LLYLHE  E+C+VHRDIKSSN++LDS+ NAKLGDFGL
Sbjct  451   LFNENSLLTWEVRYKIAQGLASGLLYLHEGWEQCVVHRDIKSSNVLLDSDFNAKLGDFGL  510

Query  1405  ARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAE  1584
             ARLVDH KGS+TT LAGT+GY+A EC ++GKASK++D+YSFG+V LEIACGRKPIDP A 
Sbjct  511   ARLVDHAKGSQTTVLAGTVGYLAPECHIAGKASKQSDVYSFGVVALEIACGRKPIDPKAG  570

Query  1585  ECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQA  1764
             E  VN+V  VW+LYGTG LL+A DP L G+F  +EVEQ++I+GLWCAHPD + RPSI+QA
Sbjct  571   EGKVNLVQRVWELYGTGNLLEACDPRLRGEFVKQEVEQLLIIGLWCAHPDENSRPSIQQA  630

Query  1765  IQVLNFEAPLPDLPETMPVATFW-PQRNV  1848
             I VLNFEAPLP LP  MPV T++ P  NV
Sbjct  631   IHVLNFEAPLPILPSKMPVPTYYAPPLNV  659



>ref|XP_010327615.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Solanum lycopersicum]
Length=702

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/634 (59%), Positives = 448/634 (71%), Gaps = 35/634 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQRNC-----IGRATYSEPL  192
             IIP V+ LSFNFD F  +N QN+T+E  +   NS IQ+T NQR+      IGR TYSE L
Sbjct  13    IIPFVNSLSFNFDSFN-TNDQNLTYEADAYPANSVIQLTKNQRDSASNDSIGRVTYSEAL  71

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
             +LWDK +  L+ F THF+F I+S G   Y DG AFFLAP GSRIP N+  GG  GLA   
Sbjct  72    YLWDKASRNLTDFTTHFSFGINSQGRNNYADGLAFFLAPAGSRIPDNSAVGGSLGLAVSG  131

Query  373   ERLNSSN-PFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
             ++  S N  FVAVEFD + N YD +  HVG+D++S+ SVV   W   I  G  ++AWI Y
Sbjct  132   QQNTSRNHSFVAVEFDTFKNFYDPKGDHVGVDINSMVSVVNVTWFSSIPNGKRTDAWITY  191

Query  550   DPRSMNLSVVFRNFGSYG--------HVSYILDLRKYLPERVTFGFAGATGKDTALQMIN  705
             +  S NLSVVF  F   G        ++SY +DLR+YLPE VTFGF+GATG   ALQ I 
Sbjct  192   NSTSKNLSVVFTGFQQQGNTTLTVLQNLSYNIDLREYLPEWVTFGFSGATGTLFALQTIY  251

Query  706   SWIFTSALDISENQAD-------------TKSTgkglviglvvggcfliggSMAFSFLAW  846
             SW FTS+L  ++N  D             +     GLVIGL+ GGC L+  S+   F   
Sbjct  252   SWNFTSSLKHNDNITDPDVPLPRPVPEDTSSKNKSGLVIGLISGGCVLVALSVIILFAFR  311

Query  847   RKRKMREEFDDDIFGN------IGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGS  1008
             RKRK+RE+ D+D   +        E     GPK+F Y EL R TN+FS+++ LG+GGFG 
Sbjct  312   RKRKVREDEDEDEDDDIIDGSMTNEFERSTGPKKFLYSELVRCTNNFSREEMLGQGGFGG  371

Query  1009  VYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLV  1188
             VYKGYL E  SY+AVKRVSR SKQGIKEYASEVR+ISR+RHK+LV LIGWCH+ ++LLLV
Sbjct  372   VYKGYLSESNSYIAVKRVSRESKQGIKEYASEVRIISRLRHKHLVQLIGWCHQKRELLLV  431

Query  1189  YEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLD  1368
             YEF+ NGSLD HL+KG+S LTWP+R+KI Q LASALLYLHEE E+ +VHRDIKSSNIMLD
Sbjct  432   YEFMPNGSLDYHLFKGRSHLTWPIRFKIAQGLASALLYLHEEWEQIVVHRDIKSSNIMLD  491

Query  1369  SNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEI  1548
             SN NAKLGDFGLARLVDH+K S+TT LAGTMGY+A ECV +GKASKETD+YSFG+V LEI
Sbjct  492   SNFNAKLGDFGLARLVDHDKESQTTVLAGTMGYMAPECVTTGKASKETDVYSFGVVVLEI  551

Query  1549  ACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAH  1728
              CGRK I+  AEE  VNI+ WVW+LYG G L +A DP LS +FN  E+E ++IVGLWC+H
Sbjct  552   GCGRKSIENKAEEHQVNIIQWVWRLYGMGNLREAVDPRLSSEFNEEEMEHLLIVGLWCSH  611

Query  1729  PDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             PD + RPSIRQAIQVLN EAPLP LP  MPV T+
Sbjct  612   PDNNCRPSIRQAIQVLNLEAPLPILPPNMPVPTY  645



>gb|KHN46238.1| L-type lectin-domain containing receptor kinase IX.1 [Glycine 
soja]
Length=709

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/625 (55%), Positives = 434/625 (69%), Gaps = 27/625 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTS-LVNNSIQITPNQRNCIGRATYSEPLHLWDK  207
             IIP   PLSFN   F P N ++I +E ++  V   I++T N R+  GRATY +P+HLWDK
Sbjct  34    IIPCAFPLSFNITSFDP-NGKSIIYEGSANPVTPVIELTGNVRDITGRATYFQPMHLWDK  92

Query  208   PTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNS  387
              TG L+ F THF+FVIDS   + YGDG AFFLAP G + P   ++GG  GL  +++RLNS
Sbjct  93    ATGNLTDFTTHFSFVIDSRNRSGYGDGMAFFLAPAGLKFP-YVSRGGALGLTLENQRLNS  151

Query  388   SNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMN  567
             ++PFVAVEFD+Y N YD   +HVGID++SL+SV    W  DI+ G  +E WI+Y+  S N
Sbjct  152   TDPFVAVEFDIYKNFYDPPGEHVGIDINSLRSVANVTWLADIKQGKLNEVWISYNSSSFN  211

Query  568   LSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDI  735
             LSVVF  F +      H+S I+DLR +LPE VT GF+ ATG DTA+  +NSW F+S L  
Sbjct  212   LSVVFTGFNNDTILRQHLSAIIDLRLHLPEFVTVGFSAATGSDTAIHSVNSWDFSSTLAA  271

Query  736   SENQADTKSTgkglviglvvggcfliggSMAF------------------SFLAWRKRKM  861
              EN      T         +                              S   W+K K 
Sbjct  272   QENITKGADTVARSPATSNIAPSQKKKNKTGLAVGLSIGGFVLIGGLGLISIGLWKKWKK  331

Query  862   REEFDDDIFGN-IGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKEL  1035
                 +D +F   +GE  G GAGP++++Y EL  A N F  + KLG+GGFG VYKGYLK++
Sbjct  332   GSVEEDLVFEEYMGEDFGRGAGPRKYSYAELTEAANGFKDEHKLGQGGFGGVYKGYLKDI  391

Query  1036  ESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSL  1215
             +S+VA+KRVS GS QGIKE+ASEV +ISR+RH+NLVHLIGWCH  K LLLVYE++ NGSL
Sbjct  392   KSHVAIKRVSEGSDQGIKEFASEVNIISRLRHRNLVHLIGWCHAGKKLLLVYEYMPNGSL  451

Query  1216  DSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGD  1395
             D HL+K +SLL W +RY I + LASALLYLHEE E+C+VHRDIKSSNIMLDS  NAKLGD
Sbjct  452   DIHLFKKQSLLKWTVRYNIARGLASALLYLHEEWEQCVVHRDIKSSNIMLDSEFNAKLGD  511

Query  1396  FGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDP  1575
             FGLAR VDH K ++TTALAGTMGY+A EC  SG+ASKE+D+YSFG+V LEIACGRKPI+ 
Sbjct  512   FGLARFVDHAKSAQTTALAGTMGYMAPECATSGRASKESDVYSFGVVALEIACGRKPINH  571

Query  1576  TAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSI  1755
              A+E  +NIV+WVW LYG G++L+AAD  L G+F   +++ +MIVGLWCAHPD + RPS+
Sbjct  572   RAQENEINIVEWVWGLYGEGRILEAADQRLEGEFEEEQIKCLMIVGLWCAHPDHNNRPSM  631

Query  1756  RQAIQVLNFEAPLPDLPETMPVATF  1830
             RQAIQVLNFEAPLP+LP ++PV T+
Sbjct  632   RQAIQVLNFEAPLPNLPSSLPVPTY  656



>ref|XP_006369692.1| Chain H family protein [Populus trichocarpa]
 gb|ERP66261.1| Chain H family protein [Populus trichocarpa]
Length=713

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/639 (55%), Positives = 444/639 (69%), Gaps = 38/639 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNC-----IGRATYSEPLH  195
             IIP    LSFNF  F     QNI++E     + +IQ+T N RN       GRATY +P+ 
Sbjct  20    IIPSASGLSFNFTSFIVGADQNISYEEAYPADGAIQLTKNLRNANMNSSSGRATYYKPMQ  79

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             LWD+ +G L+ F THF+F IDS     YGDG AFFLAP GS++P N ++G G GL   D+
Sbjct  80    LWDEASGNLTDFTTHFSFSIDSQRRTAYGDGLAFFLAPEGSKLPSNLSEGAGLGLTRRDQ  139

Query  376   RLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
              LN++ N FVAVEFD+Y N++D   +HVGID++S+QSV    W  DI GG  +EAWI+Y+
Sbjct  140   LLNTTANHFVAVEFDIYPNYFDPPGEHVGIDINSMQSVNNITWPCDISGGRITEAWISYN  199

Query  553   PRSMNLSVVF----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFT  720
               + NLSV F     N      +S I+ LR YLPERV+FGF+ +TG  +AL  + SW F+
Sbjct  200   SSTHNLSVAFTGYRNNTVEMQFLSQIVSLRDYLPERVSFGFSASTGSASALHTLYSWDFS  259

Query  721   SALDISE---------------------NQADTKSTgkglviglvvggcfliggSMAFSF  837
             S+L+I +                     N    ++  K      V  G       +  + 
Sbjct  260   SSLEIDDNVTNPIDPATNPLDPAAASPPNGGSLRNRKKNRTGLAVGLGVGGGAIVVGAAL  319

Query  838   LAWRKRKMREEFDDDIFGNI------GELGGGAGPKRFTYRELARATNSFSQQDKLGEGG  999
             +    + MR   +D+  G++       E   G GPK+F+Y+ELARATN+F  ++KLGEGG
Sbjct  320   VGIVIKFMRGHEEDEGDGHVLEEYMDDEFERGTGPKKFSYQELARATNNFKDEEKLGEGG  379

Query  1000  FGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDL  1179
             FG VYKG+LK ++S+VAVKRVSRGSKQGIKEYA+EV++ISR+RH+NLV LIGWCHE K+L
Sbjct  380   FGGVYKGFLKGIDSFVAVKRVSRGSKQGIKEYAAEVKIISRLRHRNLVQLIGWCHERKEL  439

Query  1180  LLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNI  1359
             LLVYEF+ +GSLDSHL+K  SLLTW +RYKIVQ LAS LLYLHEE E+C+VHRDIKSSNI
Sbjct  440   LLVYEFMPHGSLDSHLFKETSLLTWEVRYKIVQGLASGLLYLHEEWEQCVVHRDIKSSNI  499

Query  1360  MLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVT  1539
             MLDS  NAKLGDFGLARLVDH KGS+TT LAGTMGY+A EC ++GKAS+E+D+YSFGIV 
Sbjct  500   MLDSEFNAKLGDFGLARLVDHGKGSQTTVLAGTMGYMAPECAMTGKASRESDVYSFGIVA  559

Query  1540  LEIACGRKPIDPTAE-ECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGL  1716
             LEIACGRKPI+P A  E  V++V WVW+LYG G+LL+A DP L GDFN  ++E++MIVGL
Sbjct  560   LEIACGRKPINPKASNEDQVSMVQWVWELYGEGKLLEAVDPRLCGDFNKTQMERLMIVGL  619

Query  1717  WCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW  1833
              CAHPD  LRPSIRQA+ VLNF+APLP LP  MPV +++
Sbjct  620   SCAHPDEHLRPSIRQALHVLNFDAPLPILPSKMPVPSYF  658



>ref|XP_003532590.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Glycine max]
Length=709

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/625 (55%), Positives = 431/625 (69%), Gaps = 27/625 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTS-LVNNSIQITPNQRNCIGRATYSEPLHLWDK  207
             IIP   PLSFN   F P N ++I +E ++  V   I++T N R+  GRATY +P+HLWDK
Sbjct  34    IIPCAFPLSFNITSFDP-NGKSIIYEGSANPVTPVIELTGNVRDITGRATYFQPMHLWDK  92

Query  208   PTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNS  387
              TG L+ F THF+FVIDS   + Y DG AFFLAP G + P   ++GG  GL  +D+RLNS
Sbjct  93    ATGNLTDFTTHFSFVIDSRNQSAYEDGMAFFLAPAGLKFP-YVSRGGALGLTLEDQRLNS  151

Query  388   SNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMN  567
             ++PFVAVEFD+Y N  D   +HVGID++SL+SV    W  DI+ G  +E WI+Y+  S N
Sbjct  152   TDPFVAVEFDIYENPDDPPGEHVGIDINSLRSVANVTWLADIKQGKLNEVWISYNSSSFN  211

Query  568   LSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDI  735
             LSVVF  F +      H+S I DLR +LPE VT GF+ ATG DTA+  +NSW F+S L  
Sbjct  212   LSVVFTGFNNDTILRQHLSAITDLRLHLPEFVTVGFSAATGIDTAIHSVNSWDFSSTLAA  271

Query  736   SENQADTKSTgkglviglvvggcfliggSMAF------------------SFLAWRKRKM  861
              EN      T         +                              S   W+K K 
Sbjct  272   QENITKGADTVARYPATSNIAPSQKKKNKTGLAVGLSIGGFVLIGGLGLISIGLWKKWKK  331

Query  862   REEFDDDIFGN-IGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKEL  1035
                 +D +F   +GE  G GAGP++++Y EL  A N F  + KLG+GGFG VYKGYLK++
Sbjct  332   GSVEEDLVFEEYMGEDFGRGAGPRKYSYAELTEAANGFKDEHKLGQGGFGGVYKGYLKDI  391

Query  1036  ESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSL  1215
             +S+VA+KRVS GS QGIKE+ASEV +ISR+RH+NLVHLIGWCH  K LLLVYE++ NGSL
Sbjct  392   KSHVAIKRVSEGSDQGIKEFASEVNIISRLRHRNLVHLIGWCHAGKKLLLVYEYMPNGSL  451

Query  1216  DSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGD  1395
             D HL+K +SLL W +RY I + LASALLYLHEE E+C+VHRDIKSSNIMLDS  NAKLGD
Sbjct  452   DIHLFKKQSLLKWTVRYNIARGLASALLYLHEEWEQCVVHRDIKSSNIMLDSEFNAKLGD  511

Query  1396  FGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDP  1575
             FGLAR VDH K ++TTALAGTMGY+A EC  SG+ASKE+D+YSFG+V LEIACGRKPI+ 
Sbjct  512   FGLARFVDHAKSAQTTALAGTMGYMAPECATSGRASKESDVYSFGVVALEIACGRKPINH  571

Query  1576  TAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSI  1755
              A+E  +NIV+WVW LYG G++L+AAD  L G+F   +++ +MIVGLWCAHPD + RPS+
Sbjct  572   RAQENEINIVEWVWGLYGEGRILEAADQRLEGEFEEEQIKCLMIVGLWCAHPDHNNRPSM  631

Query  1756  RQAIQVLNFEAPLPDLPETMPVATF  1830
             RQAIQVLNFEAPLP+LP ++PV T+
Sbjct  632   RQAIQVLNFEAPLPNLPSSLPVPTY  656



>ref|XP_003532592.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Glycine max]
Length=709

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/625 (54%), Positives = 429/625 (69%), Gaps = 27/625 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTS-LVNNSIQITPNQRNCIGRATYSEPLHLWDK  207
             IIP   PLSFN   F P N ++I +E ++  V   I++T N R+  GRATY +P+HLWDK
Sbjct  34    IIPCAFPLSFNITSFDP-NGKSIIYEGSANPVTPVIELTGNVRDSTGRATYFQPMHLWDK  92

Query  208   PTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNS  387
              TG L+ F THF+FVIDS   + YGDG AFFLAP G + P   ++GG  GL  +++RLNS
Sbjct  93    ATGNLTDFTTHFSFVIDSRNRSGYGDGMAFFLAPAGLKFP-YVSRGGALGLTLENQRLNS  151

Query  388   SNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMN  567
             ++PFVAVEFD+Y N YD   +HVGID++SL+SV    W  DI+ G  +E WI+Y+  S N
Sbjct  152   TDPFVAVEFDIYKNFYDPPGEHVGIDINSLRSVANVTWLADIKQGKLNEVWISYNSSSFN  211

Query  568   LSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDI  735
             LSVVF  F +      H+S I+DLR +LPE VT GF+ ATG  TA+  +NSW F+S L  
Sbjct  212   LSVVFTGFNNDTILRQHLSAIIDLRLHLPEFVTVGFSAATGSSTAIHSVNSWDFSSTLAA  271

Query  736   SENQADTKSTgkglviglvvggcfliggSMAF------------------SFLAWRKRKM  861
              EN      T         +                              S   W+K K 
Sbjct  272   QENITKGADTVARSPATSNIAPSQKKKNKTGLAVGLSIGGFVLIGGLGLISICLWKKWKK  331

Query  862   REEFDDDIFGNI--GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKEL  1035
                 +  +F      + G G GP++++Y EL +A N F  + KLG+GGFG VYKGYLK++
Sbjct  332   GSVEEVHVFEEYMGKDFGRGGGPRKYSYAELTQAANGFKDEHKLGQGGFGGVYKGYLKDI  391

Query  1036  ESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSL  1215
             +S+VA+KRVS  S QGIKE+ASEV +ISR+RH+NLVHLIGWCH  K LLLVYE++ NGSL
Sbjct  392   KSHVAIKRVSESSDQGIKEFASEVNIISRLRHRNLVHLIGWCHAGKKLLLVYEYMPNGSL  451

Query  1216  DSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGD  1395
             D HL+K +SLL W +RY I + LASALLYLHEE E+C+VHRDIKSSNIMLDS  NAKLGD
Sbjct  452   DIHLFKKQSLLKWTVRYNIARGLASALLYLHEEWEQCVVHRDIKSSNIMLDSEFNAKLGD  511

Query  1396  FGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDP  1575
             FGLAR VDH K ++TTALAGTMGY+A EC  SG+ASKE+D+YSFG+V LEIACGRKPI+ 
Sbjct  512   FGLARFVDHAKSAQTTALAGTMGYMAPECATSGRASKESDVYSFGVVALEIACGRKPINH  571

Query  1576  TAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSI  1755
              A+E  +NIV+WVW LYG G++L+AAD  L G+F   +++ +MIVGLWCAHPD + RPS+
Sbjct  572   RAQENEINIVEWVWGLYGEGRILEAADQRLEGEFEEEQIKCLMIVGLWCAHPDHNNRPSM  631

Query  1756  RQAIQVLNFEAPLPDLPETMPVATF  1830
             RQAIQVLNFEAPLP+LP ++PV T+
Sbjct  632   RQAIQVLNFEAPLPNLPSSLPVPTY  656



>ref|XP_002300009.2| hypothetical protein POPTR_0001s29000g [Populus trichocarpa]
 gb|EEE84814.2| hypothetical protein POPTR_0001s29000g [Populus trichocarpa]
Length=677

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/640 (54%), Positives = 449/640 (70%), Gaps = 40/640 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSL-VNNSIQITPNQRNC-----IGRATYSEPL  192
             IIP    LSFNF  F   + +NI++E+ +     ++Q+T N RN       GRATY +P+
Sbjct  20    IIPSASGLSFNFTSFIVGD-RNISYEQDAYPAEGAVQLTKNLRNANMSLIFGRATYYKPM  78

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWDK +G L+ F THF+F IDS G   YGDG AFFLAP GS++PPN ++G   GL  +D
Sbjct  79    QLWDKASGNLTDFTTHFSFSIDSQGRRAYGDGLAFFLAPEGSKLPPNLSQGRSLGLTRND  138

Query  373   ERLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
             ++LN++ N FVAVEFD+Y N++D   +HVGID++S+QSV    W  +I GG  ++AWI+Y
Sbjct  139   QQLNTTDNHFVAVEFDIYKNYFDPPGEHVGIDINSMQSVNNITWLCNISGGIKTDAWISY  198

Query  550   DPRSMNLSVVF----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
                + NLSV F     N      +S I+ LR YLPERV+FGF+ +TG  +AL  + SW F
Sbjct  199   SSSTHNLSVAFTGYRNNTVEMQFLSQIVSLRDYLPERVSFGFSASTGSASALHTLYSWDF  258

Query  718   TSALDISE---------------------NQADTKSTgkglviglvvggcfliggSMAFS  834
             +S L+I +                     N    ++  K      V  G       +  +
Sbjct  259   SSRLEIDDNVTNPIDPDTNTLDPAAASPPNGGSRRNRKKNRTGLAVGLGVGGGAIVVGAA  318

Query  835   FLAWRKRKMREEFDDDIFGNI------GELGGGAGPKRFTYRELARATNSFSQQDKLGEG  996
              + +  + M    +D+  G++       E   G GPK+F+Y+ELARAT++F  ++KLGEG
Sbjct  319   LVGFVIKFMCGHEEDEEGGHVVEEYMDEEFERGTGPKKFSYQELARATSNFKDEEKLGEG  378

Query  997   GFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKD  1176
             GFG VYKG+LKE++S+VAVKRVSRGSKQGIKEYA+EV++ISR+RH+NLV LIGWCHE K+
Sbjct  379   GFGGVYKGFLKEIDSFVAVKRVSRGSKQGIKEYAAEVKIISRLRHRNLVQLIGWCHERKE  438

Query  1177  LLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSN  1356
             LLLVYEF+S+GSLDSHL+K  SLLTW +RYKIVQ LAS LLYLHEE E+C+VHRDIKSSN
Sbjct  439   LLLVYEFMSHGSLDSHLFKETSLLTWEVRYKIVQGLASGLLYLHEEWEQCVVHRDIKSSN  498

Query  1357  IMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIV  1536
             I+LDS  NAKLGDFGLARLVDH KGS+TT LAGTMGY+A EC ++GKAS+E+D+YSFGIV
Sbjct  499   IILDSEFNAKLGDFGLARLVDHGKGSQTTVLAGTMGYMAPECAMTGKASRESDVYSFGIV  558

Query  1537  TLEIACGRKPIDPTAE-ECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVG  1713
              LEIACGRKPI+P A  E  V++V WVW+LYG G+LL+A DP L GDFN  ++E++MIVG
Sbjct  559   ALEIACGRKPINPKASNEDRVSMVQWVWELYGEGKLLEAVDPRLCGDFNKTQMERLMIVG  618

Query  1714  LWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW  1833
             L CAHPD  LRPSIRQA+ VLNF+APLP LP  MPV +++
Sbjct  619   LSCAHPDEHLRPSIRQALHVLNFDAPLPILPSKMPVPSYF  658



>ref|XP_003608364.1| Class I heat shock protein [Medicago truncatula]
Length=782

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/623 (55%), Positives = 431/623 (69%), Gaps = 32/623 (5%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNCIGRATYSEPLHLWDKPT  213
             IP    L+FNF  F P++   I     +  +++IQ+T N    IGRATY +P+HLW+K T
Sbjct  23    IPNASSLTFNFTSFDPNDKSIIYEGSANPASSAIQLTINY-GSIGRATYYQPIHLWNKIT  81

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS-  390
               L+ F +HF F IDS     YGDG AFFLAP GS+  PNATKGG  GL  D++RLNS+ 
Sbjct  82    NNLTDFTSHFTFTIDSQNRQMYGDGIAFFLAPYGSK-KPNATKGGSMGLTLDNQRLNSTD  140

Query  391   NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNL  570
             NPFVAVEFD+Y NH+D   +H GID++S+ SV    W  DI+ G  +EAWINY+  S+NL
Sbjct  141   NPFVAVEFDIYRNHWDPPLEHAGIDINSMLSVANVTWLADIKQGRLNEAWINYNASSLNL  200

Query  571   SVVFRNFGSYG------HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALD  732
             SV+F  F +        H+S I+DLR YLPE VT GF+ ATG  TA+  I+SW F+S L 
Sbjct  201   SVLFTGFNNVTSSIVNQHLSSIVDLRLYLPEFVTIGFSAATGNRTAVHSISSWDFSSTL-  259

Query  733   ISENQADTKSTgkglviglvvggcfliggSMA-------------FSFL---AWRKRKMR  864
               E Q D   T     +             +A             F F+    WRKR  R
Sbjct  260   --EGQQDNNKTNTQDPVTKSPSSNKKAKTGLAVGLGTGGFVLIGVFGFIWVFLWRKR--R  315

Query  865   EEFDDDIFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELES  1041
             E+ D +    +GE  G G GPK++TY ELA A N+F  + KLG+GGFG VY+G+LK+ +S
Sbjct  316   EQEDGEFQEYMGEDFGRGTGPKKYTYAELANAANNFKDEHKLGQGGFGGVYRGFLKDTKS  375

Query  1042  YVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDS  1221
             YVA+K VS  S QGIKE+ASEV +IS++RH+NLV LIGWCH+ K LLLVYE++ NGSLD 
Sbjct  376   YVAIKSVSEDSHQGIKEFASEVTIISKLRHRNLVQLIGWCHQRKKLLLVYEYMPNGSLDI  435

Query  1222  HLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFG  1401
             HL+K +SLL W +RY I + LASALLYLHEE E+C+VHRDIK+SNIMLDS  NAKLGDFG
Sbjct  436   HLFKKQSLLKWGVRYTIAKGLASALLYLHEEWEQCVVHRDIKASNIMLDSEFNAKLGDFG  495

Query  1402  LARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTA  1581
             LAR VDH KG +TTALAGTMGY+A EC  +G+ASKETD+YSFGIV LEIACGRKPI   A
Sbjct  496   LARFVDHAKGGQTTALAGTMGYMAPECATTGRASKETDVYSFGIVALEIACGRKPI-INA  554

Query  1582  EECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQ  1761
             +E  +NIV+WVW LYG G++++A DP L GD+   +++ MMIVGLWCAHPD + RPSIRQ
Sbjct  555   QENEINIVEWVWGLYGRGRIVEAVDPRLDGDYEEEQIKCMMIVGLWCAHPDPNNRPSIRQ  614

Query  1762  AIQVLNFEAPLPDLPETMPVATF  1830
             AIQVLNFE PLP+LP +MPV T+
Sbjct  615   AIQVLNFEVPLPNLPSSMPVPTY  637



>gb|AES90561.2| receptor lectin kinase [Medicago truncatula]
Length=811

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/623 (55%), Positives = 431/623 (69%), Gaps = 32/623 (5%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNCIGRATYSEPLHLWDKPT  213
             IP    L+FNF  F P++   I     +  +++IQ+T N    IGRATY +P+HLW+K T
Sbjct  23    IPNASSLTFNFTSFDPNDKSIIYEGSANPASSAIQLTINY-GSIGRATYYQPIHLWNKIT  81

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS-  390
               L+ F +HF F IDS     YGDG AFFLAP GS+  PNATKGG  GL  D++RLNS+ 
Sbjct  82    NNLTDFTSHFTFTIDSQNRQMYGDGIAFFLAPYGSK-KPNATKGGSMGLTLDNQRLNSTD  140

Query  391   NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNL  570
             NPFVAVEFD+Y NH+D   +H GID++S+ SV    W  DI+ G  +EAWINY+  S+NL
Sbjct  141   NPFVAVEFDIYRNHWDPPLEHAGIDINSMLSVANVTWLADIKQGRLNEAWINYNASSLNL  200

Query  571   SVVFRNFGSYG------HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALD  732
             SV+F  F +        H+S I+DLR YLPE VT GF+ ATG  TA+  I+SW F+S L 
Sbjct  201   SVLFTGFNNVTSSIVNQHLSSIVDLRLYLPEFVTIGFSAATGNRTAVHSISSWDFSSTL-  259

Query  733   ISENQADTKSTgkglviglvvggcfliggSMA-------------FSFL---AWRKRKMR  864
               E Q D   T     +             +A             F F+    WRKR  R
Sbjct  260   --EGQQDNNKTNTQDPVTKSPSSNKKAKTGLAVGLGTGGFVLIGVFGFIWVFLWRKR--R  315

Query  865   EEFDDDIFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELES  1041
             E+ D +    +GE  G G GPK++TY ELA A N+F  + KLG+GGFG VY+G+LK+ +S
Sbjct  316   EQEDGEFQEYMGEDFGRGTGPKKYTYAELANAANNFKDEHKLGQGGFGGVYRGFLKDTKS  375

Query  1042  YVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDS  1221
             YVA+K VS  S QGIKE+ASEV +IS++RH+NLV LIGWCH+ K LLLVYE++ NGSLD 
Sbjct  376   YVAIKSVSEDSHQGIKEFASEVTIISKLRHRNLVQLIGWCHQRKKLLLVYEYMPNGSLDI  435

Query  1222  HLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFG  1401
             HL+K +SLL W +RY I + LASALLYLHEE E+C+VHRDIK+SNIMLDS  NAKLGDFG
Sbjct  436   HLFKKQSLLKWGVRYTIAKGLASALLYLHEEWEQCVVHRDIKASNIMLDSEFNAKLGDFG  495

Query  1402  LARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTA  1581
             LAR VDH KG +TTALAGTMGY+A EC  +G+ASKETD+YSFGIV LEIACGRKPI   A
Sbjct  496   LARFVDHAKGGQTTALAGTMGYMAPECATTGRASKETDVYSFGIVALEIACGRKPI-INA  554

Query  1582  EECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQ  1761
             +E  +NIV+WVW LYG G++++A DP L GD+   +++ MMIVGLWCAHPD + RPSIRQ
Sbjct  555   QENEINIVEWVWGLYGRGRIVEAVDPRLDGDYEEEQIKCMMIVGLWCAHPDPNNRPSIRQ  614

Query  1762  AIQVLNFEAPLPDLPETMPVATF  1830
             AIQVLNFE PLP+LP +MPV T+
Sbjct  615   AIQVLNFEVPLPNLPSSMPVPTY  637



>ref|XP_003532595.2| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Glycine max]
Length=687

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/614 (57%), Positives = 443/614 (72%), Gaps = 21/614 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRN-----CIGRATYSEPLH  195
             IIP    LSFNF  F P++ + I     + V  +IQ+T NQ +      IGRATY +P+H
Sbjct  26    IIPYASSLSFNFPSFDPNDNRIIYNRSANAVAPNIQLTTNQADKGMNGSIGRATYYQPMH  85

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             LWDK TG L+ F+T+F+FVI+S G + YGDG AFFLAP GS +P N+T GG  GL  D++
Sbjct  86    LWDKATGTLTDFSTNFSFVINSRGQSVYGDGIAFFLAPAGSMVP-NSTLGGTMGLTLDNQ  144

Query  376   RLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
              LNS+ NPFVAVEFD++ N +D   +HVGID++SL+SV  A W  DI+GG  ++A I+Y+
Sbjct  145   ILNSTDNPFVAVEFDIFGNDWDPPGEHVGIDINSLRSVANATWLADIKGGKVNQALISYN  204

Query  553   PRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIF-  717
               S+NLSV F  F +      H+S I+DL+ YLPE VT GF+ ATG  TA+  +NSW F 
Sbjct  205   STSLNLSVAFTGFKNGTALLHHLSVIVDLKLYLPEFVTVGFSAATGNLTAIHTLNSWDFN  264

Query  718   -TSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGN  894
              TS +  S+ + D K+   GL +G  V    L   S+      W+K    EE D D    
Sbjct  265   STSIIAPSQKKKDKKALAVGLGVGGFVLIAGLGLISIRL----WKKTS--EEEDHDFEEY  318

Query  895   IGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRG  1071
             I E    GAGP++++Y ELA+A N F  + KLG+GGFG VYKGYLK+L+S+VA+K+VS G
Sbjct  319   IDEDFERGAGPQKYSYAELAQAANGFKDEHKLGQGGFGGVYKGYLKDLKSHVAIKKVSEG  378

Query  1072  SKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLT  1251
             S QGIKE+ASEVR+ISR+RH+NLV+LIGWCH  K LLLVYE++SNGSLD HL+K +S+L 
Sbjct  379   SDQGIKEFASEVRIISRLRHRNLVNLIGWCHAGKKLLLVYEYMSNGSLDIHLFKKQSILQ  438

Query  1252  WPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKG  1431
             W +RY I + LASALLYLHEE E+C+VHRDIK SNIMLDS  NAKLGDFGLAR VDH K 
Sbjct  439   WAVRYNIARGLASALLYLHEEWEQCVVHRDIKPSNIMLDSEFNAKLGDFGLARFVDHAKS  498

Query  1432  SRTTALAGTMGYIALECVVSGK-ASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVD  1608
             ++TTALAGTMGY+A EC +  + ASKE+D+YSFG+V LEIACGRKPI+  A+E  ++IV 
Sbjct  499   AQTTALAGTMGYMAPECTLGYRPASKESDVYSFGVVALEIACGRKPINHRAQENEISIVQ  558

Query  1609  WVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEA  1788
             WVW LYG G++L+AAD  L G F   +++ +MIVGLWCAHPD S RPSIRQAIQVLNFEA
Sbjct  559   WVWGLYGEGRILEAADQRLEGKFEEEQIKCLMIVGLWCAHPDHSNRPSIRQAIQVLNFEA  618

Query  1789  PLPDLPETMPVATF  1830
             PLP+LP ++PV T+
Sbjct  619   PLPNLPSSLPVPTY  632



>ref|XP_003528401.2| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Glycine max]
Length=707

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/631 (55%), Positives = 445/631 (71%), Gaps = 33/631 (5%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTS-LVNNSIQITPNQRN-----CIGRATYSEPL  192
             IIP    LSFNF  F P N ++I FE ++  V  +IQ+T NQ +      IGRATY +P+
Sbjct  26    IIPYASSLSFNFTSFDP-NDKSIVFEGSANPVAPTIQLTRNQMDKGMIGSIGRATYYQPM  84

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWDK TG L+ F THF+FVIDS   +KYGDG AFFLAP GS+IP NATKG   GL  D+
Sbjct  85    QLWDKATGNLTDFTTHFSFVIDSQNRSKYGDGIAFFLAPAGSKIP-NATKGASMGLTLDN  143

Query  373   ERLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
             ++LNS+ N FVAVEFD+Y N +D   +HVGID++S++S     W  DI+ G  +EAWI+Y
Sbjct  144   QQLNSTDNSFVAVEFDIYQNGWDPPHEHVGIDINSMRSASNVTWLADIKEGKLNEAWISY  203

Query  550   DPRSMNLSVVFRNFGS-------YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINS  708
             +  S+NLSVVF  F +         H+S I+DLR +LPE V+FGF+ ATG  TA+  + S
Sbjct  204   NSSSLNLSVVFTGFNNDTDHTIQQQHLSAIVDLRLHLPELVSFGFSAATGNATAIHSLYS  263

Query  709   WIFTSALDISEN-------QADTKSTgkglviglvvggcfliggSMA--------FSFLA  843
             W FTS L   EN        A + ++               +G S+          S + 
Sbjct  264   WDFTSTLAAQENITKGADPVARSPTSNIAPSQKKKNKTGLAVGLSIGGFVCGLGLISIVL  323

Query  844   WRK-RKMREEFDDDIFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYK  1017
             W+K +K  EE + D    +GE  G G   ++++Y ELA+A N F  + KLG+GGFG VY+
Sbjct  324   WKKWKKGTEEEEHDFEEFMGEDFGRGVETRKYSYAELAQAANGFKDEQKLGQGGFGGVYR  383

Query  1018  GYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEF  1197
             GYLK+++S+VA+KRVS  S QGIKE+ASE+R I+R+RH+NLVHLIGWCHE K LLLVYE+
Sbjct  384   GYLKDIKSHVAIKRVSEDSDQGIKEFASEIRTINRLRHRNLVHLIGWCHERKKLLLVYEY  443

Query  1198  LSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNL  1377
             + NGSLD+HL+K +SLL W +RY I + LASALLYLHEE E+C+VHRDIKSSNIMLDS  
Sbjct  444   MPNGSLDTHLFKKQSLLKWAVRYNIARGLASALLYLHEEWEQCVVHRDIKSSNIMLDSEF  503

Query  1378  NAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACG  1557
             NAKLGDFGLAR VDH KG++TTALAGTMGY+A EC   G+ASKE+D+YS G+V LEIACG
Sbjct  504   NAKLGDFGLARFVDHAKGAQTTALAGTMGYMAPECATLGRASKESDVYSCGVVALEIACG  563

Query  1558  RKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDC  1737
             RKPI+  A+E  +NIV WVW+L+G G++LDAADP L GDF   +++ +MIVGLWCAHPD 
Sbjct  564   RKPINLKAQENEINIVQWVWELFGGGRILDAADPRLEGDFEEEQIKCLMIVGLWCAHPDH  623

Query  1738  SLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             + R SIRQAIQVLNFEAPLP+LP ++PV T+
Sbjct  624   NNRASIRQAIQVLNFEAPLPNLPSSLPVPTY  654



>ref|XP_006487681.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Citrus sinensis]
Length=676

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/626 (56%), Positives = 433/626 (69%), Gaps = 27/626 (4%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNCIGRATYSEPLHLWDKPTGKL  222
              + LSFNF  F  SN  +I +ER    N  IQ+  + R  I RATY++PL LW+  TG L
Sbjct  18    ANALSFNFSGF--SNDGSINYERAFPENQVIQLA-SGRGMIVRATYNKPLRLWNNATGNL  74

Query  223   SSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS-NPF  399
             + F THF+FVIDS     YGDG AFFLAP GSRIP NATKGG  GL ND E LNSS NPF
Sbjct  75    TDFTTHFSFVIDSQNRTAYGDGLAFFLAPQGSRIP-NATKGGSLGLTNDGEYLNSSSNPF  133

Query  400   VAVEFDVYLNH-YDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSV  576
             VAVEFD+Y N  +D    HVGID++S++S     W  DI  G  ++AWI+Y+  +  LSV
Sbjct  134   VAVEFDIYRNGGWDPPGNHVGIDINSMRSETNLTWWADIRNGKMNDAWISYNSSTKKLSV  193

Query  577   VF---RNFGSYGH-VSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISEN  744
              F   RN  +    + Y ++L+ +LPE VTFGF+ ATG  +A+  I SW F+S+L+  ++
Sbjct  194   AFTGIRNNATVRQFLEYQVNLKLHLPEWVTFGFSAATGNASAIHRIYSWEFSSSLETDDD  253

Query  745   QADT--------KSTgkglviglvvggcfliggSMAFSFLAW-----RKRKMREEFDDDI  885
               ++        K   +      V         +     + W     RKR + +  D+  
Sbjct  254   ITNSLVPPGPIRKGRTENRTPLAVGLSVGGGVLAGGVVLIIWVVGIRRKRNVDDGEDNQG  313

Query  886   FGNI--GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKR  1059
             F      E   GAGPKRFTY+ELA+ATN F+   KLG+GGFG VYKG+ +E  SY+AVKR
Sbjct  314   FNEYIDDEFEKGAGPKRFTYKELAQATNDFNDDQKLGQGGFGGVYKGFFRETSSYIAVKR  373

Query  1060  VSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGK  1239
             VS+GSKQGIKEYASEV +ISR+RH+NLV L+GWCHE K+LLLVYE++ NGSLDSHL+K  
Sbjct  374   VSKGSKQGIKEYASEVTIISRLRHRNLVQLLGWCHEKKELLLVYEYMPNGSLDSHLFKEN  433

Query  1240  SLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVD  1419
             +LLTW  R+KI QDLAS LLYL E  E+C+VHRDIKSSNIMLD N NAK+GDFGLARLV+
Sbjct  434   NLLTWEFRFKIAQDLASGLLYLQEGWEQCVVHRDIKSSNIMLDLNFNAKIGDFGLARLVE  493

Query  1420  HEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTA-EECHV  1596
             H KGS+TTAL GTMGY+A EC  +G+ASKE+D+YSFGIV LEIACGRKPI+ TA EE  V
Sbjct  494   HAKGSQTTALGGTMGYMAPECATTGRASKESDVYSFGIVALEIACGRKPINLTAKEEDQV  553

Query  1597  NIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVL  1776
              +V WVW LYG+G+LL+A DP L  DF+ ++VE +MIVGLWCAHPD +LRPSIRQ I VL
Sbjct  554   YLVQWVWDLYGSGKLLEAVDPRLCRDFDEQQVECLMIVGLWCAHPDENLRPSIRQVIHVL  613

Query  1777  NFEAPLPDLPETMPVATFW-PQRNVQ  1851
             N EAPLP LP  MPV T++ P  N++
Sbjct  614   NSEAPLPALPPKMPVPTYFSPPANMR  639



>gb|EYU18393.1| hypothetical protein MIMGU_mgv1a026214mg [Erythranthe guttata]
Length=692

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/639 (55%), Positives = 438/639 (69%), Gaps = 47/639 (7%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLV-NNSIQITPNQRNC-----IGRATYSEPLHL  198
             P   PL FNF  F+P+++ +I +ER++   NN IQ+T NQR+      IGRATYS PLHL
Sbjct  16    PYASPLIFNFTSFSPNDL-DIHYERSAYAANNVIQLTTNQRDSSPFASIGRATYSTPLHL  74

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
             WDK + KL+ F+T+F+FVI+S   A+YGDG +FFLAP GS+IP  ATKGG  GL  D++ 
Sbjct  75    WDKASNKLTDFSTNFSFVINSLNKAEYGDGISFFLAPSGSKIPQGATKGGAMGLTVDNDT  134

Query  379   LNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPW--SPDIEGGWGSEAWINY  549
             LNS+ NPFVAVEFD+Y N +D   +HVGIDV+S++SV    W     I  G    AW+NY
Sbjct  135   LNSTDNPFVAVEFDIYSNEWDPPNEHVGIDVNSMRSVANRTWWSGVSIMQGLKHTAWVNY  194

Query  550   DPRSMNLSVVFRNF--GSY--GHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
             D  S NL+VVF  F  GSY    VS  +DLR+YLPE VTFGF+ +TG  +AL  I SW F
Sbjct  195   DSGSKNLNVVFSGFRNGSYVRQRVSQTVDLREYLPEFVTFGFSASTGNASALHSILSWRF  254

Query  718   TSALDISENQADTKSTgkglviglvvggcfliggS----------------MAFSFLAWR  849
             TS LD+   Q    +TG   V             +                +    + W+
Sbjct  255   TSNLDLEVVQGSVTNTGLVSVGPTSPISVSSKNNAGLAVGLSIGGSLLLLGLIVVVVFWK  314

Query  850   KRKMR------EEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSV  1011
             KR  R      +EF D I G+  E+  G+GPK+F+Y ELARATN FS+ DKLGEGGFG V
Sbjct  315   KRINRLKKNEGDEFFDIIMGD-DEIERGSGPKKFSYDELARATNKFSEHDKLGEGGFGGV  373

Query  1012  YKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVY  1191
             YKGYL+ ++S VAVKR+S+GSKQGIKEYASEV++ISR+RH+NLV L+GWCHE K+LLLVY
Sbjct  374   YKGYLEGIKSNVAVKRISKGSKQGIKEYASEVKIISRLRHRNLVQLLGWCHEKKELLLVY  433

Query  1192  EFLSNGSLDSHLY---KGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIM  1362
             E + NGSLDSHL+     K  L W +R+KI Q LASALLYLHEE  +C+VHRDIKSSN+M
Sbjct  434   ELMPNGSLDSHLFGETSKKGSLNWDIRFKIAQGLASALLYLHEEWIQCVVHRDIKSSNVM  493

Query  1363  LDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTL  1542
             LDS+ NAKLGDFGLARLVDHEKG +TT LAGTMGY+A ECVV+GKASKETD+YSFG+V L
Sbjct  494   LDSDYNAKLGDFGLARLVDHEKGDQTTVLAGTMGYMAPECVVTGKASKETDVYSFGVVAL  553

Query  1543  EIACGRKPIDPTAEECHVN-IVDWVWKLYGTGQLLDAADPNL--SGDFNGREVEQMMIVG  1713
             EIA GR+PI       HV  +V+W W LYG G++L+ +DP L      N +E+ ++++VG
Sbjct  554   EIASGRRPIG----NGHVEGLVEWAWGLYGKGKVLEVSDPMLLICDRLNVKELRRLIVVG  609

Query  1714  LWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             LWC HPD S RPSI Q ++VL FE  LP LP  MPV  +
Sbjct  610   LWCVHPDSSARPSIGQVVRVLRFEGELPVLPLRMPVPIY  648



>ref|XP_004155489.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cucumis sativus]
Length=678

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/638 (52%), Positives = 430/638 (67%), Gaps = 40/638 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQIT----PNQRNCIGRATYSEPLHL  198
             ++P    LSFNF  F   N   I ++RT   N  I++T     N  N +GRATYS+PLHL
Sbjct  14    LVPFATSLSFNFTSFNQGNADMI-YDRTFPTNQVIELTGDSSNNNMNFVGRATYSQPLHL  72

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
             WD+ +G +SSF THF+F I+S G A YGDG  FF AP GS +  N ++G G G+  D E 
Sbjct  73    WDEGSGNMSSFQTHFSFAINSRGRANYGDGLTFFFAPNGSILQANISRGSGLGIGYDPEL  132

Query  379   LNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
              N +  F AVEFD+Y N++D   +HVGID++S++S+  + W  DI GG  ++ WINYD  
Sbjct  133   WNGTATFFAVEFDIYSNNFDPAFEHVGIDINSMKSIAYSRWKCDIMGGKRNDVWINYDSD  192

Query  559   SMNLSVVFRNFGSYG----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
             + NLSVVF  F +      H+ +++DLR  LPE VTFGF+ +TG + A   + SW F S 
Sbjct  193   THNLSVVFSGFENNNTLLQHLHHVVDLRLNLPEWVTFGFSASTGYEYATHSVYSWSFHST  252

Query  727   LDIS-------------------------ENQADTKSTgkglviglvvggcfliggSMAF  831
             L+++                          N   T  TG  + +G+  G  F+ G  + +
Sbjct  253   LELTLEPTFTTDPNSVASAPSPGPSLPPNNNDGSTSKTGLEIGLGIAGGVIFVGGLVIVW  312

Query  832   SFLAWRKRKMREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSV  1011
               + W+K    +  +++I  +  E   G GP+RF Y+ELARATN+F +  KLGEGGFG V
Sbjct  313   -IIVWKKMAAMKNIEEEIMLDDSEFEKGKGPRRFLYKELARATNNFKEDKKLGEGGFGGV  371

Query  1012  YKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVY  1191
             YKG+L+EL   VAVKR+S+GSKQGIKEYASEV++IS++RH+NLV LIGWCHE  +LLLVY
Sbjct  372   YKGFLRELNCNVAVKRISKGSKQGIKEYASEVKIISQLRHRNLVQLIGWCHEKDELLLVY  431

Query  1192  EFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDS  1371
             EF+ NGSLD+HL+K  + LTW LRYKI Q +ASALLYLHEE E C++HRDIKSSN+MLD 
Sbjct  432   EFMPNGSLDTHLFKPNNFLTWELRYKIGQGIASALLYLHEEWEMCVLHRDIKSSNVMLDL  491

Query  1372  NLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIA  1551
             N NAKLGDFGLARLV+H KGS+TTALAGT+GY+A EC  +G+A+KETD+YSFGIV LEIA
Sbjct  492   NYNAKLGDFGLARLVNHGKGSQTTALAGTLGYLAPECATTGRATKETDVYSFGIVALEIA  551

Query  1552  CGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNG-----REVEQMMIVGL  1716
             CGR P +P  EE  + +V+WVWKLYG G++LDA D  L  +        + +E +M+VGL
Sbjct  552   CGRMPFNPNVEEEKMVMVEWVWKLYGCGKVLDAIDSKLRKEIRSFGDEEKMMECLMVVGL  611

Query  1717  WCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             WCAHPD + RPSIRQAI VLNFEAPLP LP  +P  T+
Sbjct  612   WCAHPDSNARPSIRQAINVLNFEAPLPILPSHLPAPTY  649



>gb|KGN43786.1| hypothetical protein Csa_7G067410 [Cucumis sativus]
Length=678

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/638 (52%), Positives = 430/638 (67%), Gaps = 40/638 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQIT----PNQRNCIGRATYSEPLHL  198
             ++P    LSFNF  F   N   I ++RT   N  I++T     N  N +GRATYS+PLHL
Sbjct  14    LVPFATSLSFNFTSFNQGNADMI-YDRTFPTNQVIELTGDSSNNNMNFVGRATYSQPLHL  72

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
             WD+ +G +SSF THF+F I+S G A YGDG  FF AP GS +  N ++G G G+  D E 
Sbjct  73    WDEGSGNMSSFQTHFSFAINSRGRANYGDGLTFFFAPNGSILQANISRGSGLGIGYDPEL  132

Query  379   LNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
              N +  F AVEFD+Y N++D   +HVGID++S++S+  + W  DI GG  ++ WINYD  
Sbjct  133   WNGTATFFAVEFDIYSNNFDPPFEHVGIDINSMKSIAYSRWKCDIMGGKRNDVWINYDSD  192

Query  559   SMNLSVVFRNFGSYG----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
             + NLSVVF  F +      H+ +++DLR  LPE VTFGF+ +TG + A   + SW F S 
Sbjct  193   THNLSVVFSGFENNNTLLQHLHHVVDLRLNLPEWVTFGFSASTGYEYATHSVYSWSFHST  252

Query  727   LDIS-------------------------ENQADTKSTgkglviglvvggcfliggSMAF  831
             L+++                          N   T  TG  + +G+  G  F+ G  + +
Sbjct  253   LELTLEPTFTTDPNSVASAPSPGPSLPPNNNDGSTSKTGLEIGLGIAGGVIFVGGLVIVW  312

Query  832   SFLAWRKRKMREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSV  1011
               + W+K    +  +++I  +  E   G GP+RF Y+ELARATN+F +  KLGEGGFG V
Sbjct  313   -IIVWKKMAAMKNIEEEIMLDDSEFEKGKGPRRFLYKELARATNNFKEDKKLGEGGFGGV  371

Query  1012  YKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVY  1191
             YKG+L+EL   VAVKR+S+GSKQGIKEYASEV++IS++RH+NLV LIGWCHE  +LLLVY
Sbjct  372   YKGFLRELNCNVAVKRISKGSKQGIKEYASEVKIISQLRHRNLVQLIGWCHEKDELLLVY  431

Query  1192  EFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDS  1371
             EF+ NGSLD+HL+K  + LTW LRYKI Q +ASALLYLHEE E C++HRDIKSSN+MLD 
Sbjct  432   EFMPNGSLDTHLFKPNNFLTWELRYKIGQGIASALLYLHEEWEMCVLHRDIKSSNVMLDL  491

Query  1372  NLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIA  1551
             N NAKLGDFGLARLV+H KGS+TTALAGT+GY+A EC  +G+A+KETD+YSFGIV LEIA
Sbjct  492   NYNAKLGDFGLARLVNHGKGSQTTALAGTLGYLAPECATTGRATKETDVYSFGIVALEIA  551

Query  1552  CGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNG-----REVEQMMIVGL  1716
             CGR P +P  EE  + +V+WVWKLYG G++LDA D  L  +        + +E +M+VGL
Sbjct  552   CGRMPFNPNVEEEKMVMVEWVWKLYGCGKVLDAIDSKLRKEIRSFGDEEKMMECLMVVGL  611

Query  1717  WCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             WCAHPD + RPSIRQAI VLNFEAPLP LP  +P  T+
Sbjct  612   WCAHPDSNARPSIRQAINVLNFEAPLPILPSHLPAPTY  649



>ref|XP_002262748.2| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Vitis vinifera]
Length=688

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/627 (55%), Positives = 440/627 (70%), Gaps = 30/627 (5%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSI-QITPNQRNCIGRATYSEPLHLWDK  207
             +IP    L FNF  F+P N  NIT+E ++   N I Q+T  Q   IG ATY +PLHLWDK
Sbjct  10    MIPSATSLDFNFTSFSPYN-DNITYEGSAFPRNQIIQLTQAQSASIGWATYVQPLHLWDK  68

Query  208   PTGKLSSFNTHFAFVIDS-NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
              +G L+ F THF+FVID+ N S  +GDG AFFL P  S+  PN TKGGG GLA+D + LN
Sbjct  69    ASGNLTDFTTHFSFVIDTQNRSGSHGDGIAFFLMPADSQ-KPNVTKGGGLGLASDTQPLN  127

Query  385   SS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
             ++ N FVAVEFD+Y N +D    H GID++S+QS+    W   I  G  ++AWI+Y+  S
Sbjct  128   TTVNHFVAVEFDIYKNRWDPNDTHAGIDINSVQSIRNVKWWDSIINGRRNDAWISYNSSS  187

Query  562   MNLSVVFRNFGS-----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
              NLSVVF  F +       ++ Y +DLR YLPE V+FGF+GATG  +A+  I SW F+S+
Sbjct  188   KNLSVVFTGFRNDSTILQDNLYYEVDLRLYLPEWVSFGFSGATGNASAIHAIYSWSFSSS  247

Query  727   LDISEN-------QADTKSTgkglviglvvggcfliggSMA------------FSFLAWR  849
             L   EN       +A+T ++         +    ++G ++             F FL  R
Sbjct  248   LQTDENKTNPTSPEAETPTSNPNSNPSRKIKVKLVVGLTVGGCAFVGGLSLVLFLFLKSR  307

Query  850   KRKMREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLK  1029
             + K+     D +     +   G GPK+F Y ELA +TN+F+++ KLGEGGFG VYKG+LK
Sbjct  308   RGKVDNPVIDQLSME-DDFEKGTGPKKFRYNELASSTNNFAEEGKLGEGGFGGVYKGFLK  366

Query  1030  ELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNG  1209
             EL+SY+AVKRVS GSKQGIKEY SEV++ISR+RH+NLV LIGWCHE +DLLLVYEF+ NG
Sbjct  367   ELDSYIAVKRVSSGSKQGIKEYVSEVKIISRLRHRNLVQLIGWCHEKRDLLLVYEFMPNG  426

Query  1210  SLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKL  1389
             SL+SH++  +SLLTW +RYKI Q LASALLYLHE  E+C++HRDIKSSNIMLDS  NAKL
Sbjct  427   SLESHIFSERSLLTWEMRYKIAQGLASALLYLHEGWEQCVLHRDIKSSNIMLDSGFNAKL  486

Query  1390  GDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPI  1569
             GDFGLARLVDH KGS+TT LAGTMGY+A EC  +GKASK++DIYSFG+V LEIACGRKPI
Sbjct  487   GDFGLARLVDHGKGSQTTVLAGTMGYMAPECATTGKASKQSDIYSFGVVALEIACGRKPI  546

Query  1570  DPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRP  1749
             +  A+E  + +++WVW LYG G +L+AADP L  +F+ ++++ +M VGLWCAHPD +LRP
Sbjct  547   NLKAKEDQIMMLEWVWDLYGKGNILEAADPRLCAEFDAQQMQCLMTVGLWCAHPDRNLRP  606

Query  1750  SIRQAIQVLNFEAPLPDLPETMPVATF  1830
             S+R+ I VLNFEAPLP LP  MPV T+
Sbjct  607   SVREVIHVLNFEAPLPILPPKMPVPTY  633



>ref|XP_004155490.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cucumis sativus]
Length=697

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/615 (53%), Positives = 432/615 (70%), Gaps = 22/615 (4%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQIT----PNQRNCIGRATYSEPLHLW  201
             + L + L+FNF  F  SN   I +E+    N +I++T       +N  GRATY +P HLW
Sbjct  28    LTLANSLAFNFSSFDSSNTH-IFYEKAFPSNRTIKLTGETVNKNQNFTGRATYFKPFHLW  86

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             DKP+G LSSF THF+F IDS G+ +YGDG  FF AP  SR+    +KG G G+  +    
Sbjct  87    DKPSGNLSSFQTHFSFAIDSEGAERYGDGLTFFFAPNNSRLDAEISKGSGLGIGYNPSLT  146

Query  382   N-SSNPFVAVEFDVYLNHYDTEQK--HVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
             N + + F A+EFD++ N +D  QK  HVGID++S+ SV  + W  DI+ G  ++ WINYD
Sbjct  147   NLTYSSFFAIEFDIFSNFFDPPQKVEHVGIDINSMSSVAYSIWKCDIKSGRRTDVWINYD  206

Query  553   PRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFT  720
               ++NLS+ F  + +       +++ +D R  LPE VTFGF+ ATG   A   I SW F 
Sbjct  207   SATLNLSITFTGYENNKTILQRLNHDVDFRLTLPEWVTFGFSAATGTLYATHNIYSWDFK  266

Query  721   SALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG  900
             S L+++ +     S G+G  +GLVVG        +   FL  RK++M+  +++D+  +  
Sbjct  267   STLNLNSDSNLAPSPGQGSKVGLVVGVGV----GVGVVFLK-RKKRMKMNWEEDVVLDDS  321

Query  901   ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQ  1080
             E   G GP++F+Y ELARATN+F + +KLGEGGFG VYKG+L++L SYVAVK+VS+GS+Q
Sbjct  322   EFEKGKGPRKFSYSELARATNNFWEDEKLGEGGFGGVYKGFLRDLNSYVAVKKVSKGSRQ  381

Query  1081  GIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPL  1260
             GIKEYASEV++IS++RH+NLV LIGWCHE  +LLLVYEF+SNGSLD+HL+K  + LTW  
Sbjct  382   GIKEYASEVKIISQLRHRNLVQLIGWCHERGELLLVYEFMSNGSLDAHLFKENNFLTWEH  441

Query  1261  RYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRT  1440
             RYK+ Q +ASALLYLHEE EKC++HRDIKSSN+MLDS+ NAKLGDFGLARLVDH  GS+T
Sbjct  442   RYKVAQGIASALLYLHEEWEKCVIHRDIKSSNVMLDSDFNAKLGDFGLARLVDHAIGSQT  501

Query  1441  TALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWK  1620
             T LAGTMGY+A EC +SG+ASKE+D++SFGIV LEIACGR+P +P  EE  + +V+WVW+
Sbjct  502   TVLAGTMGYMAPECAISGRASKESDVFSFGIVALEIACGRRPYNPNVEEAKMVMVEWVWE  561

Query  1621  LYGTGQLLDAADPNLSGDF-----NGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFE  1785
             LYG G+LL+AAD  L G F       +++E +M+VGLWCAHPD + RPSIRQAI V+NFE
Sbjct  562   LYGNGRLLEAADTKLHGSFENEPQQSQQIECLMVVGLWCAHPDINCRPSIRQAIHVMNFE  621

Query  1786  APLPDLPETMPVATF  1830
             A LP LP   P   +
Sbjct  622   ASLPVLPLQFPTLAY  636



>gb|KDP35960.1| hypothetical protein JCGZ_09932 [Jatropha curcas]
Length=709

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/635 (51%), Positives = 428/635 (67%), Gaps = 42/635 (7%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRN-----CIGRATYSEPLHLWDKPT  213
             PLSFNF  F  ++ +  T    S+ +  I++T N R+      +GRATY +PLHLWDK +
Sbjct  38    PLSFNFPSFDSNHPEIYTERNASVSSEGIELTTNMRDLDQSGSVGRATYIKPLHLWDKAS  97

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN---  384
             G L++F THF+F+I+S G + YGDG AFFLAP GSR+P N   GGG GL  DD   +   
Sbjct  98    GNLTNFTTHFSFIINSKGKSNYGDGLAFFLAPNGSRVPSNVKAGGGLGLVIDDNSTHALN  157

Query  385   -SSNPFVAVEFDVYLNHYDTEQ-KHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
              S N FVAVEFD Y N +D     HVGI++ S++SV T  W+  ++ G  ++A I YD  
Sbjct  158   YSENQFVAVEFDTYQNEWDRPMFDHVGINIRSMKSVATVTWANCVKYGRTTDALITYDAS  217

Query  559   SMNLSVVFRNFGSYG------HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFT  720
                L V+F     +G      ++S  +D+ K+LPE VTFGF+ +TG    +  I SW F 
Sbjct  218   QKILDVIFSQANDFGNEVIQNYLSARVDMAKHLPEWVTFGFSASTGLSYEINRITSWGFN  277

Query  721   SALDISENQADT--------------------KSTgkglviglvvggcfliggSMAFSFL  840
             S+ +I +++  +                    K++         +         +A  F+
Sbjct  278   SSSEILDDENASLPSNIAPAPAPPPAKIPQIYKASRGKAGKLAGLSVAACTLIIIAVGFV  337

Query  841   AWRKRKMREEFD--DDIFGNIGELG--GGAGPKRFTYRELARATNSFSQQDKLGEGGFGS  1008
             ++  RK R++    D  F    E G   G GP++F+Y ELA AT +FS+ +KLGEGGFG+
Sbjct  338   SYHLRKKRKQVKTCDPTFDVSLEDGFNNGTGPRKFSYNELANATTNFSEGEKLGEGGFGA  397

Query  1009  VYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLV  1188
             VY+G+LKEL+SYVAVKRVSRGSKQGIKEY +EV++IS++RH+NLV L GWCHE ++LLL 
Sbjct  398   VYRGFLKELDSYVAVKRVSRGSKQGIKEYIAEVKIISKMRHRNLVKLFGWCHE-RELLLA  456

Query  1189  YEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLD  1368
             YEF+ NGSLDSHL+  KSLLTW +RY+I Q LASA+LYLHEE ++C++HRDIKSSNIMLD
Sbjct  457   YEFMPNGSLDSHLFNVKSLLTWEVRYRIAQGLASAVLYLHEEGDQCVLHRDIKSSNIMLD  516

Query  1369  SNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEI  1548
             SN NAKLGDFGLARLVDH KG +TT LAGTMGY+A EC  SGKASKE+DIYSFGIV LEI
Sbjct  517   SNFNAKLGDFGLARLVDHAKGFQTTVLAGTMGYMAPECFTSGKASKESDIYSFGIVALEI  576

Query  1549  ACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAH  1728
             ACGR+ ++P  EE    IV+WVW+LYG G++L+A DP L GDFN +E+E+++IVGLWC H
Sbjct  577   ACGRRVVEPRLEENQARIVEWVWELYGMGKILEATDPKLCGDFNEQEIERLLIVGLWCVH  636

Query  1729  PDCSLRPSIRQAIQ-VLNFEAPLPDLPETMPVATF  1830
             PDC  RP++RQ I  +L  EAPLP LP  MPV T+
Sbjct  637   PDCKFRPTVRQVINLLLTSEAPLPILPPEMPVPTY  671



>ref|XP_006351840.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Solanum tuberosum]
Length=684

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/626 (53%), Positives = 433/626 (69%), Gaps = 26/626 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTS---LVNNSIQITPNQRNCI-----GRATYSE  186
             +IP ++ L+FN     PS V N++   T    +    IQ+TPN+RN       GRA Y E
Sbjct  17    VIPSLYSLNFNLTNINPSYV-NLSINVTGDAYVTKQGIQVTPNERNITLSRKTGRAMYIE  75

Query  187   PLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAN  366
              L LWDK TG+++ F THF+FVIDSNG+ ++ DG AFFLAP+GS IP   + G G GL +
Sbjct  76    TLQLWDKATGEMTDFTTHFSFVIDSNGNDRFADGLAFFLAPVGSSIPV-GSFGSGLGLVD  134

Query  367   -DDERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWI  543
              + E ++S   FVAVEFD ++N++D    HVGI+++S++SV T  W  DI+ G  ++AWI
Sbjct  135   AETENMSSHESFVAVEFDTHVNNWDPSDIHVGININSMESVATTIWKNDIKLGKKNDAWI  194

Query  544   NYDPRSMNLSVVFRNFG---SYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             +Y+  S  L VVF  F    +   +SY +DLR YLPE V+FGF+ +TG+      + SW 
Sbjct  195   SYNANSKVLEVVFTGFEKKYNRDKLSYPVDLRDYLPENVSFGFSASTGQLFQKNNVKSWD  254

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggS---------MAFSFLAWRKRKMRE  867
             F S+L     +   + +      G    G  +             +  S   W+K+K  +
Sbjct  255   FNSSLSFDAIKVPQQPSAILSTSGKGSKGLLVGSSIGLPILILGLITASCFLWKKKKKGD  314

Query  868   EFDDDIFGNIG---ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELE  1038
             +  D +F ++    E   G GPK+F+Y ELARATN+F++  KLGEGGFG VYKG LKE  
Sbjct  315   KKLDHVFIDLDMDDEFEKGTGPKKFSYGELARATNNFAEGQKLGEGGFGDVYKGLLKECN  374

Query  1039  SYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLD  1218
             SYVAVKRVS+GSKQGI EYASEV++ISR+RH+NLV LIGWCHE + L LVYE + N SLD
Sbjct  375   SYVAVKRVSKGSKQGIMEYASEVKIISRLRHRNLVQLIGWCHEKEKLHLVYELMPNESLD  434

Query  1219  SHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDF  1398
              HL+K KSLL W +R+KI Q +ASALLYLHEE E+C+VHRDIK+SN+MLDSN  AKLGDF
Sbjct  435   KHLFKDKSLLVWEIRWKIAQAIASALLYLHEEWEQCVVHRDIKASNVMLDSNFTAKLGDF  494

Query  1399  GLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPT  1578
             GLARL+DH+KGS+TT LAGT+GY+A EC+++GKASKE+D+YSFGIV LEIA GR+ I+  
Sbjct  495   GLARLIDHDKGSQTTMLAGTVGYMAPECIMNGKASKESDVYSFGIVALEIASGRRSINIK  554

Query  1579  AEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIR  1758
             A E  V +V+WVW LYGTG+L++A DP L+  FN +E+E++M++GLWCAHPD  LRPSIR
Sbjct  555   APEDEVRLVEWVWSLYGTGELVEATDPRLNKMFNEKEMERLMVIGLWCAHPDNKLRPSIR  614

Query  1759  QAIQVLNFEAPLPDLPETMPVATFWP  1836
             QAI VLN EA LP+LP  MPVAT+ P
Sbjct  615   QAIHVLNSEAQLPNLPSRMPVATYSP  640



>ref|XP_004504938.1| PREDICTED: uncharacterized protein LOC101491058 [Cicer arietinum]
Length=1384

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/631 (54%), Positives = 436/631 (69%), Gaps = 33/631 (5%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSL-VNNSIQITPNQRN-----CIGRATYSEPL  192
             +IP    L+FNF  F P N + I +E ++   +++IQ+  NQ+       IGRATY +P+
Sbjct  23    MIPYASSLTFNFTSFDP-NEKTIVYEGSAYSASSAIQLITNQQGKLMNGSIGRATYYQPI  81

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
             HLWDK T  L+ F +HF FVIDS     YGDG AFFL P GS++P NATKGG  GL  D+
Sbjct  82    HLWDKTTRNLTDFTSHFTFVIDSQKKQIYGDGLAFFLVPSGSKMP-NATKGGSMGLTLDN  140

Query  373   ERLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
             + LNS+ NPFVAVEFD++ N++D   +H GI+++S+ SV    W  DI+ G  +EAWI+Y
Sbjct  141   QPLNSTDNPFVAVEFDIFKNYWDPPHEHAGININSVISVANVTWLADIKDGQLNEAWISY  200

Query  550   DPRSMNLSVVFRNFGSYG------HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSW  711
             +  S+NLS+VF  F +        H+S I+DLR YLPE VT GF+ ATG  TA+  I+SW
Sbjct  201   NASSLNLSLVFTGFDNVTSNIVNQHLSSIVDLRLYLPEFVTIGFSAATGDLTAIHSISSW  260

Query  712   IFTSALDISENQADT---------------KSTgkglviglvvggcfliggSMAFSFLAW  846
              F+S L+  E    +               K       + + +     +      S   W
Sbjct  261   DFSSTLEAQETNTTSIGDPVPRSPSSNIAPKKKKTKTGLAVGLSVGGFVIIGFFISICLW  320

Query  847   RK--RKMREEFDDDIFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYK  1017
             +K  R   EE DD+    +GE    GAGPK++TY ELA A N+F  + KLG+GGFG VY+
Sbjct  321   KKFKRGKEEEEDDEFEEYMGEDFERGAGPKKYTYAELAHAANNFKDEHKLGQGGFGGVYR  380

Query  1018  GYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEF  1197
             G+LK+ +SYVA+KRVS  S+QGIKE+ASEV +ISR+RH+NLV LIGWCHE K LLLVYE+
Sbjct  381   GFLKDKKSYVAIKRVSEDSQQGIKEFASEVTIISRLRHRNLVQLIGWCHERKKLLLVYEY  440

Query  1198  LSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNL  1377
             + NGSLD HL+K +SLL W +RY I + LASALLYLHEE E+C+VHRDIK+SNIMLDS  
Sbjct  441   MQNGSLDIHLFKKQSLLKWGVRYTIARGLASALLYLHEEWEQCVVHRDIKASNIMLDSEF  500

Query  1378  NAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACG  1557
             NAKLGDFGLAR VDH K ++TTALAGTMGY+A EC  +G+ASKETD+YSFGIV LEIACG
Sbjct  501   NAKLGDFGLARFVDHAKSAQTTALAGTMGYMAPECATTGRASKETDVYSFGIVALEIACG  560

Query  1558  RKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDC  1737
             RKPI+  A+E   +IV WVW LYG G++L+A DP L GDF+  +++ MMIVGLWC HPD 
Sbjct  561   RKPINLKAQESETHIVQWVWGLYGRGRILEAVDPRLVGDFDEEQIKCMMIVGLWCTHPDP  620

Query  1738  SLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             + RPSIRQAIQVLNFEA +P+LP +MPV T+
Sbjct  621   TNRPSIRQAIQVLNFEASMPNLPLSMPVPTY  651


 Score =   556 bits (1434),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 289/607 (48%), Positives = 396/607 (65%), Gaps = 20/607 (3%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVNNSI-QITPNQRNCIGRATYSEPLHLWDKPTGKLS  225
             PLSFN++ F+        F         + Q+T  +++ +GR  YS+  HLWD  T +++
Sbjct  732   PLSFNYEQFSGDMTNAFNFSGDVYQEKQVLQLTKYEKDSLGRVIYSKLFHLWDINTSQVT  791

Query  226   SFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAN----DDERLNSSN  393
              F T F+F I++      GDG  FFLA     +P     G G GL +    D+   +  N
Sbjct  792   DFTTSFSFTINTPNKTHRGDGITFFLASPNFPLPA-PRDGSGIGLISRAQKDNPNFSKEN  850

Query  394   PFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLS  573
              FVAVEFD  +N +D    HVGIDV+++ +  T  W   ++   G +A ++Y+  S NL+
Sbjct  851   HFVAVEFDTVVNDWDPTYDHVGIDVNAINTSYTTQWFTSLDER-GYDAVVSYNSSSNNLT  909

Query  574   VVFRNFGSYGHVSY----ILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISE  741
             V F  +     V      ++ L+ YLP+ V FGF  ATG       + SW F S+LD  E
Sbjct  910   VTFTGYQDNSIVKQNLFSVVILKDYLPDWVEFGFTSATGLSFEEHTLRSWSFNSSLDF-E  968

Query  742   NQADTKSTgkglviglvvggcfliggSMAFSFLAWR--KRKMRE--EFDDDIFGNIGELG  909
                D   TG  + + +      +    +A   + W+   R M++   FD ++  +     
Sbjct  969   AHKDGSKTGLVIGLSIGGACVLIFVLGLA-CLVKWKLKNRDMKDGLHFDHEMDNDFER--  1025

Query  910   GGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIK  1089
               + PK+FT+ ELA ATN+F++  K+GEGGFG VYKG+L+++++ VA+K+VS+GS QG+K
Sbjct  1026  -SSLPKKFTFEELAGATNNFAKDHKIGEGGFGGVYKGFLRDMKTRVAIKKVSKGSNQGVK  1084

Query  1090  EYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYK  1269
             EYASEV+VIS++RHKNLV L GWCH+  DLLLVYEF+ NGSLDS+L+KGK LLTW +RY 
Sbjct  1085  EYASEVKVISQLRHKNLVQLFGWCHKQNDLLLVYEFVENGSLDSYLFKGKGLLTWTVRYN  1144

Query  1270  IVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTAL  1449
             IV+ LASALLYLHEECE+C++HRDIKSSN+MLDSN N KLGDFGLARL++HE GS+TT L
Sbjct  1145  IVRGLASALLYLHEECEQCVLHRDIKSSNVMLDSNFNTKLGDFGLARLMNHEIGSKTTVL  1204

Query  1450  AGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYG  1629
             AGT GY++ E    GKAS+E+D+YSFG+V LEIACGRK I+P   E ++ +VDWVW+LYG
Sbjct  1205  AGTYGYLSPEAATRGKASRESDVYSFGVVALEIACGRKAIEPNLSEENIYLVDWVWELYG  1264

Query  1630  TGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPE  1809
              G+LL A+D  L G++N +EVE++MIVGLWC H D   RP IRQAIQVL+F+APLP LP 
Sbjct  1265  KGELLKASDSRLYGEYNEKEVERLMIVGLWCTHIDYLQRPVIRQAIQVLSFDAPLPILPS  1324

Query  1810  TMPVATF  1830
              M  +T+
Sbjct  1325  KMDTSTY  1331



>ref|XP_002518332.1| kinase, putative [Ricinus communis]
 gb|EEF44092.1| kinase, putative [Ricinus communis]
Length=701

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/635 (52%), Positives = 425/635 (67%), Gaps = 45/635 (7%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVN-NSIQITPNQRNC-----IGRATYSEPLHLWDKP  210
             P+SFNF  F  SN   I  ER + V+   I +T N R       +GRATY+ PLHLWDK 
Sbjct  40    PISFNFSGFD-SNHPEIFTERDACVSIEGIDLTTNTRGTDQGKRVGRATYTNPLHLWDKV  98

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD---ERL  381
             +G L++F THF+F+I+SNG + YGDG  FFLA  GSR+P N   GGG GLA +D     L
Sbjct  99    SGNLTNFTTHFSFIINSNGESNYGDGLTFFLALNGSRVPQNMEAGGGLGLAINDNVSHAL  158

Query  382   N-SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
             N + N FVA+EFD Y N +D    HVGI++ S++SV    W  ++  G  ++AWI YD  
Sbjct  159   NYAENQFVAIEFDTYKNPWDPLNDHVGINIRSMKSVEHVSWLSEVRQGITTDAWIRYDSS  218

Query  559   SMNLSVVFRNFGSY------GHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFT  720
                LSV F +   Y      G VS ++DL K+LPE VTFGF+ +TG    +  I SW F 
Sbjct  219   QKVLSVKFAHIDRYSNSIVEGKVSAVVDLAKHLPEWVTFGFSASTGLSKEMNRITSWEFN  278

Query  721   SALDISE---NQADTKSTgkglviglvvggcfliggSMA-------------------FS  834
             S+ DI E    Q+D   T                   +                     S
Sbjct  279   SSSDIVELNTTQSDPAGTANITPAANTGLLSKKSKSKIIGLVAGLSVGACVSIVGAGFAS  338

Query  835   FLAWRKRKMREEFDDDIF--GNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGS  1008
             +L  RK++++   DD +F      +   G GP++ +Y ELA AT++FS+  KLGEGGFG+
Sbjct  339   YLLRRKKQLKT--DDPVFDFAFSDDFKNGTGPRKLSYNELADATDNFSEVKKLGEGGFGA  396

Query  1009  VYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLV  1188
             VY+G+LKE+ SYVAVKRVS+ SKQGIKEYA+EV++ISR+RH+NLV L+GWCHE ++LLL 
Sbjct  397   VYRGFLKEINSYVAVKRVSKESKQGIKEYAAEVKIISRMRHRNLVKLMGWCHE-RELLLA  455

Query  1189  YEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLD  1368
             YEF+  GSLD+HL+KGKSLL W +RYKI Q LASALLYLHEE ++C++HRDIKSSNIMLD
Sbjct  456   YEFMPGGSLDAHLFKGKSLLKWEVRYKIAQGLASALLYLHEESDQCVLHRDIKSSNIMLD  515

Query  1369  SNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEI  1548
             S+ +AKLGDFGLARLVDH KGS+TT LAGTMGY+A EC  +GKASKE+DIYSFG+V LE+
Sbjct  516   SSFDAKLGDFGLARLVDHAKGSQTTVLAGTMGYMAPECFTTGKASKESDIYSFGVVALEM  575

Query  1549  ACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAH  1728
             ACGR+ ++P  EE    +++WVW+LYG G+LL AADP LSGDFN +E+E++MIVGL CAH
Sbjct  576   ACGRRVLEPGIEENQTRLMEWVWELYGIGKLLQAADPKLSGDFNEQEMERLMIVGLCCAH  635

Query  1729  PDCSLRPSIRQAIQVL-NFEAPLPDLPETMPVATF  1830
             PD + RPSIRQ I +L + E PLP LP  MPV  +
Sbjct  636   PDHAFRPSIRQVINLLISSEVPLPVLPPEMPVPAY  670



>ref|XP_004137070.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cucumis sativus]
 gb|KGN43785.1| hypothetical protein Csa_7G067400 [Cucumis sativus]
Length=710

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/623 (52%), Positives = 428/623 (69%), Gaps = 25/623 (4%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQIT----PNQRNCIGRATYSEPLHLW  201
             + L + L+FNF  F  SN   I +E+    N +I++T       +N  GRATY +P HLW
Sbjct  28    LTLANSLAFNFSSFDSSNTH-IFYEKAFPSNRTIKLTGETVNKNQNFTGRATYFKPFHLW  86

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             DKP+G LSSF THF+F IDS G+ +YGDG  FF AP  SR+    +KG G G+  +    
Sbjct  87    DKPSGNLSSFQTHFSFAIDSEGAERYGDGLTFFFAPNNSRLDAEISKGSGLGIGYNPSLT  146

Query  382   N-SSNPFVAVEFDVYLNHYDTEQK--HVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
             N + + F A+EFD++ N +D  QK  HVGID++S+ SV  + W  DI+ G  ++ WINYD
Sbjct  147   NLTYSSFFAIEFDIFSNFFDPPQKVEHVGIDINSMSSVAYSIWKCDIKSGRRTDVWINYD  206

Query  553   PRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFT  720
               ++NLS+ F  + +       +++ +D R  LPE VTFGF+ ATG   A   I SW F 
Sbjct  207   SATLNLSITFTGYENNKTILQRLNHDVDFRLTLPEWVTFGFSAATGTLYATHNIYSWDFK  266

Query  721   SALDI--------SENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFD  876
             S L++        S  Q        G+ +G+ V         +   FL  RK++M+  ++
Sbjct  267   STLNLNSDSNLAPSPGQGSKVGLVVGVGVGVGVVFLVCGLIIVWICFLKKRKKRMKMNWE  326

Query  877   DDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVK  1056
             +D+  +  E   G GP++F+Y ELARATN+F + +KLGEGGFG VYKG+L++L SYVAVK
Sbjct  327   EDVVLDDSEFEKGKGPRKFSYSELARATNNFWEDEKLGEGGFGGVYKGFLRDLNSYVAVK  386

Query  1057  RVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKG  1236
             +VS+GS+QGIKEYASEV++IS++RH+NLV LIGWCHE  +LLLVYEF+SNGSLD+HL+K 
Sbjct  387   KVSKGSRQGIKEYASEVKIISQLRHRNLVQLIGWCHERGELLLVYEFMSNGSLDAHLFKE  446

Query  1237  KSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLV  1416
              + LTW  RYK+ Q +ASALLYLHEE EKC++HRDIKSSN+MLDS+ NAKLGDFGLARLV
Sbjct  447   NNFLTWEHRYKVAQGIASALLYLHEEWEKCVIHRDIKSSNVMLDSDFNAKLGDFGLARLV  506

Query  1417  DHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHV  1596
             DH  GS+TT LAGTMGY+A EC +SG+ASKE+D++SFGIV LEIACGR+P +P  EE  +
Sbjct  507   DHAIGSQTTVLAGTMGYMAPECAISGRASKESDVFSFGIVALEIACGRRPYNPNVEEAKM  566

Query  1597  NIVDWVWKLYGTGQLLDAADPNLSGDFNG-----REVEQMMIVGLWCAHPDCSLRPSIRQ  1761
              +V+WVW+LYG G+LL+AAD  L G F       +++E +M+VGLWCAHPD + RPSIRQ
Sbjct  567   VMVEWVWELYGNGRLLEAADTKLHGSFENEPQQRQQIECLMVVGLWCAHPDINCRPSIRQ  626

Query  1762  AIQVLNFEAPLPDLPETMPVATF  1830
             AI V+NFEA LP LP   P   +
Sbjct  627   AIHVMNFEASLPVLPLQFPTLAY  649



>ref|XP_008226563.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Prunus mume]
Length=681

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/623 (52%), Positives = 430/623 (69%), Gaps = 29/623 (5%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPN-----QRNCIGRATYSEPL  192
             I P V PL+F+F +F+P+++  I+ E  T+L    +++T +     Q   +GRATY +P 
Sbjct  29    ITPSVTPLTFDFPIFSPTDINTISLEGDTNLDRQFLRLTKSCSLDQQEQSVGRATYHKPF  88

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              L +  TGKL+ F+THF F+I S  S++YG+G  FFLAP GS +     KG   GL  + 
Sbjct  89    LLRETTTGKLADFSTHFTFIIHSQNSSEYGNGLTFFLAPDGSLLNRKLGKGSNLGLPVEH  148

Query  373   ---ERLNSSNPFVAVEFDVYLNHYDTEQK----HVGIDVDSLQSVVTAPWSPDIEGGWGS  531
                    +  PFVAVEFD+  +   T Q     HVG+DV+SL+S  T PW+  +  G  +
Sbjct  149   LPGHMSTNQYPFVAVEFDISQSGIPTIQDPIYDHVGVDVNSLKSSKTGPWNGRVSDGQKN  208

Query  532   EAWINYDPRSMNLSVVFRNF--GSYG--------HVSYILDLRKYLPERVTFGFAGATGK  681
             EAWINY+  S  L+V F +F  G+ G        ++ +I+DL +YLP+RV  GF+ +TG 
Sbjct  209   EAWINYNSSSKILTVAFTSFVNGTNGTQLQRTINYLDHIIDLNQYLPDRVIVGFSASTGT  268

Query  682   DTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKM  861
               AL  INSW F S   + E+  D  + G  + +G+            A   L W+K ++
Sbjct  269   PVALHGINSWSFNSTSLLDESANDNINIGLAVGLGVGGCLIL-----FAGLVLFWKKGRL  323

Query  862   REEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELES  1041
             R+  ++ I  +  E   G GP++F Y ELA AT+ F +++KLGEGGFG VYKG++K+L S
Sbjct  324   RKSEEEPIVVD-DEFDKGTGPRKFPYNELALATSDFKEEEKLGEGGFGGVYKGFIKDLNS  382

Query  1042  YVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDS  1221
             YVAVKR+S+GSKQG KEY SEVR+ISR+RH+NLV LIGWCHE  +LLLVYEF+ NGSLDS
Sbjct  383   YVAVKRISKGSKQGQKEYTSEVRIISRLRHRNLVQLIGWCHEKGELLLVYEFMPNGSLDS  442

Query  1222  HLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFG  1401
             HL+K K++L W  RY+I Q LAS LLYLHEE E+C+VHRDIKSSNI+LDSN NAKLGDFG
Sbjct  443   HLFKAKNMLVWEARYRIAQGLASGLLYLHEEWEQCVVHRDIKSSNILLDSNFNAKLGDFG  502

Query  1402  LARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTA  1581
             LARLVDH + S+TT LAGTMGY+A EC+ +GKASKE+D+YSFG+V LEIACGRKPI+P  
Sbjct  503   LARLVDHGEQSQTTVLAGTMGYMAPECLTNGKASKESDVYSFGVVALEIACGRKPINPQL  562

Query  1582  EECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQ  1761
             E   +N+V+WVW+LYG G+LL+A D  L  DF+ +++E +MIVGLWCAHPD ++RPSI+Q
Sbjct  563   ERNQINMVEWVWELYGKGKLLEATDQKLCEDFDEKQMECLMIVGLWCAHPDYNMRPSIQQ  622

Query  1762  AIQVLNFEAPLPDLPETMPVATF  1830
             AIQVLNFEA LP LP   PVAT+
Sbjct  623   AIQVLNFEAALPVLPPKKPVATY  645



>ref|XP_008798729.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Phoenix dactylifera]
Length=680

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/615 (53%), Positives = 426/615 (69%), Gaps = 21/615 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQ-----RNCIGRATYSEPLH  195
             ++P    L+FNF  F  +  Q I F+  + +N  I++T N+      N +GRA Y EPL 
Sbjct  18    LVPSASSLAFNFSSFDQNTPQRIDFQGDAFLNKEIRLTKNELGTRITNSVGRAVYKEPLL  77

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             LWD  TG+L+ F THF+FVIDS   + YGDG AFFL+P  S IP N++ G   GL ++  
Sbjct  78    LWDSGTGELTDFITHFSFVIDSFNKSNYGDGLAFFLSPYPSSIPDNSS-GAYLGLFSEHP  136

Query  376   RLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
               N+S N  +AVEFD Y N +D  + H+GID+DS++S  T  W+  I+ G  + AW++Y 
Sbjct  137   APNTSPNRTLAVEFDSYQNAWDPSENHIGIDIDSIKSNDTVVWNSSIKDGRTANAWVSYT  196

Query  553   PRSMNLSVVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
               + NLSV         FG    +SYI+DLRK LPE+V  GF+ ATG    +  + SW F
Sbjct  197   ASTQNLSVFLTYAANPVFGGNSSLSYIVDLRKILPEKVAIGFSAATGDAVEIHNLLSWDF  256

Query  718   TSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRK--RKMREEFDDDIFG  891
             +S L+        K +  GLV+GL  G   L+   +    + WRK  R+ R+E D D   
Sbjct  257   SSTLE------PRKKSRTGLVVGLASGVAALVALLLLSCVILWRKKARRGRDEEDMDYDE  310

Query  892   NIG-ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSR  1068
             +I  E   G GP+RF Y EL RAT +FS++ KLGEGGFG+VYKG+L + +  VA+KRVS+
Sbjct  311   SIDDEFEQGRGPRRFPYSELVRATKNFSEEGKLGEGGFGAVYKGFLGDPKLDVAIKRVSK  370

Query  1069  GSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLL  1248
             GSKQG KEY SEV++ISR+RH++LV L+GWCH   + LLVYEF+ NGSLD HLY  + +L
Sbjct  371   GSKQGRKEYVSEVKIISRLRHRHLVQLVGWCHGRGEFLLVYEFMPNGSLDQHLYSTERIL  430

Query  1249  TWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEK  1428
             TWP+RYKI   LASALLYLHEE E+C+VHRD+K SN+MLDS  +AKLGDFGLARLVDH++
Sbjct  431   TWPMRYKIALGLASALLYLHEEWEQCVVHRDVKPSNVMLDSTFSAKLGDFGLARLVDHDR  490

Query  1429  GSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVD  1608
             GS+TT LAGTMGY+A ECV +GKASKE+D+YSFG+V LEIACGR+P++P  +   V +V+
Sbjct  491   GSQTTVLAGTMGYLAPECVTTGKASKESDVYSFGVVALEIACGRRPVEPWEKLSKVRLVE  550

Query  1609  WVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEA  1788
             WVW+LYG    L+AAD  LSG+F+ +++E++MIVGLWCAHPD +LRPSIRQAI VLN EA
Sbjct  551   WVWELYGRKTALEAADERLSGEFDEQQIERLMIVGLWCAHPDYNLRPSIRQAISVLNSEA  610

Query  1789  PLPDLPETMPVATFW  1833
             PLPDLP  MPV  ++
Sbjct  611   PLPDLPPKMPVPMYY  625



>gb|KDP35961.1| hypothetical protein JCGZ_09933 [Jatropha curcas]
Length=697

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/610 (53%), Positives = 416/610 (68%), Gaps = 17/610 (3%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVNNSIQITPN-----QRNCIGRATYSEPLHLWDKPT  213
             PL+F++ +F  ++   +T   TS+ N  I++T N     +   IGRATY +PLHLWDK +
Sbjct  40    PLNFSYPIFDSNHPDILTEGNTSVSNVGIELTMNLSDQKKGGSIGRATYKKPLHLWDKAS  99

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLA-NDDERLN-S  387
             G L++F THF+  IDS   + YGDG AFFLAP GS IPP+   GGG  LA ND   L+  
Sbjct  100   GNLTNFTTHFSVFIDSGTRSLYGDGLAFFLAPNGSTIPPDTKSGGGLCLAINDSLALDFH  159

Query  388   SNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMN  567
              N FVAVEFD Y N +D    H+GI++ S++S+ T  W  +   G  ++AWI+YD     
Sbjct  160   ENNFVAVEFDTYSNPWDPSTNHIGINIRSMKSITTVSWPSNKIEGKRTDAWISYDSSRKI  219

Query  568   LSVVFRNFGSY------GHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSAL  729
             L V +            G +S ++DL KYLPE VTFGF+G+TG    +  I SW F S+ 
Sbjct  220   LDVEYTYIDGISSSRINGSLSAVVDLGKYLPEWVTFGFSGSTGSLYQINRITSWAFDSSS  279

Query  730   DISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNI--GE  903
             DI +N +          +            +        RK++ + + +D +F      +
Sbjct  280   DIVDNFSSLNLEPAPSPVLSESKTINNGLMAGLIVGGVVRKQRKQTKTNDHVFDVSFDDD  339

Query  904   LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQG  1083
                G GP++F Y ELA  T +FS+ +KLGEGGFG+VYKG+LK++ S++AVK+VS GSKQG
Sbjct  340   FRNGTGPRKFAYNELANVTKNFSESEKLGEGGFGAVYKGFLKDMNSFIAVKKVSSGSKQG  399

Query  1084  IKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLR  1263
             IKEYA+EV++ISR+RH+NLV LIGWCHE K+LLL YE + NGSLDSHL+KGKSLLTW LR
Sbjct  400   IKEYAAEVKIISRMRHRNLVKLIGWCHE-KELLLAYELMPNGSLDSHLFKGKSLLTWELR  458

Query  1264  YKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTT  1443
             YKI Q LA ALLYLHEE ++C++HRDIKSSNIMLDSN  AKLGDFGLARLVDH KGS+TT
Sbjct  459   YKIAQGLALALLYLHEEGDQCVLHRDIKSSNIMLDSNFEAKLGDFGLARLVDHSKGSQTT  518

Query  1444  ALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKL  1623
              LAGTMGY+A EC  SGKASKE+DIYSFG+V LEIACGR+ ++P+ EE    IV+WVW+L
Sbjct  519   ILAGTMGYMAPECFTSGKASKESDIYSFGVVCLEIACGRRVVEPSLEENKTRIVEWVWEL  578

Query  1624  YGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQV-LNFEAPLPD  1800
             YG G+ L+AAD  L G+FN +E+E+++IVGLWC HPD + RPSIRQ I V L F++PLP 
Sbjct  579   YGMGKKLEAADKKLFGNFNEQEMERLLIVGLWCVHPDKAFRPSIRQVINVLLTFDSPLPI  638

Query  1801  LPETMPVATF  1830
             LP  MPV  +
Sbjct  639   LPSEMPVPAY  648



>ref|XP_008352687.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Malus domestica]
Length=692

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/624 (54%), Positives = 432/624 (69%), Gaps = 27/624 (4%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPN----QRN-CIGRATYSEPLHL  198
             P   PLSFNF  F P   +N++ E  + V+ + +++T +    QRN  +GRAT S+P  L
Sbjct  16    PCAAPLSFNFSSF-PKVPRNLSLEGDASVDGTFLRLTXSAADIQRNKSVGRATCSQPFLL  74

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
              +  TGKL+ F T+F F IDS     YGDG AFFLAP GS +      GG  GL   +  
Sbjct  75    RENATGKLADFTTNFTFAIDSLDXTXYGDGLAFFLAPNGSSLNTTVGLGGYLGLPVIELP  134

Query  379   LNSSN---PFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
              N S    PFVAVEFD+Y N+     D +  HVGID++SL+S VT PW+  I  G  + A
Sbjct  135   NNESTNLYPFVAVEFDIYKNNRISIKDPDGGHVGIDMNSLKSKVTKPWNGSITTGGENTA  194

Query  538   WINYDPRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMIN  705
              I YD  S NLSVV+ +F +    + ++SYI+DL +YL   V  GF  ATG  TAL  IN
Sbjct  195   RIRYDSGSKNLSVVYTSFENASLVWRNISYIVDLNEYLQGYVVVGFTAATGTLTALHKIN  254

Query  706   SWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSF-----LAWRKRKMREE  870
             SW F+S     EN+ +  +   G+ +GL+VG         A        + WRK K    
Sbjct  255   SWNFSSTELRDENEFNNSAPENGVNVGLLVGLVVGGCVVJAGGLXLVWCICWRKGKTGGX  314

Query  871   FDDD---IFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELE  1038
              DD+   +  +I E    G GPK+F+Y++LAR+T +F + +KLGEGGFG VY+G++K+L+
Sbjct  315   XDDEDPTVNDSIDEEFEKGTGPKKFSYKKLARSTGNFDEGEKLGEGGFGGVYRGFIKDLD  374

Query  1039  SYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLD  1218
             SYVAVKRVS  S+QG+KEYA+EVR+ISR+RH+NLV LIGWCHE  +LLLVYEF+SNGSLD
Sbjct  375   SYVAVKRVSSRSRQGMKEYAAEVRIISRLRHRNLVQLIGWCHEKGELLLVYEFMSNGSLD  434

Query  1219  SHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDF  1398
             SHL+K K+LL W  RY+I Q LAS L YLHEE E+C++HRDIKSSNIMLDSN NAKLGDF
Sbjct  435   SHLFKPKTLLHWEARYRIAQGLASGLFYLHEEWEQCVLHRDIKSSNIMLDSNFNAKLGDF  494

Query  1399  GLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPT  1578
             GLARLVDH K S+TT LAGTMGY+A ECV +GKASKETD+YSFG+V LEIACGRKPIDP 
Sbjct  495   GLARLVDHGKQSQTTVLAGTMGYMAPECVTTGKASKETDVYSFGVVALEIACGRKPIDPK  554

Query  1579  AEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIR  1758
                  +N+V+WVW+LYG G++++AADP L G+F+ +++E ++IVGLWCAHPD  +RPSI+
Sbjct  555   FGRTQINMVEWVWELYGEGKIIEAADPKLCGEFDAKQMECLLIVGLWCAHPDYXMRPSIQ  614

Query  1759  QAIQVLNFEAPLPDLPETMPVATF  1830
             Q IQVLNFE PLP LP  MPVA++
Sbjct  615   QTIQVLNFEVPLPILPSKMPVASY  638



>ref|XP_008455115.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cucumis melo]
Length=713

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/631 (51%), Positives = 428/631 (68%), Gaps = 31/631 (5%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQIT----PNQRNCIGRATYSEPLHLW  201
             + L + L+FNF  F  SN   I +ER    N +I++T       +N  GRATY +PLHLW
Sbjct  27    LRLANSLAFNFTSFDSSNTH-IFYERAFPSNRTIKLTGEMVNKNQNFTGRATYFKPLHLW  85

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             DKP+G LSSF THF+F IDS G+ +YGDG  FF AP  SR+    +KG G G+  +    
Sbjct  86    DKPSGSLSSFQTHFSFAIDSEGAERYGDGLTFFFAPKNSRLDAEISKGSGLGIGYNPSLT  145

Query  382   N-SSNPFVAVEFDVYLNHYDTEQK--HVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
             + + + F A+EFD++ N +D  +K  HVGID++S+ SV  + W  DI+ G  ++ WINYD
Sbjct  146   DLTYSSFFAIEFDIFSNFFDPPEKVEHVGIDINSMSSVAYSIWKCDIKRGRRTDVWINYD  205

Query  553   PRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFT  720
               ++NLS+ F  + +       +++ +D R  LPE V FGF+ ATG   A   I SW F 
Sbjct  206   SATLNLSITFTGYENNKTILQKLNHDVDFRLTLPEWVIFGFSAATGTLYATHNIYSWDFE  265

Query  721   SALDI--------------SENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRK  858
             S L++              S +Q        G+ +G+ V         +   F   RK++
Sbjct  266   STLNLNSDSNLNSDSNLAPSPDQGSKVGLVVGVGVGVGVFFLVCGLIIVWIFFWKKRKKR  325

Query  859   MREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELE  1038
              +   ++DI  +  E   G GP++F+Y ELARATN+F + +KLGEGGFG VYKG+L++L 
Sbjct  326   KKMNLEEDIVLDDSEFEKGKGPRKFSYNELARATNNFWEDEKLGEGGFGGVYKGFLRDLN  385

Query  1039  SYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLD  1218
             SYVAVK+VS+GS+QGIKEYASEV++IS++RH+NLV LIGWCHE  +LLLVYEF+SNGSLD
Sbjct  386   SYVAVKKVSKGSRQGIKEYASEVKIISQLRHRNLVQLIGWCHERGELLLVYEFMSNGSLD  445

Query  1219  SHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDF  1398
             +HL+K  + LTW  RYK+ Q +A+ALLYLHEE EKC++HRDIKSSN+MLDS+ NAKLGDF
Sbjct  446   AHLFKENNFLTWEHRYKVAQGVAAALLYLHEEWEKCVLHRDIKSSNVMLDSDFNAKLGDF  505

Query  1399  GLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPT  1578
             GLARLVDH  GS+TT LAGTMGY+A EC ++G+ASKE+D++SFGIV LEIACGR+P +P 
Sbjct  506   GLARLVDHAIGSQTTVLAGTMGYMAPECAITGRASKESDVFSFGIVALEIACGRRPYNPN  565

Query  1579  AEECHVNIVDWVWKLYGTGQLLDAADPNLSGDF-----NGREVEQMMIVGLWCAHPDCSL  1743
              EE  + +V+WVW+LYG G+LL+AAD  L G F       R++E +M+VGLWCAHPD + 
Sbjct  566   VEEGKMVMVEWVWELYGHGRLLEAADSKLHGSFEDEPEQQRQIECLMVVGLWCAHPDINC  625

Query  1744  RPSIRQAIQVLNFEAPLPDLPETMPVATFWP  1836
             RPSIRQAI V+NFEAPLP LP   P   + P
Sbjct  626   RPSIRQAIHVMNFEAPLPVLPLQFPTLAYHP  656



>ref|XP_002522044.1| kinase, putative [Ricinus communis]
 gb|EEF40244.1| kinase, putative [Ricinus communis]
Length=606

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/605 (53%), Positives = 404/605 (67%), Gaps = 78/605 (13%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNC-IGRATYSEPLHLWDKPT  213
             PL   LSFNF  F   + +NI +E     + +IQ+T N      GRATY EP+ L+++ +
Sbjct  36    PLASGLSFNFTSFIAGD-RNIIYEGAFPADRAIQLTANALTSRFGRATYPEPMQLYERSS  94

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS-  390
             GKL+ F THF+FVI+S   + YGDG  FFLAP GSR PPN T G   GL +DD+  N++ 
Sbjct  95    GKLTDFQTHFSFVINSENRSIYGDGLTFFLAPEGSRAPPNMTNGISLGLTSDDQEQNTTA  154

Query  391   NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNL  570
             N FVAVEFD++ N+         ID   LQ                              
Sbjct  155   NHFVAVEFDIFSNY---------IDPPELQ------------------------------  175

Query  571   SVVFRNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQA  750
                        H+S I++L  YLPE+VTFGF  +TG +TA   I+SW F+S L+I + Q 
Sbjct  176   -----------HLSQIVNLADYLPEKVTFGFTASTGGNTAFHSIHSWDFSSTLEI-DGQV  223

Query  751   DTKSTgkglviglvvggcfliggSMAFSFLAW--RKRKMREEFDDDIFGNI--GELGGGA  918
             + ++                       S L W   K+   +E +  +  +    +   G 
Sbjct  224   ERETGKN--------------------SQLDWVFPKKNADDEEEAHVLDDCMDDDFEKGT  263

Query  919   GPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYA  1098
             GPKRF Y ELARAT++F  ++KLG GGFG VYKG+LK L SYVAVK+VSRGS+QG+KEYA
Sbjct  264   GPKRFLYHELARATSNFKDEEKLGVGGFGEVYKGFLKNLNSYVAVKKVSRGSQQGVKEYA  323

Query  1099  SEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQ  1278
             +EV++ISR+RH+NLV LIGWCHE K+LLLVYEFL N SLDSHL+K KSLLTW LRYKI Q
Sbjct  324   AEVKIISRLRHQNLVQLIGWCHERKELLLVYEFLPNVSLDSHLFKEKSLLTWELRYKIAQ  383

Query  1279  DLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGT  1458
              LAS LLYLHEECE+C+VHRDIK+SNIMLDSN NAKLGDFGLARLV+H KGS+TT LAGT
Sbjct  384   GLASGLLYLHEECEQCVVHRDIKASNIMLDSNFNAKLGDFGLARLVEHGKGSQTTVLAGT  443

Query  1459  MGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQ  1638
             MGY+A ECV +GKAS+E+D+Y FGIV LEIACGRKPI+P A+E  V +V WVW LYG G+
Sbjct  444   MGYMAPECVTTGKASRESDVYRFGIVALEIACGRKPINPKADETEVYMVKWVWDLYGKGK  503

Query  1639  LLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMP  1818
             LL A DP L GDF+ +++E++MI+GLWCAHPD +LRPSIRQAI VL+FEAPLP LP  MP
Sbjct  504   LLKAGDPRLCGDFDKQQMERLMIIGLWCAHPDENLRPSIRQAIHVLHFEAPLPILPPEMP  563

Query  1819  VATFW  1833
             + T++
Sbjct  564   IPTYF  568



>ref|XP_002518333.1| kinase, putative [Ricinus communis]
 gb|EEF44093.1| kinase, putative [Ricinus communis]
Length=709

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/627 (51%), Positives = 428/627 (68%), Gaps = 37/627 (6%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSLVNNSIQITPN-----QRNCIGRATYSEPLHLWDKPTG  216
             L+F++  F  ++ +  T   TS+    I++T N     +   +GRATY +PLHLWDK +G
Sbjct  28    LNFSYSSFDSNHPEIFTERDTSVSQQGIELTINLSDLKREGSVGRATYRKPLHLWDKASG  87

Query  217   KLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE---RLN-  384
              L++F THF+F+I+S+  + +GDG AFFLAP  S I P+   GGG  LA +D+    LN 
Sbjct  88    NLTNFTTHFSFIINSSNKSPFGDGLAFFLAPNDSGIHPDVKSGGGLALAMNDDVNHALNY  147

Query  385   SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDP--R  558
               N FVAVEFD + N +D    HVGI++ S++SVV   W  ++  G  ++AWI YD   +
Sbjct  148   EENQFVAVEFDTFQNPWDPVGTHVGINIRSMKSVVNVSWPSNVMEGSRTDAWITYDSSHK  207

Query  559   SMNLSVVF----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
             ++N+S V+     N   +G++S ++DL K LPE VTFGF+ +TG    +  I SW F S+
Sbjct  208   TLNVSFVYVDCMNNSKMHGNISAVVDLAKCLPEWVTFGFSASTGALYEVNRITSWEFKSS  267

Query  727   LDISE-------NQA-------DTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMR  864
               I +       N A       D KS    +          +    + F  L  + +K  
Sbjct  268   SKIVDLVNIPNANSAANPVFPNDNKSNTGIVAGLSGGACALIAAAGLIFYSLRRKGKKEV  327

Query  865   EEFDDDI----FGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKE  1032
             E  DD +    FG+  +   G GP++F+Y EL   T +FS+ +KLGEGGFG+VY+G+LK+
Sbjct  328   EMNDDSVLEVSFGD--DFKNGTGPRKFSYDELVDVTKNFSEGEKLGEGGFGAVYRGFLKD  385

Query  1033  LESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGS  1212
             L  YVAVKRVSR SKQGIKEYA+EV++ISR+RH+NLV LIGWCHE K+LLL YEF+ NGS
Sbjct  386   LNCYVAVKRVSRESKQGIKEYAAEVKIISRMRHRNLVKLIGWCHE-KELLLAYEFMPNGS  444

Query  1213  LDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLG  1392
             LD+HL+KG++LLTW +RYKI Q LASALLYLHEE ++C++HRDIKSSNIMLDS+ +AKLG
Sbjct  445   LDTHLFKGRTLLTWEIRYKIAQGLASALLYLHEEGDQCVLHRDIKSSNIMLDSSFDAKLG  504

Query  1393  DFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPID  1572
             DFGLARLVDH KG++TT LAGTMGY+A EC  SGK SKE+DIYSFG+V LEIACGR+ ++
Sbjct  505   DFGLARLVDHAKGAQTTVLAGTMGYMAPECFTSGKVSKESDIYSFGVVALEIACGRRVVE  564

Query  1573  PTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPS  1752
             P  +E    IV+WVW+LYGTG+LL+AADP L GDF  +E+ +++IVGLWC HPD + RPS
Sbjct  565   PKLQEKQARIVEWVWELYGTGKLLEAADPKLWGDFQEQEMVRLIIVGLWCVHPDRTFRPS  624

Query  1753  IRQAIQV-LNFEAPLPDLPETMPVATF  1830
             IRQ I V L+ EAPLPDLP  MPV  +
Sbjct  625   IRQVINVLLSPEAPLPDLPSEMPVPAY  651



>ref|XP_006431666.1| hypothetical protein CICLE_v10003436mg [Citrus clementina]
 gb|ESR44906.1| hypothetical protein CICLE_v10003436mg [Citrus clementina]
Length=657

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/620 (53%), Positives = 429/620 (69%), Gaps = 22/620 (4%)
 Frame = +1

Query  31    IIPLV-HPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQRNCIGRATYSEPLHLWD  204
             +IPL+   LSFN+  F+P +  NIT++R    +N  IQ+ PN     GRATY++P+HLWD
Sbjct  18    LIPLLASALSFNYSSFSPLSDDNITYQRAYPDSNRVIQLPPNPATA-GRATYNKPMHLWD  76

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGG-FGLANDDERL  381
             K T  L+ F THF+FVIDS       DG AFFLAP G+    N  KGGG  GL  D E L
Sbjct  77    KTTRNLADFTTHFSFVIDSQKRTICADGLAFFLAPQGAPAIANDDKGGGSLGLTKDIEPL  136

Query  382   NSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
             NSS PF AVEFD++ N +D    HVGID+++L+SV T  W  D+ GG  +EAWINY+  +
Sbjct  137   NSSVPFFAVEFDIFNNTWDPPPTHVGIDINTLESVNTVTWWSDVGGGRRNEAWINYNSST  196

Query  562   MNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSAL  729
              NLSV F  F        ++ Y +DLR +LPE VT GF+ ATG   A+  I+SW F+S+L
Sbjct  197   HNLSVAFTGFRENTTVIQYLDYQVDLRLHLPEYVTLGFSMATGSAYAVFSIHSWEFSSSL  256

Query  730   DISENQADT-----KSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFD-DDIFG  891
             ++ +N +       +  GK   I +V             + + W     R+ +D DD  G
Sbjct  257   EMDDNFSTNPVLPPRRRGKNRTILIVGLSLGGGVLIGVLALIIWVTGIGRKRYDEDDNEG  316

Query  892   NIGELGGG-------AGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVA  1050
             N   L          +GP++++Y+EL++ATN+FS + KLG+GGFG VYKG   E  +YVA
Sbjct  317   NNQGLNEYVDYEFELSGPRKYSYKELSQATNNFSDEQKLGQGGFGGVYKGISGETNAYVA  376

Query  1051  VKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLY  1230
             VK+VS+GSKQG+KEYASEV+VISR+RH+NLV L+GWCHE  +LLLVYEF+ NGSLDSHL+
Sbjct  377   VKKVSKGSKQGLKEYASEVKVISRLRHRNLVQLLGWCHEKNELLLVYEFMPNGSLDSHLF  436

Query  1231  KGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLAR  1410
             +    LTW LRYKI Q+LA+ LLYL EE ++C++ RDIKSSNIMLDSN  AK+GDFGLAR
Sbjct  437   EENRFLTWELRYKIAQNLAAGLLYLQEEWDQCVLLRDIKSSNIMLDSNFKAKIGDFGLAR  496

Query  1411  LVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAE-E  1587
             LV+H KGS TT LAGT+GY+A EC +SGKASKE+D+YSFGIV LEIACGRK ID T + +
Sbjct  497   LVEHSKGSETTVLAGTLGYMAPECAMSGKASKESDVYSFGIVVLEIACGRKSIDHTMDKQ  556

Query  1588  CHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAI  1767
              +V+++ WVW+LY  G+LL  ADP L G+F+ +EV ++M+VGLWCAHPD SLR S+ +AI
Sbjct  557   GNVSLLQWVWELYSDGKLLQGADPRLCGEFDEQEVGRLMMVGLWCAHPDESLRGSMGEAI  616

Query  1768  QVLNFEAPLPDLPETMPVAT  1827
             +VLNFEAPLP LP  MPV T
Sbjct  617   RVLNFEAPLPILPPKMPVPT  636



>ref|XP_010027976.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=675

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/615 (53%), Positives = 427/615 (69%), Gaps = 22/615 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQR-----NCIGRATYSEPL  192
             +I   H +SFNF  F P N  N+TFE  +  ++  IQ+T NQ+     N IGRA+Y +P+
Sbjct  18    LIGHAHSVSFNFSGFQP-NTGNLTFEGDAFTSSGGIQLTRNQQDNNLQNSIGRASYDKPV  76

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWD  TG+L+ F  HF+FVI++  +  YGDG +F++AP  + IP N++ GG   L    
Sbjct  77    RLWDSKTGRLTDFTAHFSFVINALNNTYYGDGISFYIAPFDAVIPANSS-GGYLALFEPS  135

Query  373   ERLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
               +N+S N  VAVEFD + N +D    HVGI+++S+ SV    W   ++ G  + AW++Y
Sbjct  136   MAMNTSANQIVAVEFDSFKNSWDPSPDHVGININSIVSVANVSWKTSMKNGSTANAWVSY  195

Query  550   DPRSMNLSV--VFRN---FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             D  S NLSV   + N   F +   +SY++DLRK LPE+V  GF+ ATG+   +  I SW 
Sbjct  196   DSTSFNLSVFLTYANNPVFNNNSSLSYVVDLRKILPEQVKIGFSAATGQFVEIHEILSWS  255

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFS-FLAWRKRKMREEFDDDIFG  891
             F+S L+      D K      ++  VV G  L+   +    FL WRK+  R +    +  
Sbjct  256   FSSTLE------DGKKKRSLGLVLGVVLGSGLVACVLGIGWFLFWRKKSRRSKGVSMVDI  309

Query  892   NI-GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSR  1068
             +I GE   GAGPKRFTYR+LARATN F+++ KLGEGGFG VYKG L E    +AVKRVS+
Sbjct  310   SIDGEFEKGAGPKRFTYRDLARATNDFTERGKLGEGGFGGVYKGLLSESNMEIAVKRVSK  369

Query  1069  GSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLL  1248
             GSKQG KEY SEV++ISR+RH+NLV LIGWCHE  +LLLVYEFL NGSLDSHL+ GK+ L
Sbjct  370   GSKQGKKEYVSEVKIISRLRHRNLVQLIGWCHEGGELLLVYEFLPNGSLDSHLFGGKTHL  429

Query  1249  TWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEK  1428
             TW  RYKI   LASALLYLHEE E+C+VHRD+KSSN+MLDSN NAKLGDFGLARLVDH+ 
Sbjct  430   TWAARYKIALGLASALLYLHEEWEQCVVHRDVKSSNVMLDSNFNAKLGDFGLARLVDHDM  489

Query  1429  GSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVD  1608
             GS+TT LAGTMGY+A ECV +GKASKE+D+YSFG+V LEIACGRKP++   E   V +V+
Sbjct  490   GSQTTVLAGTMGYLAPECVTTGKASKESDVYSFGVVALEIACGRKPVELRVEPSKVRLVE  549

Query  1609  WVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEA  1788
             WVW LYG G++++AADP L+ +F+ R++E +M+VGLWC HPD SLRP I+Q I VLNFEA
Sbjct  550   WVWDLYGRGRVVEAADPGLNMEFDERQMECLMVVGLWCCHPDYSLRPPIKQVINVLNFEA  609

Query  1789  PLPDLPETMPVATFW  1833
             PLP LP  +PV  ++
Sbjct  610   PLPSLPSKLPVPMYY  624



>ref|XP_004295836.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Fragaria vesca subsp. vesca]
Length=698

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/620 (53%), Positives = 415/620 (67%), Gaps = 26/620 (4%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPN------QRNCIGRATYSEPLHL  198
             P    L+FNF  F  SN  NI  E  + ++  +    N      Q   +GRATY EP  L
Sbjct  37    PSATSLTFNFSSF--SNANNIRTENHANLDKQVLRLTNSAVDELQVESVGRATYDEPFLL  94

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAN----  366
              D  TGKL+ F THF FVIDS     Y DG  FF+AP GS +     +GG  GL      
Sbjct  95    QD-ATGKLADFTTHFTFVIDSLRETAYADGLVFFIAPNGSVLNTTLGRGGALGLPVENPI  153

Query  367   DDERLNSSNPFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSE  534
             D    N    FVAVEFD++ N      D    H GIDV+SL+S+ T PW+ +I  G  + 
Sbjct  154   DGPSRNIGYNFVAVEFDIFKNSLTSVDDPTGNHAGIDVNSLKSLNTKPWNGNITYGRNNS  213

Query  535   AWINYDPRSMNLSVVFRNF----GSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMI  702
             A ++YD  + NLSV F  F        ++S+ +DL++YLP  V  GF+ ATG + A+  I
Sbjct  214   ATVSYDSSTKNLSVAFTTFVNGAQQMDYLSHQVDLKEYLPNLVIAGFSAATGANIAVHKI  273

Query  703   NSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDD  882
              SW F+S         +  STG  + + +      +   S+ + F+ W+KRK  E  D+D
Sbjct  274   LSWNFSSTDLAIAKPGNGVSTGLVVGLSVGGFIVLVGVLSLVW-FIFWKKRKGGESDDED  332

Query  883   IFG---NIG-ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVA  1050
               G   +I  E   G GP++F+Y ELARATN+F + +KLGEGGFG VY+G++K+L SYVA
Sbjct  333   PMGLNDSIDDEFEKGTGPRKFSYSELARATNNFVEGEKLGEGGFGGVYRGFIKDLNSYVA  392

Query  1051  VKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLY  1230
             VKRVS+GSKQG+KEYASEVR+ISR+RH+NLV LIGWCHE  +LLLVYE++ NGSLDSH++
Sbjct  393   VKRVSKGSKQGLKEYASEVRIISRLRHRNLVQLIGWCHEKGELLLVYEYMPNGSLDSHIF  452

Query  1231  KGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLAR  1410
             K KSLL W +RYK+ Q LAS L YLHEE E+C++HRDIKSSNIMLDSN N KLGDFGLAR
Sbjct  453   KLKSLLNWRVRYKVAQGLASGLFYLHEEWEQCVLHRDIKSSNIMLDSNFNVKLGDFGLAR  512

Query  1411  LVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEEC  1590
             LVDH K S TT +AGT GY+ALE V +GKASKE+D+YSFG+V LEIACGRK ID      
Sbjct  513   LVDHGKQSETTIVAGTRGYMALEYVTTGKASKESDVYSFGVVALEIACGRKSIDLKLPST  572

Query  1591  HVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQ  1770
              +N+V WVW+LYG G++++AADP LSGDF+ +++E +MIVGLWCAHPD  +RPSI+QAIQ
Sbjct  573   QINMVQWVWELYGEGKVIEAADPVLSGDFDAKQMECLMIVGLWCAHPDYRMRPSIQQAIQ  632

Query  1771  VLNFEAPLPDLPETMPVATF  1830
             VLNFE PLP LP  MP+ATF
Sbjct  633   VLNFEVPLPSLPPQMPMATF  652



>gb|EYU18391.1| hypothetical protein MIMGU_mgv1a022316mg [Erythranthe guttata]
Length=713

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/640 (52%), Positives = 434/640 (68%), Gaps = 42/640 (7%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNCI-----GRATYSEPLH  195
             +IP    L+FN      S+   I      + +  IQ+T N+R+       GRATY +PLH
Sbjct  13    LIPSTVSLTFNLSSIGTSDAALINNVGGYVSDQGIQVTTNERSSAQVELGGRATYKDPLH  72

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAN-DD  372
             LWDK +  LS F+THF+FVIDS G   YGDG  FFLAP+GS I    + GG   + N D+
Sbjct  73    LWDKASNNLSDFSTHFSFVIDSRGRPDYGDGMTFFLAPVGSTIQ-RWSLGGSLAIGNSDN  131

Query  373   ERLNSS-NPFVAVEFDVYLNHYDTE-QKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWIN  546
               LNSS   FVAVEFD + N++D   + HVGID++SL+SV +A W  ++  G  ++AWI+
Sbjct  132   ATLNSSLEAFVAVEFDTFQNYFDPPVRSHVGIDINSLRSVKSATWENNVSQGVQNDAWIS  191

Query  547   YDPRSMNLSVVF----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             Y+  SM L V F     N     ++S+++DLR YLPE VT GF+ ATG       I SW 
Sbjct  192   YNATSMELRVDFTATSSNITRRDNLSHVVDLRDYLPEYVTVGFSAATGDWFEEHTIKSWA  251

Query  715   FTSALDI------------SENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRK  858
             F+S L I            ++ + + KS+G  LV+GL VG   L+  S    +  WR++K
Sbjct  252   FSSTLQIKNVTFENPGVVVTDVREEKKSSGVTLVVGLSVGLSVLVLASSFAGYFLWRRKK  311

Query  859   MRE----------EFDD--DIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGF  1002
              ++           FD   DI     E   G+GP +F+Y EL  AT  F++++KLGEGGF
Sbjct  312   QKKRCKKESGNGYSFDPRMDI-----EFQKGSGPNKFSYSELVLATKDFAEEEKLGEGGF  366

Query  1003  GSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLL  1182
             G VY+G+L E  SY+AVKRVS GSKQG+KEYASEV++IS++RH+NLV L+GWCHE  +LL
Sbjct  367   GGVYRGFLAETNSYIAVKRVSSGSKQGLKEYASEVKIISQLRHRNLVQLLGWCHERGELL  426

Query  1183  LVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIM  1362
             LVYE + NGSLDSH++KG+++L W +RYKI Q +ASALLYLHEE E+ +VHRDIK+SNIM
Sbjct  427   LVYELMPNGSLDSHIFKGQTILPWEVRYKIAQGIASALLYLHEEWEQAVVHRDIKASNIM  486

Query  1363  LDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTL  1542
             LDSN NAKLGDFGLARLVDHEKG+ +T LAGT+GY+A EC+V+G+ASKETD+YS GIV L
Sbjct  487   LDSNFNAKLGDFGLARLVDHEKGAHSTVLAGTLGYMAPECMVTGRASKETDVYSLGIVLL  546

Query  1543  EIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWC  1722
             EIACGR+PID +     V +V+WVW+LYG G+LLDAADP L   F+  E+E++MIVGLWC
Sbjct  547   EIACGRRPIDHSRGGDRVVLVEWVWRLYGNGELLDAADPKLEMGFDEWEMERLMIVGLWC  606

Query  1723  AHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFWPQR  1842
              HPD   RPSIRQA+ VL+FEA LP LP  MPVAT++  R
Sbjct  607   VHPDSGQRPSIRQAVHVLDFEAELPALPPMMPVATYFAPR  646



>gb|KCW54632.1| hypothetical protein EUGRSUZ_I00577, partial [Eucalyptus grandis]
Length=621

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/611 (54%), Positives = 423/611 (69%), Gaps = 22/611 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQR-----NCIGRATYSEPL  192
             +I   H +SFNF  F P N  N+TFE  +  ++  IQ+T NQ+     N IGRA+Y +P+
Sbjct  18    LIGHAHSVSFNFSGFQP-NTGNLTFEGDAFTSSGGIQLTRNQQDNNLQNSIGRASYDKPV  76

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWD  TG+L+ F  HF+FVI++  +  YGDG +F++AP  + IP N++ GG   L    
Sbjct  77    RLWDSKTGRLTDFTAHFSFVINALNNTYYGDGISFYIAPFDAVIPANSS-GGYLALFEPS  135

Query  373   ERLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
               +N+S N  VAVEFD + N +D    HVGI+++S+ SV    W   ++ G  + AW++Y
Sbjct  136   MAMNTSANQIVAVEFDSFKNSWDPSPDHVGININSIVSVANVSWKTSMKNGSTANAWVSY  195

Query  550   DPRSMNLSVVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             D  S NLSV         F +   +SY++DLRK LPE+V  GF+ ATG+   +  I SW 
Sbjct  196   DSTSFNLSVFLTYANNPVFNNNSSLSYVVDLRKILPEQVKIGFSAATGQFVEIHEILSWS  255

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFS-FLAWRKRKMREEFDDDIFG  891
             F+S L+      D K      ++  VV G  L+   +    FL WRK+  R +    +  
Sbjct  256   FSSTLE------DGKKKRSLGLVLGVVLGSGLVACVLGIGWFLFWRKKSRRSKGVSMVDI  309

Query  892   NI-GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSR  1068
             +I GE   GAGPKRFTYR+LARATN F+++ KLGEGGFG VYKG L E    +AVKRVS+
Sbjct  310   SIDGEFEKGAGPKRFTYRDLARATNDFTERGKLGEGGFGGVYKGLLSESNMEIAVKRVSK  369

Query  1069  GSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLL  1248
             GSKQG KEY SEV++ISR+RH+NLV LIGWCHE  +LLLVYEFL NGSLDSHL+ GK+ L
Sbjct  370   GSKQGKKEYVSEVKIISRLRHRNLVQLIGWCHEGGELLLVYEFLPNGSLDSHLFGGKTHL  429

Query  1249  TWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEK  1428
             TW  RYKI   LASALLYLHEE E+C+VHRD+KSSN+MLDSN NAKLGDFGLARLVDH+ 
Sbjct  430   TWAARYKIALGLASALLYLHEEWEQCVVHRDVKSSNVMLDSNFNAKLGDFGLARLVDHDM  489

Query  1429  GSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVD  1608
             GS+TT LAGTMGY+A ECV +GKASKE+D+YSFG+V LEIACGRKP++   E   V +V+
Sbjct  490   GSQTTVLAGTMGYLAPECVTTGKASKESDVYSFGVVALEIACGRKPVELRVEPSKVRLVE  549

Query  1609  WVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEA  1788
             WVW LYG G++++AADP L+ +F+ R++E +M+VGLWC HPD SLRP I+Q I VLNFEA
Sbjct  550   WVWDLYGRGRVVEAADPGLNMEFDERQMECLMVVGLWCCHPDYSLRPPIKQVINVLNFEA  609

Query  1789  PLPDLPETMPV  1821
             PLP LP  +PV
Sbjct  610   PLPSLPSKLPV  620



>ref|XP_004137071.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing 
receptor kinase IX.1-like [Cucumis sativus]
Length=665

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/638 (50%), Positives = 418/638 (66%), Gaps = 53/638 (8%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQIT----PNQRNCIGRATYSEPLHL  198
             ++P    LSFNF  F   N   I ++RT   N  I++T     N  N +GRATYS+PLHL
Sbjct  14    LVPFATSLSFNFTSFNQGNADMI-YDRTFPTNQVIELTGDSSNNNMNFVGRATYSQPLHL  72

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
             WD+ +G +SSF THF+F I+S G A YGDG  FF AP GS +  N ++G G G+  D E 
Sbjct  73    WDEGSGNMSSFQTHFSFAINSRGRANYGDGLTFFFAPNGSILQANISRGSGLGIGYDPEL  132

Query  379   LNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
              N +  F AVEFD+Y N++D   +HVGID++S++S+  + W  DI GG  ++ WINYD  
Sbjct  133   WNGTATFFAVEFDIYSNNFDPPFEHVGIDINSMKSIAYSRWKCDIMGGKRNDVWINYDSD  192

Query  559   SMNLSVVFRNFGSYG----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
             + NLSVVF  F +      H+ +++DLR  LPE VTFGF+ +TG + A   + SW F S 
Sbjct  193   THNLSVVFSGFENNNTLLQHLHHVVDLRLNLPEWVTFGFSASTGYEYATHSVYSWSFHST  252

Query  727   LDIS-------------------------ENQADTKSTgkglviglvvggcfliggSMAF  831
             L+++                          N   T  TG  + +G+  G  F+ G  + +
Sbjct  253   LELTLEPTFTTDPNSVASAPSPGPSLPPNNNDGSTSKTGLEIGLGIAGGVIFVGGLVIVW  312

Query  832   SFLAWRKRKMREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSV  1011
               + W+K    +  +++I  +  E   G GP+RF Y+ELARATN+F +  KLGEGGFG V
Sbjct  313   -IIVWKKMAAMKNIEEEIMLDDSEFEKGKGPRRFLYKELARATNNFKEDKKLGEGGFGGV  371

Query  1012  YKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVY  1191
             YKG+L+EL   VAVKR+S+GSKQGIKEYASEV++IS++RH+NLV LIGWCHE  +LLLVY
Sbjct  372   YKGFLRELNCNVAVKRISKGSKQGIKEYASEVKIISQLRHRNLVQLIGWCHEKDELLLVY  431

Query  1192  EFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDS  1371
             EF+ NGSLD+HL+K  + LTW LRYKI Q +ASALLYLHEE E C++HRDIKSSN+    
Sbjct  432   EFMPNGSLDTHLFKPNNFLTWELRYKIGQGIASALLYLHEEWEMCVLHRDIKSSNVX---  488

Query  1372  NLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIA  1551
                       LARLV+H KGS+TTALAGT+GY+A EC  +G+A+KETD+YSFGIV LEIA
Sbjct  489   ----------LARLVNHGKGSQTTALAGTLGYLAPECATTGRATKETDVYSFGIVALEIA  538

Query  1552  CGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNG-----REVEQMMIVGL  1716
             CGR P +P  EE  + +V+WVWKLYG G++LDA D  L  +        + +E +M+VGL
Sbjct  539   CGRMPFNPNVEEEKMVMVEWVWKLYGCGKVLDAIDSKLRKEIRSFGDEEKMMECLMVVGL  598

Query  1717  WCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             WCAHPD + RPSIRQAI VLNFEAPLP LP  +P  T+
Sbjct  599   WCAHPDSNARPSIRQAINVLNFEAPLPILPSHLPAPTY  636



>ref|XP_008351551.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Malus domestica]
Length=692

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/624 (53%), Positives = 427/624 (68%), Gaps = 27/624 (4%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPN-----QRNCIGRATYSEPLHL  198
             P   PLSFNF  F P+ + N+  E  + V+ + +++T +     Q   +GRATYS+P  L
Sbjct  16    PCATPLSFNFSSF-PNGLTNLFIEGDAFVDGTFLRLTKSAADIRQDQSVGRATYSQPFLL  74

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
              +  TGKL+ F T+F FVIDS G  +Y DG AFFLAP GS +      GG  GL   +  
Sbjct  75    RENATGKLADFTTNFTFVIDSVGKTRYADGLAFFLAPNGSSLNTTVGVGGSLGLPVINPL  134

Query  379   LNSSN---PFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
              N S    PFVAVEFD++ N+     D    H+GID++S+ S V  PW+  I  G  + A
Sbjct  135   NNESTNLYPFVAVEFDIFTNNRTSIKDPVGDHIGIDINSVNSKVRKPWNGSITTGGENNA  194

Query  538   WINYDPRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMIN  705
              I YD  S  LSVV+ +F +    + ++SYI+DL  YL   V  GF+ ATG  TAL  IN
Sbjct  195   RIRYDSGSKILSVVYTSFVNGVPVWRNISYIVDLNDYLQGYVVVGFSAATGSLTALHKIN  254

Query  706   SWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSF-----LAWRKRKMREE  870
             SW F+S     EN+ +  +   G+ +GLVVG        +A        + WRK K    
Sbjct  255   SWNFSSTELRDENEFNNSAPVNGVNVGLVVGLVVGGCVVLAGGLVLVWCICWRKGKTGXS  314

Query  871   FDDD---IFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELE  1038
              DD+   +  +I E    G GPK+F+Y+ LA++T +F + +KLGEGGFG VY+G++K L+
Sbjct  315   SDDEDPMVNDSIDEEFEKGTGPKKFSYKTLAQSTGNFDEGEKLGEGGFGGVYRGFIKGLD  374

Query  1039  SYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLD  1218
             SYVAVKRVS  S+QG+KEYA+EVR+ISR+RH+NLV LIGWCHE  +LLLVYEF+SNGSL+
Sbjct  375   SYVAVKRVSSRSRQGMKEYAAEVRIISRLRHRNLVQLIGWCHEKGELLLVYEFMSNGSLE  434

Query  1219  SHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDF  1398
             SHL+K K+LL W  RY+I Q LAS L YLHEE E+C++HRDIKSSNIMLDSN NAKLGDF
Sbjct  435   SHLFKSKTLLPWEARYRIAQGLASGLFYLHEEWEQCVLHRDIKSSNIMLDSNFNAKLGDF  494

Query  1399  GLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPT  1578
             GLARLVDH K S+TT LAGTMGY+A EC+ +GKASKETD+YSFGIV LEIACGRKPIDP 
Sbjct  495   GLARLVDHGKQSQTTILAGTMGYMAPECLTTGKASKETDVYSFGIVALEIACGRKPIDPK  554

Query  1579  AEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIR  1758
             +E   +N+V+WVW+LYG G++++A DP L G+F+ +++E ++I GLWCAHPD ++RPSI+
Sbjct  555   SEGSKINMVEWVWELYGEGKVIEAVDPKLCGEFDDKQMECLLIAGLWCAHPDYTIRPSIQ  614

Query  1759  QAIQVLNFEAPLPDLPETMPVATF  1830
             Q IQVLNFE PL  LP  M VA++
Sbjct  615   QTIQVLNFEVPLSILPSKMLVASY  638



>ref|XP_007213565.1| hypothetical protein PRUPE_ppa015760mg [Prunus persica]
 gb|EMJ14764.1| hypothetical protein PRUPE_ppa015760mg [Prunus persica]
Length=703

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/640 (50%), Positives = 416/640 (65%), Gaps = 40/640 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPN-----QRNCIGRATYSEPL  192
             + P    L+FNF  F P+ + N++FE  + V+ + +++T +     Q   +GRATYS+P 
Sbjct  12    LAPCATSLNFNFSTF-PNGINNLSFEGDAFVDGAFLRLTKSAADDVQDQSVGRATYSQPF  70

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              L D  TGKL+ F T+F F I+S     Y DG AFFLAP GS +     +GG  GL   +
Sbjct  71    LLRDNATGKLADFTTNFTFTINSLDKTPYADGLAFFLAPNGSALNRTIGRGGSLGLPTIN  130

Query  373   ERLNSSN---PFVAVEFDVYLNHYDTEQK----HVGIDVDSLQSVVTAPWSPDIEGGWGS  531
                N S    PFVAVEFD++ N   + Q     HVGIDV+S++S VT  W+  I  G  +
Sbjct  131   PEKNESTNLYPFVAVEFDIFQNAVTSVQDPAGDHVGIDVNSVKSKVTRAWNGSITQGRDN  190

Query  532   EAWINYDPRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQM  699
              AWI YD  S NLSV F  + +      +  Y++D+ + L   V  GF+ ATG  TAL  
Sbjct  191   NAWIRYDSGSKNLSVTFTTYENGVWVRRYFDYMVDVNEILQGWVIVGFSAATGAMTALHK  250

Query  700   INSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFS---------------  834
             INSW F S   I EN  +           +       I   +                  
Sbjct  251   INSWSFNSTSLIDENAKNNTPVAPEPTPIVEPESGNGINIGLVVGLVVGGCVLLVGGFCL  310

Query  835   --FLAWRKRKMREEFDDDIFGNIG-----ELGGGAGPKRFTYRELARATNSFSQQDKLGE  993
               F+ W+K    E  D+D    +      E   G GPK+F+Y+ LA++TN F + +KLGE
Sbjct  311   VWFIFWKKGGTGESSDNDEDPMVNDPIDDEFEKGTGPKKFSYKILAQSTNDFDEGEKLGE  370

Query  994   GGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENK  1173
             GGFG VY+G++K+L SYVAVKRVS GS+QG+KEYA+EVR+ISR+RH+NLV LIGWCHE +
Sbjct  371   GGFGGVYRGFVKDLNSYVAVKRVSSGSRQGLKEYAAEVRIISRLRHRNLVQLIGWCHEKR  430

Query  1174  DLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSS  1353
             +LLLVYEF+SNGSLDSHL+KGKSLL W  RY+I Q LAS L YLHEE E+C++HRDIKSS
Sbjct  431   ELLLVYEFMSNGSLDSHLFKGKSLLGWEARYRIAQGLASGLFYLHEEWEQCVLHRDIKSS  490

Query  1354  NIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGI  1533
             NIMLDSN NAKLGDFGLARLVDH K S+TT LAGTMGY+A ECV +GKASKETD+YSFG+
Sbjct  491   NIMLDSNFNAKLGDFGLARLVDHGKQSQTTVLAGTMGYMAPECVTTGKASKETDVYSFGV  550

Query  1534  VTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVG  1713
             V LEIACGRKPIDP      +N+V+WVW+LYG G++++AADP L GDF+ +++E ++IVG
Sbjct  551   VALEIACGRKPIDPKLGTSKINMVEWVWELYGQGKVIEAADPKLCGDFDEKQIECLLIVG  610

Query  1714  LWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW  1833
             LWCAHPD  +RPS +Q IQVL+ E   P LP  MP+A+++
Sbjct  611   LWCAHPDYKIRPSTQQIIQVLSLEVAPPILPSKMPIASYF  650



>ref|XP_007214163.1| hypothetical protein PRUPE_ppa018959mg, partial [Prunus persica]
 gb|EMJ15362.1| hypothetical protein PRUPE_ppa018959mg, partial [Prunus persica]
Length=644

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/614 (52%), Positives = 418/614 (68%), Gaps = 29/614 (5%)
 Frame = +1

Query  58    FNFDLFTPSNVQNITFE-RTSLVNNSIQITPN-----QRNCIGRATYSEPLHLWDKPTGK  219
             F F +F+P+++  I+ E   +L    +++T +     Q   +GRATY +P  L +  TGK
Sbjct  1     FYFPIFSPTDINTISLEGDANLDRQFLRLTKSCSLDQQEQSVGRATYHKPFLLRETTTGK  60

Query  220   LSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD---ERLNSS  390
             L+ F+THF F+I S  S++YG+G  FFLAP GS +     KG   GL  +        + 
Sbjct  61    LADFSTHFTFIIHSQKSSEYGNGLTFFLAPDGSLLNRKLGKGSNLGLPVEHLPGHMSTNQ  120

Query  391   NPFVAVEFDVYLNHYDTEQK----HVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
              PFVAVEFD+  N   T Q     HVG+DV+SL+S  TAPW+  +  G  +EAWINY+  
Sbjct  121   YPFVAVEFDISQNGIPTIQDPIYDHVGVDVNSLKSSKTAPWNGRVSDGRKNEAWINYNSS  180

Query  559   SMNLSVVFRNF--GSYG--------HVSYILDLRKYLPERVTFGFAGATGKDTALQMINS  708
             S  L+V F +F  G+ G        ++ +I+DL ++LP+RV  GF+ +TG   AL  INS
Sbjct  181   SKILTVAFTSFVNGTNGTQLQRTINYLDHIIDLNQHLPDRVIVGFSASTGTPVALHGINS  240

Query  709   WIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIF  888
             W F S   + E+  D  + G  + +G+            A   L W+K  +R+  ++ I 
Sbjct  241   WSFNSTSLLDESANDNINIGLAVGLGVGGCLIL-----FAGLVLFWKKGGLRKSEEEAIV  295

Query  889   GNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSR  1068
              +  E   G GP +F Y ELA AT+ F ++ KLGEGGFG VYKG++K L SYVAVKR+S+
Sbjct  296   VD-DEFDKGTGPTKFPYNELALATSDFKEEQKLGEGGFGGVYKGFIKYLNSYVAVKRISK  354

Query  1069  GSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLL  1248
             GSKQG KEY SEVR+ISR+RH+NLV LIGWCHE  +LLLVYEF+ NGSLDSHL+K K++L
Sbjct  355   GSKQGQKEYTSEVRIISRLRHRNLVQLIGWCHEKGELLLVYEFMPNGSLDSHLFKAKNML  414

Query  1249  TWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEK  1428
              W  RY+I Q LAS LLYLHEE E+C+VHRDIKSSNI+LDSN NAKLGDFGLARLVDH +
Sbjct  415   VWEARYRIAQGLASGLLYLHEEWEQCVVHRDIKSSNILLDSNFNAKLGDFGLARLVDHGE  474

Query  1429  GSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVD  1608
              S+TT LAGTMGY+A EC+ +GKASKE+D+YSFG+V LEIACGRKPID   E   +N+V+
Sbjct  475   QSQTTVLAGTMGYMAPECLTNGKASKESDVYSFGVVALEIACGRKPIDLHLERNQINMVE  534

Query  1609  WVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEA  1788
             WVW+LYG G+LL+A D  L  DF+ +++E +MIVGLWCAHPD ++RPSI++AIQVLNFEA
Sbjct  535   WVWELYGKGKLLEATDQKLCEDFDEKQMECLMIVGLWCAHPDYNMRPSIQRAIQVLNFEA  594

Query  1789  PLPDLPETMPVATF  1830
              LP LP   PVAT+
Sbjct  595   ALPVLPPKKPVATY  608



>gb|ADN34262.1| putative kinase [Cucumis melo subsp. melo]
Length=649

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/592 (52%), Positives = 409/592 (69%), Gaps = 27/592 (5%)
 Frame = +1

Query  139   ITPNQRNCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGS  318
             +  NQ N  GRATY +PLHLWDKP+G LSSF THF+F IDS G+ +YGDG  FF AP  S
Sbjct  2     VNKNQ-NFTGRATYFKPLHLWDKPSGSLSSFQTHFSFAIDSEGAERYGDGLTFFFAPKNS  60

Query  319   RIPPNATKGGGFGLANDDERLN-SSNPFVAVEFDVYLNHYDTEQK--HVGIDVDSLQSVV  489
             R+    +KG G G+  +    + + + F A+EFD++ N +D  +K  HVGID++S+ SV 
Sbjct  61    RLDAEISKGSGLGIGYNPSLTDLTYSSFFAIEFDIFSNFFDPPEKVEHVGIDINSMSSVA  120

Query  490   TAPWSPDIEGGWGSEAWINYDPRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTF  657
              + W  DI+ G  ++ WINYD  ++NLS+ F  + +       +++ +D R  LPE V F
Sbjct  121   YSIWKCDIKRGRRTDVWINYDSATLNLSITFTGYENNKTILQKLNHDVDFRLTLPEWVIF  180

Query  658   GFAGATGKDTALQMINSWIFTSALDI--------------SENQADTKSTgkglviglvv  795
             GF+ ATG   A   I SW F S L++              S +Q        G+ +G+ V
Sbjct  181   GFSAATGTLYATHNIYSWDFESTLNLNSDSNLNSDSNLAPSPDQGSKVGLVVGVGVGVGV  240

Query  796   ggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQ  975
                      +   F   RK++ +   ++DI  +  E   G GP++F+Y ELARATN+F +
Sbjct  241   FFLVCGLIIVWIFFWKKRKKRKKMNLEEDIVLDDSEFEKGKGPRKFSYNELARATNNFWE  300

Query  976   QDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIG  1155
              +KLGEGGFG VYKG+L++L SYVAVK+VS+GS+QGIKEYASEV++IS++RH+NLV LIG
Sbjct  301   DEKLGEGGFGGVYKGFLRDLNSYVAVKKVSKGSRQGIKEYASEVKIISQLRHRNLVQLIG  360

Query  1156  WCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVH  1335
             WCHE  +LLLVYEF+SNGSLD+HL+K  + LTW  RYK+ Q +A+ALLYLHEE EKC++H
Sbjct  361   WCHERGELLLVYEFMSNGSLDAHLFKENNFLTWEHRYKVAQGVAAALLYLHEEWEKCVLH  420

Query  1336  RDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETD  1515
             RDIKSSN+MLDS+ NAKLGDFGLARLVDH  GS+TT LAGTMGY+A EC ++G+ASKE+D
Sbjct  421   RDIKSSNVMLDSDFNAKLGDFGLARLVDHAIGSQTTVLAGTMGYMAPECAITGRASKESD  480

Query  1516  IYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDF-----N  1680
             ++SFGIV LEIACGR+P +P  EE  + +V+WVW+LYG G+LL+AAD  L G F      
Sbjct  481   VFSFGIVALEIACGRRPYNPNVEEGKMVMVEWVWELYGHGRLLEAADSKLHGSFEDEPEQ  540

Query  1681  GREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFWP  1836
              R++E +M+VGLWCAHPD + RPSIRQAI V+NFEAPLP LP   P   + P
Sbjct  541   QRQIECLMVVGLWCAHPDINCRPSIRQAIHVMNFEAPLPVLPLQFPTLAYHP  592



>ref|XP_008226497.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Prunus mume]
Length=680

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/620 (51%), Positives = 412/620 (66%), Gaps = 24/620 (4%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPN------QRNCIGRATYSEPLHLWD  204
             V  L FNF  F P+    I+ E  + ++    +         +   +GRATYS+P  L D
Sbjct  15    VTSLDFNFSTF-PNGKNTISLEGDARIDGEFLLLTKSAVDDVKEQSVGRATYSQPFLLRD  73

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
               TGKL+ F T+F FVIDS+G   Y DG  FF+AP GS +     +GG  GLA ++ +  
Sbjct  74    NATGKLADFTTNFTFVIDSHGKTPYADGLVFFIAPNGSLLNSTLGRGGSLGLAVENPQNI  133

Query  385   SSN--PFVAVEFDVYLNHYDTEQ----KHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWIN  546
             S N   FVAVEFD+Y N   + Q     HVG+D+++++S +T PW+  I  G  + A I+
Sbjct  134   SKNQYSFVAVEFDIYQNEVTSIQDPAGDHVGVDINTVKSKMTEPWNGSIAEGRVNSAGIS  193

Query  547   YDPRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             YD +S  ++VVF ++ +      ++  ++DL K L   V  GF+ AT   TAL  INSW 
Sbjct  194   YDSKSNGINVVFTSYVNGVQVMRYIDCMVDLNKILQGWVIVGFSAATDATTALHKINSWS  253

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFS------FLAWRKRKMREEFD  876
             F S     E   +T       +   +V G  + G  +         F+ W+KR    + D
Sbjct  254   FHSTQLFDEKPKNTTPKSGNGINIGLVLGLGIGGLVVLGGVLGLVWFICWKKRGESSDED  313

Query  877   DDIFGNIG-ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAV  1053
               +  +I  E   G GPK+F+YR+LA++T +F +  KLGEGGFG VY+GY+ +L   VAV
Sbjct  314   VTVSDSIDEEFENGIGPKKFSYRKLAQSTRNFDEGQKLGEGGFGGVYRGYITDLNLNVAV  373

Query  1054  KRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYK  1233
             KR+S GS+QG+KEYA+EVR+ISR+RH+NLV LIGWCHE K LLLVYEF+SNGSLDSHL+K
Sbjct  374   KRISSGSRQGLKEYAAEVRIISRLRHRNLVQLIGWCHERKQLLLVYEFMSNGSLDSHLFK  433

Query  1234  GKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARL  1413
              KSLL W  RY+I Q LAS L YLHEE E+C++HRD+KSSNIMLDSN NAKLGDFGLARL
Sbjct  434   AKSLLAWDARYRIAQGLASGLFYLHEEWEQCVLHRDVKSSNIMLDSNFNAKLGDFGLARL  493

Query  1414  VDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECH  1593
             VDH K S+TT LAGTMGY+A EC+ +GKASKETD+YSFG+V LEIACGRKPIDP      
Sbjct  494   VDHGKQSQTTVLAGTMGYMAPECMTTGKASKETDVYSFGVVALEIACGRKPIDPEFRSSQ  553

Query  1594  VNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQV  1773
             + +V WVW+LYG G++++AADP L GDF  R++E ++IVGLWCAHPD  +RPSI+Q IQV
Sbjct  554   ITMVKWVWELYGEGRVIEAADPKLCGDFEKRQMECLLIVGLWCAHPDYKIRPSIQQTIQV  613

Query  1774  LNFEAPLPDLPETMPVATFW  1833
             LNFE PLP LP  MPVA+++
Sbjct  614   LNFEVPLPILPSKMPVASYF  633



>ref|XP_006426233.1| hypothetical protein CICLE_v10027393mg [Citrus clementina]
 gb|ESR39473.1| hypothetical protein CICLE_v10027393mg [Citrus clementina]
Length=684

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/616 (53%), Positives = 420/616 (68%), Gaps = 25/616 (4%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQNITFERTSLVNN-SIQITPNQ-----RNCIGRATYSEPLH  195
             IP    +SFNF  F P NV  ITFE  S  ++ ++Q+T NQ      + +GRATY++P+ 
Sbjct  23    IPHGSSVSFNFPNFQP-NVPTITFEGDSFASDEALQLTKNQVDDNLTSSVGRATYNQPVP  81

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             +WD  T  L+ F THF+FV+ +   A+YG+G +FFLAP  S+IP N++ G    L + + 
Sbjct  82    IWDAKTRSLTDFTTHFSFVMSAPNPAEYGEGISFFLAPFNSKIPDNSSDGY-LALFSPET  140

Query  376   RLN--SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
              LN  S N  VAVEFD   N +D    HVGI+V+S+ S  T  W   I+    + AW++Y
Sbjct  141   ALNNDSRNQIVAVEFDSNKNRWDPSTDHVGINVNSIASEKTVLWKSSIKTAATANAWVSY  200

Query  550   DPRSMNLSV--------VFRNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMIN  705
             +  + NLSV        V+R   S  HV   +DLR+ LPE V  GF+ +TG+   L  I 
Sbjct  201   NSTTQNLSVFLTYAHKPVYRGNSSLWHV---VDLREILPETVRVGFSASTGEVVELHKII  257

Query  706   SWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDI  885
             SW F S L+ S+ +   K+     ++  +      +G      F+ WRKR    +   DI
Sbjct  258   SWSFNSTLETSDGKEKNKTGLIVGLLVGIGALACGLG---VIWFIYWRKRAGGHKEAIDI  314

Query  886   FGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVS  1065
                  E   G GPKRFTYREL+RATN+F++  KLGEGGFG VY+G L +  + +AVKRVS
Sbjct  315   ALE-DEFEKGTGPKRFTYRELSRATNNFAEAGKLGEGGFGGVYRGLLSDQNTEIAVKRVS  373

Query  1066  RGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSL  1245
             RGSKQG KEY SEVR+ISR+RH+NLVHLIGWCHE + L+LVYEF+ NGSLDSHL+ GK +
Sbjct  374   RGSKQGKKEYISEVRIISRLRHRNLVHLIGWCHEQRQLILVYEFMPNGSLDSHLFGGKVM  433

Query  1246  LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHE  1425
             LTW +RYKI   LASA+LYLHEE E+CIVHRDIKSSN++LDSN NAKLGDFGLARLVDHE
Sbjct  434   LTWNVRYKIALGLASAVLYLHEEWEQCIVHRDIKSSNVVLDSNFNAKLGDFGLARLVDHE  493

Query  1426  KGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIV  1605
              GS+TT LAGTMGY+A ECV +GKASKE+D+YSFG+V LE+ACGRKP++P  E   V +V
Sbjct  494   LGSQTTVLAGTMGYLAPECVTTGKASKESDVYSFGVVALEVACGRKPVEPRQEPSKVRLV  553

Query  1606  DWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFE  1785
             +WVW LYG GQLL+AAD  LS +F+ R++E +MIVGLWC HPD + RPSIRQ I VLNFE
Sbjct  554   EWVWDLYGKGQLLEAADGRLSKEFDERQMECLMIVGLWCCHPDFTNRPSIRQVINVLNFE  613

Query  1786  APLPDLPETMPVATFW  1833
             APLP LP  +PV  ++
Sbjct  614   APLPSLPSKLPVPMYY  629



>emb|CBI35559.3| unnamed protein product [Vitis vinifera]
Length=688

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/617 (52%), Positives = 420/617 (68%), Gaps = 20/617 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLV--NNSIQITPNQRNCI-----GRATYSEP  189
             I P    LSFNF  F   N   I FE+ + V  +  IQ+T N +N       GRATY + 
Sbjct  48    IFPCATSLSFNFTGFD-RNKGQIYFEKDAFVSPDQVIQLTRNLQNAAMNYSWGRATYMKQ  106

Query  190   LHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAND  369
             LHLWDK +G L+ F T F FVIDS  + +YGDG AFFLAP  +++P   T G G G+ + 
Sbjct  107   LHLWDKVSGNLTDFTTSFTFVIDSQKNNRYGDGLAFFLAPNRAQLPSKMTGGSGLGIVSP  166

Query  370   DERLNS-SNPFVAVEFDVYLNHYDTE---QKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
              + LN+  N FVAVEFD Y N +D     + HVGI+++S++SV  A W  +I  G  + A
Sbjct  167   SQALNTRKNRFVAVEFDTYRNDWDPRYPIKDHVGININSMKSVKNAAWLSNIPEGQTNHA  226

Query  538   WINYDPRSMNLSVVFR----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMIN  705
              I Y   + NLSVV R    N  S   + YI+DLRKYLPE  T G + ATG+   +  I+
Sbjct  227   SIKYTSGTKNLSVVLRTGRGNTSSIQSLYYIVDLRKYLPEFATVGISAATGRYFEIHGIH  286

Query  706   SWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDI  885
             SWI   A   +  +   ++    +V   V     ++G      +L  +K +   E D+D 
Sbjct  287   SWI---AEPPNLPKIGDENNKGLVVGLGVCAFVVVVGLGGTVFYLCRKKNEGGIEDDNDF  343

Query  886   -FGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRV  1062
                   E   G GP++F++ ELA AT++FS+ +KLGEGGFG VY+G+L+E  SY+AVKR+
Sbjct  344   DLAMDHEFEKGTGPRKFSFDELALATSNFSEGEKLGEGGFGRVYRGFLRERSSYIAVKRI  403

Query  1063  SRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKS  1242
             SR SKQG+KEYASEV++ISR+RH+NLV L+GWCH+  +LL+VYEF+ N SLDS L++ K+
Sbjct  404   SRRSKQGMKEYASEVKIISRLRHRNLVQLMGWCHKKGELLMVYEFMPNNSLDSCLFEAKT  463

Query  1243  LLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDH  1422
             LL W +RYKI   LA A+LYLHEE E+C+VHRDIKSSN+MLDS+ NAKLGDFGLAR VDH
Sbjct  464   LLRWAMRYKIAVGLALAVLYLHEEWEQCVVHRDIKSSNVMLDSDFNAKLGDFGLARFVDH  523

Query  1423  EKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNI  1602
              KGS+TT LAGTMGY+A EC ++ KASKE+D+YSFG+V LEI CGR+ ++P A+E  + +
Sbjct  524   GKGSQTTVLAGTMGYMAPECFMTSKASKESDVYSFGVVVLEICCGRRSVEPKAKENQIRL  583

Query  1603  VDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNF  1782
             V+WVW LYG G+LL+AADP LS DF+ ++++++M VGLWCAHPDC+LRPSIRQAI VLNF
Sbjct  584   VEWVWDLYGVGKLLEAADPRLSADFDEQQMKRLMTVGLWCAHPDCNLRPSIRQAINVLNF  643

Query  1783  EAPLPDLPETMPVATFW  1833
             EA LP LP  MPV  ++
Sbjct  644   EASLPILPSKMPVPMYF  660



>ref|XP_010648103.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Vitis vinifera]
Length=696

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/639 (50%), Positives = 420/639 (66%), Gaps = 39/639 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLV--NNSIQITPNQRNCI-----GRATYSEP  189
             I P    LSFNF  F   N   I FE+ + V  +  IQ+T N +N       GRATY + 
Sbjct  31    IFPCATSLSFNFTGFD-RNKGQIYFEKDAFVSPDQVIQLTRNLQNAAMNYSWGRATYMKQ  89

Query  190   LHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAND  369
             LHLWDK +G L+ F T F FVIDS  + +YGDG AFFLAP  +++P   T G G G+ + 
Sbjct  90    LHLWDKVSGNLTDFTTSFTFVIDSQKNNRYGDGLAFFLAPNRAQLPSKMTGGSGLGIVSP  149

Query  370   DERLNS-SNPFVAVEFDVYLNHYDTE---QKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
              + LN+  N FVAVEFD Y N +D     + HVGI+++S++SV  A W  +I  G  + A
Sbjct  150   SQALNTRKNRFVAVEFDTYRNDWDPRYPIKDHVGININSMKSVKNAAWLSNIPEGQTNHA  209

Query  538   WINYDPRSMNLSVVFR----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMIN  705
              I Y   + NLSVV R    N  S   + YI+DLRKYLPE  T G + ATG+   +  I+
Sbjct  210   SIKYTSGTKNLSVVLRTGRGNTSSIQSLYYIVDLRKYLPEFATVGISAATGRYFEIHGIH  269

Query  706   SWIFTSALDISENQADTKSTgkglviglvvggcfliggS------------MAFS-----  834
             SW F S L+   +  +T +        +         G              AF      
Sbjct  270   SWSFNSTLETLPHPPETGAEIPNPPETVAEPPNLPKIGDENNKGLVVGLGVCAFVVVVGL  329

Query  835   -----FLAWRKRKMREEFDDDI-FGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEG  996
                  +L  +K +   E D+D       E   G GP++F++ ELA AT++FS+ +KLGEG
Sbjct  330   GGTVFYLCRKKNEGGIEDDNDFDLAMDHEFEKGTGPRKFSFDELALATSNFSEGEKLGEG  389

Query  997   GFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKD  1176
             GFG VY+G+L+E  SY+AVKR+SR SKQG+KEYASEV++ISR+RH+NLV L+GWCH+  +
Sbjct  390   GFGRVYRGFLRERSSYIAVKRISRRSKQGMKEYASEVKIISRLRHRNLVQLMGWCHKKGE  449

Query  1177  LLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSN  1356
             LL+VYEF+ N SLDS L++ K+LL W +RYKI   LA A+LYLHEE E+C+VHRDIKSSN
Sbjct  450   LLMVYEFMPNNSLDSCLFEAKTLLRWAMRYKIAVGLALAVLYLHEEWEQCVVHRDIKSSN  509

Query  1357  IMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIV  1536
             +MLDS+ NAKLGDFGLAR VDH KGS+TT LAGTMGY+A EC ++ KASKE+D+YSFG+V
Sbjct  510   VMLDSDFNAKLGDFGLARFVDHGKGSQTTVLAGTMGYMAPECFMTSKASKESDVYSFGVV  569

Query  1537  TLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGL  1716
              LEI CGR+ ++P A+E  + +V+WVW LYG G+LL+AADP LS DF+ ++++++M VGL
Sbjct  570   VLEICCGRRSVEPKAKENQIRLVEWVWDLYGVGKLLEAADPRLSADFDEQQMKRLMTVGL  629

Query  1717  WCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW  1833
             WCAHPDC+LRPSIRQAI VLNFEA LP LP  MPV  ++
Sbjct  630   WCAHPDCNLRPSIRQAINVLNFEASLPILPSKMPVPMYF  668



>ref|XP_006466572.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Citrus sinensis]
Length=684

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/616 (53%), Positives = 422/616 (69%), Gaps = 25/616 (4%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQNITFERTSLVNN-SIQITPNQ-----RNCIGRATYSEPLH  195
             +P  + +SFNF  F P NV  ITFE  S  ++ ++Q+T NQ      + +GRATY++P+ 
Sbjct  23    VPHGNSVSFNFPNFQP-NVPTITFEGDSFASDEALQLTKNQVDDNLTSSVGRATYNQPVP  81

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             +WD  T +L+ F THF+FV+ +   A+YG+G +FFLAP  S+IP N++ G    L + + 
Sbjct  82    IWDAKTRRLTDFTTHFSFVMSAPNPAEYGEGISFFLAPFNSKIPDNSSDGY-LALFSPET  140

Query  376   RLN--SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
              LN  S N  VAVEFD   N +D    HVGI+V+S+ S  T  W   I+    + AW++Y
Sbjct  141   ALNNDSRNQIVAVEFDSNKNRWDPSSDHVGINVNSIASEKTVLWKSSIKTAATANAWVSY  200

Query  550   DPRSMNLSV--------VFRNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMIN  705
             +  + NLSV        V+R   S  HV   +DLR+ LPE V  GF+ +TG+   L  I 
Sbjct  201   NSTTQNLSVFLTYAHKPVYRGNSSLWHV---VDLREILPETVRVGFSASTGEVVELHKII  257

Query  706   SWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDI  885
             SW F S L+ S+ +   K+     ++  +      +G      F+ WRKR    +   DI
Sbjct  258   SWSFNSTLETSDGKEKNKTGLIVGLLVGIGALACGLG---VIWFMYWRKRVGGHKEAIDI  314

Query  886   FGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVS  1065
                  E   G GPKRFTYREL+RATN+F++  KLGEGGFG VY+G L +  + +AVKRVS
Sbjct  315   ALE-DEFEKGTGPKRFTYRELSRATNNFAEAGKLGEGGFGGVYRGLLSDQNTEIAVKRVS  373

Query  1066  RGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSL  1245
             RGSKQG KEY SEVR+ISR+RH+NLVHLIGWCHE + L+LVYEF+ NGSLDSHL+ GK +
Sbjct  374   RGSKQGKKEYISEVRIISRLRHRNLVHLIGWCHEQRQLILVYEFMPNGSLDSHLFGGKVM  433

Query  1246  LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHE  1425
             LTW +R+KI   LASA+LYLHEE E+CIVHRDIKSSN++LDSN NAKLGDFGLARLVDHE
Sbjct  434   LTWNVRHKIALGLASAVLYLHEEWEQCIVHRDIKSSNVVLDSNFNAKLGDFGLARLVDHE  493

Query  1426  KGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIV  1605
              GS+TT LAGTMGY+A ECV +GKASKE+D+YSFG+V LE+ACGRKP++P  E   V +V
Sbjct  494   LGSQTTVLAGTMGYLAPECVTTGKASKESDVYSFGVVALEVACGRKPVEPRQEPSKVRLV  553

Query  1606  DWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFE  1785
             +WVW LYG GQLL+AAD  LS +F+ R++E +MIVGLWC HPD + RPSIRQ I VLNFE
Sbjct  554   EWVWDLYGKGQLLEAADGRLSKEFDERQMECLMIVGLWCCHPDFTNRPSIRQVINVLNFE  613

Query  1786  APLPDLPETMPVATFW  1833
             APLP LP  +PV  ++
Sbjct  614   APLPSLPSKLPVPMYY  629



>ref|XP_002310341.1| hypothetical protein POPTR_0007s15010g [Populus trichocarpa]
 gb|EEE90791.1| hypothetical protein POPTR_0007s15010g [Populus trichocarpa]
Length=692

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/611 (54%), Positives = 418/611 (68%), Gaps = 23/611 (4%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSLVNNSI-QITPNQRNC-----IGRATYSEPLHLWDKPT  213
             LSFNF  F+P N+ NI F+  +  ++ + Q+T N ++       GRA+Y +P+ LWD  T
Sbjct  33    LSFNFTSFSP-NMANIFFQGDAFSSSDVLQLTKNAKDINLTGSAGRASYYKPVRLWDAKT  91

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS-  390
              +L+ F THF FV+ +  S +YGDG +FF+APL S IP +++ GG   L +    L++S 
Sbjct  92    RRLTDFTTHFTFVMKAVDSGRYGDGMSFFIAPLDSPIPQDSS-GGLLALFSPHTALSASK  150

Query  391   -NPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSM  564
              N  VAVEFD   +  +D    HVGIDV+S+ SV +  W   I+ G  + AW++Y+  + 
Sbjct  151   ENQIVAVEFDSKKDIEWDPSDNHVGIDVNSIVSVASVDWKSSIKTGSKANAWVSYNSTTK  210

Query  565   NLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSAL  729
             NLSV         FG    + YI+DLR++LPE V  GF+ +TG    +  I SW F S+L
Sbjct  211   NLSVFLTYAENPEFGGNSTLHYIIDLREFLPEWVRIGFSASTGDWVEIHNILSWTFESSL  270

Query  730   DISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIF--GNIGE  903
             ++S    D K TG  + + + +G     G  +    L WRK + R E D++        E
Sbjct  271   EVS----DKKKTGLVVGLAVGIGVLTTFGIGVLCFVLCWRKNRTRCEKDNEAIDVSMDDE  326

Query  904   LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKE-LESYVAVKRVSRGSKQ  1080
                G GPKRFTYREL RATN+F++  KLGEGGFG VYKG L E   + VAVKRVSRGSKQ
Sbjct  327   FEKGTGPKRFTYRELIRATNNFAEGGKLGEGGFGGVYKGLLNEGTNTEVAVKRVSRGSKQ  386

Query  1081  GIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPL  1260
             G KEY SEV++ISR+RH+NLV LIGWCHE  +LLLVYEF+ NGSLDSHL+ G+ +L W L
Sbjct  387   GKKEYVSEVKIISRLRHRNLVQLIGWCHERGELLLVYEFMLNGSLDSHLFGGQVMLVWNL  446

Query  1261  RYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRT  1440
             RYKI   LASALLYLHEE E+C+VHRDIKSSN+MLDSN NAKLGDFGLARLVDHE GS+T
Sbjct  447   RYKIALGLASALLYLHEEWEQCVVHRDIKSSNVMLDSNFNAKLGDFGLARLVDHELGSQT  506

Query  1441  TALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWK  1620
             T LAGTMGY+A ECV +GKASKE+D+YSFG+V LEI CGR+P++   E C V +V+WVW 
Sbjct  507   TVLAGTMGYLAPECVTTGKASKESDVYSFGVVALEITCGRRPVETRQEPCKVRLVEWVWN  566

Query  1621  LYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPD  1800
             LYG GQLLDA D  L  DF+ R++E +MIVGLWC HPD +LRPSIRQ I VLNFEAPLP 
Sbjct  567   LYGEGQLLDAVDKMLCTDFDERQMECLMIVGLWCCHPDYTLRPSIRQVINVLNFEAPLPT  626

Query  1801  LPETMPVATFW  1833
             LP  +PV  ++
Sbjct  627   LPSKLPVPMYY  637



>ref|XP_008367124.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Malus domestica]
Length=704

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/637 (51%), Positives = 421/637 (66%), Gaps = 50/637 (8%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPN-----QRNCIGRATYSEPLHLWD  204
             V PLSFNF  F P+ ++N++ E  + ++   +++T +     Q   +GRATYS+P  L D
Sbjct  21    VSPLSFNFSTF-PNGIKNLSLEGDAYIDGKYLRLTKSAVDDVQNQSVGRATYSQPFLLRD  79

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
             K TGKL+ F T+F FVIDS G   Y DGFAFFLAP GS +     +GG  GL  D     
Sbjct  80    KVTGKLADFTTNFTFVIDSRGKTPYADGFAFFLAPNGSLLNKTIGRGGSLGLPVDTSPDV  139

Query  385   S--SNPFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWIN  546
             S    PF AVE D+Y N+     D    HVG+D++S++S +T  W+  I  G  +   I+
Sbjct  140   SKIQYPFWAVELDIYRNNVTSVEDPAGDHVGVDINSVKSKMTESWNGSITNGRVNSVGIS  199

Query  547   YDPRSMNLSVVFRNFGSYGHVSYILDLRKYLPER----VTFGFAGATGKDTALQMINSWI  714
             YD  S ++ +VF ++     V   +D R  L E     V  GF+ ATG  TA+  I SW 
Sbjct  200   YDSSSKHVGIVFTSYVKDVQVMKYMDCRVDLNEILQGWVVVGFSAATGSLTAVDKIQSWS  259

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFS-------------------F  837
             F S     EN+  TK+T        +V      G ++                      F
Sbjct  260   FNSFQLREENE--TKNTPVVPEPSPIVDPKSGNGVNVGLIVGLGAGGIAFLVGGLGLVWF  317

Query  838   LAWRKRK------MREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGG  999
             L W+K        M  ++ D+      E   G GPK+F+YR LAR+T++F +++KLGEGG
Sbjct  318   LIWKKXAGSSKDGMVNDWIDE------EFQKGTGPKKFSYRTLARSTSNFDEREKLGEGG  371

Query  1000  FGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDL  1179
             FG VY+G++K+L +YVAVKRVS  S+QG+KEYA+EVR+ISR+RH+NLV LIGWCHE ++L
Sbjct  372   FGGVYRGFIKDLNAYVAVKRVSSRSRQGMKEYAAEVRIISRLRHRNLVQLIGWCHEKREL  431

Query  1180  LLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNI  1359
             LLVYEF+SNGSLDSHL+KGK+LL W  R KIVQ LAS LLYLHEE E+C++HRDIKSSNI
Sbjct  432   LLVYEFMSNGSLDSHLFKGKTLLDWEARNKIVQGLASGLLYLHEEWEQCVLHRDIKSSNI  491

Query  1360  MLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVT  1539
             MLDSNLNAKLGDFGLARLVDH K S+TT LAGTMGY+A EC+ +GKASKETD+YSFG+V 
Sbjct  492   MLDSNLNAKLGDFGLARLVDHGKQSQTTVLAGTMGYMAPECLTTGKASKETDVYSFGVVA  551

Query  1540  LEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLW  1719
             LEIACGRKPIDP  E    N+ +WVW+LYG G++++A DP L G+F+ +++E +++VGLW
Sbjct  552   LEIACGRKPIDPNLESSERNMAEWVWELYGQGKVIEATDPKLCGEFDEKQMECLLVVGLW  611

Query  1720  CAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             C HPD ++RPSI+Q IQVLNFE PLP LP  MPVA++
Sbjct  612   CVHPDYTIRPSIQQTIQVLNFEVPLPILPSKMPVASY  648



>ref|XP_009339309.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Pyrus x bretschneideri]
Length=740

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/659 (51%), Positives = 433/659 (66%), Gaps = 57/659 (9%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPN-----QRNCIGRATYSEPLHL  198
             P V PL+FNF  F+  +  NI+ E  + +    +++T +     Q   +GRATY +P  L
Sbjct  28    PSVTPLNFNFPSFSNDDSANISIEGDAYLGRPFLRLTRDATDVAQNYSVGRATYRQPFLL  87

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLA-----  363
              +K TGKL+ F T F F I+SN     GDG AFF+AP GS +     KGG  GL      
Sbjct  88    QEKATGKLADFTTSFDFAINSNNQPVPGDGLAFFMAPYGSVLNSTLGKGGSLGLPFNSTP  147

Query  364   NDDERLNSSNPFVAVEFDVYLNHY-----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWG  528
             +DD  L +  PFVAVEFD++  +      D + +HVGIDV+SL S    PW   I  G  
Sbjct  148   SDDFVLRNQYPFVAVEFDIFYYNVLTTIDDPQYEHVGIDVNSLNSSSLKPWDGGIAEGIP  207

Query  529   SEAWINYDPRSMNLSVVFRNF-GSYGHVS--------YILDLRKYLPERVTFGFAGATGK  681
             + A I Y+    NLSV F  F  S  +VS        YI+DL+ YLP+RV  GF+ +TG+
Sbjct  208   NRATITYNSSLKNLSVAFTTFVTSDNNVSRQKMRYFYYIVDLKHYLPDRVVVGFSASTGQ  267

Query  682   DTALQMINSWIFTS------------------ALDISENQAD--------TKSTgkglvi  783
               A+  I SW FTS                  A+ +S   A          K  G  + +
Sbjct  268   CFAIHKIISWNFTSTSLDDHDEPGTAPPPLQVAVPVSSPMASPTYPPKTVNKRIGLVIGL  327

Query  784   glvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNI---GELGGGAGPKRFTYRELAR  954
             G+      + G  + + FL W++R+  E  D+D   +     E   GA P++F+YRELAR
Sbjct  328   GIGGCAVVVTGLGLVWFFL-WKRRETGESSDEDTMVHELVDEEFEKGACPRKFSYRELAR  386

Query  955   ATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHK  1134
             ATN+F Q++KLGEGGFG VYKG + +L+S VAVKR+S+GSKQG KEYASEV+ ISR+RH+
Sbjct  387   ATNNFGQEEKLGEGGFGGVYKGIIPDLKSPVAVKRISKGSKQGPKEYASEVKTISRLRHR  446

Query  1135  NLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEE  1314
             NLV LIGWCHE K  LLVYEF+  GSLDSHL+K +SLLTW  RYKI Q LAS LLYLH+E
Sbjct  447   NLVQLIGWCHEKK-FLLVYEFMPKGSLDSHLFKEQSLLTWEARYKIAQGLASGLLYLHQE  505

Query  1315  CEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSG  1494
              E+C++HRDIKSSN+MLD+N NAKLGDFGLARLVDH +  +TTALAGTMGY+A E V++G
Sbjct  506   WEQCVLHRDIKSSNVMLDANFNAKLGDFGLARLVDHGQEPQTTALAGTMGYMAPEYVITG  565

Query  1495  KASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGD  1674
             KASKE+D+YSFGIV LEI CGRKPIDP      VN+V+WVW+LYG  ++++AADP L GD
Sbjct  566   KASKESDVYSFGIVALEICCGRKPIDPKFGSSKVNMVEWVWELYGEDKVIEAADPKLCGD  625

Query  1675  FNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW-PQRNV  1848
             F+ +++E +MIVGLWCAHPD ++RPSI+QAIQVLNFE PLP+LP  MPVAT++ P R++
Sbjct  626   FDEKQMECLMIVGLWCAHPDNNMRPSIQQAIQVLNFEVPLPNLPSNMPVATYFAPSRSL  684



>ref|XP_004293018.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Fragaria vesca subsp. vesca]
Length=698

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/623 (51%), Positives = 428/623 (69%), Gaps = 29/623 (5%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNCI-----GRATYSEPLHLWDKPT  213
             PL+FNF  F P    NI+ E  +  + S+++T +  + +     GRATY + L L +  T
Sbjct  30    PLTFNFPSFPPDVATNISMEGNASADGSLRLTKSALDQVLNMSFGRATYRKNLLLRENST  89

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSN  393
             GKL+ F + F FVIDS+ + + GDG AFFLAP+GS +   + +G   GL  +   L+ + 
Sbjct  90    GKLADFTSSFTFVIDSDNNNRSGDGLAFFLAPVGSALNTTSGQGRSLGLPVNTTLLDYTQ  149

Query  394   -----PFVAVEFDVYLNH---YDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
                  PFVAVEFD++ N          HVGID+++++S VT PW+  I  G  + A + Y
Sbjct  150   WTTEYPFVAVEFDIFPNKVVDLGVNYTHVGIDINTVRSNVTEPWNGSITAGNENNATVTY  209

Query  550   DPRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
             D    NLSV F  F +      ++ + +DL +YLP+ V  GF+ ATG  TAL  INSW F
Sbjct  210   DSNKKNLSVAFTTFENGVQVIRNIHFSVDLLRYLPDVVIVGFSAATGTLTALHKINSWRF  269

Query  718   --TSALD-ISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMR--EEFDDD  882
               TS +D IS +++   + G  + + +       +   + + FL +RKR+    E  DDD
Sbjct  270   DSTSLIDEISTSKSGNANIGLVVGLVVGGIVILAVVLGLVW-FLFYRKRRETNGEITDDD  328

Query  883   IFG----NIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVA  1050
                    N  +   G GP++F+Y ELA ATN+F+Q++KLGEGGFG VYKG++K++ +YVA
Sbjct  329   SMVLQDLNPEDFEKGTGPRKFSYNELALATNNFAQEEKLGEGGFGGVYKGFIKDMNAYVA  388

Query  1051  VKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLY  1230
             VK++SRGSKQG+KEYA+EV +ISR+RH+NLV LIGWCH+ K LLLVYEF+ NGSLD+HL+
Sbjct  389   VKKISRGSKQGLKEYAAEVSIISRLRHRNLVQLIGWCHDKK-LLLVYEFMPNGSLDAHLF  447

Query  1231  KGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLAR  1410
             K K LLTW +RYKI   LAS LLYLH+  E+C++HRDIKSSN+MLD+N NAKLGDFGLAR
Sbjct  448   KQKGLLTWEVRYKIAHGLASGLLYLHQGWEQCVLHRDIKSSNVMLDANYNAKLGDFGLAR  507

Query  1411  LVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEEC  1590
             LVDH K S+TT +AGTMGY+A E V +GKASKETD+YSFG+V LEIACGRKPID   E  
Sbjct  508   LVDHGKLSQTTVVAGTMGYMAAEYVTTGKASKETDVYSFGVVALEIACGRKPIDTRYEGK  567

Query  1591  HVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQ  1770
              +N+V+WVW+LYG G++++AADP L G+F+ +++E +MIVGLWCAHPD + RP I+QAIQ
Sbjct  568   QMNMVEWVWELYGEGKIIEAADPKLCGEFDEKQMECLMIVGLWCAHPDHNSRPLIQQAIQ  627

Query  1771  VLNFEAPLPDLPETMPVATFWPQ  1839
             VL+FE PLP+LP  MPVA F P 
Sbjct  628   VLDFEIPLPNLPLKMPVA-FAPH  649



>ref|XP_008383483.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Malus domestica]
Length=707

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/641 (51%), Positives = 416/641 (65%), Gaps = 46/641 (7%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPN-----QRNCIGRATYSEPLHL  198
             P   PLSFNF  F P+ + N+  E  + V+ + +++T +     Q   +GRATYS+P  L
Sbjct  16    PCATPLSFNFSSF-PNGLTNLFIEGDAFVDGTFLRLTKSAADIRQDQSVGRATYSQPFLL  74

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
              +  TGKL+ F T F FVIDS G   Y DGFAFFLAP GS +      GG  GL   +  
Sbjct  75    RENATGKLADFTTSFTFVIDSVGKTPYADGFAFFLAPNGSLLNTTIGLGGSLGLPVINRP  134

Query  379   LNSSN---PFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
              N S    PFVAVEFD+  N      D    HVGID++SL+S VT PW+  I  G  + A
Sbjct  135   NNESTNLYPFVAVEFDINPNSITSIEDPVGDHVGIDINSLKSEVTTPWNGSITTGRVNTA  194

Query  538   WINYDPRSMNLSVVFRNF--GS--YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMIN  705
              I YD  S NLSVV+ +   GS  + ++SYI+DL +YL   V  GF+ ATG  TAL  IN
Sbjct  195   QIRYDSGSKNLSVVYTSVVNGSRVWRNISYIVDLNEYLQGYVIVGFSAATGAFTALHRIN  254

Query  706   SWIFTSA--LDISENQADTKSTgkglviglvvggcfliggSMAFSF--------------  837
             SW F S    D +E +  T          +VV G                          
Sbjct  255   SWNFNSTELRDGNEFKNSTPVVPVPEPNPIVVPGTGNGVNVGLVVGLVVGGCVVLAGGLV  314

Query  838   ----LAWRKRKMREEFD------DDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKL  987
                 + WRK K  E  D      +D      E   G GPK+F+Y+ LA++T +F + +KL
Sbjct  315   LVWCIXWRKGKXGESSDXEXPMXNDXIDE--EFEKGTGPKKFSYKTLAQSTGNFDEGEKL  372

Query  988   GEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHE  1167
             GEGGFG VY+G++ +L+SYVAVKR S GS QG+KEYA+EVR+ISR+RH+NLV LIGWCHE
Sbjct  373   GEGGFGGVYRGFIXDLDSYVAVKRXSSGSXQGMKEYAAEVRIISRLRHRNLVQLIGWCHE  432

Query  1168  NKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIK  1347
              ++LLLVYEF+SNGSLDSHL+K  + L W  RY+I Q LAS L YLHEE E+C++HRDIK
Sbjct  433   KRELLLVYEFMSNGSLDSHLFKPXTXLHWEARYRIAQGLASGLXYLHEEWEQCVLHRDIK  492

Query  1348  SSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSF  1527
             SSNIMLDSN NAKLGDFGLARLVDH K S+TT LAGTMGY+A EC  +GKASKETD+YSF
Sbjct  493   SSNIMLDSNFNAKLGDFGLARLVDHGKQSQTTVLAGTMGYMAPECXTTGKASKETDVYSF  552

Query  1528  GIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMI  1707
             G+V LEIACGRKPIDP      +N+V+WVW LYG G++++AADP L G+F+ +++E ++I
Sbjct  553   GVVALEIACGRKPIDPKXGXTQINMVEWVWXLYGEGKIIEAADPKLCGEFDAKQMECLLI  612

Query  1708  VGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             VGLWCAHPD ++R SI+Q IQVLNFE PLP LP  MPVA++
Sbjct  613   VGLWCAHPDYTMRXSIQQTIQVLNFEVPLPILPSKMPVASY  653



>ref|XP_007212833.1| hypothetical protein PRUPE_ppa020749mg [Prunus persica]
 gb|EMJ14032.1| hypothetical protein PRUPE_ppa020749mg [Prunus persica]
Length=690

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/625 (51%), Positives = 410/625 (66%), Gaps = 28/625 (4%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITP----NQRN-CIGRATYSEPLHLW  201
             P    L F+F  F PS +  ++ E  + ++  +++T     +Q+N  +GRATYS+P  L 
Sbjct  13    PCATSLDFSFPTF-PSGINTLSLEGDASLDGFLRLTKSAVDDQKNFSVGRATYSKPFLLR  71

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             D  TGKL+ F T F F IDS G   YGDG AFFLAP GS +     KGG  GL       
Sbjct  72    DDATGKLADFTTTFTFAIDSEGKTIYGDGLAFFLAPNGSALNTTIGKGGSLGLPTTTPVG  131

Query  382   NSSN---PFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAW  540
             N S    PFVAVEFD++ N      D    HVGIDV+S++S VT PW+  I  G  + A 
Sbjct  132   NESTNLYPFVAVEFDIFHNLRTSIEDPAGDHVGIDVNSVKSKVTRPWNGSITEGQVNNAS  191

Query  541   INYDPRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINS  708
             I +D  S NL+V F  + +       ++Y++DL + L   V  GF+ ATG  TAL  I S
Sbjct  192   IRFDSASKNLNVTFTTYQNGVWVERDLAYMVDLNEILQGWVIVGFSAATGSRTALHKIIS  251

Query  709   WIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFS-----------FLAWRKR  855
             W F S   I EN  +  S       G  +    ++G  +              F+ W+K 
Sbjct  252   WSFNSTSLIDENAKNNTSGNGNNTSGNGINIGLVVGLVVGGCVLLVGGFCLVWFIFWKKG  311

Query  856   KMREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKEL  1035
                E  D+D      E   G GPK+F+Y+ LA++TN F + +KLGEGGFG VY+G++K+L
Sbjct  312   GTGESSDNDEDPIDEEFEKGTGPKKFSYKILAQSTNDFDEGEKLGEGGFGGVYRGFVKDL  371

Query  1036  ESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSL  1215
              SYVAVKRVS GS+QG+KEYA+EVR+ISR+RH+NLV LIGWCHE ++LLLVYEF+SNGSL
Sbjct  372   NSYVAVKRVSSGSRQGLKEYAAEVRIISRLRHRNLVQLIGWCHEKRELLLVYEFMSNGSL  431

Query  1216  DSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGD  1395
             DSHL+KGKSLL W  RYKI Q L S L YLHEE E+C++HRDIKSSNIMLDSN NAKLGD
Sbjct  432   DSHLFKGKSLLGWEARYKIAQGLVSGLFYLHEEWEQCVLHRDIKSSNIMLDSNFNAKLGD  491

Query  1396  FGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDP  1575
             FGLARLVDH K S TT LAGTMGY+A ECV +G ASKETD+YSFG+V LEIACGRKP+DP
Sbjct  492   FGLARLVDHGKQSHTTVLAGTMGYMAPECVTTGTASKETDVYSFGVVALEIACGRKPVDP  551

Query  1576  TAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSI  1755
                   +N+V+WVW+LYG G++++AADP L  DF+ +++E ++IVGLWCAHPD  +RPS 
Sbjct  552   KLGTSKINMVEWVWELYGQGKVIEAADPKLCRDFDEKQIECLLIVGLWCAHPDYKIRPST  611

Query  1756  RQAIQVLNFEAPLPDLPETMPVATF  1830
             +Q IQVL+ E   P LP  MPVA++
Sbjct  612   QQIIQVLSLEVAPPILPSKMPVASY  636



>ref|XP_009340630.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Pyrus x bretschneideri]
Length=703

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/631 (50%), Positives = 409/631 (65%), Gaps = 39/631 (6%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVNNSI------QITPNQRNCIGRATYSEPLHLWDKP  210
             PLSFNF  F P+ +  ++ E  + ++          I       +GRATYS+P  L DK 
Sbjct  24    PLSFNFPTF-PNGINTLSLEGDAYIDGKFLRLTKSSIDDVHDQSVGRATYSQPFLLRDKA  82

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS  390
             TG L+ F T+F FVIDS G   Y DG AFFLAP GS +     +GG  GL  D+   N S
Sbjct  83    TGNLADFTTNFTFVIDSRGKTPYADGLAFFLAPNGSLLNSTIGRGGSLGLPVDNLPHNVS  142

Query  391   N---PFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
                 PF AVEFD+Y N      D    HVG+D++S++S +T  W+  I  G  +   I+Y
Sbjct  143   KSQYPFWAVEFDIYRNEVTSVEDPAGDHVGVDINSVKSKMTESWNGSITNGQVNSVGISY  202

Query  550   DPRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
             D  S ++ +VF ++ +      H+   +DL + L   V  GF+ ATG  TA+  I SW F
Sbjct  203   DSASNHVGIVFTSYVNDVQVMKHIDCRVDLNEILQGWVIVGFSAATGSLTAVDKIKSWSF  262

Query  718   TSALDISENQADTKSTgkglviglvvggcfliggSMAFS-----------------FLAW  846
              S     EN     S        +           + F                  FL W
Sbjct  263   NSIQLHEENATKNTSVVPEPSPIVDPKLGNGTDIGLIFGLGAGGIVFLVGGLGLVWFLIW  322

Query  847   RKRKMREEFDDDIFGNI--GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKG  1020
             +KR    E  D +  +    E   G GPK+F+YR LA +T++F +++KLGEGGFG VY+G
Sbjct  323   KKRGSSSE--DGMVNDWIDEEFQKGTGPKKFSYRTLAASTSNFDEREKLGEGGFGGVYRG  380

Query  1021  YLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFL  1200
             ++K+L +YVAVKR+S  S+QG+KEYA+EVR+ISR+RH+NLV LIGWCHEN++LLLV EF+
Sbjct  381   FIKDLNTYVAVKRISSKSRQGMKEYAAEVRIISRLRHRNLVQLIGWCHENRELLLVSEFM  440

Query  1201  SNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLN  1380
             SNGSLDSHL+KGKSLL W  R KIVQ LAS LLYLHEE E+C++HRDIKSSNIMLDSN N
Sbjct  441   SNGSLDSHLFKGKSLLAWEARNKIVQGLASGLLYLHEEWEQCVLHRDIKSSNIMLDSNFN  500

Query  1381  AKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGR  1560
             AKLGDFGLARLVDH K S+TT LAGTMGY+A EC+ +GKASKETD+YSFG+V LEI CGR
Sbjct  501   AKLGDFGLARLVDHGKQSQTTVLAGTMGYMAPECLTTGKASKETDVYSFGVVALEIVCGR  560

Query  1561  KPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCS  1740
             KPI+P +    +N+V WVW+LYG G++++AADP L G+F+ +++E ++IVGLWCAHPD +
Sbjct  561   KPIEPMSGRSKMNMVAWVWELYGEGKVIEAADPKLCGEFDEKQMECLLIVGLWCAHPDYT  620

Query  1741  LRPSIRQAIQVLNFEAPLPDLPETMPVATFW  1833
             +RPSIRQ IQVLNFE PLP LP  MPVA ++
Sbjct  621   IRPSIRQTIQVLNFEVPLPTLPSKMPVAGYF  651



>ref|XP_008226559.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Prunus mume]
Length=700

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/638 (50%), Positives = 412/638 (65%), Gaps = 39/638 (6%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPN-----QRNCIGRATYSEPLHL  198
             P    LSF+F  FT  ++  ++ E  + V    +++T +     Q   +GRATYS+P  L
Sbjct  13    PAASSLSFSFPNFTNDDINTLSLEGDAFVGGDFLRLTKSTADQVQDQSVGRATYSQPFLL  72

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
              D  TGKL+ F T+F F IDS     Y DG AFFLAP GS +     +GG  GL   +  
Sbjct  73    RDNATGKLADFTTNFTFAIDSLDKTPYADGLAFFLAPNGSALNRTIGRGGALGLPVINPE  132

Query  379   LNSSN---PFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
              N S    PFVAVEFD+Y N++    D    HVGIDV+S++S VT  W+  I  G  + A
Sbjct  133   KNESTNLYPFVAVEFDIYSNNFTSVEDPAGDHVGIDVNSVKSKVTRAWNGSITKGPLNNA  192

Query  538   WINYDPRSMNLSVVFRNFGSYGHV----SYILDLRKYLPERVTFGFAGATGKDTALQMIN  705
             WI YD  S NLSV F  + +   V     Y++D+ + L   V  GF+ ATG  TAL  IN
Sbjct  193   WIRYDSGSKNLSVTFTTYENGVRVRRYFDYMVDVNEILQGWVIVGFSAATGAMTALYKIN  252

Query  706   SWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFS-----------------  834
             SW F S   I EN  +           +  G    I   +                    
Sbjct  253   SWSFNSTSLIDENANNNTPVAPEPTPIVEPGSGNGINIGLVVGLVVGGCVLLVGGFCLVW  312

Query  835   FLAWRKRKMREEFDDDIFGNIG-----ELGGGAGPKRFTYRELARATNSFSQQDKLGEGG  999
             F+ W+K    E  D+D    I      E   G GPK+F+Y+ LA++TN F + +KLGEGG
Sbjct  313   FIFWKKGGTGESSDNDEDPMINDPIDDEFEKGTGPKKFSYKMLAQSTNDFDEGEKLGEGG  372

Query  1000  FGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDL  1179
             FG VY+G++K+L+S VAVKRVS GS+QG+KEYA+EVR+ISR+RH+NLV LIGWCHE ++L
Sbjct  373   FGGVYRGFVKDLDSNVAVKRVSSGSRQGLKEYAAEVRIISRLRHRNLVQLIGWCHEKREL  432

Query  1180  LLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNI  1359
             LLVYEF+SNGSLDSHL+KGK+LL W  RY+I Q LAS L YLHEE E+C++HRDIKSSNI
Sbjct  433   LLVYEFMSNGSLDSHLFKGKNLLGWEARYRIAQGLASGLFYLHEEWEQCVLHRDIKSSNI  492

Query  1360  MLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVT  1539
             MLDSN NAKLGDFGLA+L DH K S+TT LAGTMGY+A ECV +GKASKETD+YSFG+V 
Sbjct  493   MLDSNFNAKLGDFGLAQLFDHGKQSQTTILAGTMGYMAPECVTTGKASKETDVYSFGVVA  552

Query  1540  LEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLW  1719
             LEIACGRKPIDP      +N+V+WVW+LYG G++++AADP L GDF+ +++E ++IVGLW
Sbjct  553   LEIACGRKPIDPKLGTSKINMVEWVWELYGQGKVIEAADPKLCGDFDEKQIECLLIVGLW  612

Query  1720  CAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW  1833
             CAHPD  +RPS +Q IQVL+ E   P LP  MPVA+++
Sbjct  613   CAHPDYKIRPSTQQIIQVLSLEVAPPILPSKMPVASYF  650



>ref|XP_009339306.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Pyrus x bretschneideri]
Length=701

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/637 (50%), Positives = 421/637 (66%), Gaps = 50/637 (8%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQRN-----CIGRATYSEPLHLWD  204
             V PLSFNF  F P+ ++N++ E  + ++   +++T +  +      +GRATYS+P  L D
Sbjct  22    VFPLSFNFSTF-PNGIKNLSLEGDAYIDGKYLRLTKSAVDDVLDQSVGRATYSQPFLLRD  80

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
             K TGKL+ F T+F F+IDS G   Y DG AFFLAP GS +     +GG  GL  D     
Sbjct  81    KVTGKLADFTTNFTFIIDSRGKTPYADGLAFFLAPNGSLLNKTIGRGGSLGLPVDTSPQV  140

Query  385   S--SNPFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWIN  546
             S    PF AVE DVY N+     D    HVG+D++S++S +T  W+  I  G  +   I+
Sbjct  141   SKIQYPFWAVELDVYRNNVPSVEDPAGDHVGVDINSVKSKMTESWNGSITNGRVNSVGIS  200

Query  547   YDPRSMNLSVVFRNFGSYGHVSYILDLRKYLPER----VTFGFAGATGKDTALQMINSWI  714
             YD  S ++ +VF ++     V   +D R  L E     V  GF+ ATG  TA+  I SW 
Sbjct  201   YDSASKHVGIVFTSYVKDVQVMKYMDCRVDLNEILQGWVVVGFSAATGSLTAVDKIQSWS  260

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFS-------------------F  837
             F S     EN+  TK+T        +V      G ++                      F
Sbjct  261   FNSFQLCEENE--TKNTPVVPEPSSIVDPKSGNGVNVGLIVGLGAGGIALLVGGLGLVWF  318

Query  838   LAWRKRK------MREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGG  999
             L W+KR+      M  ++ D+      E   G GPK+F+Y  LAR+T++F +++KLGEGG
Sbjct  319   LIWKKREGSSKDGMVNDWIDE------EFQKGTGPKKFSYGTLARSTSNFDEREKLGEGG  372

Query  1000  FGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDL  1179
             FG VY+G++K+L++YVAVKR+S  S QG+KEYA+EVR+ISR+RH+NLV LIGWCHE + L
Sbjct  373   FGGVYRGFIKDLKAYVAVKRISSRSTQGMKEYAAEVRIISRLRHRNLVQLIGWCHEKRGL  432

Query  1180  LLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNI  1359
             LLVYEF+SNGSLDSHL+KGKSLL W  R KIVQ LAS LLYLHEE E+C++HRDIKSSNI
Sbjct  433   LLVYEFMSNGSLDSHLFKGKSLLAWEARNKIVQGLASGLLYLHEEWEQCVLHRDIKSSNI  492

Query  1360  MLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVT  1539
             MLDSNLNAKLGDFGLARLVDH K S+TT LAGTMGY+A EC+ +GKASKETD+YSFG+V 
Sbjct  493   MLDSNLNAKLGDFGLARLVDHGKQSQTTVLAGTMGYMAPECLTTGKASKETDVYSFGVVA  552

Query  1540  LEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLW  1719
             LEIACGRKPIDP +E    N+ +WVW+LYG G++++AADP L G+F+ +++E +++VGLW
Sbjct  553   LEIACGRKPIDPNSESSETNMAEWVWELYGQGKVIEAADPKLCGEFDEKQMECLLVVGLW  612

Query  1720  CAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             C HPD ++RPSI+Q IQVL FE PLP LP  MPVA++
Sbjct  613   CVHPDYTIRPSIQQTIQVLKFEVPLPILPSKMPVASY  649



>emb|CAN70210.1| hypothetical protein VITISV_007747 [Vitis vinifera]
Length=692

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/611 (53%), Positives = 414/611 (68%), Gaps = 26/611 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSI-QITPNQRNCIGRATYSEPLHLWDK  207
             +IP    L FNF  F+P N  NIT+E ++   N I Q+T  Q   IG ATY +PLHLWDK
Sbjct  42    MIPSATSLDFNFTSFSPYN-DNITYEGSAYPRNQIIQLTQAQSASIGWATYVQPLHLWDK  100

Query  208   PTGKLSSFNTHFAFVIDS-NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
              +G L+ F THF+FVID+ N S  +GDG AFFL P  S+  PN TKGGG GLA+D + LN
Sbjct  101   ASGNLTDFTTHFSFVIDTQNRSGSHGDGIAFFLMPADSQ-KPNVTKGGGLGLASDTQPLN  159

Query  385   SS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
             ++ N FVAVEFD+Y N +D    H GID++S+QS+    W   I  G  ++AWI+Y+  S
Sbjct  160   TTVNHFVAVEFDIYKNRWDPNDTHAGIDINSVQSIRNVKWWDSIINGRINDAWISYNSSS  219

Query  562   MNLSVVFRNFGS-----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
              NLSVVF  F +       ++ Y +DLR YLPE         T  +             A
Sbjct  220   KNLSVVFTGFRNDSTILQDNLYYEVDLRLYLPEWADENKTNPTSPE-------------A  266

Query  727   LDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG--  900
                + N     S    + + + +              L    +  R + D+ +   +   
Sbjct  267   ETPTSNPNSNPSRKIKVKLVVGLTVGGCAFVGSLSLVLFLFLKSRRGKVDNPVIDQLSME  326

Query  901   -ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSK  1077
              +   G GPK+F Y ELA +TN+F+++ KLGEGGFG VYKG+LKEL+SY+AVKRVS GSK
Sbjct  327   DDFEKGTGPKKFRYNELASSTNNFAEEGKLGEGGFGGVYKGFLKELDSYIAVKRVSSGSK  386

Query  1078  QGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWP  1257
             QGIKEY SEV++ISR+RH+NLV LIGWCHE +DLLLVYEF+ NGSL+SHL+  +SLLTW 
Sbjct  387   QGIKEYVSEVKIISRLRHRNLVQLIGWCHEKRDLLLVYEFMPNGSLESHLFSERSLLTWE  446

Query  1258  LRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSR  1437
             +RYKI Q LASALLYLHE  E+C++HRDIKSSNIMLDS  NAKLGDFGLARLVDH KGS+
Sbjct  447   MRYKIAQGLASALLYLHEGWEQCVLHRDIKSSNIMLDSGFNAKLGDFGLARLVDHGKGSQ  506

Query  1438  TTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVW  1617
             TT LAGTMGY+A EC  +GKASK++DIYSFG+V LEIACGRKPI+  A+E  + +++WVW
Sbjct  507   TTVLAGTMGYMAPECATTGKASKQSDIYSFGVVALEIACGRKPINLKAKEDQIMMLEWVW  566

Query  1618  KLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLP  1797
              LYG G +L+AADP L  +F+ ++++ +M VGLWCAHPD +LRPS+R+ I VLNFEAPLP
Sbjct  567   DLYGKGNILEAADPRLCAEFDAQQMQCLMTVGLWCAHPDRNLRPSVREVIHVLNFEAPLP  626

Query  1798  DLPETMPVATF  1830
              LP  MPV T+
Sbjct  627   ILPPKMPVPTY  637



>ref|XP_002265338.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1 
[Vitis vinifera]
Length=687

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/612 (51%), Positives = 421/612 (69%), Gaps = 19/612 (3%)
 Frame = +1

Query  46    HPLSFNFDLFTPSNVQNITFE--RTSLVNNSIQITPNQRN-----CIGRATYSEPLHLWD  204
             + LSFN   F P N   I FE   +   +  IQ+T NQ++       GRATY +P  LWD
Sbjct  36    NSLSFNLGNFDP-NDHEIIFEGHASYSADKVIQLTRNQQDKKMNDSWGRATYCKPFQLWD  94

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
             K +G+++ F T+F+F IDS  +  YGDG AFFLAP  +R+P + T GG  GL + ++ LN
Sbjct  95    KASGRMADFTTNFSFEIDSQRNFSYGDGLAFFLAPNSTRLPSDVT-GGSLGLVSRNQTLN  153

Query  385   SS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
             S+ N F AVEFD + N +D +  HVGID++S++S  +  W  +I  G  +   I+YD  S
Sbjct  154   STANHFFAVEFDTFPNAWDPKHDHVGIDINSMKSAKSVTWLNNIPEGKINHVSISYDSSS  213

Query  562   MNLSVVFRNFGSYGHVS-----YILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
              NLSV+F     Y +++     Y +DLR YL   VT GF+ ATG  + + +I+SW F+SA
Sbjct  214   ENLSVIFGTDDLYNNITPQSLYYKVDLRNYLTPFVTIGFSSATGDRSEINIIHSWNFSSA  273

Query  727   LDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG--  900
             L I  + A+     K  ++  +  G F +   +      W K+K+ E+ + D   ++   
Sbjct  274   L-IFSDSAEENEEKKTGLVVGLGVGAFALVAGLGLVCFCWWKKKISEKGEADPDFDLSMD  332

Query  901   -ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSK  1077
              +   G GP++F Y EL  ATN+F++ +K+GEGGFG VYKG+   L SYVAVKRVS+GS 
Sbjct  333   DDFEKGTGPRKFMYHELVLATNNFAEGEKVGEGGFGGVYKGFSSNLSSYVAVKRVSKGSN  392

Query  1078  QGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWP  1257
              GIKEYASEV++ISR+RH+NL+ L+GWCH+ ++LLLVYEF+ NGSL S L++GK+LLTW 
Sbjct  393   PGIKEYASEVKIISRLRHRNLLQLLGWCHKKRELLLVYEFIPNGSLASCLFQGKTLLTWA  452

Query  1258  LRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSR  1437
              RYKI   LASALLYLHEE E+C+VHRDIKSSN+MLD+  NAKLGDFGLARLVDH K S+
Sbjct  453   TRYKIATGLASALLYLHEEWEQCVVHRDIKSSNVMLDAEFNAKLGDFGLARLVDHGKESQ  512

Query  1438  TTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVW  1617
             TT LAGTMGY+A EC+++GKASKE D+YSFG+V LEI  GR+ ++P A+E  + +V+W+W
Sbjct  513   TTVLAGTMGYMAPECIMTGKASKELDVYSFGVVVLEICSGRRCVEPKAQEDQIRLVEWIW  572

Query  1618  KLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLP  1797
              LYG G+LL+AAD  LS DF+  ++ ++M+VGLWCA+PDCSLRPSIRQAI VL+ EA LP
Sbjct  573   NLYGVGKLLEAADSRLSADFDEEQMVRLMVVGLWCAYPDCSLRPSIRQAINVLDSEASLP  632

Query  1798  DLPETMPVATFW  1833
              LP  MP+  ++
Sbjct  633   ALPSKMPLPMYY  644



>ref|XP_009340621.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Pyrus x bretschneideri]
Length=685

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/621 (52%), Positives = 426/621 (69%), Gaps = 32/621 (5%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQN-ITFERTSLVNNS-IQITP-------NQRNCIGRATYSEPLHLW  201
             PL++NF  F  S + + I+ E  +  +   IQ+          +   +GR TY EP  L 
Sbjct  33    PLTYNFSSFPNSTINSSISLEGDAYTDGQFIQLAKIHETAALRRNGSVGRVTYREPFLLR  92

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             +  TGKL+ F THF F +D   +  Y DGFAFF+AP GS +     +GG  GL    E L
Sbjct  93    ENATGKLADFTTHFTFEMDPL-NKTYADGFAFFVAPNGSLLNRTLGRGGSLGLP--VEHL  149

Query  382   NSS-----NPFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSE  534
             NS+      PFVAVEFD+Y N      D    HVGI+++SL+S +T PW+  I  G  + 
Sbjct  150   NSTLSRSQYPFVAVEFDIYWNPMPNIGDPLGDHVGININSLKSYITKPWNGSILDGKQNG  209

Query  535   AWINYDPRSMNLSVVFRNF--GSY--GHVSYILDLRKYLPERVTFGFAGATGKDTALQMI  702
             AWI+Y+  S NLSV F ++  GS    ++ Y++DL +YLP+ V  GF+ A+G  T   MI
Sbjct  210   AWISYNSGSKNLSVAFTSYVNGSQLTTYLDYVVDLEQYLPDWVIVGFSAASGARTTQFMI  269

Query  703   NSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDD  882
              SW F S L +   ++ + S    L +GL +GG       ++F +   RK+K R + + +
Sbjct  270   KSWSFNSTL-VPPPRSSSGSNNIALAVGLGIGGFIAFVLGLSFVWCLLRKKKARGKTNTN  328

Query  883   IFGNI-----GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYV  1047
                 I     GE G G GP+ F+Y+ELA AT++F+  +KLGEGGFG VY+GY+K+L+SYV
Sbjct  329   EDPAIHELIDGEFGKGTGPRMFSYKELAFATSNFAGVEKLGEGGFGGVYRGYIKDLKSYV  388

Query  1048  AVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHL  1227
             AVK++S  SKQG+KE+ASEVR+IS++RH+NLV LIGWCH+ K LLLVYEF+ NGSLDSHL
Sbjct  389   AVKKISSKSKQGLKEFASEVRIISQLRHRNLVQLIGWCHKKK-LLLVYEFMPNGSLDSHL  447

Query  1228  YKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLA  1407
             +  K LL W LRYKI Q LAS LLYLH+E E+C++HRDIKSSN+MLDSN NAKLGDFGLA
Sbjct  448   FTEKCLLLWGLRYKIAQGLASGLLYLHQEWEQCVLHRDIKSSNVMLDSNFNAKLGDFGLA  507

Query  1408  RLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEE  1587
             RLVDH K S+TT +AGT GY+ALE V++GKASKE+D+YSFGIV LEIACGRKPID + E 
Sbjct  508   RLVDHGKQSQTTIVAGTRGYMALEYVITGKASKESDVYSFGIVALEIACGRKPIDLSLES  567

Query  1588  CHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAI  1767
               V +V+WVW+LYG G++++AADP L GDF+ +E+E ++IVGLWCAHPD   RPSI+QAI
Sbjct  568   SQVEMVEWVWELYGEGKVIEAADPKLHGDFDEKEMECLLIVGLWCAHPDYHFRPSIQQAI  627

Query  1768  QVLNFEAPLPDLPETMPVATF  1830
             QVLNFE PLP LP  MPVAT+
Sbjct  628   QVLNFEVPLPILPSNMPVATY  648



>ref|XP_008386207.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Malus domestica]
Length=705

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/630 (50%), Positives = 410/630 (65%), Gaps = 38/630 (6%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPN-----QRNCIGRATYSEPLHLWDKP  210
             PLSFNF  F P+ +  ++ E  + ++   +++T +         +GRATYS+P  L DK 
Sbjct  24    PLSFNFSTF-PNGINTLSLEGDAYIDGKFLRLTKSAVDDVHDQSVGRATYSQPFLLRDKA  82

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS  390
             TGKL+ F T+F FVIDS G   Y DG AFFLAP GS +     +GG  GL  D+   N S
Sbjct  83    TGKLADFTTNFTFVIDSRGKTPYADGLAFFLAPNGSLLNSTIGRGGSLGLPVDNPPHNVS  142

Query  391   N---PFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
                 PF AVEFD+Y N      D    HVG+D++S++S +T  W+  I  G  +   I+Y
Sbjct  143   KSQYPFWAVEFDIYXNEVTSVEDPAGDHVGVDINSVKSKMTESWNGSITNGQVNSVGISY  202

Query  550   DPRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
             D  S ++ +VF ++ +      H+   +DL   L   V  GF+  TG  TA+  I SW F
Sbjct  203   DSASNHVGIVFTSYVNDVQVMKHIDCRVDLNDILQGWVIVGFSAXTGSLTAVDKIKSWSF  262

Query  718   TSALDISENQADTKSTgkglviglvvggcfliggSMAFS-----------------FLAW  846
              S     EN     S        +           + F                  F  W
Sbjct  263   BSIQLNEENATKNTSVVPEPSXVVDPKLGNGTNIGLIFGLGAGGIVFLVGGLGLVWFFIW  322

Query  847   RKRKMREE-FDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGY  1023
             +KR   E+   +D      E   G GPK+F+YR LA +T++F +++KLGEGGFG VY+G+
Sbjct  323   KKRSSSEDGMVNDWIDE--EFQKGTGPKKFSYRTLAASTSNFDEREKLGEGGFGGVYRGF  380

Query  1024  LKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLS  1203
             +K+L +YVAVKR+S  S+QG+KEYA+EVR+ISR+RH+NLV LIGWCHE ++LLLVYEF+S
Sbjct  381   IKDLNTYVAVKRISSKSRQGMKEYAAEVRIISRLRHRNLVQLIGWCHEKRELLLVYEFMS  440

Query  1204  NGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNA  1383
             NGSLDSHL+KGKSLL W  R KIVQ LAS LLYLHEE E+C++HRDIKSSNIMLDSN NA
Sbjct  441   NGSLDSHLFKGKSLLAWEARNKIVQGLASGLLYLHEEWEQCVLHRDIKSSNIMLDSNFNA  500

Query  1384  KLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRK  1563
             KLGDFGLARLVDH K S+TT L GT+GY+A EC+ +GKASKETD+YSFG+V LEIACG K
Sbjct  501   KLGDFGLARLVDHGKQSQTTILGGTLGYMAPECLTTGKASKETDVYSFGVVALEIACGXK  560

Query  1564  PIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSL  1743
             PIDP      +N+V WVW+LYG G++++AADP L G+F+ +++E ++IVGLWCAHPD ++
Sbjct  561   PIDPMLGRSKMNMVKWVWELYGEGKVIEAADPKLCGEFDEKQMECLLIVGLWCAHPDYTI  620

Query  1744  RPSIRQAIQVLNFEAPLPDLPETMPVATFW  1833
             RPSI+Q IQVLNFE PLP LP  MPVA+++
Sbjct  621   RPSIQQTIQVLNFEVPLPTLPSKMPVASYF  650



>ref|XP_007047726.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
 gb|EOX91883.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
Length=692

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/654 (51%), Positives = 437/654 (67%), Gaps = 19/654 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVN-NSIQITPNQ-----RNCIGRATYSEPL  192
             ++P   PLSFNF  F+P N+QNI FE  +  + N +Q+T N         IGRA+Y++ +
Sbjct  30    LLPCAMPLSFNFTSFSP-NMQNIEFEGDAFSSANVLQLTKNDAIDNLTGSIGRASYNQAV  88

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWD   G+L+ F THF+F++ +   ++YGDG +FF+AP  S++PPN++ G       + 
Sbjct  89    RLWDASNGRLTDFTTHFSFILRAVNLSEYGDGISFFIAPFDSKMPPNSSDGFLALFNRNS  148

Query  373   ERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
                +S+N  VAVEFD + N +D    HVGI+++S+ SV    W   I+ G  + AW++Y+
Sbjct  149   TSNSSNNNIVAVEFDSFQNDWDPSDDHVGININSIISVTNVTWKSSIKNGSRANAWVSYN  208

Query  553   PRSMNLSVVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
               + NLSV         F     ++Y++DLR  LPE V  GF+ +TG+   +  I SW F
Sbjct  209   SSTRNLSVFLTYADNPVFSGNSSLAYVVDLRNILPEWVRIGFSASTGRQVEIHNILSWSF  268

Query  718   TSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKR-KMREEFDDDIFGN  894
              S+L     +   +    GL++GL VG   L  G    SF+ WR R ++ ++ D   F  
Sbjct  269   DSSL-----ETGGRGNNLGLIVGLAVGFGLLALGLGLLSFIMWRIRARLNKDSDAVDFTI  323

Query  895   IGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGS  1074
               E   G GPKRF Y+EL RATN+F++  KLGEGGFG VYKG L +  + VAVKRVSRGS
Sbjct  324   DDEFEKGTGPKRFMYQELTRATNNFAEVGKLGEGGFGGVYKGLLSDSNTEVAVKRVSRGS  383

Query  1075  KQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTW  1254
             KQG KEY SEV++ISR+RH+NLV L+GWCHE  +LLLVYEFL NGSLDSHL+ GK +LTW
Sbjct  384   KQGKKEYISEVKIISRLRHRNLVQLLGWCHEKGELLLVYEFLPNGSLDSHLFGGKIMLTW  443

Query  1255  PLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGS  1434
              +R+KI   LASALLYLHEE E+C+VHRDIK SN+MLDSN NAKLGDFGLARLVDH+ GS
Sbjct  444   TVRHKIALGLASALLYLHEEWEQCVVHRDIKCSNVMLDSNFNAKLGDFGLARLVDHDLGS  503

Query  1435  RTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWV  1614
             +TT LAGTMGY+A ECV +GKASKE+D+YSFG+V LEIACGRKP++P  E   V +++WV
Sbjct  504   QTTVLAGTMGYLAPECVTTGKASKESDVYSFGVVALEIACGRKPVEPREEPSKVRMLEWV  563

Query  1615  WKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPL  1794
             W LYG GQLL A D  L  DF+ R++E +M+ GLWC HPD + RPSIRQ I VLNFEAPL
Sbjct  564   WDLYGKGQLLQAVDKRLDNDFDERQMECLMVTGLWCCHPDYTHRPSIRQVINVLNFEAPL  623

Query  1795  PDLPETMPVATFW-PQRNVQysssssyygsdvsqtsQTKSLVSSGNTDCSCSSA  1953
             P LP  +PV  ++ P  N+   S +S  G   S+  +T+   SS +T+   SSA
Sbjct  624   PSLPSKLPVPMYYAPPINLCKFSYTSSTGLTDSEKYRTQCSCSSCSTNTYSSSA  677



>ref|XP_007212582.1| hypothetical protein PRUPE_ppa015892mg, partial [Prunus persica]
 gb|EMJ13781.1| hypothetical protein PRUPE_ppa015892mg, partial [Prunus persica]
Length=714

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/641 (50%), Positives = 419/641 (65%), Gaps = 47/641 (7%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQRNC-----IGRATYSEPLHL  198
             P   PL+FNF  F+ +   NI+ E  + ++   I++T           IGRATY +P  L
Sbjct  30    PSATPLTFNFPSFS-NGTTNISLEGDAYIDGKFIKLTKKPEELKVAENIGRATYHKPFLL  88

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
              +K TGKL+ F THF F+IDS     +GDG  FFLAP GS +      GG  GL  +D  
Sbjct  89    QEKATGKLADFTTHFTFIIDSG----HGDGMVFFLAPNGSLVNIAIGGGGTLGLPVEDLP  144

Query  379   LNSSN---PFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
                S    PFVAVEFD++ N      D    HV ID++SL+S +T  W+  I+    + A
Sbjct  145   GGMSRTQYPFVAVEFDIFQNTQPSIQDPPSDHVAIDINSLKSNITTTWNGGIDKAKLNTA  204

Query  538   WINYDPRSMNLSVVFRNF--GSYG-------HVSYILDLRKYLPERVTFGFAGATGKDTA  690
             W++Y+  S NLSV F +F  G+ G       ++SY++DL++YLP+ V  GF+ ATG D A
Sbjct  205   WVSYNSSSKNLSVAFTSFLNGTNGTQLEIIRYLSYMVDLKQYLPDWVIVGFSTATGNDIA  264

Query  691   LQMINSWIFTSALDISEN-----------------QADTKSTgkglviglvvggcfligg  819
             +  I SW FTS   + E                  ++ T +    + +G+        G 
Sbjct  265   VHRIVSWNFTSTALVDETTMNNTQVFPPPSPSANPKSGTSNIRLPIGLGVGGCIILAGGL  324

Query  820   SMAFSFLAWRKRKMREEFDDDIFGNI---GELGGGAGPKRFTYRELARATNSFSQQDKLG  990
             ++ +    +RKRK   E D++   N     E   G GP++F+YR+LARATN+F + +KLG
Sbjct  325   ALVWFMFIFRKRKAVGESDENPVVNCLIDDEFEKGTGPRKFSYRDLARATNNFHEGEKLG  384

Query  991   EGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHEN  1170
             EGGFG VY  ++K L SYVA+KR+S GSKQG+KEYASEVR+ISR+RH+NLV LIGWCHE 
Sbjct  385   EGGFGGVYIAFIKNLNSYVAIKRISNGSKQGLKEYASEVRIISRLRHRNLVQLIGWCHEK  444

Query  1171  KDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKS  1350
             ++LLLVYEF+ N SLDSHL+K  SLL+W +RYKI + LAS L YLHEE E+C++HRDIKS
Sbjct  445   RELLLVYEFMPNSSLDSHLFKINSLLSWQIRYKIARGLASGLFYLHEEWEQCVLHRDIKS  504

Query  1351  SNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFG  1530
             SN+MLDSN N KLGDFGLARLVDH K S TT +AGT GY+ALE V +GKASKE+D+YSFG
Sbjct  505   SNVMLDSNFNVKLGDFGLARLVDHGKQSPTTIVAGTRGYMALEYVTTGKASKESDVYSFG  564

Query  1531  IVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIV  1710
             +V LEIACGRKPID   E   + +V+WVW+LYG G+++ AADP L G F+  ++E +M V
Sbjct  565   VVALEIACGRKPIDLNLESSEIEMVEWVWELYGEGKVIQAADPKLYGQFDENQMESLMTV  624

Query  1711  GLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW  1833
             GLWCAHPD   RPSI+QAIQVLN+E PLP LP  MPVAT++
Sbjct  625   GLWCAHPDYRFRPSIQQAIQVLNWEVPLPILPSKMPVATYF  665



>ref|XP_010910292.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Elaeis guineensis]
Length=680

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/615 (49%), Positives = 411/615 (67%), Gaps = 21/615 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQ-----RNCIGRATYSEPLH  195
             ++P    L+FNF  F  +    I F+  +  +  I++T N+      N +GRA Y EPL 
Sbjct  18    LVPFASSLAFNFSSFDQNTPVRIEFQGDAFFDKEIRLTKNELNTPITNSVGRAVYKEPLL  77

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             LW+  TG+L+ F THF+FVIDS   + YG G AFFL P  S IP N++ GG  GL ++  
Sbjct  78    LWNSGTGELTDFITHFSFVIDSFNESVYGHGLAFFLTPYPSSIPDNSS-GGYLGLFSEQP  136

Query  376   RLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
               N+S N  VAVEFD + N +D    H+GID+DS++S  T  W+  ++ G  + AWI+Y 
Sbjct  137   TPNTSPNRTVAVEFDSFRNDWDPSPNHIGIDIDSIKSNATVVWNSSVKNGRTANAWISYT  196

Query  553   PRSMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
               + NLSV         FG    +S I+DL++ LPE V  GF+ ATG    +  + SW F
Sbjct  197   ASTRNLSVFLTYAKNPTFGGNSSLSCIVDLKEILPENVAIGFSAATGDAVEIHNLLSWDF  256

Query  718   TSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRK--RKMREEFDDDIFG  891
             +S L   E +  +++     +   V     ++  S     + WR+  R+ R+E D D   
Sbjct  257   SSTL---EPRKKSRTGLLVGLASGVGVLMAVLVLSCV---VLWRRKARRGRDEEDQDYDE  310

Query  892   NIG-ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSR  1068
             +I  E   G GP+RF    L  AT +FS++ KLGEGGFG+VY+G L + +  VA+KRVS+
Sbjct  311   SIDDEFEQGRGPRRFPNSALVSATKNFSEEGKLGEGGFGAVYRGLLSDPKLEVAIKRVSK  370

Query  1069  GSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLL  1248
             GSKQG KEY SEV++ISR+RH++LV L+GWCH   + LLVYEF+ NGSLD HLY  + +L
Sbjct  371   GSKQGRKEYVSEVKIISRLRHRHLVQLVGWCHGRGEFLLVYEFMPNGSLDQHLYSTERIL  430

Query  1249  TWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEK  1428
             TW +RYKI   LASALLYLHEE E+C+VHRD+K SN+MLDS  +AKLGDFGLARL+DH++
Sbjct  431   TWAMRYKIALGLASALLYLHEEWEQCVVHRDVKPSNVMLDSTFSAKLGDFGLARLIDHDR  490

Query  1429  GSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVD  1608
             GS+TT LAGTMGY+A ECV +GKASKE+D+YSFG+V LEIACGR+P++P      V +V+
Sbjct  491   GSQTTVLAGTMGYLAPECVTTGKASKESDVYSFGVVALEIACGRRPVEPRENLSKVRLVE  550

Query  1609  WVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEA  1788
             WVW+LYG   +L+AAD  L+G+F+ +++E++MIVGLWCAHPD +LRPSIRQ I VLNFEA
Sbjct  551   WVWELYGGKMILEAADERLAGEFDEQQIERLMIVGLWCAHPDYNLRPSIRQVISVLNFEA  610

Query  1789  PLPDLPETMPVATFW  1833
             PL DLP  MPV  ++
Sbjct  611   PLADLPPKMPVPMYY  625



>ref|XP_007212415.1| hypothetical protein PRUPE_ppa016555mg, partial [Prunus persica]
 gb|EMJ13614.1| hypothetical protein PRUPE_ppa016555mg, partial [Prunus persica]
Length=653

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/618 (54%), Positives = 431/618 (70%), Gaps = 28/618 (5%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVN-NSIQIT--PNQRNCIGRATYSEPLHLWDKPTGK  219
             PL+FNF  F+ +   NI+ E  + ++ N I++T  P +   +GRATY EP  L +  TGK
Sbjct  23    PLTFNFPSFSNATT-NISLEGVADIDSNLIRLTKNPGENGNVGRATYHEPFLLRENATGK  81

Query  220   LSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD---ERLNSS  390
             L+ F T FAF+IDS     + DG  FF+AP GS +      G   GL  +D   +   + 
Sbjct  82    LADFTTTFAFIIDSG----HADGMVFFVAPNGSLLNSAVGSGSKLGLPVEDLPGDISRTQ  137

Query  391   NPFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
              PFVAVEFD++ N      D +  HVGI+V+SL+S +T PW+  IE G  + A I+Y+  
Sbjct  138   YPFVAVEFDIFKNPVPTINDPDGDHVGINVNSLKSNITMPWNGGIEEGKQNSARISYNSS  197

Query  559   SMNLSVVFRNF--GSYG-------HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSW  711
             S NLSV F +F  G+ G       ++SY++DL++YLP+ V  GF+ ATG + A+  I SW
Sbjct  198   SKNLSVAFTSFQNGTNGTQVEVINYLSYMVDLKQYLPDWVIIGFSAATGNEVAVHKIVSW  257

Query  712   IFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLA-WRKRKMREEFDDDIF  888
              FTS   + E ++   +   GL IGL VGGC ++   +   +L  W+K K   E D++ F
Sbjct  258   NFTSTALVDEPKSGNANANIGLPIGLGVGGCLILVAGLGLVWLIFWKKGKAAGEHDENPF  317

Query  889   GNI---GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKR  1059
              N     EL  G GP++F+YRELARAT +F + +KLGEGGFG VYKG++K+L S+VAVKR
Sbjct  318   TNSFIHEELEKGIGPRKFSYRELARATKNFEEGEKLGEGGFGGVYKGFIKDLNSHVAVKR  377

Query  1060  VSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGK  1239
             +S GSKQG+KEYASEVR+ISR+RH+NLV LIGWCHE K+L+LVYEF+ NGSLDSHL+K K
Sbjct  378   ISSGSKQGLKEYASEVRIISRLRHRNLVQLIGWCHEKKELMLVYEFMPNGSLDSHLFKEK  437

Query  1240  SLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVD  1419
              LLTW +RY I Q LAS L YLHEE E+C++HRDIKSSNIMLDSN N KLGDFGLARLVD
Sbjct  438   GLLTWQIRYSIAQGLASGLFYLHEEWEQCVLHRDIKSSNIMLDSNFNVKLGDFGLARLVD  497

Query  1420  HEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVN  1599
             H K S+TT +AGT GY+ALE V +GKAS E+DIYSFG+V LEIACGRKPID + E   + 
Sbjct  498   HGKQSQTTNVAGTRGYMALEYVTTGKASMESDIYSFGVVALEIACGRKPIDLSLENSQIE  557

Query  1600  IVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLN  1779
             +V+WVW+LYG G L+ AADP L G F+ +++E +MIVGLWCAHPD   RPSI+Q IQVLN
Sbjct  558   MVEWVWELYGEGTLIQAADPKLCGHFDEKQMECLMIVGLWCAHPDYKFRPSIQQVIQVLN  617

Query  1780  FEAPLPDLPETMPVATFW  1833
             FE PLP LP  MPVAT++
Sbjct  618   FEVPLPILPSKMPVATYF  635



>ref|XP_009365634.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Pyrus x bretschneideri]
Length=697

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/633 (51%), Positives = 421/633 (67%), Gaps = 39/633 (6%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITP-----NQRNCIGRATYSEPLHLW  201
             P   PL+FNF  F P    NI+ E  +  +  +++T      N+    GRATYS+P  L 
Sbjct  30    PSATPLTFNFSSFPPLTA-NISLEGDAYTDGFLRLTKSAVDDNKTRSAGRATYSQPFLLR  88

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGS---RIPPNATKGGGFGLANDD  372
                TGK++ F T+F FVIDS     YG+GFAFF+AP  S   R     T   G  +    
Sbjct  89    QNATGKIADFTTNFTFVIDSQKETNYGNGFAFFIAPNASILNRKLAKHTLSMGLPVHPLG  148

Query  373   ERLNSS-NPFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
               +N+S  P+VAVEFD++ N      D    HVGIDV+S+ S +  PW+  I  G  + A
Sbjct  149   VTVNTSLYPYVAVEFDIHYNDQPDIQDPVGDHVGIDVNSVMSRIAKPWNGSIVNGRINIA  208

Query  538   WINYDPRSMNLSVVFRNFGSYG-----HVSYILDLRKYLPERVTFGFAGATGKDTALQMI  702
             +INYD +S NLSV F    + G     +++Y +DL +YLP+ V  GF G TG+  A   I
Sbjct  209   FINYDSKSKNLSVAFTTCNANGVQVMSYLNYTVDLTRYLPDLVVVGFTGETGRCYATHKI  268

Query  703   NSWIF--TSALDISENQADTKSTgkglviglvvggcfliggSMAFSFL---AWRKRKMRE  867
             NSW F  TS LD + +++ TKS+  G +   +  G  LI        L     RK++ RE
Sbjct  269   NSWSFNSTSLLDDAHHKSTTKSSRNGRMAVGMGIGGSLIILVCGLQLLWSKILRKKRERE  328

Query  868   EFDDD---------IFGNIGELGG-GAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYK  1017
             E   D         I  +  E G   +GP++F+Y ELA AT+ FS+++KLGEGGFG VYK
Sbjct  329   EISSDCEYPSGLDLIMDDDFEKGIITSGPRKFSYSELAHATSDFSKEEKLGEGGFGGVYK  388

Query  1018  GYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEF  1197
             G++++L S+VAVKR+SR SKQG+KEYA+EVR+I R+RH+NLV LIGWCHE K LLLVYEF
Sbjct  389   GFIQDLNSFVAVKRISRASKQGLKEYAAEVRIIGRLRHRNLVQLIGWCHEKK-LLLVYEF  447

Query  1198  LSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNL  1377
             +SNGSLDSHL+K  S L W +RYKI Q +A+ L YLH+E E+C++HRDIKSSN+MLDSN 
Sbjct  448   MSNGSLDSHLFKETSFLNWEVRYKIAQGVAAGLQYLHQEWEQCVLHRDIKSSNVMLDSNF  507

Query  1378  NAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACG  1557
             NAKLGDFGLARLVDH K  +TTALAGTMGY+A E ++SGKASKE+D+YSFGIV LEIACG
Sbjct  508   NAKLGDFGLARLVDHGKEPQTTALAGTMGYMAPEYIISGKASKESDVYSFGIVALEIACG  567

Query  1558  RKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDC  1737
             RKPID T     VN+V WVW LYG  ++++AADP L G F+ ++VE +MIVGLWCAHPD 
Sbjct  568   RKPIDHT----RVNMVKWVWDLYGEDKVIEAADPKLGGVFDKKQVECLMIVGLWCAHPDY  623

Query  1738  SLRPSIRQAIQVLNFEAPLPDLPETMPVATFWP  1836
             S+RPS++Q +Q+  FE PLP LP  MPVAT++P
Sbjct  624   SMRPSMQQVMQMFTFEVPLPILPSKMPVATYFP  656



>ref|XP_007206302.1| hypothetical protein PRUPE_ppa020680mg [Prunus persica]
 gb|EMJ07501.1| hypothetical protein PRUPE_ppa020680mg [Prunus persica]
Length=691

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/616 (53%), Positives = 415/616 (67%), Gaps = 30/616 (5%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQRN-----CIGRATYSEPLHLWD  204
             V   SFN   F  +N +++ F+  +  +   IQ+T NQ +       GRATY +P+ LWD
Sbjct  32    VKSFSFNISSFN-TNTKDLNFQGDAFPSRGVIQLTKNQVDGPLTESAGRATYFQPVRLWD  90

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
               TG+L+ F THF+FV+ +     YGDG +FFLAP GS IP N + GG   L + +  LN
Sbjct  91    SSTGRLTDFTTHFSFVMKALNDTYYGDGISFFLAPFGSEIP-NHSTGGYLALFSSETALN  149

Query  385   SS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
             +S N  VAVEFD Y N +D    HVGI+++S+ SV    W   I+ G  + AW+ Y+  +
Sbjct  150   ASKNNIVAVEFDSYKNEWDPSPDHVGININSIASVANVSWKTTIKNGSVANAWVTYNSTT  209

Query  562   MNLSVVFR-------NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFT  720
              NL+V          N G    VSYI++L+  LPE V+ GF+ ATG    +  I SW F+
Sbjct  210   RNLTVFLTYSKNPTYNVGDCS-VSYIVNLKDVLPELVSVGFSAATGYWVEIHNILSWSFS  268

Query  721   SALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKR--KMREEFD---DDI  885
             S L+I+ N+   K    G+ +G   G      G   F F++WRKR  K+ E +D   DD 
Sbjct  269   STLEINSNKEAQKKLRLGIGLGAGFGLLSCGLG--LFWFMSWRKRVNKIDEAYDMSMDD-  325

Query  886   FGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVS  1065
                  E   G GP+RFTYREL+RATN+FS+  KLGEGGFG VYKG L E  + VAVKRVS
Sbjct  326   -----EFDKGTGPRRFTYRELSRATNNFSEGGKLGEGGFGGVYKGLLSESNTEVAVKRVS  380

Query  1066  RGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSL  1245
             RGSKQG KEY +EVR+ISR+RH+NLV LIGWCHE  + LL+YE + NGSLDSHL+  K  
Sbjct  381   RGSKQGKKEYVAEVRIISRLRHRNLVQLIGWCHEQNEFLLIYELMPNGSLDSHLFGMKLH  440

Query  1246  LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHE  1425
             LTW LRYKI   LASA+LYLHEE E+C+VHRDIKSSN+MLDSN NAKLGDFGLARLVDHE
Sbjct  441   LTWTLRYKIALGLASAILYLHEEWEQCVVHRDIKSSNVMLDSNFNAKLGDFGLARLVDHE  500

Query  1426  KGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIV  1605
              GS+TT LAGTMGY+A ECV +G+ASKE+D+YSFG+V LEI+CGR+P++  AE   V +V
Sbjct  501   LGSQTTVLAGTMGYLAPECVTTGRASKESDVYSFGVVALEISCGRRPVEAKAEPSRVRLV  560

Query  1606  DWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFE  1785
             +WVW LYG  Q+L+AAD  L  DF+ +++E +M VGLWC HPD ++RPSIRQ I VLNFE
Sbjct  561   EWVWDLYGKDQILEAADERLCRDFDEQQIECLMAVGLWCCHPDPTVRPSIRQVINVLNFE  620

Query  1786  APLPDLPETMPVATFW  1833
             AP+P LP  +PV  ++
Sbjct  621   APMPSLPSKLPVPMYF  636



>ref|XP_002265301.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1 
[Vitis vinifera]
Length=671

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/616 (51%), Positives = 424/616 (69%), Gaps = 20/616 (3%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFE--RTSLVNNSIQITPNQRN-----CIGRATYSEPLHLWDKP  210
             LSFN   F P N   I FE   +   +  IQ+T NQ +        RATY +P  LWDK 
Sbjct  38    LSFNLGNFDP-NDHEIIFEGHASYSADKVIQLTSNQEDKKMNDSWVRATYYKPFQLWDKA  96

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS  390
             +G+++ F T+F+F IDS  ++ YGDG AFFLAP  +++P + T   G GL ++++ LNS+
Sbjct  97    SGRMADFTTNFSFEIDSQRNSSYGDGLAFFLAPNSTQLPSDVTGASGLGLVSNNQTLNST  156

Query  391   -NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMN  567
                F AV FD + N +D +  HV ID++S++SV    W   I+ G      I+Y   S N
Sbjct  157   AKHFFAVAFDTFPNAWDPKPDHVRIDINSMKSVKNVTWLSIIKDGKIKYVSISYTASSQN  216

Query  568   LSVVF-----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALD  732
             +SV+F      N  +   + Y +DL  YLPE VT GF+ ATG  + + +I+SW F+SAL 
Sbjct  217   MSVIFGSDYLYNKTTLQSLYYKVDLSDYLPEFVTIGFSSATGDFSEINIIHSWNFSSALQ  276

Query  733   ISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG---E  903
             IS++  + +    GLV+GL VG   L+ G     F  W+K K+ E+ +D+   ++    +
Sbjct  277   ISDSAEENEEKKTGLVVGLSVGAFALVAGLGLVCFCLWKK-KVSEKGEDNPDFDLSMDDD  335

Query  904   LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQG  1083
             L  G GP++F Y EL  ATN+F++ +K+GEGGFG VYKG+ + L SY+AVKRVS+GS QG
Sbjct  336   LEKGTGPRKFMYHELVLATNNFAEGEKVGEGGFGGVYKGFSRNLSSYIAVKRVSKGSDQG  395

Query  1084  IKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLR  1263
             IKEY SEV++ISR+RH NL+ L+GWCH+ ++LLLVYEF+ NGSL S L++GK LLTW +R
Sbjct  396   IKEYESEVKIISRLRHWNLLQLLGWCHKKRELLLVYEFMPNGSLASCLFQGKILLTWAMR  455

Query  1264  YKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTT  1443
             YKI   LAS LLYLHEE E+C+VHRD+KSSN+MLD+  NAKLGDFGLARLVDH KGS+TT
Sbjct  456   YKIATGLASVLLYLHEEWEQCVVHRDVKSSNVMLDAEFNAKLGDFGLARLVDHGKGSKTT  515

Query  1444  ALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKL  1623
              LAGT+GY+A E +++GKASKE D+YSFG+V LEI  GR+ ++P A+E  + +V+WVW L
Sbjct  516   VLAGTVGYMAPEYILTGKASKELDVYSFGVVALEICSGRRCVEPNAQEDQIRLVEWVWDL  575

Query  1624  YGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDL  1803
             YG G+L +AADP LS DF+  ++ ++M+VGLWCAHPDCSLRPSIRQAI VLN EA LP L
Sbjct  576   YGVGKLPEAADPRLSADFDEEQMARLMVVGLWCAHPDCSLRPSIRQAINVLNSEASLPAL  635

Query  1804  PETMPVATFW--PQRN  1845
             P  MPV  ++  P+ N
Sbjct  636   PSKMPVPMYYAPPENN  651



>ref|XP_002518336.1| kinase, putative [Ricinus communis]
 gb|EEF44096.1| kinase, putative [Ricinus communis]
Length=718

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/639 (51%), Positives = 420/639 (66%), Gaps = 45/639 (7%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPNQRN-----CIGRATYSEPLH  195
             +P V  LSF+F  F   N +NI +    S+ +  I +T NQR       +GR  Y+ PL+
Sbjct  33    VPSVTSLSFDFPSFN-QNDRNIRYAGNASVTSQEISLTTNQREKDMSASMGRIIYASPLY  91

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             LWDK +  L++F T+F+F IDS  S  YGDG AFFLAP     P  A  GGGFGL+ D+E
Sbjct  92    LWDKESKNLTNFFTNFSFTIDSLNSTNYGDGMAFFLAPTDFPFPDMA--GGGFGLSKDNE  149

Query  376   RLNSSNPFVAVEFDVYLNH-----YDT-EQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
                S+ PFVAVEFD Y N      +D+   +HVGID++   S     W  DIE G  ++A
Sbjct  150   --TSAYPFVAVEFDTYGNKGWDPPFDSGNGEHVGIDINLTVSKNHTKWYTDIEDGRRNDA  207

Query  538   WINYDPRSMNLSVVFRNFGSYGH------VSYILDLRKYLPERVTFGFAGATGKDTALQM  699
              I+YD  S  LSV F +F S  +      +SY +DLR  LPE V  GF+  T     +  
Sbjct  208   SISYDSSSKVLSVTFTSFNSSSNEMFEQNLSYQVDLRDCLPEWVAIGFSATTVASFEMHT  267

Query  700   INSWIFTSALD-------------ISENQADTKSTgkglviglvvggcfliggSMAFSFL  840
             ++S  FTS L              + E    TK + K + + + +     +         
Sbjct  268   LHSRYFTSDLQFIDKPIPPTVSAPMIEEVPPTKRSKKEVGLVVGLSVSGFVIFISLICLF  327

Query  841   AWRKRKMREEFDDDIFGNIGELG------GGAGPKRFTYRELARATNSFSQQDKLGEGGF  1002
              W++ +     DD+   +  ++        G GP++F+Y +L RATN+FS+Q+KLGEGGF
Sbjct  328   MWKRSRGETNVDDEEVVDHFDMSMDEDFEKGTGPRKFSYNDLVRATNNFSEQEKLGEGGF  387

Query  1003  GSVYKGYLKE-LESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDL  1179
             G+VYKG+L+E + SYVAVKR+S+GSKQG+KEYASEV++ISR+RH+NLV LIGWCHE K L
Sbjct  388   GAVYKGFLREFMNSYVAVKRISKGSKQGMKEYASEVKIISRLRHRNLVQLIGWCHEEKKL  447

Query  1180  LLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNI  1359
             LLVYEF+ NGSLDSHL+K  SLLTW +RYKI Q LAS LLYL EE E+C++HRDIKSSNI
Sbjct  448   LLVYEFMPNGSLDSHLFKQDSLLTWDIRYKIAQGLASGLLYLQEEWEQCVLHRDIKSSNI  507

Query  1360  MLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVT  1539
             MLDSN NAKLGDFGLARLVDH KG  TT LAGTMGY+A EC ++GKAS+E+D+YSFG+V 
Sbjct  508   MLDSNFNAKLGDFGLARLVDHGKGPETTILAGTMGYMAPECAITGKASRESDVYSFGVVA  567

Query  1540  LEIACGRKPIDPTAEECHVNIVDWVWKLYGTG--QLLDAADPNLSGDFNGREVEQMMIVG  1713
             LEIACGRKPI+  A E  V ++ WVW LYG G  +LL+AADP L+GDF+ ++++ ++IVG
Sbjct  568   LEIACGRKPINYKAGEDQVYLIQWVWNLYGGGPSKLLEAADPRLNGDFDEQQMKCLIIVG  627

Query  1714  LWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             LWC HPD   R SIRQAIQVL FEAPLP LP  MPV T+
Sbjct  628   LWCVHPDEKCRASIRQAIQVLKFEAPLPILPAKMPVPTY  666



>ref|XP_008237269.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1 
[Prunus mume]
Length=691

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/615 (53%), Positives = 415/615 (67%), Gaps = 28/615 (5%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQRN-----CIGRATYSEPLHLWD  204
             V   SFN   F  +N +++ F+  +  +   IQ+T NQ +       GRATY +P+ LWD
Sbjct  32    VKSFSFNISSFN-TNTKDLNFQGDAFPSGGVIQLTKNQVDGPLTESAGRATYFQPVRLWD  90

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
               TG+L+ F THF+FV+ +     YGDG +FFLAP GS IP N + GG   L + +  LN
Sbjct  91    SSTGRLTDFTTHFSFVMKALNDTYYGDGISFFLAPFGSEIP-NHSTGGYLALFSSETALN  149

Query  385   SS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
             +S N  VAVEFD Y N +D    HVGI+V+S+ SV    W   I+ G  + AW+ Y+  +
Sbjct  150   ASKNNIVAVEFDSYENEWDPSPDHVGINVNSIASVANVSWKTTIKNGSVANAWVTYNSTT  209

Query  562   MNLSV--VFRNFGSYG----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTS  723
              NLSV   + N  +Y      VSYI++L+  LPE V+ GF+ ATG    +  I SW F+S
Sbjct  210   RNLSVFLTYSNNPTYNVGDCSVSYIVNLKDVLPELVSVGFSAATGYWVEIHNILSWSFSS  269

Query  724   ALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKR--KMREEFD---DDIF  888
              L+I  N+   K    G+ +G+  G      G   F F++WRK+  KM E  D   DD  
Sbjct  270   TLEIKSNKEAQKKLRLGIGLGVGCGLLSCGLG--LFWFMSWRKKVNKMDEACDMSMDD--  325

Query  889   GNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSR  1068
                 E   G GP+RFTYREL RATN+FS+  KLGEGGFG VY+G L E  + VAVKRVSR
Sbjct  326   ----EFDKGTGPRRFTYRELGRATNNFSEGGKLGEGGFGGVYRGLLSESNTEVAVKRVSR  381

Query  1069  GSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLL  1248
             GSKQG KEY +EVR+ISR+RH+NLV LIGWCHE  + LL+YE + NGSLDSHL+  K  L
Sbjct  382   GSKQGKKEYVAEVRIISRLRHRNLVQLIGWCHEQSEFLLIYELMPNGSLDSHLFGMKLHL  441

Query  1249  TWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEK  1428
             TW LRYKI   LASA+LYLHEE E+C+VHRDIKSSN+MLDSN NAKLGDFGLARLVDHE 
Sbjct  442   TWTLRYKIALGLASAILYLHEEWEQCVVHRDIKSSNVMLDSNFNAKLGDFGLARLVDHEL  501

Query  1429  GSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVD  1608
             GS+TT LAGTMGY+A ECV +G+ASKE+D+YSFG+V LEI+CGR+P++  AE   V +V+
Sbjct  502   GSQTTVLAGTMGYLAPECVTTGRASKESDVYSFGVVALEISCGRRPVEAKAEPSRVRLVE  561

Query  1609  WVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEA  1788
             WVW LYG  Q+L+AAD  L  DF+ +++E +M VGLWC HPD ++RPSIRQ I VLNFEA
Sbjct  562   WVWDLYGKDQILEAADKRLCRDFDEQQIECLMAVGLWCCHPDPTVRPSIRQVINVLNFEA  621

Query  1789  PLPDLPETMPVATFW  1833
             P+P LP  +PV  ++
Sbjct  622   PMPSLPPKLPVPMYF  636



>ref|XP_008237618.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Prunus mume]
Length=689

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/639 (50%), Positives = 405/639 (63%), Gaps = 42/639 (7%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPN------QRNCIGRATYSEPLHL  198
             P    LSF+F  FT  ++  ++ E  + V+       N      + + +GRATY +P  L
Sbjct  13    PAASSLSFSFPNFTNDDITTLSLEEDAYVDGKFLRLTNSAVDDLKNDSVGRATYRQPFLL  72

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
              D  TGKL+ F T F F IDS G   Y DG AFFLAP GS +     +GG  GL   +  
Sbjct  73    RDNTTGKLADFTTTFTFAIDSQGKTFYADGLAFFLAPKGSALNTTIGRGGSLGLPTINPE  132

Query  379   LNSSN---PFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
              N S    PFVAVEFD++ N      D    HVGIDV+S++S VT  W+  I  G  +  
Sbjct  133   KNESTNLYPFVAVEFDIFHNARTSIDDPAGDHVGIDVNSVKSKVTRAWNGSITKGQFNSV  192

Query  538   WINYDPRSMNLSVVFRNF------GSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQM  699
              I YD  S NLSV F  +      G Y  + Y +D+ + L   V  GF+ ATG   AL  
Sbjct  193   SIRYDSGSKNLSVTFTTYENGVWVGRY--LDYTVDVNEILQGWVIVGFSAATGSLIALHK  250

Query  700   INSWIFTSALDISENQ-------------ADTKSTgkglviglvvggcfliggSMAFSFL  840
             I SW F S   I EN               + KS        +V          +    L
Sbjct  251   IKSWSFNSTSLIDENAKNNTPAAPEPIPIVEPKSGNGINTGLVVGLVVGGCVLLVGGFCL  310

Query  841   AWR---KRKMREEFDDD---IFGNI--GELGGGAGPKRFTYRELARATNSFSQQDKLGEG  996
              W    K    E  D+D   +  ++   E   G GPK+F+Y+ LA+ TN F++ +KLGEG
Sbjct  311   VWFIFWKEGTGESSDNDEDPVVNDLIDEEFEKGTGPKKFSYKILAQWTNDFNEGEKLGEG  370

Query  997   GFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKD  1176
             GFG VYKG++K+L SYVAVKRVS GS+QG+KEYA+EVR+ISR+RH+NLV LIGWCHE ++
Sbjct  371   GFGGVYKGFVKDLNSYVAVKRVSSGSRQGLKEYAAEVRIISRLRHRNLVQLIGWCHEKRE  430

Query  1177  LLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSN  1356
             LLLVYEF+SNGSLDSHL+KGKSLL W  RY+I Q LAS L YLHEE E+C++HRDIKSSN
Sbjct  431   LLLVYEFMSNGSLDSHLFKGKSLLCWEARYRIAQGLASGLFYLHEEWEQCVLHRDIKSSN  490

Query  1357  IMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIV  1536
             IMLDSN NAKLGDFGLARLVDH K S+TT LAGTMGY+A ECV +GKASKETD+YSFG+V
Sbjct  491   IMLDSNFNAKLGDFGLARLVDHGKQSQTTVLAGTMGYMAPECVTTGKASKETDVYSFGVV  550

Query  1537  TLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGL  1716
              LEIACGRKPIDP      +N+V+WVW+LYG G++++AADP L GDF+ +++E ++IVGL
Sbjct  551   ALEIACGRKPIDPKLGTNKINMVEWVWELYGQGKVIEAADPKLCGDFDEKQIECLLIVGL  610

Query  1717  WCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW  1833
             WCAHPD  +RPS +Q IQVL+ E   P LP  MPVA+++
Sbjct  611   WCAHPDYKIRPSTQQIIQVLSLEVAPPILPSKMPVASYF  649



>ref|XP_008392173.1| PREDICTED: uncharacterized protein LOC103454355 [Malus domestica]
Length=1280

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/625 (53%), Positives = 424/625 (68%), Gaps = 29/625 (5%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFE-------RTSLVNNSIQITPNQRNCIGRATYSEPLH  195
             P   PLSFNF  F P    N+  E       R   + NS  +  +Q    GRATYS+P  
Sbjct  16    PCATPLSFNFSSF-PKVPHNLFLEGDASADGRFLRLTNS-ALDGHQSWSDGRATYSQPFL  73

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             L +  TGKL+ F T+F FVIDS G   Y DG AFFLAP GS +     +GG  GL     
Sbjct  74    LRENATGKLADFTTNFTFVIDSVGKTPYADGLAFFLAPNGSSLNTAVGRGGSLGLPVTIP  133

Query  376   RLNSSN---PFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSE  534
               N S    PFVAVEFD++ N+     D    H+GID++S+ S V  PW+  I  G  + 
Sbjct  134   LNNESTNLYPFVAVEFDIFTNNQTCVNDPVGDHIGIDINSVNSKVXXPWNGSITTGGENN  193

Query  535   AWINYDPRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMI  702
             A I YD  S  LSVV+ +F +    + ++SYI+DL  YL   V  GF+ ATG  TAL  I
Sbjct  194   ARIRYDSGSKILSVVYTSFVNGVPVWRNISYIVDLNXYLQGYVVVGFSAATGSLTALHKI  253

Query  703   NSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSF-----LAWRKRKMRE  867
             NSW F+S     EN+ +  +   G+ +GLVVG        +A        + WRK K  E
Sbjct  254   NSWNFSSTELRDENEFNNSAPVNGVNVGLVVGLVVGGCVVLAGGLVXVWCICWRKGKTGE  313

Query  868   EFDDD---IFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKEL  1035
               DD+   +  +I E    G GPK+F+Y+ LA++T +F + +KLGEGGFG VY+G++ +L
Sbjct  314   SSDDEDPMVNDSIDEEFEKGTGPKKFSYKTLAQSTGNFDEGEKLGEGGFGGVYRGFIDDL  373

Query  1036  ESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSL  1215
             +SYVAVKRVS GS+QG+KEYA+EVR+ISR+RH+NLV LIGWCHE ++LLLVYEF+SNGSL
Sbjct  374   DSYVAVKRVSSGSRQGMKEYAAEVRIISRLRHRNLVQLIGWCHEKRELLLVYEFMSNGSL  433

Query  1216  DSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGD  1395
             DSHL+K K++L W  RY+I Q LAS L YLHEE E+C++HRDIKSSNIMLDSN NAKLGD
Sbjct  434   DSHLFKPKTVLHWEARYRIAQGLASGLFYLHEEWEQCVLHRDIKSSNIMLDSNFNAKLGD  493

Query  1396  FGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDP  1575
             FGLARLVDH K S+TT LAGTMGY+A EC+ +GKASKETD+YSFG+  LEIACGRKPIDP
Sbjct  494   FGLARLVDHGKQSQTTVLAGTMGYMAPECLTTGKASKETDVYSFGVXALEIACGRKPIDP  553

Query  1576  TAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSI  1755
                   +N+V+WVW+LYG G++++AADP L G+F+ +++E ++IVGLWCAHPD +++PSI
Sbjct  554   KLGRTQINMVEWVWELYGEGKIIEAADPKLCGEFDAKQMECLLIVGLWCAHPDYTMKPSI  613

Query  1756  RQAIQVLNFEAPLPDLPETMPVATF  1830
             +Q IQVLNFE PLP LP  MPVA++
Sbjct  614   QQTIQVLNFEVPLPILPSKMPVASY  638


 Score = 86.7 bits (213),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 9/106 (8%)
 Frame = +1

Query  436  DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSVVFRNF--GSYG--  603
            D     V ID++SL+S +T PW+ DI  G  ++AWI+Y+  S N SV F +F  G+ G  
Sbjct  687  DQVXDRVAIDINSLKSNITTPWNGDINEGKRNDAWISYNSSSKNPSVAFTSFQNGTNGTE  746

Query  604  -----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
                 ++SYI+DL++YLP+ V  GF+ ATG+D A+  I SW FTS 
Sbjct  747  VEVIKYLSYIIDLKQYLPDWVIVGFSAATGQDIAVHKIISWNFTST  792



>ref|XP_008365117.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Malus domestica]
Length=697

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/620 (52%), Positives = 417/620 (67%), Gaps = 33/620 (5%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQN-ITFERTSLVNNS-IQITP-------NQRNCIGRATYSEPLHLW  201
             PL++NF  F  S + + I+ E  +  +   IQ+          +   +GR TY EP  L 
Sbjct  45    PLTYNFSSFPNSTINSSISLEGDAYTDGQFIQLAKIYETAALRKNGSVGRVTYREPFLLR  104

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             +  TGKL  F THF F +D   + KY DG AFF+AP GS +     +GG  GL    E L
Sbjct  105   ENATGKLGDFTTHFTFEMDPLNN-KYADGLAFFVAPNGSLLNYTLGRGGSLGLP--VEHL  161

Query  382   NSSN-----PFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSE  534
             NS+      PFVAVEFD+Y N      D E  HVGID++S++S +T PW+  I  G  + 
Sbjct  162   NSTQSRSQYPFVAVEFDIYWNARSNIGDPEGDHVGIDINSVKSYITKPWNGSILDGKQNG  221

Query  535   AWINYDPRSMNLSVVFRNF--GSY--GHVSYILDLRKYLPERVTFGFAGATGKDTALQMI  702
             AWI+Y+  S NLSV F ++  GS    ++ YI++L +YLP+ V  GF+ A+G  T   MI
Sbjct  222   AWISYNSGSKNLSVAFTSYVNGSQLTTYLDYIVNLEQYLPDWVIVGFSAASGARTTQFMI  281

Query  703   NSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKR---KMREEF  873
              SW F S L      +   +     V   + G   L+   +    + W+KR   K     
Sbjct  282   KSWSFNSTLVPPPRSSSGSNNIALAVGLGLGGFIALVSFVLC---ILWKKRARGKTNTNE  338

Query  874   DDDIFGNI-GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVA  1050
             D  I   I GE G G  P+ F+Y+ELA AT++F++ +KLGEGGFG VY+GY+K+L+SYVA
Sbjct  339   DPTIHELIDGEFGKGTSPRMFSYKELALATSNFAEVEKLGEGGFGGVYRGYIKDLKSYVA  398

Query  1051  VKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLY  1230
             VK++S  SKQG+KE+ASEVR+IS++RH+NLV LIGWCH+ K LLLVYEF+ NGSLDSHL+
Sbjct  399   VKKISSKSKQGLKEFASEVRIISQLRHRNLVQLIGWCHKKK-LLLVYEFMPNGSLDSHLF  457

Query  1231  KGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLAR  1410
               K LL W LRYKI Q LAS LLYLH+E E+C++HRDIKSSN+MLDSN NAKLGDFGLAR
Sbjct  458   AEKCLLLWGLRYKIAQGLASGLLYLHQEWEQCVLHRDIKSSNVMLDSNFNAKLGDFGLAR  517

Query  1411  LVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEEC  1590
             LVDH K S+TT +AGT GY+ALE V++GKASKE+D+YSFGIV LEIACGRKPI+   E  
Sbjct  518   LVDHGKQSQTTIVAGTRGYMALEYVITGKASKESDVYSFGIVALEIACGRKPIBLGLESS  577

Query  1591  HVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQ  1770
              V +V+WVW+LYG G++++AADP L GDF+ +E+E ++IVGLWCAHPD   RPSI++AIQ
Sbjct  578   QVEMVEWVWELYGEGKVIEAADPKLHGDFDEKEMECLLIVGLWCAHPDYHFRPSIQRAIQ  637

Query  1771  VLNFEAPLPDLPETMPVATF  1830
             VLNFE PLP LP  MPVAT+
Sbjct  638   VLNFEVPLPILPXNMPVATY  657



>ref|XP_010648102.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1 
[Vitis vinifera]
Length=659

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/616 (50%), Positives = 422/616 (69%), Gaps = 29/616 (5%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSLV--NNSIQITPNQR-----NCIGRATYSEPLHLWDKP  210
             LSF+F+ F P N   I FE  +    + +I +T NQ+     +  GRATY EP HLWDK 
Sbjct  39    LSFSFNDFDP-NGNQIHFEGQASYSGDKAIYLTRNQQEKKMNDSWGRATYREPFHLWDKA  97

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGL-ANDDERLNS  387
             + ++  F+T+F+F IDS G   +G+G AFFLAP G+++P   T G G GL +N+ + LNS
Sbjct  98    STRMVDFSTNFSFGIDSLGYF-HGEGLAFFLAPYGTQLPSVVTGGSGLGLVSNNQQALNS  156

Query  388   S-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSM  564
             + N F AVEFD Y N +D +  HVGI+++S++SV    WS  + GG  +   I+Y   S 
Sbjct  157   TENHFFAVEFDTYPNDWDPKHDHVGININSMKSVENMTWSHTL-GGKINHVSISYASSSK  215

Query  565   NLSVVFRNFGSYGHVS-----YILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSAL  729
             NLSV+F     Y + +     Y ++L  YLPE VT GF+ A      + +I SW F S+ 
Sbjct  216   NLSVIFGTDDLYDNTTPQSLYYKVNLSNYLPEFVTIGFSSARKNSYEINVIYSWSFRSS-  274

Query  730   DISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIF--GNIGE  903
                    D + + + +V         + G  M F F  W+K    +  +D  F    + +
Sbjct  275   -------DLQISDRVVVGLSFGVCALVAGLGMVF-FCLWKKGISEKGVEDPDFDLSMVED  326

Query  904   LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQG  1083
                G GP++FT +EL  ATN+F++ +KLGEGGFG VYKG+L+   SY+AVKRVSRGS+QG
Sbjct  327   FATGTGPRKFTRQELVLATNNFAEAEKLGEGGFGGVYKGFLRNPSSYIAVKRVSRGSEQG  386

Query  1084  IKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLR  1263
             +KEYASEV++ISR+RH+NLV L+GW H+ ++LLLVY+F+ NGSL S L++GK+LLTW +R
Sbjct  387   VKEYASEVKIISRLRHRNLVQLMGWSHKKRELLLVYDFMPNGSLASCLFEGKTLLTWAMR  446

Query  1264  YKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTT  1443
             YKI   LASALLYLHEE E+C+VHRD+KSSN+MLD++ NAKL DFGLARLVDH K S+TT
Sbjct  447   YKIATGLASALLYLHEEWEQCVVHRDVKSSNVMLDTDFNAKLSDFGLARLVDHGKRSQTT  506

Query  1444  ALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKL  1623
              LAGTMGY+A EC++ G ASKE+D+YSFG+V LEI CGRK ++P A+E  + +V+WVW L
Sbjct  507   VLAGTMGYMAPECLMKGNASKESDVYSFGVVALEICCGRKSVEPKAKENQIKLVEWVWTL  566

Query  1624  YGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDL  1803
             YG G+LL+AADP L  DF+ +++E++MIVGLWCAHPDC++RP+IRQA+ VLN+EA LP L
Sbjct  567   YGVGKLLEAADPRLCADFDEKQIERLMIVGLWCAHPDCNIRPAIRQAVNVLNYEASLPVL  626

Query  1804  PETMPVATFW-PQRNV  1848
             P  MPV  ++ P  N 
Sbjct  627   PSNMPVPMYYAPPENT  642



>ref|XP_008226418.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Prunus mume]
Length=753

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/601 (51%), Positives = 397/601 (66%), Gaps = 45/601 (7%)
 Frame = +1

Query  163   IGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATK  342
             +GRATYS+P  L +  TGKL+ F   F F IDSN +  YGDG  FF+AP GS + P    
Sbjct  101   VGRATYSQPFLLRENATGKLADFTAFFKFAIDSNNNTNYGDGLTFFIAPNGSSLDPTIAG  160

Query  343   GGGFGL------ANDDERLNSSNPFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVT  492
             G   GL      +++D    +  PFVAVEFD+Y N      D    HVGIDV+SL SV+ 
Sbjct  161   GSSLGLPVNTTPSSNDAVPRNQYPFVAVEFDIYQNVQPIINDPRHNHVGIDVNSLHSVIY  220

Query  493   APWSPDIEGGWGSEAWINYDPRSMNLSVVFR----NFGSYGHVSYILDLRKYLPERVTFG  660
               WS  I  G  + A ++Y+  S NLSV +     +     ++ Y +DL+ YLP+ V  G
Sbjct  221   QNWSAGILQGKENNATVSYNSTSKNLSVAYTTILDDVQVINYLDYTVDLKDYLPDWVVVG  280

Query  661   FAGATGKDTALQMINSWIFTSALDISENQAD--TKSTgkglviglvvggcfliggSMAFS  834
             F+ +TG   AL  I SW F S   +  ++ D  T +T   + +  +            + 
Sbjct  281   FSASTGSSVALFKIVSWNFNSTSLVDHHKVDIATDNTTSVVAVPALSPVASAYNPKPGYD  340

Query  835   -------------------------FLAWRKRKMREEFDDDIFGN---IGELGGGAGPKR  930
                                      F+ W+KR   +  D+D   N     E   GAGP++
Sbjct  341   RRIGLAIGISIAGFAVLVGGLGLVWFILWKKRGTGDTSDEDPMVNELKDDEFEKGAGPRK  400

Query  931   FTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVR  1110
             F+Y EL +AT++FS++ KLGEGGFG VYKG++ +L SYVAVKR+SRGSKQG KEYASEVR
Sbjct  401   FSYSELTQATSNFSEEKKLGEGGFGGVYKGFIPDLNSYVAVKRISRGSKQGPKEYASEVR  460

Query  1111  VISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLAS  1290
             +ISR+RH+NLV LIGWCHE K  LLVYEF+ NGSLDSHL++ + LLTW  RYKI Q LAS
Sbjct  461   IISRVRHRNLVQLIGWCHERK-FLLVYEFMPNGSLDSHLFEEEKLLTWEARYKIAQGLAS  519

Query  1291  ALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYI  1470
              LLYLH+E E+C++HRDIKSSN+MLDSN NAKLGDFGLARLVDH K S+TT LAGTMGY+
Sbjct  520   GLLYLHQEWEQCVLHRDIKSSNVMLDSNFNAKLGDFGLARLVDHGKQSQTTILAGTMGYM  579

Query  1471  ALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDA  1650
             A E V +GKAS+++D+YSFGIV LEI+CGRKPIDP      VN+V+WVW+LYG  ++++A
Sbjct  580   APEYVNTGKASRQSDVYSFGIVALEISCGRKPIDPKFGSSKVNMVEWVWELYGEDRVIEA  639

Query  1651  ADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             ADP L GDF+ +++E +MIVGLWC+HPD ++RPSI+QAIQVLNFE PLP+LP  MPVAT+
Sbjct  640   ADPKLCGDFDEKQMECLMIVGLWCSHPDYNMRPSIQQAIQVLNFEVPLPNLPSKMPVATY  699

Query  1831  W  1833
             +
Sbjct  700   F  700



>gb|EYU18390.1| hypothetical protein MIMGU_mgv1a022756mg [Erythranthe guttata]
Length=680

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/618 (52%), Positives = 423/618 (68%), Gaps = 35/618 (6%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQR-----NCIGRATYSEPLH  195
             IP    L+FN      S+ + I       V++  IQ+T N+R     N  GRATY E LH
Sbjct  17    IPSTISLTFNLSRIGSSDSRMINSTGGGYVSDQGIQVTTNERSSSQVNIGGRATYIEHLH  76

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             LWD+ +  LS F+THF+FVIDS G + +GDG  FFLAP+GS I  + + GG   + N++ 
Sbjct  77    LWDRASNNLSDFSTHFSFVIDSRGRSDFGDGLTFFLAPVGSTIQ-SWSLGGSLAIGNNNI  135

Query  376   RLNSSN-PFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
              +NSS+  FVAVEFD + N +D    HVGID++S+ SV TA W  ++  G  ++AWI+Y+
Sbjct  136   TVNSSSEAFVAVEFDTFPNFFDPGTTHVGIDINSMISVKTARWENNVSQGVQNDAWISYN  195

Query  553   PRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFT  720
               SM L V F    S      ++S+++DLR+YLPE V  GF+ ATG       I SW F+
Sbjct  196   ATSMELRVDFTGTSSNRTRRDNLSHVVDLREYLPEYVAVGFSAATGSWFEEHTIKSWAFS  255

Query  721   SALDIS----ENQA--------DTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMR  864
             S L I     EN          + KS+G  LV+GL VG   L+  S    +  WR++K +
Sbjct  256   STLQIKNVTFENPGVVITGGGKEKKSSGVTLVVGLSVGLSILVLASAFAGYFLWRRKKQK  315

Query  865   -----EEFDDDIFG---NIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKG  1020
                  E  D D +    +I E   G+GP +F+Y EL  AT  F++++KLGEGGFG VY+G
Sbjct  316   KRCKKESGDVDYYDPRMDI-EFQKGSGPNKFSYSELVLATKDFAEEEKLGEGGFGGVYRG  374

Query  1021  YLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFL  1200
             +L E  SY+AVKRVS GSKQG+KEYASEV++IS++RH+NLV LIGWCHE  +LLLVYE +
Sbjct  375   FLAETNSYIAVKRVSSGSKQGLKEYASEVKIISQLRHRNLVQLIGWCHERGELLLVYELM  434

Query  1201  SNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLN  1380
              NGSLDSHL+KG+++L W +RYKI Q +ASALLYLHEE E+ +VHRDIK+SNIMLDSN N
Sbjct  435   PNGSLDSHLFKGQTILPWEVRYKIAQGIASALLYLHEEWEQAVVHRDIKASNIMLDSNFN  494

Query  1381  AKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGR  1560
             AKLGDFGLAR VDHEKG+ +T LAGT+GY+A EC+V+G+ASKETD+YS GIV LEIACGR
Sbjct  495   AKLGDFGLARFVDHEKGAHSTVLAGTLGYMAPECMVTGRASKETDVYSLGIVMLEIACGR  554

Query  1561  KPIDPTAE--ECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPD  1734
             +PID +    E  V +V+WVW+LYG G+LL+AADP L  +F+ +E+E++MIV LWC HPD
Sbjct  555   RPIDHSRRCGEDRVVLVEWVWRLYGKGELLEAADPKLETEFDEQEMERLMIVALWCVHPD  614

Query  1735  CSLRPSIRQAIQVLNFEA  1788
                RPSIRQA+ VL+FEA
Sbjct  615   SVQRPSIRQAVHVLDFEA  632



>ref|XP_008345115.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Malus domestica]
Length=705

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/639 (50%), Positives = 425/639 (67%), Gaps = 37/639 (6%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPN-----QRNCIGRATYSEPLHL  198
             P V PL+FNF  F+ ++  NI+ E  + + +  +++T +     +   +GRATY +P  L
Sbjct  24    PSVTPLNFNFPSFSSADSPNISIEGDAYLGSPFLRLTRDATGEAKBYSVGRATYRQPFLL  83

Query  199   WDKPTGKLSSFNTHFAFVI---DSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLA--  363
              +  TGKL+ F T F F I   +SN  +  GDG AFF+AP GS +     +GG  GL   
Sbjct  84    QENATGKLADFTTSFDFEIKSVNSNSXSVPGDGLAFFIAPKGSVLISTLGQGGSLGLPFN  143

Query  364   ---NDDERLNSSNPFVAVEFDVYLNHY-----DTEQKHVGIDVDSLQSVVTAPWSPDIEG  519
                +DD  + +   FVAVEFD++  +      D + +HVGIDV+SL S    PW   I  
Sbjct  144   STPSDDFVVRNQYAFVAVEFDIFYYNVLTTIDDPQYEHVGIDVNSLNSSKWEPWVGGITE  203

Query  520   GWGSEAWINYDPRSMNLSVVFRNFGS-----------YGHVSYILDLRKYLPERVTFGFA  666
             G  +   I Y+  S NLSV F    +             +  Y +DL +YLP+ V  GF+
Sbjct  204   GIRNSXTITYNSSSKNLSVAFTTLVTSDLNDSQVVQKMTYFDYTVDLTRYLPDWVVVGFS  263

Query  667   GATGKDTALQMINSWIFTSALDISEN-QADTKSTgkglviglvvggcfliggSMAFSFLA  843
              +TG+  A+  I SW FTS   +     A  K  G  + +G+      + G  + + FL 
Sbjct  264   ASTGQSIAIHKIMSWNFTSTSLVDHPVPASNKPIGLVIGLGIGGCAVVVTGLGLVWFFL-  322

Query  844   WRKRKMREEFDDDIFGNI---GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVY  1014
             W++R+  E  D+D   +     E   GA P++F+YRELARATN+F Q++KLGEGGFG VY
Sbjct  323   WKRRETGESGDEDTMLHELVDEEFERGACPRKFSYRELARATNNFGQEEKLGEGGFGGVY  382

Query  1015  KGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYE  1194
             KG + +LES VAVKR+SRGSKQG KEYASEV+ ISR+RH+NLV LIGWCHE K  LLVYE
Sbjct  383   KGIIPDLESPVAVKRISRGSKQGSKEYASEVKTISRLRHRNLVQLIGWCHERK-FLLVYE  441

Query  1195  FLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSN  1374
             F+  GSLDSHL+K +SLLTW  RYKI Q LAS LLYLH+E ++C++HRDIKSSN+MLD+N
Sbjct  442   FMPKGSLDSHLFKEQSLLTWEARYKIAQGLASGLLYLHQEWDQCVLHRDIKSSNVMLDAN  501

Query  1375  LNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIAC  1554
              NAKLGDFGLARLVDH +   TTA+AGTMGY+A E V++GKASKE+D+YSFGIV LEI C
Sbjct  502   FNAKLGDFGLARLVDHGQEPPTTAVAGTMGYMAPEYVITGKASKESDVYSFGIVALEICC  561

Query  1555  GRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPD  1734
             GRKPIDP      VN+V+WVW+LYG  ++++AADP L GDF+ +++E +MIVGLWCAHPD
Sbjct  562   GRKPIDPKFGSSKVNMVEWVWELYGEEKVIEAADPKLCGDFDEKQMECLMIVGLWCAHPD  621

Query  1735  CSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW-PQRNV  1848
              ++RPSI+QAIQVLNFE PLP+LP  MPVAT++ P R++
Sbjct  622   NNMRPSIQQAIQVLNFEVPLPNLPSKMPVATYFAPSRSL  660



>ref|XP_002264871.2| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Vitis vinifera]
Length=696

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/625 (51%), Positives = 427/625 (68%), Gaps = 24/625 (4%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLV----NNSIQITPNQRN-----CIGRATYSEP  189
             P    LSFNF  F  SN  NI+F+         +  IQ+T N+ +       GRA YSE 
Sbjct  31    PSATSLSFNFSSF-GSNNHNISFDEAGDAVYSSDGCIQLTRNENDKQSNDSWGRAMYSER  89

Query  190   LHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAND  369
             L+LWD+ +  L+ F ++F+FVI+S GS+++ DG  FFL   G+++  + T GG  GLAN+
Sbjct  90    LYLWDQTSRNLTDFTSNFSFVINSQGSSQHADGLTFFLN--GTQLHTD-TLGGTLGLANE  146

Query  370   DERLN-SSNPFVAVEFDVYLN--HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAW  540
                 N S+  F+AVEFD + N    D E +H+GID++S+ SV T  WS +I GG  +   
Sbjct  147   KNETNKSAVTFIAVEFDTFTNAAKKDPEGEHIGIDINSMISVKTVNWSSNITGGKKNHVS  206

Query  541   INYDPRSMNLSVVF-----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMIN  705
             I+Y   S NLSVV       +  +   +SY +DLR+YLPE VT GF+GATG    +  I 
Sbjct  207   ISYTSSSHNLSVVLITEVTDSTNTTQSLSYEIDLREYLPEYVTMGFSGATGTYFQINKIC  266

Query  706   SWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKM---REEFD  876
             SW F+S L+   +    +    GL++GL VG   ++GG     +  W+KR     +E+  
Sbjct  267   SWNFSSTLEFPSSVEPGEGKKTGLMVGLSVGAFVVVGGLGLVWYYMWKKRNTGGDQEDGA  326

Query  877   DDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVK  1056
             D       +   G GP++F++ ELA AT++FS  +KLGEGGFG VY+G+L EL SYVAVK
Sbjct  327   DSDLAMDEDFEKGTGPRKFSFNELALATSNFSDGEKLGEGGFGGVYRGFLGELNSYVAVK  386

Query  1057  RVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKG  1236
             RV+R S+QG+KEYASEV++  R+RH+NLV L+GWCH+  +LLLVYE L NGSL + L++ 
Sbjct  387   RVTRNSQQGMKEYASEVKIFCRLRHRNLVRLMGWCHQKGELLLVYELLPNGSLSTCLFEE  446

Query  1237  KSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLV  1416
             K+LLTW +RY+I   LAS+LLYLHEE E+C+VHRDIKSSN+MLDS+ NAKLG FGLARLV
Sbjct  447   KTLLTWAMRYRIALGLASSLLYLHEEWEQCVVHRDIKSSNVMLDSDFNAKLGYFGLARLV  506

Query  1417  DHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHV  1596
             DH KGS+TT LAGTMGYIA EC ++GKASKE+D+YSFGIV LEI CGR+ ++  AEE  +
Sbjct  507   DHGKGSQTTVLAGTMGYIAPECFMTGKASKESDVYSFGIVVLEICCGRRAVETKAEENQI  566

Query  1597  NIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVL  1776
              +V+WVW LYG G+LL+AADP LS D++ +++E++MIVGLWCAHPDC+ RPS+RQAI VL
Sbjct  567   RLVEWVWDLYGVGKLLEAADPRLSADYDDQQMERLMIVGLWCAHPDCNARPSMRQAISVL  626

Query  1777  NFEAPLPDLPETMPVATFWPQRNVQ  1851
             N EA LP LP  MPVA ++    +Q
Sbjct  627   NSEALLPLLPIKMPVAMYYAPPALQ  651



>ref|XP_010254613.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1 
[Nelumbo nucifera]
Length=654

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/607 (51%), Positives = 411/607 (68%), Gaps = 17/607 (3%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSLVN-NSIQITPNQRNC-IGRATYSEPLHLWDKPTGKLS  225
             LSF    F P    N+ F+  ++ +  +I+       C +G A Y+E LHLWD  TGKL+
Sbjct  28    LSFKISRFDPE-ATNVLFQGDAIPSVGTIEFNKVNYLCRVGWAIYAERLHLWDSATGKLT  86

Query  226   SFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN-SSNPFV  402
              F THF+F I++ G+A YG G  FFLAP+GS+IPPN+  GG  GL N     + S N  V
Sbjct  87    DFTTHFSFTINTQGAASYGHGLTFFLAPVGSQIPPNSA-GGFLGLFNTTTSDSVSRNQIV  145

Query  403   AVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSVV  579
             AVEFD + N  +D    HVGI+ +S+ S V APW+  +  G  ++ WI Y+  + NLSV 
Sbjct  146   AVEFDSFSNPEWDPPVPHVGINNNSIASAVFAPWNASLHSGETADVWITYNATTKNLSVF  205

Query  580   FR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISEN  744
             +      NF +   + Y +DL K LPE VT GF+ ATG++    ++ SW F+S+L++ EN
Sbjct  206   WNYEDNPNFRTNSTLFYRVDLMKVLPEWVTIGFSAATGQNVERHILESWEFSSSLEVKEN  265

Query  745   QADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFG----NIGELGG  912
             Q       K +V  +V     + G  +  + L  R R+  E   + +      NI +   
Sbjct  266   QGKNNRNIKLVVSLVVTSAVLIGGVCITVAILRRRWRRQPEREAEGLAQLTSINI-DFER  324

Query  913   GAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKE  1092
             G GPKR++Y+ELA AT++FS + KLGEGGFG VY+G+L +L   +AVK++SRGS+QG KE
Sbjct  325   GVGPKRYSYKELASATDNFSDERKLGEGGFGGVYRGFLSDLNLAIAVKKISRGSRQGKKE  384

Query  1093  YASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKI  1272
             Y +EV++ISR+RH+NLV LIGWCH+  + LLVYEF+ NGSLDSHL+  KS LTW +RYKI
Sbjct  385   YITEVKIISRLRHRNLVQLIGWCHDRGEFLLVYEFMPNGSLDSHLFGRKSPLTWAVRYKI  444

Query  1273  VQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALA  1452
                LASALLYLHEE E+C+VHRDIKSSN+MLDSN N KLGDFGLARL+DHE   +TT +A
Sbjct  445   AHGLASALLYLHEEWEQCVVHRDIKSSNVMLDSNFNVKLGDFGLARLMDHELAPQTTGIA  504

Query  1453  GTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEE-CHVNIVDWVWKLYG  1629
             GT+GY+A E V +GKAS+E+D++SFG+V LEIACGRK +DP  E+   V +V+WVW LYG
Sbjct  505   GTLGYLAPEYVSTGKASRESDVFSFGVVALEIACGRKSVDPLMEQDSQVGLVEWVWDLYG  564

Query  1630  TGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPE  1809
               +LL A D  L   F+ ++VE +M+VGLWCAHPD  LRPSIRQAIQVLNFEA +P+LP 
Sbjct  565   RARLLTAVDERLEMGFDAKQVECLMVVGLWCAHPDHHLRPSIRQAIQVLNFEAVMPNLPP  624

Query  1810  TMPVATF  1830
              MPVAT+
Sbjct  625   KMPVATY  631



>ref|XP_009339300.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Pyrus x bretschneideri]
Length=706

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/638 (50%), Positives = 420/638 (66%), Gaps = 41/638 (6%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVN-NSIQITPNQ-----RNCIGRATYSEPLHL  198
             P   PL FNF  F P+ +  +  E  + V+  S+++T +         +GRATYS+P  L
Sbjct  16    PCATPLYFNFPSF-PNGLTTLFIEDYAFVDGKSLRLTKSTAGDRLNQSVGRATYSQPFLL  74

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLA---ND  369
              +  TGKL+ F T F F I S G   Y DG AF LAP GS +     +GG  GL      
Sbjct  75    RENATGKLADFTTKFTFSIGSEGKKDYADGLAFSLAPNGSLLNTTIGRGGSLGLPVINPP  134

Query  370   DERLNSSNPFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
             +++  +  PFVAVEFD+Y N+     D    HVGID++SL+S VT PW+  I  G  + A
Sbjct  135   NKKSTNLYPFVAVEFDIYTNNVTSIKDPVGDHVGIDINSLKSKVTEPWNGSITTGRENTA  194

Query  538   WINYDPRSMNLSVVFRNFGS-----------YGHVSYILDLRKYLPERVTFGFAGATGKD  684
              I YD  S NLSVV+ +F +           + ++ Y++DL +YL   V  GF+ ATG  
Sbjct  195   RIRYDSGSKNLSVVYTSFENASPVFVNGVQVWEYLDYMVDLNEYLQGYVVVGFSAATGAL  254

Query  685   TALQMINSWIFTSA------------LDISENQADTKSTgkglviglvvggcfliggSMA  828
              ++ +I +W F S               I E           LV  +V G   L+GG + 
Sbjct  255   ASIPIIKTWSFNSTDLPLPVVPVPEPNPIVEPDPGNGVNVGRLVGLVVGGCVLLVGGLVL  314

Query  829   FSFLAWRKRKMREEFDDD---IFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEG  996
               ++ WRK K     DD+   +  +I E    G GPK+F+Y+ LA++T +F + +KLGEG
Sbjct  315   VWWICWRKGKTGGSSDDEDPMVNDSIDEEFEKGTGPKKFSYKTLAQSTGNFDEAEKLGEG  374

Query  997   GFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKD  1176
             GFG VY+G++K+L+SYVAVKRVS  S+QG+KEYA+EVR+ISR+RH+NLV LIGWCHE  +
Sbjct  375   GFGGVYRGFIKDLDSYVAVKRVSSRSRQGMKEYAAEVRIISRLRHRNLVQLIGWCHEKGE  434

Query  1177  LLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSN  1356
             LLLVYEF+SNGSLDSHL+K K++L W  RY+I Q LAS L YLHEE E+C++HRDIKSSN
Sbjct  435   LLLVYEFMSNGSLDSHLFKPKTVLHWEARYRIAQGLASGLFYLHEEWEQCVLHRDIKSSN  494

Query  1357  IMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIV  1536
             IMLDSN NAKLGDFGLARLVDH K S+TT LAGTMGY+A ECV +GKASKETD+YSFG+V
Sbjct  495   IMLDSNFNAKLGDFGLARLVDHGKQSQTTVLAGTMGYMAPECVTTGKASKETDVYSFGVV  554

Query  1537  TLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGL  1716
              LEIACGRKPIDP      +N+V+WVW+LYG G++++AADP L G+F+ +++E ++IVGL
Sbjct  555   ALEIACGRKPIDPKFGTTQINMVEWVWELYGEGKIIEAADPKLCGEFDAKQMECLLIVGL  614

Query  1717  WCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
              CAHPD  +RPSI Q IQVLNFE PLP LP  MPVA++
Sbjct  615   CCAHPDYMMRPSILQTIQVLNFEVPLPTLPSKMPVASY  652



>ref|XP_008338483.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1 
[Malus domestica]
Length=690

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/619 (52%), Positives = 417/619 (67%), Gaps = 36/619 (6%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQRN-----CIGRATYSEPLHLWD  204
             V+  SFN   F  +N ++IT++  +  +   IQ+T NQ +       GRA +++P+ L+D
Sbjct  32    VNSFSFNISSFD-TNTKDITYQGDAFPSRGVIQLTKNQVDGPLTESAGRALFAZPVRLYD  90

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
                G+L+ F THF FV+ +    +YGDG +FFLAPL S+IP N+T GG   L + +   N
Sbjct  91    ASKGRLTDFTTHFTFVMXALBDTRYGDGISFFLAPLDSKIPENST-GGYLALFSSNSNFN  149

Query  385   SS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
             S+ N  VAVEFD + N +D    HVGI+V+S+ SV    W   I+ G  + AW++Y+  S
Sbjct  150   STKNQIVAVEFDSFKNSWDPSPDHVGINVNSIVSVANISWKTTIKNGSVANAWVSYNSTS  209

Query  562   MNLSVVFRNFGSYGH----------VSYILDLRKYLPERVTFGFAGATGKDTALQMINSW  711
              NLSV    F +Y            VSYI+DLRK LPE V+ GF+ ATG    +  I SW
Sbjct  210   QNLSV----FLTYSKNPEFSAGDCSVSYIIDLRKVLPELVSVGFSAATGAWVEIHNILSW  265

Query  712   IFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKR--KMREEFD---  876
              F+S LDIS N    +    G+ +G   G      G   F F++WRKR  K+ E +D   
Sbjct  266   SFSSTLDISSNNEAERKIRIGVGLGAGFGLLSCGLG--LFWFISWRKRAKKINEAYDISM  323

Query  877   DDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVK  1056
             DD      E   G GP+RFTYREL  ATN+F++  KLGEGGFG VYKG L E ++ VAVK
Sbjct  324   DD------EFDKGTGPRRFTYRELNHATNNFAEGGKLGEGGFGGVYKGLLTESKTEVAVK  377

Query  1057  RVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKG  1236
             RVSRGSKQG KEY +EVR+ISR+RH+NLV LIGWCHE  + LLVYE + NGSLDSHL+  
Sbjct  378   RVSRGSKQGKKEYIAEVRIISRLRHRNLVQLIGWCHEQGEFLLVYEIMPNGSLDSHLFGX  437

Query  1237  KSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLV  1416
             K  LTW +R+KI   LASA+LYLHEE E+C+VHRDIKSSN+MLDSN NAKLGDFGLARLV
Sbjct  438   KLHLTWTVRHKIALGLASAILYLHEEWEQCVVHRDIKSSNVMLDSNFNAKLGDFGLARLV  497

Query  1417  DHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHV  1596
             DH  GS+TT LAGTMGY+A ECV  G+ASKE+D+YSFG+V+LEI+CGR+P++  AE   V
Sbjct  498   DHGLGSQTTVLAGTMGYLAPECVTDGRASKESDVYSFGVVSLEISCGRRPVEAKAEPSRV  557

Query  1597  NIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVL  1776
              +V+WVW LYG  Q+L+A D  L+ +F+ +++E +M VGLWC HPD ++RPSIRQ I VL
Sbjct  558   RLVEWVWDLYGKDQILEAVDERLNKEFDEQQIECLMTVGLWCCHPDPTVRPSIRQVINVL  617

Query  1777  NFEAPLPDLPETMPVATFW  1833
             NFEAP+P LP  +PV  ++
Sbjct  618   NFEAPMPSLPSXLPVPXYF  636



>ref|XP_008245320.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Prunus mume]
Length=709

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/642 (50%), Positives = 411/642 (64%), Gaps = 53/642 (8%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVNNSI------QITPNQRNCIGRATYSEPLHLWDKP  210
             PL+F+F  F   +   I  E  + ++          +  + +  +GRATYS P  L +  
Sbjct  26    PLNFSFSRFNGKDYPTICTEGDAYIDTQFLRLTNSSLDNDMKGSVGRATYSRPFLLRENS  85

Query  211   TGKLSSFNTHFAFVI---DSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             TGKL+ F T F F I   DS+  + YGDG AFF+AP GS I      G   GL       
Sbjct  86    TGKLADFTTSFNFAIVSMDSDNKSSYGDGLAFFIAPNGSFIGTKLAAGTTLGLP-----Y  140

Query  382   NSSNP----FVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWIN  546
             N ++P    FVAVEFD+Y N   D   +HVGIDV+SL S +T PW   I+ G  + A I+
Sbjct  141   NFTSPKDTAFVAVEFDIYANPMVDPPYEHVGIDVNSLNSSITRPWKGGIKEGKRNSATIS  200

Query  547   YDPRSMNLSVVFRNFGS-------YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMIN  705
             Y+  S NLSV F  + S         H  YI+DL++YLP+ V  GF+ +TG  T+L  I 
Sbjct  201   YNSTSKNLSVAFTTYVSNTSDTQVMKHFYYIIDLKQYLPDWVVVGFSASTGNYTSLNKII  260

Query  706   SWIFTSA--------LDISENQADTKSTgkglviglvvggcfliggSMAFSFLA------  843
             SW F S         + I+ +     +                +   +A    A      
Sbjct  261   SWNFNSTSLGDHDSKVGIATDNQTPSAMASTNSNRKSRNKSIGLAVGLAIGACAVLFGGL  320

Query  844   -------WRKRKMREEFDDD--IFGNI--GELGGGAGPKRFTYRELARATNSFSQQDKLG  990
                    W+KR+   E  D+  I   +   E   GAGP++F Y ELA+AT++F + +KLG
Sbjct  321   GLIRLVMWKKRETTVESSDEDPIVHELIDDEFEKGAGPRKFLYSELAQATSNFREGEKLG  380

Query  991   EGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHEN  1170
             EGGFG VYKG++ +L+SYVAVK++SRGSKQG+KEYASEV++ISR+RH+NLV LIGWCHE 
Sbjct  381   EGGFGGVYKGFITDLKSYVAVKKISRGSKQGLKEYASEVKIISRLRHRNLVQLIGWCHER  440

Query  1171  KDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKS  1350
             K  LLVYEF+ NGSLDSHL+K +SLLTW  RYKI Q LAS LLYLHEE E+C++HRDIKS
Sbjct  441   K-FLLVYEFMPNGSLDSHLFKEQSLLTWDARYKIAQGLASGLLYLHEEWEQCVLHRDIKS  499

Query  1351  SNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFG  1530
             SN+MLDSN NAKLGDFGLARLVDH K S+TT LAGTMGY+A + + +GKASKE+DIYSFG
Sbjct  500   SNVMLDSNFNAKLGDFGLARLVDHGKQSQTTILAGTMGYMAPDYLSTGKASKESDIYSFG  559

Query  1531  IVTLEIACGRKPID-PTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMI  1707
             +V LEIACGRKPID P +    +N V+WVW+LYG  ++++AADP L GDF  +++E +M 
Sbjct  560   VVALEIACGRKPIDLPKSGSSPINSVEWVWELYGEERVIEAADPKLCGDFVEKQMECLMT  619

Query  1708  VGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW  1833
             VGLWCAHPD S RPSI+QAIQVLNFE PLP LP  MPVAT++
Sbjct  620   VGLWCAHPDYSKRPSIQQAIQVLNFEIPLPILPSKMPVATYF  661



>ref|XP_011031283.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Populus euphratica]
Length=693

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/610 (52%), Positives = 412/610 (68%), Gaps = 21/610 (3%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSLVNNSI-QITPNQRNC-----IGRATYSEPLHLWDKPT  213
             LSFNF  F+P N+ NI+F+  +  ++ + Q+T N ++       GRATY +P+ LWD  T
Sbjct  34    LSFNFTSFSP-NMANISFQGDAFSSSDVLQLTKNAKDSNLTGSAGRATYYKPVRLWDAKT  92

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS-  390
              +L+ F THF FV+ +  S  YGDG +FF+APL S IP +++ GG   L +     ++S 
Sbjct  93    RRLTDFTTHFTFVMKAVDSGWYGDGMSFFIAPLDSPIPQDSS-GGLLALFSPHTAFSASK  151

Query  391   -NPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSM  564
              N  VAVEFD   +  +D    HVGIDV+S+ SV +  W   I+ G  + AW++Y+  + 
Sbjct  152   ENQIVAVEFDSKKDIEWDPSDNHVGIDVNSIVSVASVDWKSSIKTGSKANAWVSYNSTTK  211

Query  565   NLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSAL  729
             NLSV         FG    + YI+DLR++LPE V  GF+ +TG    +  I SW F S+L
Sbjct  212   NLSVFLTYAENPKFGGNSTLHYIIDLREFLPEWVRIGFSASTGDWVEIHNILSWTFESSL  271

Query  730   DISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG-EL  906
             ++S+ +   K+     +            G + F     + R+  ++ ++ I  ++  E 
Sbjct  272   EVSDKK---KTGLVVGLAVGFGVLTTFGIGVLCFVLRRRKNRRWCDKENEAIDVSMDDEF  328

Query  907   GGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKE-LESYVAVKRVSRGSKQG  1083
               G GPKRFTYREL RATN+F +  KLGEGGFG VYKG  KE   + VAVKRVSRGSKQG
Sbjct  329   EKGTGPKRFTYRELIRATNNFEEGGKLGEGGFGGVYKGLFKEGTNTEVAVKRVSRGSKQG  388

Query  1084  IKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLR  1263
              KEY SEV++ISR+RH+NLV LIGWCHE  +LLLVYEF+ NGSLDSHL+ G+ +L W LR
Sbjct  389   KKEYVSEVKIISRLRHRNLVQLIGWCHERGELLLVYEFMPNGSLDSHLFGGQVMLIWNLR  448

Query  1264  YKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTT  1443
             YKI   LASALLYLHEE E+C+VHRDIKSSN+MLDSN NAKLGDFGLARLVDHE GS+TT
Sbjct  449   YKIALGLASALLYLHEEWEQCVVHRDIKSSNVMLDSNFNAKLGDFGLARLVDHELGSQTT  508

Query  1444  ALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKL  1623
              LAGTMGY+A ECV +GKASKE+D+YSFG+V LEI CGR+P++   E   V +V+WVW L
Sbjct  509   VLAGTMGYLAPECVTTGKASKESDVYSFGVVALEITCGRRPVETRQEPSKVRLVEWVWNL  568

Query  1624  YGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDL  1803
             YG G+LLDA D  L  DF+ R++E +MIVGLWC HPD +LRPSIRQ I VLNFEAPLP L
Sbjct  569   YGEGKLLDAVDKMLCTDFDERQMECLMIVGLWCCHPDYTLRPSIRQVINVLNFEAPLPTL  628

Query  1804  PETMPVATFW  1833
             P  +PV  ++
Sbjct  629   PSKLPVPMYY  638



>ref|XP_008226556.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Prunus mume]
Length=651

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/620 (54%), Positives = 427/620 (69%), Gaps = 32/620 (5%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVNNS-IQIT--PNQRNCIGRATYSEPLHLWDKPTGK  219
             PL+FNF  F P+   NI+ E  +   +  I++T  P ++  +GRATY EP  L +  TGK
Sbjct  23    PLTFNFPSF-PNGTNNISLEGEAYFGSQLIRLTRSPAEKWNVGRATYREPFLLRENATGK  81

Query  220   LSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL-----N  384
             L+ F T FAF+IDS     + DG  FF+AP GS +  N   GGG  L    E +      
Sbjct  82    LADFTTTFAFIIDSG----HADGMVFFVAPNGSLL--NRAAGGGNKLGLPVENMPGDISR  135

Query  385   SSNPFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
             +  PFVAVEFD++ N      D +  HVGIDV+SL+S +T PW+  IE G  + A I+Y+
Sbjct  136   TQYPFVAVEFDIFKNPAPIIEDPDGDHVGIDVNSLKSNITRPWNGGIEEGKQNSARISYN  195

Query  553   PRSMNLSVVFRNF--GSYG-------HVSYILDLRKYLPERVTFGFAGATGKDTALQMIN  705
               S NLSV F +F  G+ G       H+SY++DL++YLP+    GF+ ATG   A+  I 
Sbjct  196   SSSKNLSVAFTSFQNGTNGTQVEVINHLSYVVDLKQYLPDWAIVGFSAATGNKVAVFKIV  255

Query  706   SWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLA-WRKRKMREEFDDD  882
             SW FTS   + E ++   +   GL IGL VGGC ++   +   +L  W+K K   E D++
Sbjct  256   SWNFTSTALVDEPKSGNANANIGLPIGLGVGGCLILVAGLGLVWLIFWKKGKAAGEHDEN  315

Query  883   IFGNI---GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAV  1053
              F N     EL  G GP++F+YRELARAT +F + +KLGEGGFG VYKG++K+L S+VAV
Sbjct  316   PFANSFIHEELEKGTGPRKFSYRELARATKNFEEGEKLGEGGFGGVYKGFVKDLNSHVAV  375

Query  1054  KRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYK  1233
             KR+S GSKQG+KEYASEVR+ISR+RH+NLV LIG CHE K+L+LVYEF+ NGSLDSHL+K
Sbjct  376   KRISSGSKQGLKEYASEVRIISRLRHRNLVQLIGRCHEKKNLMLVYEFMPNGSLDSHLFK  435

Query  1234  GKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARL  1413
                LLTW +RY I Q LAS L YLHEE E+C++HRDIKS N+MLDS+ N KLGDFGLARL
Sbjct  436   ENGLLTWQIRYSIAQGLASGLFYLHEEWEQCVLHRDIKSCNVMLDSHFNVKLGDFGLARL  495

Query  1414  VDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECH  1593
             VDH K S+TT +AGT GY+ALE V +GKAS E+DIYSFG+V LEIACGRKPID + E   
Sbjct  496   VDHGKQSQTTNVAGTRGYMALEYVTTGKASMESDIYSFGVVALEIACGRKPIDLSLESSQ  555

Query  1594  VNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQV  1773
             + +V+WVW+LYG G L+ AADP L G F+ +++E +MIVGLWCAHPD   RPSI+QAIQV
Sbjct  556   IEMVEWVWELYGEGTLIQAADPKLCGHFDEKQMECLMIVGLWCAHPDYKFRPSIQQAIQV  615

Query  1774  LNFEAPLPDLPETMPVATFW  1833
             LNFE PLP LP  MPVAT++
Sbjct  616   LNFEVPLPILPSKMPVATYF  635



>ref|XP_003532589.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Glycine max]
Length=666

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/629 (51%), Positives = 413/629 (66%), Gaps = 34/629 (5%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPN---QRN--CIGRATYSEPL  192
             IIPL + LSF++  F   +V+   +E   S++  +IQ+T N   Q N   +GR T  + +
Sbjct  27    IIPLANSLSFDYPNFKNGDVK---WEGDASILKGAIQVTSNTMDQNNNYSVGRVTSYKKM  83

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWD  TGKL+ F T F+FV+ S G + YGDG AFFLA     +  N  +GGG GL +  
Sbjct  84    LLWDMNTGKLADFTTKFSFVVFS-GKSYYGDGMAFFLADPNLPLLKNIREGGGLGLVDGK  142

Query  373   ERLNSSNPFVAVEFDVYLNHYDTEQ-KHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
             + LNS+ PFVAVEFD + N +D +   HVG++ +S++S +T  W  DI+        I Y
Sbjct  143   QVLNSTQPFVAVEFDTFHNKWDPQGGTHVGLNFNSMRSNITKQWLTDIQIWNVYNCSIEY  202

Query  550   DPRSMNLSVVFRNFGSYG-----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             +  ++NLSV F  + +       ++SY +DLR YLP +V  GF+ ATGK   +  + SW 
Sbjct  203   NSSTLNLSVSFTTYNNVSKPVEEYISYKVDLRDYLPGKVILGFSAATGKLYEVHTLRSWS  262

Query  715   FTSALDISENQADTKSTgkglvi--------------glvvggcfliggSMAFSFLAW-R  849
             F S+L   EN  + K                      G+ +G   ++G       L W R
Sbjct  263   FNSSLQSDENTNEIKPVAAPPTSNPDSENEHKIGLWVGIGIGVGLVLGLLGLICALLWKR  322

Query  850   KRKMREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLK  1029
              R+ + E   D+     E   G GPK F Y EL  ATN F++  KLG+GGFG VYKGYLK
Sbjct  323   SREKKGELVFDL-NMADEFPKGTGPKSFCYNELVSATNKFAE--KLGQGGFGGVYKGYLK  379

Query  1030  ELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNG  1209
             +L+SYVA+KR+S+ S+QG+KEY +EV+VIS++RH+NLV LIGWCH   D LL+YEF+ NG
Sbjct  380   DLKSYVAIKRISKESRQGMKEYVTEVKVISQLRHRNLVQLIGWCHRKNDFLLIYEFMPNG  439

Query  1210  SLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKL  1389
             SLDSHLY  KS LTW +RY I   LASALLYL EE E+C++HRDIKSSNIMLDS  NAKL
Sbjct  440   SLDSHLYGVKSFLTWTVRYNIALGLASALLYLQEEWEQCVIHRDIKSSNIMLDSCFNAKL  499

Query  1390  GDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPI  1569
             GDFGLARLVDHEKGS+TT +AGT GYIA E   SGKA+KE+DIYSFG+V LEIA GRKP+
Sbjct  500   GDFGLARLVDHEKGSQTTRIAGTRGYIAPEYFTSGKATKESDIYSFGVVLLEIASGRKPV  559

Query  1570  DPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRP  1749
             +  AEE  + +V+WVWKLYG G+ L+AADP L G+F+  ++E+++IVGLWC HPD S RP
Sbjct  560   ELEAEEGQITVVEWVWKLYGLGRFLEAADPKLCGEFDENQMERLVIVGLWCVHPDYSFRP  619

Query  1750  SIRQAIQVLNFEAPLPDLPETMPVATFWP  1836
             SIRQ IQVL FE+ LP LPE MPV T+ P
Sbjct  620   SIRQVIQVLKFESALPILPEMMPVPTYLP  648



>ref|XP_007156452.1| hypothetical protein PHAVU_003G287100g [Phaseolus vulgaris]
 gb|ESW28446.1| hypothetical protein PHAVU_003G287100g [Phaseolus vulgaris]
Length=701

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/614 (52%), Positives = 409/614 (67%), Gaps = 22/614 (4%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQN-ITFERTSLVNNSI-QITPNQ-----RNCIGRATYSEPLHLW  201
             V  +SFNF  F  SN+ N I F   +  +N + Q+T NQ      + +GRA+YS+P+ LW
Sbjct  53    VESVSFNFSSFQQSNLNNQIDFAGDAFPSNGVLQLTKNQLDGPVTDSVGRASYSQPVRLW  112

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             D+ T KL+ F THF+FVI +   +  GDG AFFLAP  S IP N+  GG  GL + D   
Sbjct  113   DQKTKKLTDFTTHFSFVIKAVNESIVGDGLAFFLAPFDSSIPNNSA-GGFLGLFSPDSAF  171

Query  382   NSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
             ++  N  VAVEFD + N +D    HVGI+V+S+QSV    W   I+ G  + AW+ Y+  
Sbjct  172   DTKKNQLVAVEFDSFKNEWDPSSDHVGINVNSIQSVANVSWRSSIKNGSVANAWVWYNST  231

Query  559   SMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTS  723
             S NLSV         F     VSY++D R  LPE V  GF+ ATG    +  I  W F+S
Sbjct  232   SKNLSVFLTYAENPTFNGSSSVSYVIDFRDVLPEFVRIGFSAATGTWVEIHNILLWSFSS  291

Query  724   ALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIF---GN  894
              LD        KS    +V   V  GC +    + + F  WR+R       +DI     +
Sbjct  292   TLD---GDGRKKSKVGLVVGISVGLGCLVGLVGLLW-FTFWRRRNRLRGVSEDIIDVDAS  347

Query  895   IG-ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRG  1071
             I  E   G GPKRF+YREL+ ATN+F+++ KLG+GGFG VYKG +      VAVKRVS+G
Sbjct  348   IDDEFERGTGPKRFSYRELSNATNNFAEEGKLGQGGFGGVYKGLIVNSNLEVAVKRVSKG  407

Query  1072  SKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLT  1251
             SKQG KEY SEVRVISR+RH+NLV L+GWCHE  +LLLVYEF+ NGSLDSHL+  + +L+
Sbjct  408   SKQGKKEYISEVRVISRLRHRNLVQLLGWCHEQSELLLVYEFMPNGSLDSHLFGNRVMLS  467

Query  1252  WPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKG  1431
             W +RYK+   LASALLYLHEE E+C+VHRDIKSSNIMLD+N NAKLGDFGLARLVDHE G
Sbjct  468   WVVRYKVALGLASALLYLHEEWEQCVVHRDIKSSNIMLDANFNAKLGDFGLARLVDHEVG  527

Query  1432  SRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDW  1611
             S+TT LAGTMGY+A ECV +GK+SKE+D+YSFG+V LEI CGRKP++   E   V +V+W
Sbjct  528   SQTTVLAGTMGYLAPECVTTGKSSKESDVYSFGVVALEITCGRKPVEVREEPGKVRLVEW  587

Query  1612  VWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAP  1791
             VW LYG G+LL+AAD  L+ +F  +++E +M+VGLWC HPD ++RPSIRQ I VLNFEAP
Sbjct  588   VWNLYGKGKLLEAADEKLNLEFEEQQMECLMVVGLWCCHPDHTMRPSIRQVISVLNFEAP  647

Query  1792  LPDLPETMPVATFW  1833
             LP LP  +PV  ++
Sbjct  648   LPSLPSKLPVPMYF  661



>ref|XP_010242792.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Nelumbo nucifera]
Length=713

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/624 (51%), Positives = 424/624 (68%), Gaps = 27/624 (4%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPNQRN-----CIGRATYSEPLHL  198
             P    LSFNF  F  +N + I +E   S  +  IQ+T N+ +      +GRATY +P+HL
Sbjct  33    PSAASLSFNFTSFD-TNSREIQYEGNASPSDGVIQLTRNRIDMSVDLSVGRATYEQPVHL  91

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
             WD  T  L+ F T F+F ID+  +   GDG AFFLAP GS +PPN+T G   GL      
Sbjct  92    WDNATNNLTDFTTDFSFTIDARNNTIPGDGLAFFLAPNGSTLPPNST-GSPLGLFERRLM  150

Query  379   LNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDP  555
              N++ N  VAVEFD + N +D    H+GID++S++SV    W   ++ G  + A I Y+ 
Sbjct  151   FNTTENQIVAVEFDTFKNPFDPSDDHLGIDINSIESVRNVSWPHSMKDGRRANARITYNS  210

Query  556   RSMNLSVVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKDT---ALQMINSW  711
              + +LSV         F    ++SY +DLR YLPE VT GF+ +TG+      L +INSW
Sbjct  211   STKDLSVFLTYDDIPVFTGSPNLSYTVDLRDYLPEWVTVGFSASTGRHNESFQLHVINSW  270

Query  712   IFTSALDISENQADTKSTgkglviglvvggcfliggSMAFS--FLAWRKRKMREEFDDDI  885
              F+S+L++  + ++T        + + +        +   +  +L +RKR  R + DD  
Sbjct  271   AFSSSLELGNSNSETGEDKNNTGLVVGLVVGAGALVAAGLTVVWLVFRKRLNRGKDDDYD  330

Query  886   FGNI-------GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESY  1044
               ++        E   G GPKRF Y+EL+R+TN+FS++ KLGEGGFG VY+G+L +L S 
Sbjct  331   SEDVILDDTMDDEFEKGTGPKRFLYKELSRSTNNFSEEGKLGEGGFGGVYRGFLSDLNSD  390

Query  1045  VAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSH  1224
             VA+KRVS+GSKQG+KEY SEV++ISR+RHKNLV L+GWCH+  +LLLVYEF+ NGSLDSH
Sbjct  391   VAIKRVSKGSKQGVKEYMSEVKIISRLRHKNLVQLVGWCHQRSELLLVYEFMPNGSLDSH  450

Query  1225  LYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGL  1404
             L+  K LLTW +RY I   LASALLYLHE  E+C++HRDIKSSN+MLDSN NAKLGDFGL
Sbjct  451   LFGTKGLLTWEVRYNIALGLASALLYLHELWEQCVIHRDIKSSNVMLDSNFNAKLGDFGL  510

Query  1405  ARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAE  1584
             ARLVDH +G++TT LAGTMGY+A ECV++GKASKE+D+YSFG+V LEIACGR+P+D  AE
Sbjct  511   ARLVDHGEGAQTTMLAGTMGYMAPECVITGKASKESDVYSFGVVALEIACGRRPVDSKAE  570

Query  1585  ECHVNIVDWVWKLYGTGQLLDAADPNLSG-DFNGREVEQMMIVGLWCAHPDCSLRPSIRQ  1761
             E  V +++WVW+ YG G+L++AAD  L    F+ +++E +MIVGLWCAHPD +LRPSIRQ
Sbjct  571   EGKVRLLEWVWEFYGQGKLVEAADSRLLNLGFDEKQLECLMIVGLWCAHPDYNLRPSIRQ  630

Query  1762  AIQVLNFEAPLPDLPETMPVATFW  1833
             A+ VL+FEAPLP LP  MPV T++
Sbjct  631   ALNVLSFEAPLPVLPSKMPVPTYF  654



>ref|XP_010646858.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Vitis vinifera]
Length=1001

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/614 (53%), Positives = 418/614 (68%), Gaps = 18/614 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSI-QITPNQ-----RNCIGRATYSEPL  192
             ++P  + +SF+F  F P N+ +I FE  +     + Q+T NQ      +  GRA+Y+EP+
Sbjct  339   LLPHANSISFSFSGFQP-NMPDIFFENDAFATGGLLQVTKNQVDDSLTSSTGRASYAEPV  397

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWD  TG+L++F THF+F I +   + YGDG + FLAP  SRIPP+++ GG   L +  
Sbjct  398   RLWDASTGRLTNFTTHFSFAIKAVNDSVYGDGLSLFLAPFDSRIPPDSS-GGYLALFSAK  456

Query  373   ERLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
                N+S N  +AVEFD   + +D    HVGI+++S+ SV    W   I+ G  + AW++Y
Sbjct  457   SAFNTSQNKIIAVEFDSRQDEWDPSSDHVGININSIISVQKVQWKSSIKNGSRANAWVSY  516

Query  550   DPRSMNLSVVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             +  + NLSV         F     +SY++DL K LPE +  GF+ ATG+   L  + SW 
Sbjct  517   NSATKNLSVFLTYADNPVFSGNSTLSYVVDLTKVLPEWIRVGFSAATGESIELHTVYSWE  576

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGN  894
             F S L+ S  +        GLV+ LVV    L  GS  + F+ WRKR    + D  +   
Sbjct  577   FESTLEASGGKGKKS---FGLVVALVVTIGVLTCGSGGYWFIWWRKRVGPRKEDMALELA  633

Query  895   IG-ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRG  1071
             I  E   G GPKRFTYREL+ AT +FS++ KLGEGGFG VYKG L + ++ VAVKRVSRG
Sbjct  634   IDDEFEKGTGPKRFTYRELSHATKNFSEEGKLGEGGFGGVYKGLLSDSKTEVAVKRVSRG  693

Query  1072  SKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLT  1251
             SKQG KEY SEV++ISR+RH+NLV LIGWCHE+ +LLLVYEF+ NGSLD+HL+ G S LT
Sbjct  694   SKQGKKEYVSEVKIISRLRHRNLVQLIGWCHEHGELLLVYEFMPNGSLDTHLFGGNSTLT  753

Query  1252  WPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKG  1431
             W +RYKI   LAS+LLYLHEE E+C+VHRDIKSSNIMLDSN NAKLGDFGLAR VDHE G
Sbjct  754   WTVRYKIALGLASSLLYLHEEWEQCVVHRDIKSSNIMLDSNFNAKLGDFGLARFVDHELG  813

Query  1432  SRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDW  1611
             S+TT LAGTMGY+A ECV +GKASKE+D+YSFG+V LEI CGR+P++P AE     +V+W
Sbjct  814   SQTTVLAGTMGYLAPECVTTGKASKESDVYSFGVVALEITCGRRPVEPRAEPSKTRLVEW  873

Query  1612  VWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAP  1791
             VW LYG GQL +A D  LS +F+ R++E +M VGLWC HPD + RPSIRQ I VL+FEAP
Sbjct  874   VWSLYGKGQLFEAVDKGLSMEFDQRQMECLMTVGLWCCHPDSTHRPSIRQVINVLSFEAP  933

Query  1792  LPDLPETMPVATFW  1833
             LP+LP TMPV  ++
Sbjct  934   LPNLPMTMPVPMYF  947


 Score =   177 bits (448),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 99/248 (40%), Positives = 143/248 (58%), Gaps = 14/248 (6%)
 Frame = +1

Query  31   IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSI-QITPNQ-----RNCIGRATYSEPL  192
            ++P  + +SF+F  F P N+ +I FE  S     + Q+T NQ      + IGRA+Y+EP+
Sbjct  36   LLPHANSISFSFSGFQP-NMPDIFFENDSFATGGLLQVTKNQVDDSLTSSIGRASYAEPV  94

Query  193  HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
            HLWD  TG+L+ F THF+F I +   + YGDG + FLAP  SRIPP+++ GG   L +  
Sbjct  95   HLWDASTGRLTDFTTHFSFAIKAVNDSVYGDGLSLFLAPFDSRIPPDSS-GGYLALFSAK  153

Query  373  ERLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
               N+S N  VAVEFD   + +D    HVGI+++S+ SV    W   I+ G  + AW++Y
Sbjct  154  SAFNTSQNKIVAVEFDSRQDEWDPSSDHVGININSIISVQKVQWKSSIKNGSRANAWVSY  213

Query  550  DPRSMNLSVVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
            +  + NLSV         F     +SY++DL K LPE +  GF+ ATG+   L  + SW 
Sbjct  214  NSATKNLSVFLTYADNPVFSGNSTLSYVVDLTKVLPEWIRVGFSAATGESIELHTVYSWE  273

Query  715  FTSALDIS  738
            F S L+ S
Sbjct  274  FESTLEAS  281



>ref|XP_009412467.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Musa acuminata subsp. malaccensis]
Length=685

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/620 (50%), Positives = 404/620 (65%), Gaps = 26/620 (4%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQNITFERTSLV-NNSIQITPNQ-----RNCIGRATYSEPLH  195
             +PL   LSFNF  F  S+   I  +R + V N+ IQ+T NQ      +  GRA Y EPL 
Sbjct  20    VPLATSLSFNFSSFDQSSRSKIQLQRDAYVANDRIQLTKNQLDGSITSSGGRAVYGEPLL  79

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             LWD  T +L+ F T F F I+    +  GDG AFFL+   S IPPN+  GG  GL N   
Sbjct  80    LWDPETRELTDFTTRFVFAINGLNESSTGDGVAFFLSSYPSAIPPNSL-GGSLGLFNSTP  138

Query  376   RLNSS--NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
                +S  N  VAVEFD + N +DT   H+GIDV+S+ S     W  +I  G    AW++Y
Sbjct  139   LPANSTINNTVAVEFDTFKNDFDTSANHIGIDVNSVNSSAVVDWRSNITDGREVNAWVSY  198

Query  550   DPRSMNLSVVFRNFG-----SYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             +  + NLSV F  +      S   +SY++DLR  LPE+V  GF+ ATG       + SW 
Sbjct  199   NASTHNLSV-FMTYAQDAGSSNSSLSYVIDLRDVLPEKVAVGFSAATGSGIETHALLSWS  257

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMRE-------EF  873
             F S+L  +   A  KS    +V  ++     ++    +   +  R+   R+       EF
Sbjct  258   FNSSLLPTPLAAKRKSKMGLVVGVVIGAAVLMVVLG-SLGLILRRRTSGRDAEDEEELEF  316

Query  874   DDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAV  1053
             D ++     E     GPKRF Y+ELA AT +FS+++KLGEGGFGSVY+GYLK+ +  VA+
Sbjct  317   DRNM---DDEFERERGPKRFAYQELADATRNFSEEEKLGEGGFGSVYRGYLKDSKFEVAI  373

Query  1054  KRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYK  1233
             KR+SRGSKQG KEY SEV++ISR+RH+NLV L+GWCH+  +  LVYEF+ NGSLDS+LY 
Sbjct  374   KRISRGSKQGRKEYVSEVKIISRLRHRNLVQLVGWCHDRGEFSLVYEFMPNGSLDSYLYS  433

Query  1234  GKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARL  1413
                LL WP R+++   LASALLYLHEE E+C+VHRD+K SN+MLDS  NAKLGDFGLARL
Sbjct  434   TARLLEWPARHRVALGLASALLYLHEEWEQCVVHRDVKPSNVMLDSAFNAKLGDFGLARL  493

Query  1414  VDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECH  1593
             VDH++GS+TT LAGTMGY+A ECV +GKASKETD+YSFGI+ LEIACGR+P+    +   
Sbjct  494   VDHDRGSQTTVLAGTMGYLAPECVTTGKASKETDVYSFGILALEIACGRRPVQLMEQASK  553

Query  1594  VNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQV  1773
             V +V+WVW+LYG  +LL+AAD  L G F+ +++E +M+VGLWCAHPD   RPSI+Q I V
Sbjct  554   VRLVEWVWELYGRRRLLEAADEKLGGVFDEKQMECLMVVGLWCAHPDYDRRPSIKQVINV  613

Query  1774  LNFEAPLPDLPETMPVATFW  1833
             LN EAPLP+LP +MPV  ++
Sbjct  614   LNLEAPLPELPPSMPVLMYY  633



>ref|XP_009364824.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1 
[Pyrus x bretschneideri]
Length=690

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/619 (52%), Positives = 419/619 (68%), Gaps = 36/619 (6%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQRN-----CIGRATYSEPLHLWD  204
             V+  SFN   F  +  ++IT++  +  +   IQ+T NQ +       GRA++++P+HL+D
Sbjct  32    VNSFSFNISSFD-TTTKDITYQGDAFPSRGVIQLTKNQVDGPLTESAGRASFAQPVHLYD  90

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
               TG+L+ F THF FV+ +    +YGDG +FFLAPL S+IP N+T GG  GL + +   N
Sbjct  91    ASTGRLTDFTTHFTFVMKALDDTRYGDGISFFLAPLDSKIPENST-GGYLGLFSSNSNFN  149

Query  385   SS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
             S+ N  VAVEFD + N +D    HVGI+V+S+ SV    W   I+ G  + AW++Y+  S
Sbjct  150   STKNQIVAVEFDSFKNSWDPSPDHVGINVNSVVSVANISWKTTIKNGSVANAWVSYNSTS  209

Query  562   MNLSVVFRNFGSYGH----------VSYILDLRKYLPERVTFGFAGATGKDTALQMINSW  711
              NLSV    F +Y            VSYI+DLRK LPE V+ GF+ ATG+   +  I SW
Sbjct  210   QNLSV----FLTYSKNPEFSAGDCSVSYIIDLRKVLPELVSVGFSAATGEWVEIHNILSW  265

Query  712   IFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKR--KMREEFD---  876
              F+S L+IS N    +    G+ +G   G      G   F F++ RKR  K+ E +D   
Sbjct  266   SFSSTLEISSNNEAERQIRIGVGLGAGFGFLSCGLG--LFWFISSRKRAKKINEAYDISM  323

Query  877   DDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVK  1056
             DD      E   G GP+RFTYREL RATN+F++  KLGEGGFG VYKG L E  + VAVK
Sbjct  324   DD------EFDKGTGPRRFTYRELNRATNNFAEGGKLGEGGFGGVYKGLLTESNTEVAVK  377

Query  1057  RVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKG  1236
             RVSRGS+QG KEY +EVR+ISR+RH+NLV LIGWCHE  + LLVYE + NGSLDSHL+  
Sbjct  378   RVSRGSRQGKKEYIAEVRIISRLRHRNLVQLIGWCHEQGEFLLVYEIMPNGSLDSHLFGM  437

Query  1237  KSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLV  1416
             K  LTW +R+KI   LASA+LYLHEE E+C+VHRDIKSSN+MLD+N NAKLGDFGLARLV
Sbjct  438   KLHLTWTVRHKIALGLASAILYLHEEWEQCVVHRDIKSSNVMLDANFNAKLGDFGLARLV  497

Query  1417  DHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHV  1596
             DH  GS+TT LAGTMGY+A ECV  G+ASKE+D+YSFG+V LEI+CGR+P++  AE   V
Sbjct  498   DHGLGSQTTVLAGTMGYLAPECVTDGRASKESDVYSFGVVALEISCGRRPVEAKAEPSRV  557

Query  1597  NIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVL  1776
              +V+WVW LYG  Q+L+A D  L+ +F+ +++E +M VGLWC HPD ++RPSIRQ I VL
Sbjct  558   RLVEWVWDLYGKDQILEAVDERLNKEFDEQQIECLMTVGLWCCHPDPTVRPSIRQVINVL  617

Query  1777  NFEAPLPDLPETMPVATFW  1833
             NFEAP+P LP  +PV  ++
Sbjct  618   NFEAPMPSLPSKLPVPMYF  636



>ref|XP_003631707.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Vitis vinifera]
Length=675

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/620 (52%), Positives = 413/620 (67%), Gaps = 29/620 (5%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVN--NSIQITPNQRNCI-----GRATYSEP  189
             I P    LSFNF  F P+N Q I+FE  +  +  + IQ+T NQ++       GRA Y E 
Sbjct  32    IFPSATSLSFNFTTFEPNNGQ-ISFEGEARYSSYDGIQLTRNQQDKTMGHSWGRAIYKEQ  90

Query  190   LHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAND  369
             L+LWD+ +  L+ F T+F+FVI+S   + + DG  FFL   G+++P +   G   GL N 
Sbjct  91    LYLWDRTSRNLTDFATNFSFVINSLNRSVHADGITFFLN--GTQLP-SGKFGENLGLTN-  146

Query  370   DERLNSSNP----FVAVEFDVYLNH--YDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGS  531
                 N +N     FVAVEFD + N    D    HVGID++S  SV T  WS +IE G  +
Sbjct  147   ----NVTNTTVIRFVAVEFDTFCNKAKRDPVSDHVGIDINSTISVKTVNWSSNIEEGKLN  202

Query  532   EAWINYDPRSMNLSVVF-----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQ  696
                I Y   S NLSVV       +  +   +SY +DLR+YLPE VT GF+GATG    + 
Sbjct  203   HVSIRYTSGSQNLSVVLITEFMDDKTTSQSLSYKVDLREYLPEFVTIGFSGATGNSFQIH  262

Query  697   MINSWIFTSALDISE--NQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREE  870
              I SW F+S L         D K TG  + + + V       G +       R     E 
Sbjct  263   NIYSWNFSSTLQPPNPVEPGDGKKTGFVVGLSVGVVVVVCGLGLVWHHLRKKRNSGGEEN  322

Query  871   FDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVA  1050
               D       +   G GP++F++ ELA AT++F++++KLGEGGFG VY+G+L+EL SYVA
Sbjct  323   GTDSDLVMDEDFEKGTGPRKFSFDELALATSNFAEEEKLGEGGFGGVYRGFLRELNSYVA  382

Query  1051  VKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLY  1230
             VKRVSRGSKQG+KEYA+EV++ISR+RH+NLV L+GWCH+  +LLLVYEF+ NG+L S L 
Sbjct  383   VKRVSRGSKQGMKEYAAEVKIISRLRHRNLVRLMGWCHKKGELLLVYEFMPNGNLSSCLL  442

Query  1231  KGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLAR  1410
             + K+LLTW +RYKI   LAS+LLYLHEE E+C+V RDIKSSN+MLDS+ NAKLGDFGLAR
Sbjct  443   EEKTLLTWAMRYKIALGLASSLLYLHEEWEQCVVRRDIKSSNVMLDSDFNAKLGDFGLAR  502

Query  1411  LVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEEC  1590
             LVDH KGS+TT LAGTMGY+  EC+++GKASKETD+YSFGIV LEI CGR+P++P A+E 
Sbjct  503   LVDHSKGSQTTVLAGTMGYMDPECLLTGKASKETDVYSFGIVALEICCGRRPVEPKAKEK  562

Query  1591  HVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQ  1770
              V +V+WVW LYG G+L+DAADP LS DF+  ++E++MIVGLWCAHPDC LRPSIRQAI 
Sbjct  563   QVRLVEWVWHLYGVGKLVDAADPRLSNDFDEEQMERLMIVGLWCAHPDCDLRPSIRQAIN  622

Query  1771  VLNFEAPLPDLPETMPVATF  1830
             VLN EA LP LP  MPV  +
Sbjct  623   VLNSEASLPLLPLKMPVPMY  642



>ref|XP_010273740.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
isoform X2 [Nelumbo nucifera]
Length=659

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/630 (49%), Positives = 420/630 (67%), Gaps = 35/630 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNF--------DLFTPSNVQNITFERTSLVNNSIQITPNQRNCIGRATYSE  186
             +IP  +PLSFNF        D+        I+++      N   ++ N  +C GRA++  
Sbjct  31    LIPSANPLSFNFSGSDQSTRDIIRLEGHAAISYKDIDFTEN---LSINNASC-GRASFKN  86

Query  187   PLHLWDKPTGKLSSFNTHFAFVID-SNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLA  363
             P+HL+D  TG L+ F+T+F+F I  ++      +G AFFLAP GS +P +++ GG  GL 
Sbjct  87    PVHLYDNATGNLTDFSTNFSFSITRTDQEFLIAEGLAFFLAPSGSNLPVDSS-GGALGLV  145

Query  364   NDDE-RLNSSNPFVAVEFDVYLNHYD---------TEQKHVGIDVDSLQSVVTAPW-SPD  510
                +   N+ N  +AVEFD + N +D             HVGID++S++SV TA W S D
Sbjct  146   RYSQMEDNTKNQIIAVEFDTFGNVFDPVPYSENLSRPMYHVGIDINSVKSVTTANWTSND  205

Query  511   IEGGWGSEAWINYDPRSMNLSVVFR-NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDT  687
             I  G  +   INY+  + NLSV +  +      + YI+DLRKYLPE VT GF+ +TG+  
Sbjct  206   IGSGNITWVLINYNSSTKNLSVTWTYSDNPTSSLFYIIDLRKYLPEWVTIGFSSSTGQLK  265

Query  688   ALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAW------R  849
              +  ++SW F S+L++ E+ + ++           +    ++G S A   + W      +
Sbjct  266   EITSVHSWNFYSSLEVEESNSTSEIPKASKTDKRGLIIGLVVGASSALIGVVWLVLWIKK  325

Query  850   KRKMREEFDDDIFGNI--GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGY  1023
             KR + EE D+ +  +    E   G GPKRF Y ELARAT++F++  KLGEGGFG VYKG 
Sbjct  326   KRDVTEEEDEMVLDDSMNDEFEQGTGPKRFLYSELARATDNFAEDQKLGEGGFGGVYKGV  385

Query  1024  LKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLS  1203
             L  L   +AVKRVS+ SKQGIKEY SEV++ISR+RHKNLV L+GWCH+ K+ +LVYEF+ 
Sbjct  386   LSYLNLDIAVKRVSQKSKQGIKEYVSEVKIISRLRHKNLVQLVGWCHQRKEFVLVYEFMP  445

Query  1204  NGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNA  1383
             NGSLD+HL+  ++LLTW  RY I   LASAL YLHEE E+C+VHRDIKSSN+MLDS+ NA
Sbjct  446   NGSLDTHLFGRQALLTWERRYNIALGLASALFYLHEEWEQCVVHRDIKSSNVMLDSDFNA  505

Query  1384  KLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRK  1563
             KLGDFGLARLVDH KGS+TT LAGTMGY+A ECV++GK+SKE+D+YS+GIV LEIACGR+
Sbjct  506   KLGDFGLARLVDHGKGSQTTVLAGTMGYMAPECVITGKSSKESDVYSYGIVALEIACGRR  565

Query  1564  PIDPTAEECHVNIVDWVWKLYGTGQLLDAADPN-LSGDFNGREVEQMMIVGLWCAHPDCS  1740
             PI+P  E   + +V+WVW+L+G G++L+A D   L   F+ +++E +M+VGLWCAHPDC+
Sbjct  566   PIEPCVEASKIRLVEWVWELHGRGKILEAVDSGLLEMGFDEKQMECLMVVGLWCAHPDCN  625

Query  1741  LRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
              RPSIRQAIQVL+FEAPLP LP  MPV T+
Sbjct  626   FRPSIRQAIQVLSFEAPLPTLPSKMPVPTY  655



>ref|XP_010273739.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
isoform X1 [Nelumbo nucifera]
Length=686

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/630 (49%), Positives = 420/630 (67%), Gaps = 35/630 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNF--------DLFTPSNVQNITFERTSLVNNSIQITPNQRNCIGRATYSE  186
             +IP  +PLSFNF        D+        I+++      N   ++ N  +C GRA++  
Sbjct  31    LIPSANPLSFNFSGSDQSTRDIIRLEGHAAISYKDIDFTEN---LSINNASC-GRASFKN  86

Query  187   PLHLWDKPTGKLSSFNTHFAFVID-SNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLA  363
             P+HL+D  TG L+ F+T+F+F I  ++      +G AFFLAP GS +P +++ GG  GL 
Sbjct  87    PVHLYDNATGNLTDFSTNFSFSITRTDQEFLIAEGLAFFLAPSGSNLPVDSS-GGALGLV  145

Query  364   NDDE-RLNSSNPFVAVEFDVYLNHYD---------TEQKHVGIDVDSLQSVVTAPW-SPD  510
                +   N+ N  +AVEFD + N +D             HVGID++S++SV TA W S D
Sbjct  146   RYSQMEDNTKNQIIAVEFDTFGNVFDPVPYSENLSRPMYHVGIDINSVKSVTTANWTSND  205

Query  511   IEGGWGSEAWINYDPRSMNLSVVFR-NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDT  687
             I  G  +   INY+  + NLSV +  +      + YI+DLRKYLPE VT GF+ +TG+  
Sbjct  206   IGSGNITWVLINYNSSTKNLSVTWTYSDNPTSSLFYIIDLRKYLPEWVTIGFSSSTGQLK  265

Query  688   ALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAW------R  849
              +  ++SW F S+L++ E+ + ++           +    ++G S A   + W      +
Sbjct  266   EITSVHSWNFYSSLEVEESNSTSEIPKASKTDKRGLIIGLVVGASSALIGVVWLVLWIKK  325

Query  850   KRKMREEFDDDIFGNI--GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGY  1023
             KR + EE D+ +  +    E   G GPKRF Y ELARAT++F++  KLGEGGFG VYKG 
Sbjct  326   KRDVTEEEDEMVLDDSMNDEFEQGTGPKRFLYSELARATDNFAEDQKLGEGGFGGVYKGV  385

Query  1024  LKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLS  1203
             L  L   +AVKRVS+ SKQGIKEY SEV++ISR+RHKNLV L+GWCH+ K+ +LVYEF+ 
Sbjct  386   LSYLNLDIAVKRVSQKSKQGIKEYVSEVKIISRLRHKNLVQLVGWCHQRKEFVLVYEFMP  445

Query  1204  NGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNA  1383
             NGSLD+HL+  ++LLTW  RY I   LASAL YLHEE E+C+VHRDIKSSN+MLDS+ NA
Sbjct  446   NGSLDTHLFGRQALLTWERRYNIALGLASALFYLHEEWEQCVVHRDIKSSNVMLDSDFNA  505

Query  1384  KLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRK  1563
             KLGDFGLARLVDH KGS+TT LAGTMGY+A ECV++GK+SKE+D+YS+GIV LEIACGR+
Sbjct  506   KLGDFGLARLVDHGKGSQTTVLAGTMGYMAPECVITGKSSKESDVYSYGIVALEIACGRR  565

Query  1564  PIDPTAEECHVNIVDWVWKLYGTGQLLDAADPN-LSGDFNGREVEQMMIVGLWCAHPDCS  1740
             PI+P  E   + +V+WVW+L+G G++L+A D   L   F+ +++E +M+VGLWCAHPDC+
Sbjct  566   PIEPCVEASKIRLVEWVWELHGRGKILEAVDSGLLEMGFDEKQMECLMVVGLWCAHPDCN  625

Query  1741  LRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
              RPSIRQAIQVL+FEAPLP LP  MPV T+
Sbjct  626   FRPSIRQAIQVLSFEAPLPTLPSKMPVPTY  655



>ref|XP_009412463.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Musa acuminata subsp. malaccensis]
Length=691

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/622 (50%), Positives = 410/622 (66%), Gaps = 24/622 (4%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQNITFERTSLV-NNSIQITPNQRN-----CIGRATYSEPLH  195
             +PL   LSFNF  F  S++  I  +R + V N+ IQ+T NQ +       GRA Y EPL 
Sbjct  20    VPLATSLSFNFSSFDQSSLSKIQLQRDAYVANDRIQLTKNQLDGSLISSGGRAVYGEPLL  79

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             LWD  T +L+ F T FAF I+   ++  GDG AFFL+   S IPP  + GGG GL N   
Sbjct  80    LWDPETRELTDFTTRFAFAINGLNASLIGDGVAFFLSSYPSTIPP-ISLGGGLGLFNITP  138

Query  376   RLNSS--NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
                +S  N  VAVEFD Y N +DT   H+GIDV+S+ S     W  +I  G    AW++Y
Sbjct  139   LPANSTINNTVAVEFDTYNNSFDTSANHIGIDVNSVISSKVVDWRSNITDGREVNAWVSY  198

Query  550   DPRSMNLSVVFRNFG-----SYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             +  + NLSV F  +      S   +SY++DLR  LPE+V  GF+ ATG       + SW 
Sbjct  199   NASTHNLSV-FMTYAQDAGSSNSSLSYVIDLRDVLPEKVAVGFSAATGNRIETNALLSWS  257

Query  715   FTSALD----ISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDD  882
             F S+L     +    A  + +  GL +G V+G   L+    +   + WR+R    + +D+
Sbjct  258   FNSSLQPKTTLPAPPAAKRKSKMGLAVGGVIGAAVLMVLLGSLGLILWRRRTTGRDAEDE  317

Query  883   ----IFGNIG-ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYV  1047
                    N+  E     GPKRF Y+ELA AT +FS+++KLGEGGFGSVY+GYLK+ +  V
Sbjct  318   EELEFDRNMDDEFERERGPKRFAYQELADATRNFSEEEKLGEGGFGSVYRGYLKDSKLEV  377

Query  1048  AVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHL  1227
             A+KR+SRGSKQG KEY SEV++ISR+RH+NLV L+GWCH+  +  LVYEF+ NGSLDS+L
Sbjct  378   AIKRISRGSKQGRKEYVSEVKIISRLRHRNLVQLVGWCHDRGEFSLVYEFMPNGSLDSYL  437

Query  1228  YKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLA  1407
             Y    LL WP R+++   LASALLYLHEE E+C+VHRD+K SN+MLDS  NAKLGDFGLA
Sbjct  438   YSTARLLEWPARHRVALGLASALLYLHEEWEQCVVHRDVKPSNVMLDSAFNAKLGDFGLA  497

Query  1408  RLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEE  1587
             RLVDH++GS+TT LAGTMGY+A ECV +GKASKE+D+YSFGI+ LEIACGR+P+    + 
Sbjct  498   RLVDHDRGSQTTVLAGTMGYLAPECVNTGKASKESDVYSFGILALEIACGRRPVQLMEQA  557

Query  1588  CHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAI  1767
               V +V+WVW+LYG  +LL+AAD  L G F+ +++E +M+VGLWCAHPD   RPSI+Q I
Sbjct  558   SKVRLVEWVWELYGRRRLLEAADEKLGGVFDEKQMECLMVVGLWCAHPDYDRRPSIKQVI  617

Query  1768  QVLNFEAPLPDLPETMPVATFW  1833
              VLN EAP P+LP +MPV  ++
Sbjct  618   NVLNLEAPFPELPPSMPVPMYY  639



>gb|EYU18392.1| hypothetical protein MIMGU_mgv1a002656mg [Erythranthe guttata]
Length=649

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/604 (52%), Positives = 404/604 (67%), Gaps = 39/604 (6%)
 Frame = +1

Query  133   IQITPNQR-----NCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAF  297
             IQ+T ++R       +GRATY +PLHLWD+ + K++ F+T F+FVIDS GS   GDG  F
Sbjct  46    IQVTTDERGERLAQLVGRATYIDPLHLWDRASRKIADFSTSFSFVIDSRGSLDLGDGLTF  105

Query  298   FLAPLGSRIPPNATKGGGFGLANDDERLNSSNPFVAVEFDVYLNHYDT-EQKHVGIDVDS  474
             FLAP+GS I P +  G            ++S  FVAVEFD Y N YD  +Q HVGID++S
Sbjct  106   FLAPIGSTIQPWSFGGNLALGNGGVPVNSTSQAFVAVEFDTYQNLYDPPQQTHVGIDINS  165

Query  475   LQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSVVF----RNFGSYGHVSYILDLRKYLP  642
             ++SVVT  W  ++  G  ++AW++Y+  SM L V F    RN    G++SY++D R YLP
Sbjct  166   MKSVVTTKWENNVTLGLQNDAWVSYNGSSMELRVEFTGKSRNGTQRGNLSYMVDFRDYLP  225

Query  643   ERVTFGFAGATGKDTALQMINSW--------------------IFTSALDISENQADTKS  762
             E VT GF+ ATG       + SW                    I +S+L    N      
Sbjct  226   ENVTVGFSAATGDLFETHTVKSWEFYSSSLELAPPPPPPLPPRIVSSSLPPQPNAGGGGG  285

Query  763   TgkglviglvvggcfliggSMAFSFLAWRKRKMRE-EFDDDIFGNIG-----ELGGGAGP  924
                 +V   V     ++    A  FL WRK+K  + E  DD  G+       E   G GP
Sbjct  286   GVGLVVGLSVGLAIVIVSLVFASYFLWWRKKKNNKKEMGDDRAGSFHPHMDIEFQKGCGP  345

Query  925   KRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASE  1104
             K+F+YREL RATN+F++++KLGEGGFG VY+G+L E  SY+AVKRVS GSKQG+KEYASE
Sbjct  346   KKFSYRELVRATNNFAKEEKLGEGGFGGVYRGFLAETNSYIAVKRVSSGSKQGLKEYASE  405

Query  1105  VRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDL  1284
             V++IS++RH+NLV L GWCHE  +LLLVYE+L NGSLDSHL+KG+++L W +RY+I Q +
Sbjct  406   VKIISQLRHRNLVQLHGWCHERGELLLVYEYLPNGSLDSHLFKGQTILPWEVRYRIAQGV  465

Query  1285  ASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMG  1464
             ASALLYLHEE E+ +VHRDIK+SNIMLDSN NAKLGDFGLARLVDHEKGS+TT LAGT G
Sbjct  466   ASALLYLHEEWERAVVHRDIKASNIMLDSNFNAKLGDFGLARLVDHEKGSQTTVLAGTFG  525

Query  1465  YIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTA-EECHVNIVDWVWKLYGTGQL  1641
             Y+A ECVV+G+ASKETDIYS GIV LEIACG++PI  +  +E  + +V+WVW LY +G+L
Sbjct  526   YMAPECVVTGRASKETDIYSLGIVFLEIACGKRPIGRSKDQEKQMVLVEWVWSLYRSGRL  585

Query  1642  LDAADPNLS-GDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAP-LPDLPETM  1815
             ++AADP L+   ++ REVEQ+M VG+WCA P+   RPSIRQ I  L+ EA  +P  P  M
Sbjct  586   IEAADPELAESGYDEREVEQVMAVGMWCARPESDQRPSIRQVINALSSEADVVPGFPPLM  645

Query  1816  PVAT  1827
              V T
Sbjct  646   SVPT  649



>ref|XP_010273726.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Nelumbo nucifera]
Length=679

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/619 (51%), Positives = 410/619 (66%), Gaps = 23/619 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRN-CIGRATYSEPLHLWDK  207
             +IP  +P+SFNF  F      +I  ER + ++ S  I  N+     GRATY +P+ LW+K
Sbjct  30    LIPFSNPISFNFSSFDDKARDSINLERDAKISASQDIQLNEIEWSSGRATYRDPVRLWNK  89

Query  208   PTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNS  387
              TG L+ F T F+F IDS    +Y DG AFFLAP GS +P      G F   ++ + L  
Sbjct  90    ETGTLTDFTTQFSFYIDSLNDERYADGMAFFLAPNGSALPSKCCNMGIFKQYSELDPLE-  148

Query  388   SNPFVAVEFDVYLNHYDTEQK---------HVGIDVDSLQSVVTAPW-SPDIEGGWGSEA  537
              N  VAVEFD Y N +D             HVGID++S +SV TA W S   E G  + A
Sbjct  149   -NQVVAVEFDTYGNEWDPVPSEDNWSFIPYHVGIDINSARSVATANWTSTSFEDGKMTIA  207

Query  538   WINYDPRSMNLSVVFRNFGS-YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
              I+Y+  + NLSV +    +    +S+ +DL+ YLPE V  GF+G+TG+   L ++ SW 
Sbjct  208   NISYNSSTKNLSVSWTYADNPTSSLSFKVDLKNYLPEWVMVGFSGSTGRTGELHVVRSWY  267

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFD-----D  879
             F S+L + E+   +  T     + + V     + G    SF+ W KRK + E +     D
Sbjct  268   FYSSLQV-ESSDSSGGTNWKTKMVVGVVVGASMSGLGVISFILWIKRKRQREEEEEEEED  326

Query  880   DIFGNI--GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAV  1053
              +FGN    E   G GPKRF Y EL RATN+F++  KLGEGGFG VYKG+L +L   +AV
Sbjct  327   MVFGNSINEEFERGIGPKRFLYGELVRATNNFAEGRKLGEGGFGGVYKGFLSDLNMEIAV  386

Query  1054  KRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYK  1233
             KR+S+ SKQGIKEY SEV++IS++RHKNLV L+GWCH+ K+LLLVYEF+ NGSLDSHL+ 
Sbjct  387   KRISQRSKQGIKEYMSEVKIISQVRHKNLVQLVGWCHQRKELLLVYEFMPNGSLDSHLFG  446

Query  1234  GKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARL  1413
              K  L W +RYKI   LASAL YLHEE E+CIVHRDIKSSN+MLD+N NAKLGDFGLARL
Sbjct  447   QKEPLGWEVRYKIALGLASALFYLHEEWEQCIVHRDIKSSNVMLDANFNAKLGDFGLARL  506

Query  1414  VDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECH  1593
             VDH + ++TT LAGTMGY+A ECV +GK+SKE+D+YSFGIV LEIACGR+PI+P  E   
Sbjct  507   VDHGQRAQTTVLAGTMGYMAPECVATGKSSKESDVYSFGIVALEIACGRRPIEPWLETNK  566

Query  1594  VNIVDWVWKLYGTGQLLDAADPNLSG-DFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQ  1770
             V +++WVW+LYG   L++  DP L+   F+ ++++ +M+VGLWCAHPD +LRPSI+Q + 
Sbjct  567   VRLIEWVWELYGREMLVEGIDPRLTNMGFDEKQLKCLMVVGLWCAHPDSNLRPSIKQVML  626

Query  1771  VLNFEAPLPDLPETMPVAT  1827
             VL+FEAPLP LP  MPV T
Sbjct  627   VLSFEAPLPTLPPKMPVPT  645



>ref|XP_003530584.2| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Glycine max]
 gb|KHN08935.1| L-type lectin-domain containing receptor kinase IX.1 [Glycine 
soja]
Length=678

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/610 (51%), Positives = 411/610 (67%), Gaps = 17/610 (3%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFERTSLVNNSI-QITPNQRN-----CIGRATYSEPLHLWD  204
             V  LSFNF  F P++   I F+  +  +  + Q+T NQ +      +GRA+Y++ + LWD
Sbjct  35    VECLSFNFSTFQPNSNNLIDFKGDAFSSRGVLQLTKNQIDDKITFSVGRASYNQQVRLWD  94

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
             + T KL+ F THF+FV+ +    ++GDG AFF+AP  S IP N+  GG  GL +++   N
Sbjct  95    RRTKKLTDFTTHFSFVMKAVDPKRFGDGLAFFIAPFDSVIPNNSA-GGYLGLFSNESAFN  153

Query  385   -SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
                N  VAVEFD + N +D    HVGIDV+S+QSV    W   I+ G  + AWI Y+  +
Sbjct  154   MKKNQLVAVEFDSFENEWDPSSDHVGIDVNSIQSVTNVSWKSSIKNGSVANAWIWYNSTT  213

Query  562   MNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
              NLSV         F     +SY++DLR  LPE V  GF+ ATG    +  I SW F+S 
Sbjct  214   KNLSVFLTYADNPTFNGNSSLSYVIDLRDVLPELVRIGFSAATGSWIEVHNILSWSFSSN  273

Query  727   LDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG-E  903
             LD  +N+   K      +   +      + G + F+F  WR++   +E +  +  +I  E
Sbjct  274   LD-GDNRKKVKVGLVVGLSVGLGCCLVCVVGLLWFTF--WRRKNKGKEENLGVDASIDDE  330

Query  904   LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQG  1083
                G GPKRFTYREL+ ATN+F+++ KLGEGGFG VYKG +      VAVKRVS+GSKQG
Sbjct  331   FERGTGPKRFTYRELSNATNNFAEEGKLGEGGFGGVYKGLVVNSNLEVAVKRVSKGSKQG  390

Query  1084  IKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLR  1263
              KEY SEVRVISR+RH+NLV LIGWCHE  +LLLVYE++ NGSLDSH++  + +L+W +R
Sbjct  391   KKEYVSEVRVISRLRHRNLVQLIGWCHEQGELLLVYEYMPNGSLDSHIFGNRVMLSWVVR  450

Query  1264  YKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTT  1443
             +K+   LASALLYLHEE E+C+VHRDIKSSN+MLD+N NAKLGDFGLARLVDHE GS+TT
Sbjct  451   HKVALGLASALLYLHEEWEQCVVHRDIKSSNVMLDANFNAKLGDFGLARLVDHELGSQTT  510

Query  1444  ALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKL  1623
              LAGTMGY+A ECV +GK+SKE+D+YSFG+V LEI CGRKP++   E   V +V+WVW L
Sbjct  511   VLAGTMGYLAPECVTTGKSSKESDVYSFGVVALEITCGRKPVEVREEPSKVRLVEWVWSL  570

Query  1624  YGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDL  1803
             YG G+LL+AAD  L+ +F  +++E +MIVGLWC HPD ++RPSIRQ I VLN EAPLP L
Sbjct  571   YGKGKLLEAADKKLNWEFEEQQMECLMIVGLWCCHPDHTMRPSIRQVISVLNLEAPLPSL  630

Query  1804  PETMPVATFW  1833
             P  +PV  ++
Sbjct  631   PSKLPVPMYY  640



>ref|XP_007159175.1| hypothetical protein PHAVU_002G215400g [Phaseolus vulgaris]
 gb|ESW31169.1| hypothetical protein PHAVU_002G215400g [Phaseolus vulgaris]
Length=668

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/631 (50%), Positives = 422/631 (67%), Gaps = 35/631 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPN---QRN--CIGRATYSEPL  192
             IIPL + LSF +  F   +V+   +E   S++  +IQ+T N   Q N   +GR T  E +
Sbjct  26    IIPLANSLSFYYPNFKNGDVK---WEGDASILKGAIQVTSNTIDQNNNYSVGRVTSYEQM  82

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWD  +GKL+ F T F+FVI S  S  YGDG +FFLA     +  +  +GGG GL + +
Sbjct  83    LLWDMKSGKLADFTTKFSFVIFSEKSY-YGDGMSFFLADPNLPLLKDIKEGGGLGLVDGE  141

Query  373   ERLNSS-NPFVAVEFDVYLNH-YDTEQ-KHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWI  543
             + LNS+ +PFVAVEFD + N  +D     HVG++ +S++S +T  W  D++        I
Sbjct  142   QVLNSTQHPFVAVEFDTFHNKLWDPPGGTHVGLNFNSMKSNITKSWLTDVQIWNVYNCSI  201

Query  544   NYDPRSMNLSVVFRNFGSYG----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSW  711
              Y+  ++NLSV F  +        +VSY +DLR +LP RV  GF+ ATGK   +  + SW
Sbjct  202   KYNSSTLNLSVSFTMYNDSKPLEEYVSYKVDLRDHLPGRVILGFSAATGKLYEVHTLRSW  261

Query  712   IFTSALDISENQADTK---------------STgkglviglvvggcfliggSMAFSFLAW  846
              F+S L   EN  + K                  +  V   +  G  L    + F+ L  
Sbjct  262   SFSSNLQSDENTNEIKPEAVPPDSYLMPEKGKKIELRVGLGIGLGLVLSLSGLIFTLLWK  321

Query  847   RKRKMREEFDDDIFGNIGEL-GGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGY  1023
             R R  ++E   ++  N+G++   G GPK F+Y ELA ATN FS+ +KLG+GGFG VYKGY
Sbjct  322   RSRGRKKELVFNL--NMGDVFPKGTGPKSFSYNELASATNKFSESEKLGQGGFGGVYKGY  379

Query  1024  LKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLS  1203
             LK+++SYVA+KR+SR S+QG+KEY +EV+VIS++RH+NLV LIGWCHE  D +LVYEF+ 
Sbjct  380   LKDIKSYVAIKRISRESRQGMKEYVTEVKVISQLRHRNLVQLIGWCHEKNDFILVYEFMP  439

Query  1204  NGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNA  1383
             NGSLDSHLY+ KS LTW +RY I   LASALLYL EE E+C++HRDIKSSNIMLDS+ NA
Sbjct  440   NGSLDSHLYEVKSFLTWIVRYNIALGLASALLYLQEEWEQCVIHRDIKSSNIMLDSSFNA  499

Query  1384  KLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRK  1563
             KLGDFGLARLVDHEKGS+TT +AGT GYIA E   SGKA+KE+DIYSFG+V LEI  GRK
Sbjct  500   KLGDFGLARLVDHEKGSQTTHIAGTRGYIAPEYFTSGKATKESDIYSFGVVLLEITSGRK  559

Query  1564  PIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSL  1743
              ++  AEE  + +V+WVWKLYG G+LL+AADP L G+F+ ++++++++VGLWC HPD S 
Sbjct  560   SVELEAEEGQITLVEWVWKLYGLGRLLEAADPKLCGEFDEKQMKRLVVVGLWCVHPDYSF  619

Query  1744  RPSIRQAIQVLNFEAPLPDLPETMPVATFWP  1836
             RPSIRQ IQVL F++PLP LPE MPV T+ P
Sbjct  620   RPSIRQVIQVLKFDSPLPILPEMMPVPTYLP  650



>ref|XP_010090632.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis]
 gb|EXC36488.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis]
Length=683

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/622 (50%), Positives = 415/622 (67%), Gaps = 43/622 (7%)
 Frame = +1

Query  46    HPLSFNFDLFTPSNVQNITFERTSLVNNSI-QITPNQR-----NCIGRATYSEPLHLWDK  207
             H L FNF  F P N  +ITF+  +  ++ + Q+T NQ        IGRA+YS+P+ LWD 
Sbjct  20    HTLFFNFTTFQP-NTLHITFQGDAFQSSGVLQLTKNQALGSLAYSIGRASYSKPVRLWDA  78

Query  208   PTGKLSSFNTHFAFVIDS-NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
              TG+L+ F THF+F++ + +  A  GDG +FFLAP  S +P N++ GG   L + +   N
Sbjct  79    ATGRLTDFTTHFSFIMQALDVEAGSGDGISFFLAPFNSDVPNNSS-GGFLALFSPETAFN  137

Query  385   SS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPW-SPDIEGGWGSEAWINYDPR  558
             +S N  VAVEFD + + +D +  HVGI+V+S+ SV    W    ++ G  + AW++Y+  
Sbjct  138   ASENQIVAVEFDSFADPWDPKADHVGINVNSIVSVKNVTWPQSSMKNGSIANAWVSYNSS  197

Query  559   SMNLSVVFRNFGSYGH---------VSYILDLRKYLPERVTFGFAGATGKDTALQMINSW  711
             + NLSV    F +Y H         +S+I+DLR+ LP+ V  GF+ ATGK   +  + SW
Sbjct  198   TKNLSV----FLTYAHDPIFQGQYNLSHIVDLREILPQEVRIGFSAATGKHIEIHNVLSW  253

Query  712   IFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREE-----FD  876
              F+S+L++   +          +   +                 WRK+  +EE     +D
Sbjct  254   SFSSSLEVGGGK--------RRLALGIGLALGFGVLGCGLGLACWRKKSGKEEQKHGYYD  305

Query  877   DDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELES--YVA  1050
               I    GE   G GPKRFTY+EL+RATN F+++ KLGEGGFG VYKG L +  S   +A
Sbjct  306   PSI---DGEFEKGTGPKRFTYKELSRATNDFAEEGKLGEGGFGGVYKGLLSDQNSNIEIA  362

Query  1051  VKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLY  1230
             VKRVSRGSKQG KEY +EV++ISR+RH+NLV LIGWCHE  DL+LVYEFL NGSLD+HL+
Sbjct  363   VKRVSRGSKQGKKEYIAEVKIISRLRHRNLVQLIGWCHEQGDLILVYEFLPNGSLDTHLF  422

Query  1231  KGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLAR  1410
               + +L W +R+KI   LASALLYLHEECEKC+VHRDIKSSNIMLD+N NAKLGDFGLAR
Sbjct  423   GKRKVLKWAIRHKIALGLASALLYLHEECEKCVVHRDIKSSNIMLDTNFNAKLGDFGLAR  482

Query  1411  LVDH-EKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEE  1587
             LVDH E GS+TT LAGTMGY+A ECV  G ASKETD+YSFG+V LEI+CGR+P+DP AE 
Sbjct  483   LVDHDELGSQTTVLAGTMGYLAPECVTIGMASKETDVYSFGVVALEISCGRRPVDPKAEP  542

Query  1588  CHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAI  1767
               + +V+WVW LYG GQ+L A D  L  +F+  ++E++M+VGLWC HPD ++RPSI Q I
Sbjct  543   SKIRLVEWVWDLYGKGQILQAVDEGLKTEFDETQIERLMVVGLWCVHPDPTIRPSIMQVI  602

Query  1768  QVLNFEAPLPDLPETMPVATFW  1833
              VLNF+APLP LP  MPVA ++
Sbjct  603   NVLNFQAPLPRLPPKMPVAMYF  624



>gb|KDP41147.1| hypothetical protein JCGZ_03641 [Jatropha curcas]
Length=639

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/604 (51%), Positives = 407/604 (67%), Gaps = 24/604 (4%)
 Frame = +1

Query  88    VQNITFERTSL-VNNSIQITPNQ-----RNCIGRATYSEPLHLWDKPTGKLSSFNTHFAF  249
             + +I+F+  S   NN +Q+T N       + +GRA+Y  P+ +WD  T KL+ F THF+F
Sbjct  1     MADISFQGDSFPSNNVLQLTKNAIDDNLMSSVGRASYKYPVRIWDAKTRKLTDFTTHFSF  60

Query  250   VIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNS--SNPFVAVEFDVY  423
             ++ +    + GDG +FF+AP  S IP N++ GG   L + D    +   N  VAVEFD +
Sbjct  61    IMKAVDPNRVGDGISFFMAPFNSEIPNNSS-GGFLALFSPDSAFGALKKNQIVAVEFDSF  119

Query  424   LNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSVVFR-----N  588
              N +D    HVGI V+S+ SV    W   I+ G  + AW++Y+  + NLSV         
Sbjct  120   ENTWDPSDDHVGIIVNSIVSVTNVTWKSSIKNGSKANAWVSYNSTTRNLSVFLSYAENPK  179

Query  589   FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTKSTg  768
             F     +SYI+DLR +LPE V  GF+ +TG+      I SW F S L+I++   + K   
Sbjct  180   FSGNSSLSYIVDLRDFLPEWVRIGFSASTGRWVETHNILSWDFDSNLEINKKPKEKKGLI  239

Query  769   kglviglvvggcfliggSMAFSFLAWRK--RKMREEFDDDIFGNIGELGGGAGPKRFTYR  942
              GL  GL + GC          F  W+K  R   E+  +D+  +  E   G GPKRFTYR
Sbjct  240   VGLAGGLGLLGCG----LCLLGFFCWKKWYRNRNEDEGEDVMDD--EFEKGTGPKRFTYR  293

Query  943   ELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISR  1122
             EL+RATNSFS+  KLGEGGFG VY+G L E  + VAVK+VS+GS+QG KEY SEV++ISR
Sbjct  294   ELSRATNSFSEGGKLGEGGFGGVYRGLLTESNTPVAVKKVSKGSRQGKKEYISEVKIISR  353

Query  1123  IRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLY-KGKSLLTWPLRYKIVQDLASALL  1299
             +RH+NLV LIGWCHE ++ LLVYEF+ NGSLDSHL+ +  ++LTW +RYKI   LASALL
Sbjct  354   LRHRNLVQLIGWCHEKREFLLVYEFMPNGSLDSHLFGRSTTILTWSIRYKIALGLASALL  413

Query  1300  YLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALE  1479
             YLHEE E+C+VHRDIKSSN+MLDSN NAKLGDFGLARLVDHE GS+TT LAGTMGY+A E
Sbjct  414   YLHEEWEQCVVHRDIKSSNLMLDSNFNAKLGDFGLARLVDHELGSQTTVLAGTMGYLAPE  473

Query  1480  CVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADP  1659
             CV +GKASKE+D+YSFG+V LEI CGR+P+D   E   V +V+WVW LYG GQ+++A D 
Sbjct  474   CVTTGKASKESDVYSFGVVALEITCGRRPVDAKQEANKVRLVEWVWDLYGKGQIIEAMDK  533

Query  1660  NLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW-P  1836
              L  +F+ R++E +MIVGLWC HPD +LRPSIRQ I +LNFEAPLP+LP  +PV  ++ P
Sbjct  534   RLREEFDERQLECLMIVGLWCCHPDFNLRPSIRQVINILNFEAPLPNLPSKLPVPMYYAP  593

Query  1837  QRNV  1848
               N+
Sbjct  594   PMNI  597



>ref|XP_010096782.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis]
 gb|EXB65804.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis]
Length=750

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/630 (50%), Positives = 416/630 (66%), Gaps = 38/630 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNI-TFERTSLVNNSIQIT-PNQRNCIGRATYSEPLHLWD  204
             +IP   PL FNF  F   +   + T    + + + I++T  N+ + IGR TY E LHLWD
Sbjct  22    VIPFSTPLEFNFPEFGEQHKSKLRTQGNITYLGSEIELTTANKTDQIGRVTYLEALHLWD  81

Query  205   KPTGK--LSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
               TG   ++ F T F+F++ ++     GDG AFFLA     IP   T G G GL + +ER
Sbjct  82    NSTGSAVVADFTTDFSFIVHADKKPN-GDGIAFFLAQPPYDIP-KVTDGSGIGLVSSEER  139

Query  379   LNSSNPFVAVEFDVYLNH-YDTEQ--KHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
              ++S   VA+EFD   N  +D E   +HVGIDV+S++S  T  WS DI       A I+Y
Sbjct  140   ESTSYSLVAIEFDTLRNQDFDPEDLDEHVGIDVNSVKSKRTTRWSCDITSWNIYNATISY  199

Query  550   DPRSMNLSVVFRNFGSYGHVS----YILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
             + R  NLSV+F  +     V     Y +DL  YLPE V+FGF+ A G  T+  ++ SW F
Sbjct  200   NSRRKNLSVLFTGYEEKVPVQQQLFYEIDLAFYLPELVSFGFSAANGLFTSRHILRSWSF  259

Query  718   TSALDISE---NQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMRE-------  867
              S   +++     +D+K TG  + + +      +    +    + W+KR  +E       
Sbjct  260   KSHDFVTKPGKESSDSKKTGLVVGLSVGAFVILVTVLCL-IGLVLWKKRTKKEIGDDDDD  318

Query  868   -------EFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYL  1026
                      DDD   N       +G +RF+Y EL  ATN+F++++KLG+GGFG VY+G+L
Sbjct  319   DDLVFDLYMDDDFERN-------SGARRFSYDELLVATNNFAEEEKLGQGGFGGVYRGFL  371

Query  1027  KELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSN  1206
             K L SYVA+K+VS  S QG+KEYASEV++IS++RH+NLV LIGWCH  KDLLL+YEF+ N
Sbjct  372   KSLNSYVAIKKVSSVSNQGVKEYASEVKIISQLRHRNLVQLIGWCHRKKDLLLIYEFMPN  431

Query  1207  GSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAK  1386
             GSLDSHL+K KS+LTW  RY I + +ASALLYLH+E E+C++HRDIK+SNIMLDSN NAK
Sbjct  432   GSLDSHLFKRKSVLTWATRYNIARGMASALLYLHQEWEQCVLHRDIKASNIMLDSNFNAK  491

Query  1387  LGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKP  1566
             LGDFGLARLVDH+KGS+TTALAGT+GY+A ECV +G+AS+E+DIYSFG+V LEIACGRK 
Sbjct  492   LGDFGLARLVDHDKGSQTTALAGTLGYMAPECVTTGRASRESDIYSFGVVALEIACGRKA  551

Query  1567  IDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLR  1746
             I+P   E    IV+ VW LYG  ++L+AADP L G FN +++E++MIVGLWCAHPD  LR
Sbjct  552   IEPNEREDETIIVESVWDLYGADKILEAADPTLCGAFNEQQMERLMIVGLWCAHPDHKLR  611

Query  1747  PSIRQAIQVLNFEAPLPDLPETMPVATFWP  1836
             PSI+QAI VL+FEAPLP LP  MP+ ++ P
Sbjct  612   PSIKQAIHVLDFEAPLPVLPSHMPLPSYLP  641



>ref|XP_002527242.1| kinase, putative [Ricinus communis]
 gb|EEF35168.1| kinase, putative [Ricinus communis]
Length=637

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/596 (52%), Positives = 403/596 (68%), Gaps = 19/596 (3%)
 Frame = +1

Query  88    VQNITFERTSLVNNSI-QITPNQ-----RNCIGRATYSEPLHLWDKPTGKLSSFNTHFAF  249
             + +I+F+  +  + S+ Q+T N      R+ +GRATY  P+ LWD  T KL+ F THF+F
Sbjct  1     MADISFQGDAFSSRSVLQLTRNAKDDNLRSSVGRATYKNPVRLWDVKTRKLTDFTTHFSF  60

Query  250   VIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS--NPFVAVEFDVY  423
              + +    ++GDG +FF+AP  S+IP N++ GG   L + D   ++S  N  VAVEFD +
Sbjct  61    TMKAIDQNRFGDGISFFIAPFDSQIPDNSS-GGFLALFSPDSAFSASRENQIVAVEFDSF  119

Query  424   LNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSVVF---RN--  588
              N +D    HVGI V+S+ SV    W   I+ G  + AWI+Y+  + NLSV     +N  
Sbjct  120   ENPWDPSDNHVGIIVNSIISVTNITWKSSIKNGSVANAWISYNSTTKNLSVFLTYAKNPV  179

Query  589   FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTKSTg  768
             F     +SYI+DLR +LPE V  GF+ +TG    +  I SW FTS L+I+     TKS  
Sbjct  180   FSGNSSLSYIIDLRDFLPEWVRVGFSASTGSWVEIHNILSWNFTSTLEINRK---TKSKT  236

Query  769   kglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG-ELGGGAGPKRFTYRE  945
               +V           G  +   F+ WRKR      ++ + G++  E   G GPKRFTYRE
Sbjct  237   SLVVGLASGSVLLASGIGV-LCFVYWRKRSGGGNEEEIVDGSMDDEFEKGTGPKRFTYRE  295

Query  946   LARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRI  1125
             L  AT++FS+  KLGEGGFG VYKG L   ++ VAVK+VSRGSKQG KEY SEV++ISR+
Sbjct  296   LTHATSNFSEAGKLGEGGFGGVYKGLLSGSKTEVAVKKVSRGSKQGRKEYVSEVKIISRL  355

Query  1126  RHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYL  1305
             RH+NLV LIGWCHE  + LLVYEF+ NGSLD+ L+ G ++L W +RYKI   LASALLYL
Sbjct  356   RHRNLVQLIGWCHERNEFLLVYEFMPNGSLDTRLFGGVTMLIWSVRYKIALGLASALLYL  415

Query  1306  HEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECV  1485
             HEE E+C+VHRDIKSSN+MLDSN NAKLGDFGLARLVDHE GS+TT LAGTMGY+A ECV
Sbjct  416   HEEWEQCVVHRDIKSSNVMLDSNFNAKLGDFGLARLVDHELGSQTTVLAGTMGYLAPECV  475

Query  1486  VSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNL  1665
              +GKASKE+D+YSFG+V LEI CGR+P+D   E   V +V+WVW LYG GQL++A D  L
Sbjct  476   TTGKASKESDVYSFGVVALEITCGRRPVDVRQEPDKVRLVEWVWDLYGKGQLVEAVDKRL  535

Query  1666  SGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW  1833
             S +F+ R++E +MIVGLWC HPD + RPSIRQ I VLNFEAPLP LP  +PV  ++
Sbjct  536   SREFDERQLECLMIVGLWCCHPDFNHRPSIRQVINVLNFEAPLPSLPAKLPVPMYY  591



>ref|XP_008244616.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Prunus mume]
Length=651

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/624 (49%), Positives = 399/624 (64%), Gaps = 25/624 (4%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPN------QRNCIGRATYSEPLHL  198
             P V  L F+F  F  +    ++ E  + ++    +         +   +GRATYS+P  L
Sbjct  13    PCVTSLDFSFSTFR-NGKNTVSLEGDARIDGEFLLLTKSAVDDVKEQSVGRATYSQPFLL  71

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
              D  TGKL+   T+F FVIDS G   Y DG AFF+AP GS +     +GG  GLA ++ +
Sbjct  72    RDNATGKLADLTTNFTFVIDSQGKTPYADGLAFFIAPNGSLLNSTLGRGGNLGLAVENPQ  131

Query  379   LNSSN---PFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
              N+S    PFVAVEFD+Y +      D    HVGID  +L+S +T  W+  I  G  + A
Sbjct  132   NNTSKSQYPFVAVEFDIYQDEVTSIDDPMGDHVGIDSSTLKSQMTTAWNGSIAEGRVNSA  191

Query  538   WINYDPRSMNLSVVFRNFGSYGHVSYILD----LRKYLPERVTFGFAGATGKDTALQMIN  705
              I+Y+  +  + VVF ++     +   LD    L   L   V  GF+ AT  +TAL  IN
Sbjct  192   GISYNSTTNGIHVVFTSYVDGVQMMRYLDCEVPLDNILQGWVIVGFSAATDANTALHKIN  251

Query  706   SWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFS-----FLAWRKRKMREE  870
             SW F S     E   +T       +   +V    + G  +        F+ W+KR   E 
Sbjct  252   SWSFHSTQLFDEKPKNTTPKSGNGINIRLVLELGIGGLVLGGGLGLVWFICWKKRG--ES  309

Query  871   FDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVA  1050
              D+D+     E   G GPK+F+YR+LA++T++F +  KLGEGGFG VY+GY+K+L   VA
Sbjct  310   SDEDVTVIDEEFEKGTGPKKFSYRKLAQSTSNFHEGQKLGEGGFGGVYRGYIKDLNLNVA  369

Query  1051  VKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLY  1230
             VKR+S GS+QG+KEYA+EVR+ISR+RH+NLV LIGWCHE K LLLVYEF+SNGS  SHL+
Sbjct  370   VKRISSGSRQGLKEYAAEVRIISRLRHRNLVQLIGWCHERKQLLLVYEFMSNGSFFSHLF  429

Query  1231  KGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLAR  1410
             K KSLL W  RY+I Q LAS L YLHEE E+C++HRD+KSSNIMLDSN N KLGDFGLAR
Sbjct  430   KAKSLLAWDARYRIAQGLASGLFYLHEEWEQCVLHRDVKSSNIMLDSNFNPKLGDFGLAR  489

Query  1411  LVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEEC  1590
             LVDH K S TT LAGTMGY+A E + +GKASKETD+YS+G+V LEIACGRKP D      
Sbjct  490   LVDHGKQSETTVLAGTMGYMAPEYMTTGKASKETDVYSYGVVALEIACGRKPNDLEFRSR  549

Query  1591  HVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQ  1770
              + +V+WVW LYG G++++AADP LSGDF  R++E ++IVGLWCAHPD  +RPSI+Q IQ
Sbjct  550   QITMVEWVWDLYGEGRVIEAADPKLSGDFEKRQMECLLIVGLWCAHPDYKIRPSIQQTIQ  609

Query  1771  VLNFEAPLPDLPETMPVATFWPQR  1842
             VLNFE PLP LP  MPVA++   R
Sbjct  610   VLNFEVPLPILPSKMPVASYSSPR  633



>ref|XP_009412464.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=662

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/613 (50%), Positives = 403/613 (66%), Gaps = 20/613 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPN-QRNCIGRATYSEPLHLWD  204
             +IP+   LSFNF  F       I F+   SL++  + +T +  +  +GRA Y EPL LWD
Sbjct  19    VIPMASSLSFNFSGFDNETTSKIEFQGDASLLDKEVHLTSSPMQYSVGRAVYREPLRLWD  78

Query  205   KPTGKLSSFNTHFAFVIDSNGS-AKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
               T +L+ F THF+FVI+S+     +GDG AFFL    S +P   ++G   GL ++    
Sbjct  79    ATTRELADFTTHFSFVINSSDPLTPHGDGLAFFLTAYPSTLPA-YSRGAFLGLFSNSSVD  137

Query  382   NSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
             +S    VAVEFD + N +D    HVGID+DS+ S     W+  ++ G  + AW +YD  +
Sbjct  138   SSRVSTVAVEFDTFPNGWDPLADHVGIDIDSITSSAAVQWNSSLKDGRRASAWASYDAAT  197

Query  562   MNLSVVF---RN--FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
              NLSV     RN  F     + +I+DLR  LPE V  GF+ +TG  T    + SW F S 
Sbjct  198   HNLSVFLSYERNPAFSGNSSLHFIVDLRDVLPEMVAIGFSASTGNLTETHSLLSWSFNST  257

Query  727   LDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIGEL  906
             L         K T  GL IGL VG   L+  S    F+  +K+       +    +  E+
Sbjct  258   LQ------PRKQTKAGLEIGLGVGVGVLVAVSGLIWFVFSKKKASSTNLKEAEDIDCDEI  311

Query  907   GGGA-----GPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRG  1071
                      GPKRF Y ELA A  +FS++ KLGEGGFGSVYKGYLK+ +  VA+KRVSRG
Sbjct  312   IDDEFERERGPKRFPYEELASAARNFSKEGKLGEGGFGSVYKGYLKDPKLDVAIKRVSRG  371

Query  1072  SKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLT  1251
             SKQG KEY SEV++ISR+RH+NLV L+GWCH+ ++ LLVYE + NGSLDS+LY  K  L 
Sbjct  372   SKQGRKEYVSEVKIISRLRHRNLVQLVGWCHDRREFLLVYELMPNGSLDSYLYTTKKTLQ  431

Query  1252  WPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKG  1431
             WP+R+KI   LASALLYLHEE E+C+VHRDIK SN+MLDS  NAKLGDFGLARLVDH+  
Sbjct  432   WPVRHKIALGLASALLYLHEEWEQCVVHRDIKPSNVMLDSAFNAKLGDFGLARLVDHDSH  491

Query  1432  SRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDW  1611
             S+TT LAGTMGY+A ECV +GKASKE+D+YSFGIV LEIACGR+P++P  ++  V +V+W
Sbjct  492   SQTTVLAGTMGYLAPECVTTGKASKESDVYSFGIVALEIACGRRPVEPMEQKGKVRLVEW  551

Query  1612  VWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAP  1791
             VW+LYG G++L+AAD  L G+F+ +++  +M+VGLWCAHPDC++RPSIRQAI VLNFE P
Sbjct  552   VWELYGWGRVLEAADGKLDGEFDEKQMACLMVVGLWCAHPDCTMRPSIRQAINVLNFETP  611

Query  1792  LPDLPETMPVATF  1830
              P+LP  MPV  +
Sbjct  612   WPELPPKMPVPMY  624



>ref|XP_010273784.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Nelumbo nucifera]
Length=695

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/635 (49%), Positives = 422/635 (66%), Gaps = 37/635 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNN--SIQITP------NQRNCIGRATYSE  186
             +IP V+PLSFNF     +    I  ER +  ++  +I++T       + +   GRA+Y +
Sbjct  33    LIPSVNPLSFNFSSSNRTTRDIINLERDATFSDQGTIELTEFSSASGSTQYSSGRASYKD  92

Query  187   PLHLWDKPTGKLSSFNTHFAFVIDS-NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLA  363
             P+ LWD  TG L+ F THF+F ++  NGS    DG A FLAP GS IP ++  GG  GL 
Sbjct  93    PVRLWDNKTGILTDFTTHFSFTLNRMNGSRTIADGLALFLAPNGSTIPHDS-GGGALGLF  151

Query  364   NDDERLNSS-NPFVAVEFDVYLNHYDT-----------------EQKHVGIDVDSLQSVV  489
             ++D  LN + N  +AVEFD + N +D                     HVGIDV+S+ SV 
Sbjct  152   SNDLALNKTKNRIIAVEFDTWGNDWDPVPYNHTSEGPRNPSFEDPPYHVGIDVNSIDSVK  211

Query  490   TAPWSPDIEGGWGSEAWINYDPRSMNLSVVFRNFG--SYGHVSYILDLRKYLPERVTFGF  663
             TA W+  IE G  +  WI+Y+  + NLSV +  +G  S   +SY +DLR+YLPE +T G 
Sbjct  212   TATWTNSIEYGKTTSTWISYNSSTKNLSVSW-TYGDNSSSSLSYRIDLRQYLPEWITIGL  270

Query  664   AGATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAF-SFL  840
             +G+TG       I SW F S+L++ E+   T S  +  ++  +V G   + G+M F  F+
Sbjct  271   SGSTGLSGLRHQIYSWEFNSSLEVEESNPATTSNVRKAMMVGIVVGTSFLMGAMGFLCFV  330

Query  841   AWRK--RKMREEFDDDIFGNI--GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGS  1008
              W K  R+  E+ DD    +    E   G GPKRF   ELARATN F ++ KLGEGGFG 
Sbjct  331   LWTKMKRERMEKEDDSTLDDFMNDEFEKGTGPKRFLCGELARATNDFREEQKLGEGGFGG  390

Query  1009  VYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLV  1188
             VYKG+L +L   VAVK+VS+ SKQGIKEY SEV++IS++RHKNLV LIGWCH+ K+ LLV
Sbjct  391   VYKGFLTDLNMDVAVKKVSQRSKQGIKEYMSEVKIISQLRHKNLVQLIGWCHQRKEFLLV  450

Query  1189  YEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLD  1368
             YEF+SNGSLD +L+  K LL W +RYKI  +LASAL YLHEE ++C+VHRDIK SN+MLD
Sbjct  451   YEFMSNGSLDKYLFGQKGLLVWEIRYKIALELASALFYLHEEWKQCVVHRDIKPSNVMLD  510

Query  1369  SNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEI  1548
             SN NAKLGDFGLARL++H++G +TT LAGT+GY+A ECV++G++SKE+D+YS+GIV LEI
Sbjct  511   SNFNAKLGDFGLARLIEHDQGPQTTVLAGTLGYMAPECVITGRSSKESDVYSYGIVVLEI  570

Query  1549  ACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNL-SGDFNGREVEQMMIVGLWCA  1725
             AC R+  +   E   + +V+WVW+LYG G LL+A D  L +  F+ +++E +M VGLWCA
Sbjct  571   ACCRRSAEIVLEGSKIRLVEWVWELYGKGCLLEAVDWRLMNTGFDVKQMECLMAVGLWCA  630

Query  1726  HPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             HPD +LRPSI++A+QVL+FEAPLP LP  MPV T+
Sbjct  631   HPDSNLRPSIKKAMQVLSFEAPLPILPSKMPVPTY  665



>ref|XP_008367553.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Malus domestica]
Length=672

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/617 (51%), Positives = 402/617 (65%), Gaps = 41/617 (7%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPN-----QRNCIGRATYSEPLHLWDKP  210
             PLSFNF  F P    N+  E  +  +   +++T +     Q    GRATYS+P  L +  
Sbjct  20    PLSFNFSSF-PXXXXNLXJEGDAXXDGXFLRLTXSAXDXXQXXSXGRATYSQPFLLRENA  78

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS  390
             TGKL+ F T+F FVI S  +  Y DG AFFLAP GS +      GG  GL       N S
Sbjct  79    TGKLADFTTNFTFVIXSK-TPYYADGLAFFLAPNGSSLNTXVGXGGSLGLPVXXPLNNES  137

Query  391   N---PFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
                 PFVAVEFD++ N+     D    H+GID++S+ S V  PW+  I  G  + A I Y
Sbjct  138   TNLYPFVAVEFDIFXNNXTXXXDPVGDHIGIDINSVNSKVXXPWNGSITTGGENNARIRY  197

Query  550   DPRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
             D  S  LSV + +F +    + ++SYI+DL  YL   V  GF+ ATG  TAL  INSW F
Sbjct  198   DSGSKILSVXYTSFVNGVPVWXNISYIVDLNXYLQGYVXVGFSAATGXXTALHKINSWNF  257

Query  718   TSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFD------D  879
             +S     EN+ +                  +  GS +   L W   K     D      +
Sbjct  258   SSTELRDENEFNNSXX--------------VXXGSTSDWLLGWLXGKXGXSSDXEXPXXN  303

Query  880   DIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKR  1059
             D      E   G GPK+F+Y+ LA +T +F + +KLGEGGFG VY+G++ +L+SYVAVKR
Sbjct  304   DXIDE--EFEKGTGPKKFSYKXLAXSTGNFDEGEKLGEGGFGGVYRGFIXDLDSYVAVKR  361

Query  1060  VSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGK  1239
              S GS QG+KEYA+EVR+ISR+RH+NLV LIGWCHE  +LLLVYEF+SNGSLDSHL+K K
Sbjct  362   XSSGSXQGMKEYAAEVRIISRLRHRNLVQLIGWCHEKXELLLVYEFMSNGSLDSHLFKPK  421

Query  1240  SLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVD  1419
             ++L W  RY+I Q LAS L YLHEE E+C++HRDIKSSNIMLDSN NAKLGDFGLARLVD
Sbjct  422   TVLHWEARYRIAQGLASGLXYLHEEWEQCVLHRDIKSSNIMLDSNFNAKLGDFGLARLVD  481

Query  1420  HEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVN  1599
             H K S+TT LAGTMGY+A EC  +GKASKETD+YSFG+V LEIACGRKPIDP      +N
Sbjct  482   HGKQSQTTVLAGTMGYMAPECXTTGKASKETDVYSFGVVALEIACGRKPIDPKLGXTQIN  541

Query  1600  IVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLN  1779
             +V+WVW LYG G++++AADP L G+F+ +++E ++IVGLWCAHPD ++R SI+Q IQVLN
Sbjct  542   MVEWVWXLYGEGKIIEAADPKLCGEFDAKQMECLLIVGLWCAHPDYTMRXSIQQTIQVLN  601

Query  1780  FEAPLPDLPETMPVATF  1830
             FE PLP LP  MPVA++
Sbjct  602   FEVPLPILPSKMPVASY  618



>gb|KHN46235.1| L-type lectin-domain containing receptor kinase IX.1 [Glycine 
soja]
Length=895

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/629 (50%), Positives = 407/629 (65%), Gaps = 34/629 (5%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPN---QRN--CIGRATYSEPL  192
             IIPL + LSF++  F   +V+   +E   S++  +IQ+T N   Q N   +GR T  + +
Sbjct  27    IIPLANSLSFDYPNFKNGDVK---WEGDASILKGAIQVTSNTMDQNNNYSVGRVTSYKKM  83

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWD  TGKL+ F T F+FV+ S G + YGDG AFFLA     +  N  +GGG GL +  
Sbjct  84    LLWDMNTGKLADFTTKFSFVVFS-GKSYYGDGMAFFLADPNLPLLKNIREGGGLGLVDGK  142

Query  373   ERLNSSNPFVAVEFDVYLNHYDTEQ-KHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
             + LNS+ PFVAVEFD + N +D +   HVG++ +S++S +T  W  DI+        I Y
Sbjct  143   QVLNSTQPFVAVEFDTFHNKWDPQGGTHVGLNFNSMRSNITKQWLTDIQIWNVYNCSIEY  202

Query  550   DPRSMNLSVVFRNFGSYG-----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             +  ++NLSV F  + +       ++SY +DLR YLP +V  GF+ ATGK   +  + SW 
Sbjct  203   NSSTLNLSVSFTTYNNVSKPVEEYISYKVDLRDYLPGKVILGFSAATGKLYEVHTLRSWS  262

Query  715   FTSALDISENQADTKSTgkglviglvvggcfl--------------iggSMAFSFLAW-R  849
             F S+L   EN  + K                               +G       L W R
Sbjct  263   FNSSLQSDENTNEIKPVAAPPTSNPASENEHKIGLWVGIGIGVGLVLGLLGLICALLWKR  322

Query  850   KRKMREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLK  1029
              R  + E   D+     E   G GPK F Y EL  ATN F++  KLG+GGFG VYKGYLK
Sbjct  323   SRDKKGELVFDL-NMADEFPKGTGPKSFCYNELVSATNKFAE--KLGQGGFGGVYKGYLK  379

Query  1030  ELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNG  1209
             +L+SYVA+KR+S+ S+QG+KEY +EV+VIS++RH+NLV LIGWCH   D LL+YEF+ NG
Sbjct  380   DLKSYVAIKRISKESRQGMKEYVTEVKVISQLRHRNLVQLIGWCHRKNDFLLIYEFMPNG  439

Query  1210  SLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKL  1389
             SLDSHLY  KS LTW +RY I   LASALLYL EE E+C++HRDIKSSNIMLDS  NAKL
Sbjct  440   SLDSHLYGVKSFLTWTVRYNIALGLASALLYLQEEWEQCVIHRDIKSSNIMLDSCFNAKL  499

Query  1390  GDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPI  1569
             GDFGLARLVDHEKGS+TT +AGT GYIA E   SGKA+KE+DIYSFG+V LEIA GRKP+
Sbjct  500   GDFGLARLVDHEKGSQTTRIAGTRGYIAPEYFTSGKATKESDIYSFGVVLLEIASGRKPV  559

Query  1570  DPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRP  1749
             +  AEE  + +V+WVWKLYG G+ L+AADP L G+F+  ++E+++IVGLWC HPD S RP
Sbjct  560   ELEAEEGQITVVEWVWKLYGLGRFLEAADPKLCGEFDENQMERLVIVGLWCVHPDYSFRP  619

Query  1750  SIRQAIQVLNFEAPLPDLPETMPVATFWP  1836
             SIRQ IQVL FE+ LP LPE MPV T+ P
Sbjct  620   SIRQVIQVLKFESALPILPEMMPVPTYLP  648


 Score =   273 bits (699),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 171/245 (70%), Gaps = 15/245 (6%)
 Frame = +1

Query  1015  KGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYE  1194
             + Y K L SY A+KR+S GS Q +KEYA EV +IS++RH NLV L GWCH+  DL L+YE
Sbjct  665   RSYFKGLNSYAAMKRISAGSAQSLKEYAEEVTIISQLRHMNLVKLAGWCHKKNDLFLIYE  724

Query  1195  FLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSN  1374
             ++ NGSLDS L+ G+  L W +RY +   LASA LYL EECEK + HR+IKSSNIM+DSN
Sbjct  725   YMPNGSLDSCLFGGEKFLPWKVRYNVALGLASAWLYLQEECEKFVFHREIKSSNIMVDSN  784

Query  1375  LNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIAC  1554
              +AKLGDFGLAR VDHEKGS+++                G  S+E+D +SFG+V LE+A 
Sbjct  785   FSAKLGDFGLARQVDHEKGSQSSV---------------GVGSEESDTFSFGVVLLEVAT  829

Query  1555  GRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPD  1734
             GRK I     E  V++V+W W+ +G   LL AADPNL  +F+ ++ E +++VGLWCA+PD
Sbjct  830   GRKAIHHKDMEGGVSLVEWAWEHHGLRNLLAAADPNLCAEFDVQQTECLLVVGLWCANPD  889

Query  1735  CSLRP  1749
             C+ RP
Sbjct  890   CASRP  894



>ref|XP_003562911.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Brachypodium distachyon]
Length=690

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/617 (48%), Positives = 401/617 (65%), Gaps = 20/617 (3%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSN---VQNITFERTSLVNNSIQITPNQRN-----CIGRATYSEP  189
             I  V PLSF  + FT SN   +  I F+  +  N +I++T ++ N      +GRA Y++P
Sbjct  23    IARVSPLSFKLN-FTESNNNALAAIQFQDDAFYNKAIRLTKDELNNDITYSVGRAVYTDP  81

Query  190   LHLWDKPTGKLSSFNTHFAFVID-SNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAN  366
             + LWD  TG+L+ F T F F+I  ++ S   G+G AFFL+P  S IP ++T G     +N
Sbjct  82    VPLWDSATGQLADFTTRFTFMIAATDRSNSTGEGLAFFLSPYPSVIPNSSTDGFLGLFSN  141

Query  367   DDERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWIN  546
              + + + SN  VAVEFD + N +D +  HVGID+ S+ SV    W   I  G  + AW+ 
Sbjct  142   SNGQNDPSNELVAVEFDSHKNTWDPDDNHVGIDIHSIVSVANRTWISSINDGRIANAWVT  201

Query  547   YDPRSMNLSVVFRNFGSYGH-----VSYILDLRKYLPERVTFGFAGATGKDTALQMINSW  711
             Y   SMNLSV      +  H     +SY +DLRKYLP++V  GF+ ATG+   L  I  W
Sbjct  202   YQASSMNLSVFLTYLDNPQHSGNSSLSYSVDLRKYLPDKVAIGFSAATGRSVELHQILYW  261

Query  712   IFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFG  891
              F S  D+   + + K+     +         +    + +  L +R R+ ++E +  +  
Sbjct  262   EFDST-DLQLMKTE-KTRSILAISLGTSISVVVCSMGLVWYLLHFRSRRSKKEREKKLDY  319

Query  892   NIG---ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRV  1062
             N+    E   G GP+RF Y EL  AT +F  + KLGEGGFG+VY+G+LK+    VA+KRV
Sbjct  320   NVSIDCEFEKGRGPRRFRYNELVGATKNFVLERKLGEGGFGAVYQGFLKDQNLDVAIKRV  379

Query  1063  SRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKS  1242
             ++GS QG KEY SEV++IS++RH+NLV L GWCHE  + LLVYEF+ N SLD+HLY   +
Sbjct  380   AKGSTQGRKEYISEVKIISQLRHRNLVQLEGWCHERGEFLLVYEFMPNRSLDTHLYDNSN  439

Query  1243  LLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDH  1422
             LLTWPLR+K+   +ASALLYLHEE E+C+VHRD+K SN+MLDS  NAKLGDFGLARLVDH
Sbjct  440   LLTWPLRFKVTIGVASALLYLHEEWEQCVVHRDVKPSNVMLDSAFNAKLGDFGLARLVDH  499

Query  1423  EKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNI  1602
             ++ S+TT LAGTMGY+A ECV +GKASKE+D+YSFGI+ LEIACGR+P+    E+  + +
Sbjct  500   DRASQTTVLAGTMGYMAPECVTTGKASKESDVYSFGILALEIACGRRPVVLKEEDNKIRL  559

Query  1603  VDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNF  1782
             V WVW LYG  ++L+A D  L G F  REV  +M+VGLWCAHPD +LRPSIRQ I VL F
Sbjct  560   VQWVWDLYGRNEILNAVDGRLDGAFEEREVLCLMVVGLWCAHPDYNLRPSIRQVISVLKF  619

Query  1783  EAPLPDLPETMPVATFW  1833
             EAPLP LP  MPVA ++
Sbjct  620   EAPLPSLPAKMPVAMYF  636



>emb|CAN76415.1| hypothetical protein VITISV_038497 [Vitis vinifera]
Length=665

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/615 (51%), Positives = 415/615 (67%), Gaps = 24/615 (4%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLV----NNSIQITPNQR-----NCIGRATYSEP  189
             P    LSFNF  F  SN  NI+F+         +  IQ+T N++     N  GRA YSE 
Sbjct  31    PSATSLSFNFSSF-GSNNHNISFDEAGDAVYSSDGCIQLTRNEKDMQANNSWGRAMYSER  89

Query  190   LHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAND  369
             L+LWD+ +  L+ F ++F+FVI+S G + + DG  FFL   G+++  +   G   GLA +
Sbjct  90    LYLWDQTSRNLTDFTSNFSFVINSQGDSLHADGLTFFLN--GTQLHTDML-GETLGLAKE  146

Query  370   DERLNSSN-PFVAVEFDVYLN--HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAW  540
                 N S   F+AVEFD + N    D E +H+GID++S+ SV T  WS +IE G  +   
Sbjct  147   KNETNKSAVTFIAVEFDTFTNAAKRDPEGEHIGIDINSMISVKTVNWSSNIEKGKLNHVS  206

Query  541   INYDPRSMNLSVVF-----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMIN  705
             I+Y   S NLSVV       +  +   +SY +DLR+YLPE VT GF+G+TG    +  I 
Sbjct  207   ISYTSSSHNLSVVLITEVTDSTNTTQSLSYKVDLREYLPEYVTMGFSGSTGTYFQINKIC  266

Query  706   SWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKM---REEFD  876
             SW F+S L+   +    K    GLV+GL V    ++GG     F  WRKR     +E+  
Sbjct  267   SWNFSSTLEPPSSVEPGKGKKTGLVVGLSVCAFVVVGGFGLAWFYLWRKRNTGRDQEDGG  326

Query  877   DDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVK  1056
             D       +   G GP++F++ ELA AT +FS+  KLGEGGFG VY+G+L+EL SYVAVK
Sbjct  327   DSDLAMDEDFEKGTGPRKFSFNELALATTNFSEGQKLGEGGFGGVYRGFLRELNSYVAVK  386

Query  1057  RVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKG  1236
             RV+R S+QG+KEYASEV++  R+RH+NLV L+GWCH+  +LLLVYE L NGSL + L++ 
Sbjct  387   RVTRNSQQGMKEYASEVKIFCRLRHRNLVQLMGWCHKKGELLLVYELLPNGSLSTCLFEE  446

Query  1237  KSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLV  1416
             K+LLTW +RY+I   LAS+LLYLHEE E+C+VHRDIKSSN+MLDS+ NAKL DFGLARLV
Sbjct  447   KTLLTWAMRYRIALGLASSLLYLHEEWEQCVVHRDIKSSNVMLDSDFNAKLRDFGLARLV  506

Query  1417  DHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHV  1596
             DH KGS+TT LAGTMGY+A EC ++GKASKE+D+YSFGIV LEI CGR+ ++  AEE  +
Sbjct  507   DHGKGSQTTVLAGTMGYMAPECFMTGKASKESDMYSFGIVALEICCGRRAVETKAEENQI  566

Query  1597  NIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVL  1776
              +V+WVW LYG G+LL+A DP LS D++ +++E++MIVGLWCAHPDC+ RPS+R+A+ VL
Sbjct  567   RLVEWVWDLYGVGKLLEATDPRLSADYDDQQMERLMIVGLWCAHPDCNARPSMREAMSVL  626

Query  1777  NFEAPLPDLPETMPV  1821
             N EA LP LP  MPV
Sbjct  627   NSEALLPLLPIKMPV  641



>ref|XP_004494968.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cicer arietinum]
Length=672

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/623 (49%), Positives = 401/623 (64%), Gaps = 35/623 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPNQRN-----CIGRATYSEPL  192
             II  V PLSF+++        ++  E   SL+   IQ+T   R       +GR T  EP+
Sbjct  19    IITSVKPLSFHYN--QSFKYDDVKLEGDASLLYPYIQLTATSRYQSNAYSVGRVTSFEPV  76

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWD+ + KL+ F T F+F I SN +  +GDG AFF A     +  +  +GGG GL NDD
Sbjct  77    QLWDRTSRKLTDFTTQFSFTIFSNETG-FGDGLAFFFADPKLPLHNHIQQGGGLGLVNDD  135

Query  373   ERLNSSN-PFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
             + +NS+   FVAVEFD + N +D    HVGI+ +S++S +T PW  DI         I Y
Sbjct  136   QIMNSTEYSFVAVEFDTHQNSWDPSGTHVGINFNSMKSQITKPWFIDIRNKKTYYCKIEY  195

Query  550   DPRSMNLSVVFRNFGSYG------HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSW  711
             +  + NL V F      G      ++SY +DLR YLP++V FGF+ ATG    +  + SW
Sbjct  196   NSSAHNLKVSFTGNIINGKPIKKSYLSYNVDLRDYLPDKVIFGFSAATGYMFEMNTLKSW  255

Query  712   IFTSALD------------------ISENQADTKSTgkglviglvvggcfliggSMAFSF  837
              F S L                   IS      K T    +   VV     +     F  
Sbjct  256   SFNSTLQSHHDNIPQIANPAPSPIKISPKIDSNKGTIWIGLGVGVVVASSFLILGW-FCI  314

Query  838   LAWRKRKMREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYK  1017
             L W++ KM++E          E   G GPKRF Y +LA ATN+F +  K+G+GGFG VYK
Sbjct  315   LMWKRAKMKKEDSTFDLKMDDEFQKGTGPKRFCYNKLASATNNFEESQKIGQGGFGVVYK  374

Query  1018  GYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEF  1197
             GYLK+++S VA+KR+SR SKQGIKEYA+EV++IS++RH+NLV LIGWCH  KDLLL+YEF
Sbjct  375   GYLKDIDSNVAIKRISRESKQGIKEYATEVKIISQLRHRNLVQLIGWCHRKKDLLLIYEF  434

Query  1198  LSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNL  1377
             + NGSLDSHLY+GKS+LTW +RY I  DLASALLYLHEE E+C++HRDIKSSNIMLDSN 
Sbjct  435   MQNGSLDSHLYRGKSVLTWHMRYNIAMDLASALLYLHEEWEQCVLHRDIKSSNIMLDSNF  494

Query  1378  NAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACG  1557
             NAK+GDFGLARLVDHEKGS+TT +AGTMGY+A E   +GKA+KE+DIYSFGIV+LE+  G
Sbjct  495   NAKVGDFGLARLVDHEKGSQTTVIAGTMGYLAPEYFTTGKATKESDIYSFGIVSLELVSG  554

Query  1558  RKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDC  1737
             RKP+D  A+E  + I DWVW+LY  G+ ++  D  L G F+  ++E++++VGLWCA+P+ 
Sbjct  555   RKPVDLNAKEDQMAIYDWVWELYRLGRFVEVVDTKLGGVFDEMKMERLVVVGLWCANPNY  614

Query  1738  SLRPSIRQAIQVLNFEAPLPDLP  1806
             SLRPS+RQ IQVL FEA LP LP
Sbjct  615   SLRPSVRQLIQVLKFEAALPILP  637



>ref|XP_004301118.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Fragaria vesca subsp. vesca]
Length=662

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/595 (53%), Positives = 411/595 (69%), Gaps = 40/595 (7%)
 Frame = +1

Query  166   GRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKY-GDGFAFFLAPLGSRIPPNATK  342
             GRATY E   L    TGKL+ F + F F I S+G + +  DG AFFLAP GS +     +
Sbjct  27    GRATYKETFLLRQNSTGKLADFTSSFTFAIQSDGRSNFPADGLAFFLAPAGSSLDSILGQ  86

Query  343   GGGFGLANDDERLNSSN--------PFVAVEFDVYLNHYDTEQK---------HVGIDVD  471
             G   GL  ++   N +         PFVAVEFD++LN  D+  +         HVGID++
Sbjct  87    GCSLGLPVNNSLENYTKSGILYFEYPFVAVEFDIFLN-VDSGNRSIDLGLNYTHVGIDIN  145

Query  472   SLQSVVTAPWSP-DIEGGWGSEAWINYDPRSMNLSVVFRNFGS----YGHVSYILDLRKY  636
             SL+S VTAPW   +I  G  + A I+Y+  S NLSV F    +      ++ + +DL +Y
Sbjct  146   SLKSNVTAPWDGGNITTGGKNNATISYNSTSKNLSVAFTTIQNEVQVIRNIDFSVDLLQY  205

Query  637   LPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADT------KSTgkglviglvvg  798
             LP++V  GF+ +TG+  AL  I SW F S     EN   T       +   GLV+GL VG
Sbjct  206   LPDKVIVGFSASTGQQFALHRIISWSFDSTSLADENITSTLPAPKSGNANVGLVVGLAVG  265

Query  799   gcfliggSMAFSFLAWRKRK--MREEFDDD--IFGNIG--ELGGGAGPKRFTYRELARAT  960
             G  ++ G + F FL  RKR+    E  DDD  +  ++   E   G GP++F+Y ELA AT
Sbjct  266   GGVILVGVLGFVFLFCRKRRETTGESTDDDTRVLHDLDPEEFEKGTGPRKFSYNELALAT  325

Query  961   NSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNL  1140
             N+F+Q +KLGEGGFG VYKG++K++ +YVAVK++SRGSKQG+KEYA+EV +ISR+RH+NL
Sbjct  326   NNFAQGEKLGEGGFGGVYKGFIKDMNAYVAVKKISRGSKQGLKEYAAEVSIISRLRHRNL  385

Query  1141  VHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECE  1320
             V LIGWCHE K LLLVYEF+ N SLDSHLYK KSLLTW +R+KI   LAS LLYLH+  E
Sbjct  386   VQLIGWCHEKK-LLLVYEFMPNSSLDSHLYKEKSLLTWEVRFKIAHGLASGLLYLHQGWE  444

Query  1321  KCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKA  1500
             +C++HRDIKSSN+MLD+N NAKLGDFGLA+LVDH K S+TT +AGTMGY+A E V +GKA
Sbjct  445   QCVLHRDIKSSNVMLDANFNAKLGDFGLAKLVDHGKLSQTTVVAGTMGYMATEYVATGKA  504

Query  1501  SKETDIYSFGIVTLEIACGRKPIDPTAEE--CHVNIVDWVWKLYGTGQLLDAADPNLSGD  1674
             SKETD+YSFG+V LEIACGRKPID   EE    +N+V+WVW+LYG G++++AADP L G+
Sbjct  505   SKETDVYSFGVVALEIACGRKPIDTRYEEKQMKMNMVEWVWELYGEGKIIEAADPKLCGE  564

Query  1675  FNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFWPQ  1839
             F+ +++E +MIVGLWCAHPD + RP I+QAIQVLNFE PLP+LP  MPVA F+P+
Sbjct  565   FDEKQMECLMIVGLWCAHPDHNSRPLIQQAIQVLNFEVPLPNLPLNMPVA-FFPR  618



>ref|XP_003551295.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Glycine max]
 gb|KHN09733.1| L-type lectin-domain containing receptor kinase IX.1 [Glycine 
soja]
Length=679

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/610 (52%), Positives = 413/610 (68%), Gaps = 18/610 (3%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFERTSLVNNSI-QITPNQRN-----CIGRATYSEPLHLWD  204
             V  LSFN   F  ++   I F+  +  +N + Q+T NQ +      +GRA+Y++P+ LWD
Sbjct  35    VVSLSFNSSTFQLNSNNLIDFKGDAFSSNGVLQLTKNQIDDKITFSVGRASYNQPVRLWD  94

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
               T KL+ F THF+FV+ +   +++GDG AFFLAP  S + PN + GG  GL +++   N
Sbjct  95    GRTKKLTDFTTHFSFVMKAIDPSRFGDGLAFFLAPFDS-VLPNNSAGGYLGLFSNESAFN  153

Query  385   SS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
             +  N  VAVEFD + N +D    HVGI+V+S+QSV    W   I+ G  + AWI Y+  +
Sbjct  154   TKKNQLVAVEFDSFKNEWDPSSDHVGINVNSIQSVTNVTWKSSIKNGSVANAWIWYNSTT  213

Query  562   MNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
              NLSV         F     + Y++DLR  LPE V  GF+ ATG    +  I SW F+S+
Sbjct  214   KNLSVFLTYANNPTFNGNSSLWYVIDLRDVLPEFVRIGFSAATGSWIEIHNILSWSFSSS  273

Query  727   LDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG-E  903
             LD    +   K    GLV+GL VG   L+       F  WR++   +E +  +  +I  E
Sbjct  274   LD----EGSRKKVKVGLVVGLSVGLGCLVCVVGLLWFTFWRRKNKGKEDNLGVDASIDDE  329

Query  904   LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQG  1083
                G GPKRFTY EL+ ATN+F+++ KLGEGGFG VYKG +      VAVKRVS+GSKQG
Sbjct  330   FERGTGPKRFTYPELSNATNNFAEEGKLGEGGFGGVYKGIVVHSNLEVAVKRVSKGSKQG  389

Query  1084  IKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLR  1263
              KEY SEVRVISR+RH+NLV LIGWCHE  +LLLVYE++ NGSLDSHL+  + +L+W +R
Sbjct  390   KKEYVSEVRVISRLRHRNLVQLIGWCHEQGELLLVYEYMPNGSLDSHLFGNRVMLSWVVR  449

Query  1264  YKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTT  1443
             +K+   LASALLYLHEE E+C+VHRDIKSSN+MLD+N NAKLGDFGLARLVDHE GS+TT
Sbjct  450   HKVALGLASALLYLHEEWEQCVVHRDIKSSNVMLDANFNAKLGDFGLARLVDHELGSQTT  509

Query  1444  ALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKL  1623
              LAGTMGY+A ECV +GK+SKE+D+YSFG+V LEI CGRKP++   E   V +V+WVW L
Sbjct  510   VLAGTMGYLAPECVTTGKSSKESDVYSFGVVALEITCGRKPVEVREEPSKVRLVEWVWSL  569

Query  1624  YGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDL  1803
             YG G+LL+AAD  L+ +F  +++E +MIVGLWC HPD ++RPSIRQ I VLNFEAPLP L
Sbjct  570   YGKGKLLEAADQKLNWEFEEQQMECLMIVGLWCCHPDHTMRPSIRQVISVLNFEAPLPSL  629

Query  1804  PETMPVATFW  1833
             P  +PV  ++
Sbjct  630   PSKLPVPMYY  639



>ref|XP_007148345.1| hypothetical protein PHAVU_006G200500g [Phaseolus vulgaris]
 gb|ESW20339.1| hypothetical protein PHAVU_006G200500g [Phaseolus vulgaris]
Length=651

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/625 (51%), Positives = 417/625 (67%), Gaps = 18/625 (3%)
 Frame = +1

Query  1     VGCffllllfIIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPN---QRNC--I  165
             V C+ +L +  +P  +PL+F++  F   + +        +  + IQ+T N   Q N   +
Sbjct  12    VLCYAMLTVSFLPPTNPLTFSYSHFWEDDARLQLQGDAEVSRSEIQVTYNGEGQSNSYSV  71

Query  166   GRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKG  345
             GR T  E + LWD  +GKL+ F T F F + S+  A YGDG AFFLA     +  N T+G
Sbjct  72    GRVTPLENMQLWDMSSGKLADFTTQFNFSVYSD-EALYGDGLAFFLADPELPLLNNITEG  130

Query  346   GGFGLANDDERLNSSN-PFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGG  522
             GG GL +  + LNS++  FVA+EFD + N +D E  HVG++ +S++S +T PW  D+   
Sbjct  131   GGLGLVDGGQVLNSTHHSFVALEFDTFQNPWDPEDPHVGMNFNSMESNITVPWLADMSTN  190

Query  523   WGSEAWINYDPRSMNLSVVFR--NFGSYGHV----SYILDLRKYLPERVTFGFAGATGKD  684
                   I Y+  +++LSV F   N+   G V    SY +DLRK+LPERV  GF+ ATG  
Sbjct  191   DSYSCSIEYNSTTLSLSVSFSGYNYQKGGRVENSFSYQVDLRKHLPERVMVGFSAATGDL  250

Query  685   TALQMINSWIFTSALDISENQ-ADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKM  861
                 ++ SW F+S L IS +   + K      +   +V    L+G S    FL WR+ K 
Sbjct  251   FENHILKSWSFSSTLQISHSSDGNNKVVEWLGIGMGLVVLLGLLGLS---CFLIWRRIKG  307

Query  862   REEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELES  1041
             + E  +       E   G GPKRF Y EL  ATN FS+ +KLG+GGFGSVY+G+LK+L S
Sbjct  308   KGEILELDLQMDDEFQKGIGPKRFRYNELESATNKFSESEKLGQGGFGSVYRGFLKDLNS  367

Query  1042  YVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDS  1221
             YVA+KRVSR SKQG+KEYA+EV++IS++RHKNLV L+GWCH  KDLLLVYEF+ NGSLD 
Sbjct  368   YVAIKRVSRESKQGVKEYATEVKIISQLRHKNLVQLLGWCHREKDLLLVYEFMPNGSLDF  427

Query  1222  HLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFG  1401
             HLY GK  LTWP+RY I   LASALLYL EE EKC++HRDIKSSNIMLDS+ NAKLGDFG
Sbjct  428   HLY-GKGFLTWPIRYNIALGLASALLYLQEEWEKCVLHRDIKSSNIMLDSSFNAKLGDFG  486

Query  1402  LARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTA  1581
             LARLVDHEKGS+TT +AGT GYIA E V +GKA KE+DIYSFG+V LEIA GRKPID +A
Sbjct  487   LARLVDHEKGSQTTFIAGTRGYIAPEYVTTGKAYKESDIYSFGVVLLEIASGRKPIDLSA  546

Query  1582  EECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQ  1761
             +E  V +V+W W+LY  G++++ ADP L G+F+  E+E+++ +GLWCAHP+   RPS+ Q
Sbjct  547   KEGKVTVVEWAWELYELGEIVEVADPKLCGEFDEEEMERLVAIGLWCAHPNYRFRPSVMQ  606

Query  1762  AIQVLNFEAPLPDLPETMPVATFWP  1836
              IQ+L FEA LP LP+ +P+  F+P
Sbjct  607   VIQMLKFEAELPTLPKFLPLQNFYP  631



>ref|XP_010265513.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
isoform X2 [Nelumbo nucifera]
Length=666

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/625 (49%), Positives = 409/625 (65%), Gaps = 36/625 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNF---DLFTPSNVQNITFERTSLVNNSIQITPNQRNC-----IGRATYSE  186
             +IP   PLSF F   DL T   +Q+      S+ ++ I +T N+R+       GR  Y  
Sbjct  22    LIPSATPLSFKFPSSDLSTSDLIQD---GNVSISSDVIDLTTNKRDANITSSYGRVRYKH  78

Query  187   PLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIP--PNATKGGGFGL  360
             P+ LWD  TG L+ F T+ +F I+S  +   GDG AFFL P GS  P  P+    G FG 
Sbjct  79    PVRLWDNKTGILTDFTTNLSFTINSMNNPNSGDGIAFFLVPNGSTFPGYPSGEHLGVFGY  138

Query  361   ANDDERLNSSNPFVAVEFDVYLNHY--DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSE  534
                + R+      +AVEFD Y N    D +  HVGID++S +SV TA     I+    + 
Sbjct  139   NETENRV------IAVEFDTYQNSLAGDPDYPHVGIDINSTRSVNTARLPSGIKYANKTN  192

Query  535   AWINYDPRSMNLSV--VFRNFGSYGH---VSYILDLRKYLPERVTFGFAGATGKDTALQM  699
             A I+Y+  +  LSV   + +   Y     +SY +DLR +LPE VT G + +TG    L  
Sbjct  193   ALISYNSSTKRLSVFWTYADISIYNENSGLSYDVDLRNFLPEWVTVGISASTGSFAELHQ  252

Query  700   INSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRK------M  861
             I+SW F S+L+I E+ + T  TG  + + + +G            F+ W KRK       
Sbjct  253   IHSWEFNSSLEIKESNSTTNKTGLVIGLVVGLGTLIG---LGGVWFIIWMKRKRAGVKEE  309

Query  862   REEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELES  1041
              ++  +       E G G GPKRF+Y +L RAT +F ++ KLG+GGFG +Y+G+L +L  
Sbjct  310   DDDDMELDDPMDVEFGKGVGPKRFSYGDLVRATCNFVEEQKLGQGGFGRIYRGFLSDLNL  369

Query  1042  YVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDS  1221
              VA+K+VS GSKQGIKEY SEV++ISR+RHKNLV LIGWCH+  +LLL+YEF+ NGSLDS
Sbjct  370   EVAIKKVSEGSKQGIKEYMSEVKIISRLRHKNLVQLIGWCHQRNELLLIYEFMPNGSLDS  429

Query  1222  HLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFG  1401
             HL+  K  L+W +RYKI   LASAL Y+HEE E+C+VHRDIKSSN+MLDSN NAKLGDFG
Sbjct  430   HLFGQKHSLSWEIRYKIALGLASALFYMHEEWEQCVVHRDIKSSNVMLDSNFNAKLGDFG  489

Query  1402  LARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTA  1581
             LARLVDH +GS+TT LAGTMGY+A ECV++GK+SKE+D+YS+G+V LEIACGRKP++P A
Sbjct  490   LARLVDHGQGSQTTVLAGTMGYMAPECVITGKSSKESDVYSYGVVALEIACGRKPVEPWA  549

Query  1582  EECHVNIVDWVWKLYGTGQLLDAADPNL-SGDFNGREVEQMMIVGLWCAHPDCSLRPSIR  1758
             E   V +V+WVW+LYG G+LL+AAD  L +  F+ +E+E +M+VGLWC HPDC+LRPS++
Sbjct  550   EASKVRMVEWVWELYGRGKLLEAADSRLVNMGFDEKEMECLMVVGLWCVHPDCNLRPSMK  609

Query  1759  QAIQVLNFEAPLPDLPETMPVATFW  1833
             Q IQ L FEAPLP LP  MPV T++
Sbjct  610   QLIQALGFEAPLPTLPPRMPVPTYY  634



>gb|KCW59671.1| hypothetical protein EUGRSUZ_H02425, partial [Eucalyptus grandis]
Length=634

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/607 (49%), Positives = 400/607 (66%), Gaps = 17/607 (3%)
 Frame = +1

Query  46    HPLSFNFDLFTPSNVQNITFE---RTSLVNNSIQITPNQRNC-IGRATYSEPLHLWDKPT  213
             + LSFN   F      ++ +E   R  +   ++  T     C +GRA Y+E L LWD  T
Sbjct  28    YSLSFNISRFD-GKATDMVYEGDARLDVGTRTVDFTSATYYCHVGRAFYAEKLRLWDSAT  86

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSN  393
              +L+ F+T F+F ID+   + YG G AFFLAP+G +IP N + GG  GL N   R +S N
Sbjct  87    RRLTDFSTRFSFTIDTQNRSHYGAGLAFFLAPVGFQIPVN-SDGGFLGLFNTTYRDSSLN  145

Query  394   PFVAVEFDVYLNH-YDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNL  570
               VAVEFD Y+N  +D   +HVGI+++S+ SVVTA W+        ++ W+ Y+  + NL
Sbjct  146   RIVAVEFDPYVNSDWDPPYEHVGININSIASVVTAAWNASFHSADTADTWVVYNSETKNL  205

Query  571   SVVF-----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDI  735
             SV +      N      +SY +DL   LPE V  GF+ AT        + SW F+S L++
Sbjct  206   SVSWIYQTTPNPHETTSISYQIDLTTVLPEEVMIGFSAATSYYVERHQLESWSFSSNLEV  265

Query  736   SENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDD--DIFGNIGELG  909
              E Q + K T   + + +++G        ++      RKRK R E  +  ++    GEL 
Sbjct  266   EEQQGNAKRTKLVVGLAVLLGVLLCGIVVISAIL---RKRKRRSEGSETANLMSINGELE  322

Query  910   GGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIK  1089
              GAGP+RFTY +L  ATN+F ++ KLG+GGFG+VYKGY   L++ VAVKR+SRGS+QG K
Sbjct  323   RGAGPRRFTYADLVSATNNFDEERKLGQGGFGAVYKGYPVGLDAAVAVKRISRGSEQGKK  382

Query  1090  EYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYK  1269
             E+ +EV+VIS +RH+NLV LIGWCHE  + +LVYEF+ NGSLD HL+  K +L W  R K
Sbjct  383   EFITEVKVISSLRHRNLVQLIGWCHEANEFILVYEFMPNGSLDRHLFGKKRILGWAARLK  442

Query  1270  IVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTAL  1449
             I   LASALLYLHEE E+C+VHRDIKSSN+MLDS  N KLGDFGLARL+DHE G +TT L
Sbjct  443   ISVGLASALLYLHEEWEQCVVHRDIKSSNVMLDSGFNVKLGDFGLARLMDHELGPQTTGL  502

Query  1450  AGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYG  1629
             AGT GY+A E V +G+ASKE+D+YSFG+V +EIA GR+ +DP  +  HV++V WVW LYG
Sbjct  503   AGTFGYLAPEYVSTGRASKESDVYSFGVVAIEIATGRRAVDPMEQSSHVSLVGWVWDLYG  562

Query  1630  TGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPE  1809
              GQ+++A D  L  DF+  +VE++++VGLWCAHPD SLRP++RQA+QVLNFEA +P LP 
Sbjct  563   RGQVIEAMDDQLQVDFDQNQVERLLVVGLWCAHPDRSLRPTVRQALQVLNFEAAVPVLPN  622

Query  1810  TMPVATF  1830
              +PVA +
Sbjct  623   KLPVAVY  629



>ref|XP_004958075.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Setaria italica]
Length=688

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/620 (47%), Positives = 404/620 (65%), Gaps = 31/620 (5%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSN---VQNITFERTSLVNNSIQITPNQRN-----CIGRATYSEPLHL  198
             V PL F  + FT SN      I F+  +  N ++++T  + +      +GRA +++P+ L
Sbjct  24    VSPLQFKLN-FTESNHNGAATIQFQEDAFYNKAVRLTKEEMDGQITHSVGRAVFTDPVTL  82

Query  199   WDKPTGKLSSFNTHFAFVIDSN-GSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             WD  TG+L+ F T F F+I +N  ++  G+G AFFL+P  S +P N+  G     ++  +
Sbjct  83    WDSTTGQLADFTTRFTFMIKANVTNSSNGEGLAFFLSPYPSVVPNNSGDGNLGLFSSSAD  142

Query  376   RLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDP  555
             +  +SN  VA+EFD + N +D +  HVGI+++S+ SV    W   I+ G  + AW+ Y  
Sbjct  143   QSETSNQIVAIEFDSHKNSWDPDDNHVGININSIVSVTNVTWKSSIKDGKIANAWVTYQA  202

Query  556   RSMNLSVVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFT  720
              SMNLSV         F     +SY +DLRKYLP++V  GF+ ATGK      I  W F+
Sbjct  203   SSMNLSVFLTYKDSPIFSGNSTLSYSVDLRKYLPDKVAIGFSAATGKLVETHRILYWEFS  262

Query  721   SALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREE---------F  873
             S    ++ Q  +K   + +VIGL      ++  SM       R RK R           +
Sbjct  263   S----TDVQLKSKKMKRVVVIGLATSISGMVCFSMGLVLCFLRFRKTRRLRKEEEEKLEY  318

Query  874   DDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAV  1053
             D+ I    GE   G GP+RF Y EL  AT +F+ + KLGEGGFG+VY+G+LK+    +A+
Sbjct  319   DESI---DGEFEKGRGPRRFRYNELVAATKNFALERKLGEGGFGAVYQGFLKDQNLNIAI  375

Query  1054  KRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYK  1233
             KRV++GS QG KEY SEV++ISR+RH+NLV L+GWCHE+ + LLVYEF+ N SLD+HLY 
Sbjct  376   KRVAKGSTQGKKEYISEVKIISRLRHRNLVQLVGWCHEHGEFLLVYEFMPNRSLDTHLYD  435

Query  1234  GKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARL  1413
                +LTWPLR+KI   +ASALLYLHEE E+C+VHRD+K SN+MLDS+ NAKLGDFGLARL
Sbjct  436   NSDILTWPLRFKITISVASALLYLHEEWEQCVVHRDVKPSNVMLDSSFNAKLGDFGLARL  495

Query  1414  VDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECH  1593
             VDH++GS+TT +AGTMGY+A ECV +GKASKE+D+YSFGI+ LE+ACGR+P+ P  ++  
Sbjct  496   VDHDRGSQTTVIAGTMGYLAPECVTTGKASKESDVYSFGILALEVACGRRPVVPKEDDEK  555

Query  1594  VNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQV  1773
             + +V WVW LYG  ++L+A D  L G  + RE  ++M+VGLWCAHPD +LRPSIRQ I V
Sbjct  556   IKLVQWVWDLYGRNEILNAVDGRLDGALDEREAVRLMVVGLWCAHPDYNLRPSIRQVISV  615

Query  1774  LNFEAPLPDLPETMPVATFW  1833
             L FEA LP LP  MPVA ++
Sbjct  616   LKFEASLPSLPPKMPVAMYF  635



>ref|XP_009412945.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Musa acuminata subsp. malaccensis]
Length=686

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/616 (49%), Positives = 400/616 (65%), Gaps = 17/616 (3%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQNITFERTSLV-NNSIQITPNQ-----RNCIGRATYSEPLH  195
             +PL   LSFNF  F  S+   I  +  + V N+ IQ+T NQ      +  GRA Y EPL 
Sbjct  20    VPLATSLSFNFSSFDQSSRSKIQQQGDAYVANDRIQLTKNQLDGSITSSGGRAVYGEPLL  79

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             LWD  T +L+ F T F F I+    +  GDG AFFL+   S IPPN+  GGG GL N  +
Sbjct  80    LWDPETRELTDFTTRFVFAINGLNESSTGDGVAFFLSSYPSAIPPNSL-GGGLGLFNSTQ  138

Query  376   RLN--SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
                  + N  VAVEFD + N +DT   H+GIDV+S++S     W  +I+ G    AW++Y
Sbjct  139   LAADLTFNNTVAVEFDTFKNDFDTSANHIGIDVNSVKSSAVVDWRSNIKDGREVNAWVSY  198

Query  550   DPRSMNLSVVFRNFGSYGH----VSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
             +  + NLSV        G     +SY++DLR+ LPE+V  GF+ ATG       + SW F
Sbjct  199   NASTRNLSVFMTYAQDAGSGNSSLSYLIDLRRVLPEKVAVGFSAATGSGIETHALLSWSF  258

Query  718   TSAL---DISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIF  888
              S+L     S+            V+ +V+G   LI             R   +E + +  
Sbjct  259   NSSLLPKRKSKMGLVVGVVIGAAVLMVVLGSLGLILRRRRRRRRRTTGRDAEDEEELEFD  318

Query  889   GNIG-ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVS  1065
              N+  E     GPKRF Y+ELA AT +FS+++KLGEGGFGSVY+GYLK+ +  VA+KR+S
Sbjct  319   RNMDDEFERERGPKRFAYQELADATRNFSEEEKLGEGGFGSVYRGYLKDSKLEVAIKRIS  378

Query  1066  RGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSL  1245
             RGSKQG KEY SEV++ISR+RH+NLV L+GWCH+  +  LVYE + NGSLDS+LY    L
Sbjct  379   RGSKQGRKEYVSEVKIISRLRHRNLVQLVGWCHDRGEFSLVYELMPNGSLDSYLYSTTRL  438

Query  1246  LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHE  1425
             L WP R+++   LASALLYLHEE E+C+VHRD+K SN+MLDS  NAKLGDFGLARLVDH+
Sbjct  439   LEWPARHRVALGLASALLYLHEEWEQCVVHRDVKPSNVMLDSAFNAKLGDFGLARLVDHD  498

Query  1426  KGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIV  1605
             +GS+TT LAGTMGY+A ECV +GKASKE+D+YSFGI+ LEIACGR+P+    +   V +V
Sbjct  499   RGSQTTVLAGTMGYLAPECVNTGKASKESDVYSFGILALEIACGRRPVQLMEQASKVRLV  558

Query  1606  DWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFE  1785
             +WVW+LYG  +LL+AAD  L G F+ +++E +M+VGLWCAHPD   RPSI+Q I VLN E
Sbjct  559   EWVWELYGWRRLLEAADEKLGGVFDEKQMECLMVVGLWCAHPDYDRRPSIKQVINVLNLE  618

Query  1786  APLPDLPETMPVATFW  1833
             APLP+LP +MPV  ++
Sbjct  619   APLPELPPSMPVPMYY  634



>ref|XP_010026583.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=652

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/607 (49%), Positives = 400/607 (66%), Gaps = 17/607 (3%)
 Frame = +1

Query  46    HPLSFNFDLFTPSNVQNITFE---RTSLVNNSIQITPNQRNC-IGRATYSEPLHLWDKPT  213
             + LSFN   F      ++ +E   R  +   ++  T     C +GRA Y+E L LWD  T
Sbjct  28    YSLSFNISRFD-GKATDMVYEGDARLDVGTRTVDFTSATYYCHVGRAFYAEKLRLWDSAT  86

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSN  393
              +L+ F+T F+F ID+   + YG G AFFLAP+G +IP N + GG  GL N   R +S N
Sbjct  87    RRLTDFSTRFSFTIDTQNRSHYGAGLAFFLAPVGFQIPVN-SDGGFLGLFNTTYRDSSLN  145

Query  394   PFVAVEFDVYLNH-YDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNL  570
               VAVEFD Y+N  +D   +HVGI+++S+ SVVTA W+        ++ W+ Y+  + NL
Sbjct  146   RIVAVEFDPYVNSDWDPPYEHVGININSIASVVTAAWNASFHSADTADTWVVYNSETKNL  205

Query  571   SVVF-----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDI  735
             SV +      N      +SY +DL   LPE V  GF+ AT        + SW F+S L++
Sbjct  206   SVSWIYQTTPNPHETTSISYQIDLTTVLPEEVMIGFSAATSYYVERHQLESWSFSSNLEV  265

Query  736   SENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDD--DIFGNIGELG  909
              E Q + K T   + + +++G        ++      RKRK R E  +  ++    GEL 
Sbjct  266   EEQQGNAKRTKLVVGLAVLLGVLLCGIVVISAIL---RKRKRRSEGSETANLMSINGELE  322

Query  910   GGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIK  1089
              GAGP+RFTY +L  ATN+F ++ KLG+GGFG+VYKGY   L++ VAVKR+SRGS+QG K
Sbjct  323   RGAGPRRFTYADLVSATNNFDEERKLGQGGFGAVYKGYPVGLDAAVAVKRISRGSEQGKK  382

Query  1090  EYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYK  1269
             E+ +EV+VIS +RH+NLV LIGWCHE  + +LVYEF+ NGSLD HL+  K +L W  R K
Sbjct  383   EFITEVKVISSLRHRNLVQLIGWCHEANEFILVYEFMPNGSLDRHLFGKKRILGWAARLK  442

Query  1270  IVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTAL  1449
             I   LASALLYLHEE E+C+VHRDIKSSN+MLDS  N KLGDFGLARL+DHE G +TT L
Sbjct  443   ISVGLASALLYLHEEWEQCVVHRDIKSSNVMLDSGFNVKLGDFGLARLMDHELGPQTTGL  502

Query  1450  AGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYG  1629
             AGT GY+A E V +G+ASKE+D+YSFG+V +EIA GR+ +DP  +  HV++V WVW LYG
Sbjct  503   AGTFGYLAPEYVSTGRASKESDVYSFGVVAIEIATGRRAVDPMEQSSHVSLVGWVWDLYG  562

Query  1630  TGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPE  1809
              GQ+++A D  L  DF+  +VE++++VGLWCAHPD SLRP++RQA+QVLNFEA +P LP 
Sbjct  563   RGQVIEAMDDQLQVDFDQNQVERLLVVGLWCAHPDRSLRPTVRQALQVLNFEAAVPVLPN  622

Query  1810  TMPVATF  1830
              +PVA +
Sbjct  623   KLPVAVY  629



>ref|XP_010068312.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=665

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/630 (48%), Positives = 413/630 (66%), Gaps = 39/630 (6%)
 Frame = +1

Query  55    SFNFDLFTPSNVQNITFERTSLV-NNSIQITPNQRN-----CIGRATYSEPLHLWDKPTG  216
             +F+F  F P+N  +I+FE  +   +NS+Q+T NQ++       GRATY  P+HLWDK TG
Sbjct  19    AFDFPSFNPNN-HDISFESDAYASDNSLQLTENQKDKGNIVSAGRATYVRPMHLWDKSTG  77

Query  217   KLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAN--DDERLNSS  390
              ++ F THF+F I+S GS  Y DG +FFLAP GS IPP+ ++GG   L N   D+  +S+
Sbjct  78    NVADFTTHFSFAINSLGSKVYADGMSFFLAPNGSNIPPH-SEGGKLALVNLQSDDSDSSN  136

Query  391   NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGS-EAWINYDPRSMN  567
               FVAVEFD Y+N +D + +H+GID++S+ S    PW  +  G  G   A I YD    N
Sbjct  137   ASFVAVEFDTYVNSWDPQYEHIGIDINSVNSTTFVPWKWNRIGSGGRVRATIAYDSSVHN  196

Query  568   LSVVFRNFGS-------YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
             LSV+  +  S          +S I++L +YLPE VT GFA  +G    +  + SW F S+
Sbjct  197   LSVLLIDDESDETLSKNQSSLSLIINLTEYLPEWVTIGFAATSGSAIEIHTVYSWKFNSS  256

Query  727   LDISENQADTKSTgkglviglvvgg-----------cfliggSMAFSFLAWRKR------  855
             L I  N+   +S      +                    +  S+ F+   +R R      
Sbjct  257   LQIELNENFNQSIVPTDNLSSEKKSKSWIWVVIGLSSAFLLISLIFTITWFRHRLKKDIN  316

Query  856   ---KMREEFDD-DIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGY  1023
                ++R   DD D+     ELG  AGPK+F+Y ELA AT++F+    LG+GGFG VY+GY
Sbjct  317   PRSEIRHTHDDHDVMRMEEELGEVAGPKQFSYSELAVATDNFTDDRLLGQGGFGRVYEGY  376

Query  1024  LKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLS  1203
             L  + S VAVK+V   + QG+KEYA+EV+ I ++RH+NLV L+GWCH+ K+LLLVY+F+S
Sbjct  377   LDGIHSSVAVKKVKPEAGQGMKEYAAEVKTIGQLRHRNLVRLLGWCHDEKELLLVYKFMS  436

Query  1204  NGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNA  1383
             NGSLDSHL+KGK+LL+W  RYKI Q LASAL +LHE  ++C+VHRDIKSSN+MLD + NA
Sbjct  437   NGSLDSHLFKGKTLLSWETRYKIAQGLASALFFLHEGWDQCVVHRDIKSSNVMLDLHFNA  496

Query  1384  KLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRK  1563
             KLGDFGLARLVDH KG+ TT LAGT+GY+A EC+ +GKA+KE+DIYSFG+V LEIACG K
Sbjct  497   KLGDFGLARLVDHAKGAHTTILAGTIGYLAPECISTGKATKESDIYSFGVVLLEIACGLK  556

Query  1564  PIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSL  1743
              + P     H+++V+ VW++YG  +LLD ADP L G FN  ++E +MIVGLWCAHP+ +L
Sbjct  557   ALGPMEANGHMHLVERVWEVYGARKLLDVADPKLCGKFNEEQMECLMIVGLWCAHPNYTL  616

Query  1744  RPSIRQAIQVLNFEAPLPDLPETMPVATFW  1833
             RPS+R+A+ VLNF+ P P+L    PV T++
Sbjct  617   RPSVREAVNVLNFDLPPPNLLGKAPVPTYF  646



>gb|EMS67946.1| L-type lectin-domain containing receptor kinase IX.1 [Triticum 
urartu]
Length=693

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/621 (48%), Positives = 402/621 (65%), Gaps = 25/621 (4%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQN---ITFERTSLVNNSIQITPNQ-----RNCIGRATYSEP  189
             I  V PLSF  + FT SN      I F+  +  N  I++T ++      N +GRA Y+ P
Sbjct  23    IASVSPLSFKLN-FTESNYSASTAIQFQEDAFYNKGIKLTKDELKGQITNSVGRAVYTNP  81

Query  190   LHLWDKPTGKLSSFNTHFAFVID-SNGSAK---YGDGFAFFLAPLGSRIPPNATKGGGFG  357
             + LWD  TG+L+ F+THF F I  +N SA    YG+G AFFL+P  S + PN++ GG  G
Sbjct  82    VLLWDTTTGQLADFSTHFTFRITATNLSATHDPYGEGLAFFLSPYPS-VVPNSSTGGFLG  140

Query  358   L-ANDDERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSE  534
             L +N  +  + SN  VAVEFD + + +D +  HVGID+ S+ S     W+  I  G  + 
Sbjct  141   LFSNGSDHNDPSNELVAVEFDSHNDTWDPKGDHVGIDIHSIVSATNVLWNSSINDGRIAN  200

Query  535   AWINYDPRSMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQM  699
             AW++Y   S+NLSV         F      SY +DLRKYLP +V  GF+ ATG+   L  
Sbjct  201   AWVSYQASSLNLSVFLTYLEDPQFSGNSTFSYSVDLRKYLPGKVAIGFSAATGRFVELHE  260

Query  700   INSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDD  879
             I  W F S  D+   + + K     ++    +    +    + +  L +R R+ R E   
Sbjct  261   ILYWEFNST-DLQLMKTE-KMRSVLVISLATITSVVVCSMCLVWCLLHFRTRRSRNEKQK  318

Query  880   DIFGNI---GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVA  1050
              +  +    GE   G+GP+RF Y EL  AT +F+ + KLGEGGFG+VY+G LK+    VA
Sbjct  319   KLGYHESIDGEFEKGSGPRRFRYNELVAATRNFALERKLGEGGFGAVYQGLLKDQNLDVA  378

Query  1051  VKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLY  1230
             +KRV++GS QG KEY SEV++ISR+RH+NLV L GWCHE+ + LLVYEF+ N SLD+HLY
Sbjct  379   IKRVAKGSTQGRKEYISEVKIISRLRHRNLVQLEGWCHEHGEFLLVYEFMPNRSLDTHLY  438

Query  1231  KGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLAR  1410
                +LLTWPLR+K+   +ASALLYLHEE E+C++HRDIK SN+MLDS  NAKLGDFGLAR
Sbjct  439   DNSNLLTWPLRFKVTAGVASALLYLHEEWEQCVIHRDIKPSNVMLDSAFNAKLGDFGLAR  498

Query  1411  LVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEEC  1590
             L+DH++ S+TT LAGTMGY+A ECV +GKASKE+D+YSFGI+ LEIACGR+P+    ++ 
Sbjct  499   LIDHDRASQTTVLAGTMGYMAPECVTTGKASKESDVYSFGILALEIACGRRPVVLKEDDD  558

Query  1591  HVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQ  1770
              + +V WVW LYG  ++L+A D  L G F  RE   +M+VGLWCAHPD +LRPSIRQ I 
Sbjct  559   KIVLVQWVWDLYGRNKILNAVDSRLDGAFEDREAACLMVVGLWCAHPDYNLRPSIRQVIS  618

Query  1771  VLNFEAPLPDLPETMPVATFW  1833
             VL FEAPLP+LP  MPVA ++
Sbjct  619   VLKFEAPLPNLPPKMPVAMYF  639



>dbj|BAC79695.1| putative lectin-like protein kinase [Oryza sativa Japonica Group]
Length=689

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/624 (48%), Positives = 403/624 (65%), Gaps = 30/624 (5%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSN---VQNITFERTSLVNNSIQITPNQRN-----CIGRATYSEP  189
             I  V+PLSF  + FT SN      I  +  +  N ++++T ++ N      +GRA Y++P
Sbjct  21    IAHVNPLSFKLN-FTESNHNGSATIQLQEDAFYNKAVKLTKDELNGKITQSVGRAIYTDP  79

Query  190   LHLWDKPTGKLSSFNTHFAFVIDS-NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAN  366
             + LWD  TG+L+SF T F F I +    + YG+G AFFL+   S +P N+  G     +N
Sbjct  80    VPLWDSTTGQLASFTTRFTFKIYAPTNDSSYGEGLAFFLSSYPSVVPNNSMDGYLGLFSN  139

Query  367   DDERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWIN  546
              +++ +  N  VAVEFD + N +D +  HVGI++ S+ SV    W   I  G  + AW+ 
Sbjct  140   SNDQSDPLNQIVAVEFDSHKNTWDPDGNHVGINIHSIVSVANVTWRSSINDGRIANAWVT  199

Query  547   YDPRSMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSW  711
             Y   S NLSV         F     +SY +DL KYLP++V+ GF+ +TGK   L  I  W
Sbjct  200   YQANSRNLSVFLSYQDNPQFSGNSSLSYSVDLSKYLPDKVSIGFSASTGKFVELHQILYW  259

Query  712   IFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAW----------RKRKM  861
              F S  D+   + + K+ G  ++     G   +    +   FL +           K K 
Sbjct  260   EFDST-DVHLMKTE-KTKGILVISLSTSGSVVVCSIGLVCFFLCFRRIRRTTRSREKEKE  317

Query  862   REEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELES  1041
             + + D+ I     E   G GP+RF Y EL  AT++F+ + KLGEGGFG+VY+G+LK+   
Sbjct  318   KLDCDESI---DSEFEKGKGPRRFQYNELVVATDNFAAERKLGEGGFGAVYQGFLKDQNI  374

Query  1042  YVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDS  1221
              +A+KRV++GS QG KEY SEV++ISR+RH+NLV L+GWCHE+ + LLVYEF+ N SLD 
Sbjct  375   EIAIKRVAKGSTQGRKEYISEVKIISRLRHRNLVQLVGWCHEHGEFLLVYEFMPNRSLDK  434

Query  1222  HLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFG  1401
             HLY G +LL WPLR+KI   +ASALLYLHEE E+C+VHRD+K SN+MLDS  NAKLGDFG
Sbjct  435   HLYDGGNLLAWPLRFKITIGVASALLYLHEEWEQCVVHRDVKPSNVMLDSGFNAKLGDFG  494

Query  1402  LARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTA  1581
             LARLVDH++GS+TT +AGTMGY+A ECV +GKASKETD+YSFGI+ LEIACGR+P+ P  
Sbjct  495   LARLVDHDRGSQTTVIAGTMGYMAPECVTTGKASKETDVYSFGILALEIACGRRPVVPKE  554

Query  1582  EECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQ  1761
             +   +++V WVW LYG  ++L+A D  L G+F  REV  +M+VGLWCAHPD ++RPSIRQ
Sbjct  555   DNDRISLVQWVWDLYGRNEILNAIDGRLDGEFEEREVISLMVVGLWCAHPDYNIRPSIRQ  614

Query  1762  AIQVLNFEAPLPDLPETMPVATFW  1833
              I VL FEAPLPDLP  MPVA ++
Sbjct  615   VISVLKFEAPLPDLPPKMPVAMYF  638



>ref|XP_009605385.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like, 
partial [Nicotiana tomentosiformis]
Length=636

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/615 (49%), Positives = 407/615 (66%), Gaps = 24/615 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVN-NSIQITPNQRNC-IGRATYSEPLHLWD  204
             +IP V  + F    F P +V +I +E  ++ +   I+ T     C +  A Y E + +WD
Sbjct  7     LIPFVSSVYFKIPRFGP-DVTDILYEGDAVASVGEIEFTKVTYLCRVAHAIYREKVPIWD  65

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
               + KL+ F+THF+F ID+   + YG G AFFLAP+G +IPPN + GG  GL N     +
Sbjct  66    PDSTKLADFSTHFSFTIDTLNRSLYGHGIAFFLAPVGFQIPPN-SDGGFLGLFNTTTSDS  124

Query  385   SSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
             + N  V VEFD + N  +D   +HVGI+ +S+ S VTAPW+  +  G   +AWI Y+  +
Sbjct  125   AQNQVVVVEFDSFSNPEWDPPFEHVGINKNSIASSVTAPWNGSLHSGETIDAWITYNSTT  184

Query  562   MNLSVVFRNFGS--YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDI  735
              NLSV F N+G      +SYI++LR+ LP  +T GF+ ATGK+     + SW F+S+LDI
Sbjct  185   KNLSV-FWNYGKGFNSSISYIINLREVLPSWITIGFSAATGKNVERHTLESWEFSSSLDI  243

Query  736   SENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMR---------EEFDDDIF  888
             +E   + +     +     +GG   +   +A   L   +R+             F+DD  
Sbjct  244   TELGGNGRRKIGLIAGLTALGGVLFVSAILALVILRKWRRRKMKRNPETISLTSFNDD--  301

Query  889   GNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSR  1068
                  L  GAGPK+F+Y EL  +TN FS++ KLGEGGFG VYKGYL +L+  +AVK++SR
Sbjct  302   -----LEKGAGPKKFSYEELDTSTNHFSEERKLGEGGFGEVYKGYLIDLDIAIAVKKISR  356

Query  1069  GSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLL  1248
             GSKQG KEY +EV+VISR+RH+NLV LIGWCH+    LLVYEF+ NGSLD HL+  ++ L
Sbjct  357   GSKQGKKEYITEVKVISRLRHRNLVQLIGWCHDQGKFLLVYEFMPNGSLDCHLFGKRNPL  416

Query  1249  TWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEK  1428
             +W  RYKI   LASALLYLHEE E+C++HRDIKSSN+MLDS+ N KLGDFGLARL+DHE 
Sbjct  417   SWNTRYKISLGLASALLYLHEEWEQCVIHRDIKSSNVMLDSSFNVKLGDFGLARLMDHEL  476

Query  1429  GSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVD  1608
             G +TT LAGT+GY+A E + +G+ASKE+D+YSFG+V LEIA GRK +DP   +    +V+
Sbjct  477   GPQTTGLAGTLGYLAPEYIKTGRASKESDVYSFGVVALEIATGRKSVDPGTGKSDAGLVE  536

Query  1609  WVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEA  1788
             +VW+LYG GQL    D  L+ DF+ ++VE++MI GLWCAHP+ +LRPSIRQAI VLNFEA
Sbjct  537   YVWELYGKGQLPSVVDEKLNLDFDAKQVERLMITGLWCAHPESNLRPSIRQAIHVLNFEA  596

Query  1789  PLPDLPETMPVATFW  1833
              LP+LP  MPV  ++
Sbjct  597   ALPNLPIKMPVPVYY  611



>ref|XP_003608367.1| Lectin receptor-like kinase Tg-20 [Medicago truncatula]
 gb|AES90564.1| lectin receptor kinase [Medicago truncatula]
Length=683

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/604 (48%), Positives = 401/604 (66%), Gaps = 15/604 (2%)
 Frame = +1

Query  49    PLSFNFDLF--TPSNVQNITFERTSLVNNSIQITPNQRNCIGRATYSEPLHLWDKPTGKL  222
             PLSFN++      +N  NI+ +  S  N  +Q+T  +++ +GR TYS+  HLW+  T ++
Sbjct  32    PLSFNYEQLGGDKTNTFNISGD-VSQDNQVLQLTNYEKDSLGRVTYSKLFHLWNINTSEV  90

Query  223   SSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN----SS  390
             + F T F+F I++   + +GDG  F+LA      P +   G G GLA+  +  N      
Sbjct  91    TDFTTRFSFSINTPNKSYHGDGITFYLAR--PNFPMSQIDGSGIGLASRVQLSNPNYTKE  148

Query  391   NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNL  570
             NPFVAVEFD ++N +D +  HVGIDV+S+ +  T  W   ++   G +A ++YD  S NL
Sbjct  149   NPFVAVEFDTFVNDWDPKYDHVGIDVNSISTNHTTQWFTSMDER-GYDAEVSYDSSSNNL  207

Query  571   SVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDIS  738
             +V F  +        H+ Y+++LR  LP+ V FGF  ATG       +NSW F S+LD  
Sbjct  208   TVTFTGYQDNKTIQQHLFYVVNLRDVLPDWVEFGFTSATGFFWEYHTLNSWSFNSSLDFE  267

Query  739   ENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIGELGGGA  918
               +  TK+     +          + G +       R + M++E   D+  +  +    +
Sbjct  268   AKKDGTKTGLVIGLGVGGAVALICVIGLVCLLKWKLRNKGMKDESHFDLAMD-SDFERSS  326

Query  919   GPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYA  1098
              PK+FTY ELAR+TN+F+ + K+G GGFG+VYKG++++L+ +VA+K+VS+ S QG+KEYA
Sbjct  327   LPKKFTYEELARSTNNFANEHKIGAGGFGAVYKGFIRDLKHHVAIKKVSKESNQGVKEYA  386

Query  1099  SEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQ  1278
             SEV+VIS++RHKNLV L GWCH+  DLLLVYEF+ NGSLDS+++KGK LL W +RY I +
Sbjct  387   SEVKVISQLRHKNLVQLYGWCHKQNDLLLVYEFVENGSLDSYIFKGKGLLIWTVRYNIAR  446

Query  1279  DLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGT  1458
              LASALLYLHEECE C++HRDIKSSN+MLDSN N KLGDFGLARL++HE  S+TT LAGT
Sbjct  447   GLASALLYLHEECEHCVLHRDIKSSNVMLDSNFNTKLGDFGLARLMNHETESKTTVLAGT  506

Query  1459  MGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQ  1638
              GY++ E    GKAS+E+D+YSFG+V LEIACGRK I+P+  E H+ +VDWV +LYG G 
Sbjct  507   YGYLSPEAATRGKASRESDVYSFGVVALEIACGRKAIEPSLSEEHIYLVDWVCELYGNGD  566

Query  1639  LLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMP  1818
             LL AAD  L G+FN +EVE++MIVGLWC H D   RP IRQ +QVLNF+APLP+LP  M 
Sbjct  567   LLKAADSRLYGEFNEKEVERLMIVGLWCTHTDHLQRPMIRQVVQVLNFDAPLPNLPLQMN  626

Query  1819  VATF  1830
              +T+
Sbjct  627   ASTY  630



>gb|KDP41155.1| hypothetical protein JCGZ_03649 [Jatropha curcas]
Length=658

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/615 (49%), Positives = 402/615 (65%), Gaps = 17/615 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSL--VNNSIQITPNQRNC-IGRATYSEPLHLW  201
             I+P    ++F    F PS+  NI ++  ++  V     I      C +G  TY+EP+ +W
Sbjct  23    ILPFASSINFKITRFDPSST-NILYQGDAVPSVGAVELINKLTYVCRVGWVTYAEPIPVW  81

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             D  TGK+S F+THF+F+ID  G + YG G  FFLAP+G +IPPN+  GG  GL N     
Sbjct  82    DSHTGKVSDFSTHFSFIIDVQGRSAYGHGIVFFLAPVGFQIPPNSA-GGFLGLFNTSTSD  140

Query  382   NSSNPFVAVEFDVYLNH-YDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
             +S N  V VEFD + N  +D   +HVGI+ +S+ S V  PW+  +  G  ++ WI+Y+  
Sbjct  141   SSQNQIVTVEFDSFPNEEWDPPVEHVGINNNSIASAVYTPWNASLHSGDTADVWISYNSS  200

Query  559   SMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTS  723
             S NLSV +      N      + Y +DL K LPE+VT G + ATG + A   + SW F+S
Sbjct  201   SKNLSVSWNYKSTSNSHENSSLFYTIDLVKALPEKVTIGLSAATGINGARHTLKSWEFSS  260

Query  724   ALDI--SENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMRE----EFDDDI  885
             +LDI  +      K      V          +  SM  S    +  + R+    +    I
Sbjct  261   SLDIKITNGNKPKKIKVIVSVSVSAFLLIAGVITSMEISQRRKKIIRRRKAEAMKLSTGI  320

Query  886   FGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVS  1065
                  +L  GAGP+RF+Y +L  +TN+FS + KLGEGGFG+VYKGYL E++  +AVK+ S
Sbjct  321   TSINEDLERGAGPRRFSYEDLVSSTNNFSDERKLGEGGFGAVYKGYLNEIDMAIAVKKFS  380

Query  1066  RGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSL  1245
             RGSKQG KEY +EV+ IS++RH+NLV LIGWCH+  + LLVYEF+ NGSLDSHL+  K+ 
Sbjct  381   RGSKQGKKEYITEVKTISQLRHRNLVQLIGWCHDRGEFLLVYEFMPNGSLDSHLFGKKNP  440

Query  1246  LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHE  1425
             L W +RYKI   LASALLYLHEE E+C+VHRD+KSSN+MLDSN N KLGDFGLARL+DHE
Sbjct  441   LPWSVRYKISLGLASALLYLHEEWEQCVVHRDVKSSNVMLDSNFNVKLGDFGLARLMDHE  500

Query  1426  KGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIV  1605
              G +TTA+AGT+GY+A E +  G+ASK++D+YSFG+V LEIA GRK IDP  ++  V++V
Sbjct  501   LGPQTTAIAGTLGYLAPEYISIGRASKDSDVYSFGVVALEIASGRKAIDPIVQKSGVSLV  560

Query  1606  DWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFE  1785
             +W+W LYG G+L    D  L+ ++N +E+E ++IVGLWCAHPD S+RPSIRQAIQVLNFE
Sbjct  561   EWIWDLYGWGKLHLGIDKRLNMEYNEKEIECLVIVGLWCAHPDYSVRPSIRQAIQVLNFE  620

Query  1786  APLPDLPETMPVATF  1830
             A +PDLP  MPV  F
Sbjct  621   AAIPDLPAKMPVPMF  635



>ref|XP_002527230.1| kinase, putative [Ricinus communis]
 gb|EEF35156.1| kinase, putative [Ricinus communis]
Length=672

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/568 (52%), Positives = 392/568 (69%), Gaps = 12/568 (2%)
 Frame = +1

Query  163   IGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATK  342
             +G  TY E + LWD  TGKLS F+THF+F+ID+ G + YG G  FFLAP+G +IPPN+  
Sbjct  84    VGWVTYGESVPLWDSTTGKLSDFSTHFSFIIDTQGRSTYGHGIVFFLAPVGFQIPPNSA-  142

Query  343   GGGFGLANDDERLNSSNPFVAVEFDVYLNH-YDTEQKHVGIDVDSLQSVVTAPWSPDIEG  519
             GG  GL N     +S N  V VEFD + N  +D    HVGI+ +S+ S V  PW+     
Sbjct  143   GGFLGLFNTSTSDSSKNQIVTVEFDSFSNEEWDPPVGHVGINNNSIASAVYTPWNASFHS  202

Query  520   GWGSEAWINYDPRSMNLSVVF-----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKD  684
             G  ++AWI Y+  + NLSV +      N G    +SYI+DL K LPE+VT GF+ ATG++
Sbjct  203   GDIADAWITYNSITKNLSVFWTYKETSNPGENSSLSYIIDLMKVLPEQVTIGFSAATGQN  262

Query  685   TALQMINSWIFTSALDISENQA-DTKSTgkglviglvvggcfliggSMAFSFLAWRKRK-  858
              A   + SW F+S+L +      + K T   + +   V GC LI  ++  + +  R+RK 
Sbjct  263   GARHSLQSWEFSSSLVVKGKHGNELKKTQVIVGVSASVSGCLLIAAAVILALVISRRRKQ  322

Query  859   -MREEFDD--DIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLK  1029
              M+++  +   I     +L  GAGP++F+Y +L  ATN+FS    LGEGGFG+VYKGYL 
Sbjct  323   IMKKKRAEVAGISSIYEDLERGAGPRKFSYEDLVTATNNFSGVRNLGEGGFGAVYKGYLN  382

Query  1030  ELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNG  1209
             +++  +AVK+ SRGSKQG KEY +EV+ IS++RH+NLV LIGWCH+  + LLVYEF+ NG
Sbjct  383   DIDMAIAVKKFSRGSKQGKKEYITEVKTISQLRHRNLVQLIGWCHDRGEFLLVYEFMPNG  442

Query  1210  SLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKL  1389
             SLDSHL+  KS L+W +RYKI   LASALLYLHEE E+C+VHRD+KSSN+MLDS+ N KL
Sbjct  443   SLDSHLFGKKSPLSWAVRYKISLGLASALLYLHEEWEQCVVHRDVKSSNVMLDSSFNVKL  502

Query  1390  GDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPI  1569
             GDFGLARL+DHE G +TT LAGT+GY+A E + +G+ASK++D+YSFG+V LEIA GRK I
Sbjct  503   GDFGLARLMDHELGPQTTGLAGTLGYLAPEYISTGRASKDSDVYSFGVVCLEIASGRKAI  562

Query  1570  DPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRP  1749
             D   ++  + +V+W+W LYG G++    D  L  +F+ +EVE+++IVGLWCAHPD S RP
Sbjct  563   DQIEQKSGICLVEWIWDLYGCGKIHCGIDKRLQINFDEKEVERLVIVGLWCAHPDSSARP  622

Query  1750  SIRQAIQVLNFEAPLPDLPETMPVATFW  1833
             SIRQAIQVLNFEA +PDLP  MPV  F+
Sbjct  623   SIRQAIQVLNFEAEIPDLPAKMPVPAFY  650



>ref|XP_004134270.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cucumis sativus]
 gb|KGN56317.1| hypothetical protein Csa_3G115060 [Cucumis sativus]
Length=685

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/619 (50%), Positives = 404/619 (65%), Gaps = 17/619 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQ-----RNCIGRATYSEPL  192
             I+  V  LSF F  F  +N  N+ FE  S  +N  IQ+T NQ      +  GRA+Y++P+
Sbjct  26    ILFKVQSLSFTFPNFQQNN-PNLFFEGDSFTSNGLIQLTKNQADGPLTDSSGRASYAQPV  84

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWD  TG++++F THF+F +     + +GDG AFF+ P  S++P N+T GG  GL + D
Sbjct  85    RLWDAATGQVTNFTTHFSFRVTQLNQSSFGDGIAFFIVPYESKLPANST-GGFLGLFSSD  143

Query  373   ERLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
                +SS N    VEFD   + +DT   H+GI+V+S++S+    W   ++    + AWI Y
Sbjct  144   LAFDSSKNQVFGVEFDSKQDDWDTSDDHLGINVNSIKSINHLDWKSSMKDSRTANAWITY  203

Query  550   DPRSMNLSVVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             +  + NLSV         F     +S  +DL+ +LPERV  GF+ ATGK   +  I SW 
Sbjct  204   NSATNNLSVFLTYDSDPIFTGTFTISTFVDLKSFLPERVRVGFSAATGKWFQIHNIISWS  263

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGN  894
             F S LD  +N           +   +  G  +    +    L W  +K+R   DD     
Sbjct  264   FNSTLD--DNLGGGDKNKNTGLAIGLGVGLGVGICGLILLGLFWWGKKLRRMEDDVDDSI  321

Query  895   IGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGS  1074
               E   G GPKRFTYREL RAT +F +  KLGEGGFG VYKG L E  + +AVKRVSRGS
Sbjct  322   DDEFEKGTGPKRFTYRELTRATKNFDEAGKLGEGGFGGVYKGLLTESNTEIAVKRVSRGS  381

Query  1075  KQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTW  1254
             +QG KEY SEV++ISR+RH+NLV L GWCHE  + LLVYEF+ NGSLD+HL++G+++L+W
Sbjct  382   RQGKKEYISEVKIISRLRHRNLVQLFGWCHEKGEFLLVYEFMPNGSLDTHLFRGQTMLSW  441

Query  1255  PLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGS  1434
             P+RYKI   LAS+LLYLHEE E+C+VHRDIKSSN+MLDSN NAKLGDFGLAR VDHE GS
Sbjct  442   PVRYKIAIGLASSLLYLHEEWEQCVVHRDIKSSNVMLDSNFNAKLGDFGLARFVDHELGS  501

Query  1435  RTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWV  1614
             +TT LAGTMGY+A ECV  GKASKE+D+YSFG+V LEIACGR+P++  AE   V +V+WV
Sbjct  502   QTTVLAGTMGYLAPECVTDGKASKESDVYSFGVVALEIACGRRPVESRAEPDQVRLVEWV  561

Query  1615  WKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPL  1794
             W+ YG G++L  AD  L  +F+ +++E +M+VGLWC HPD  LRPSIRQ I  LNFEA L
Sbjct  562   WESYGRGEVLKTADKRLEMEFDEQQMEALMVVGLWCCHPDFKLRPSIRQVINALNFEASL  621

Query  1795  PDLPETMPVATFW-PQRNV  1848
             P LP  +PV  ++ P  N+
Sbjct  622   PTLPAKLPVPMYFAPSMNL  640



>ref|XP_008670494.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Zea mays]
 tpg|DAA41154.1| TPA: putative lectin-domain receptor-like protein kinase family 
protein [Zea mays]
Length=696

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/621 (47%), Positives = 400/621 (64%), Gaps = 30/621 (5%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSN---VQNITFERTSLVNNSIQITPNQ-----RNCIGRATYSEPLHL  198
             V  LSF  + FT SN      I  +  +  N ++++T  +      + +GRA  ++P+ L
Sbjct  25    VSSLSFKLN-FTESNSNGAATIQLQEDAFYNKAVRLTKEELDGQIAHSVGRAVLADPVTL  83

Query  199   WDKPTGKLSSFNTHFAFVIDSN-GSAKYGDGFAFFLAPLGSRIPPNATKG--GGFGLAND  369
             WD  TG+L+ F T F F+I +      YG+G AFFL+P  S +P N+  G  G FG ++ 
Sbjct  84    WDSSTGELADFTTRFTFMIKARVADGSYGEGLAFFLSPYPSVVPKNSEDGNLGLFGSSSA  143

Query  370   DERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
             D+   +SN  VAVEFD + N +D +  HVGI++ S+ SV    W   I+ G  + AW+ Y
Sbjct  144   DQSSETSNQIVAVEFDSHKNPWDPDDNHVGINIHSIVSVDNVTWRSSIKDGKMANAWVTY  203

Query  550   DPRSMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
                S NLSV         F     +SY +DLR+YLPE+V  GF+ ATG+      I  W 
Sbjct  204   QASSRNLSVFLTYKDSPQFSGNSSLSYSVDLRRYLPEKVAIGFSAATGQLVEAHQILYWE  263

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAW--------RKRKMREE  870
             F S  D+   ++  K+    ++         +    + + F++         RK + ++E
Sbjct  264   F-SCTDVRVVKSK-KAKSLLVISLTTSVSGIVCSMGLVWCFMSLKTKHTRRARKDQGKQE  321

Query  871   FDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVA  1050
             +D+ I    GE   G GP+RF Y EL  AT +F+ + KLGEGGFG+VYKG LK+    VA
Sbjct  322   YDESI---DGEFEKGRGPRRFRYDELVSATKNFALERKLGEGGFGAVYKGSLKDPNLTVA  378

Query  1051  VKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLY  1230
             +KRV++GS QG KEY SEV++ISR+RH+NLV L+GWCHE  + LLVYEF+ N SL++HLY
Sbjct  379   IKRVAKGSTQGKKEYISEVKIISRLRHRNLVQLVGWCHERGEFLLVYEFMPNRSLNTHLY  438

Query  1231  KGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLAR  1410
                +LL WPLR+KI   +ASALLYLHEE E+C+VHRD+K SN+MLDS+ NAKLGDFGLAR
Sbjct  439   DSSNLLAWPLRFKITVGVASALLYLHEEWEQCVVHRDVKPSNVMLDSSFNAKLGDFGLAR  498

Query  1411  LVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEEC  1590
             LVDH++GS+TT +AGTMGY+A ECV +GKASKE+D+YS G++ LE+ACGR+P+    ++ 
Sbjct  499   LVDHDRGSQTTVIAGTMGYLAPECVTTGKASKESDVYSLGVLALEVACGRRPVVLKEDDD  558

Query  1591  HVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQ  1770
              +N+V+WVW+LYG  ++L A D  L G  + RE  ++M+VGLWCAHPD SLRP +RQ I 
Sbjct  559   KINLVEWVWRLYGRNEILTAVDGRLDGALDEREAVRLMVVGLWCAHPDYSLRPCVRQVIS  618

Query  1771  VLNFEAPLPDLPETMPVATFW  1833
             VL FEAPLP LP TMPVA ++
Sbjct  619   VLKFEAPLPSLPPTMPVAVYF  639



>ref|XP_007214191.1| hypothetical protein PRUPE_ppa021403mg [Prunus persica]
 gb|EMJ15390.1| hypothetical protein PRUPE_ppa021403mg [Prunus persica]
Length=689

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/579 (54%), Positives = 401/579 (69%), Gaps = 20/579 (3%)
 Frame = +1

Query  166   GRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKG  345
             GRATYS+P  L +K TGKL+ F T F F +DS   + YGDG AFF+AP GS +  +    
Sbjct  70    GRATYSQPFLLHEKATGKLADFTTSFNFALDSLKESTYGDGLAFFVAPSGSFLLNDTEPA  129

Query  346   GG--FGLANDDERLNSSNPFVAVEFDVY-LNHYDTEQKHVGIDVDSLQSVVTAPWSPDIE  516
             GG   GL  +    N +  FVAVEFD+Y  +  D    HVGIDV+SL S +  PW   I 
Sbjct  130   GGNNLGLPVNFASPNDT-AFVAVEFDIYAYSTTDPPYDHVGIDVNSLNSTIFRPWKGGIM  188

Query  517   GGWGSEAWINYDPRSMNLSVVFRNFG-------SYGHVSYILDLRKYLPERVTFGFAGAT  675
              G  + A I+Y+  S NLSV F  F           H S I+DL++YLP+ V  GF+ +T
Sbjct  189   EGKTNNATISYNSTSKNLSVAFTTFAPDSNVTQEMAHFSDIMDLKQYLPDLVVVGFSAST  248

Query  676   GKDTALQMINSWIFTS-ALDISENQADTKSTgkglviglvvggcfliggSMAFS-FLAWR  849
             G   +L  I SW F+S +L   +  ++ KS  K + + + +G             F+ W+
Sbjct  249   GNYISLNKIISWNFSSTSLGDRDTNSNRKSGNKSIGLAVGLGIGGCAVLVGGLGWFIMWK  308

Query  850   KRKMREEFDDDIFGNIGEL-----GGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVY  1014
             KR+   E  D+    + EL       GAGP++F+Y ELARAT++F + +KLGEGGFG VY
Sbjct  309   KRERAGESSDEDHPMVHELIDDEFEKGAGPRKFSYSELARATSNFEEGEKLGEGGFGGVY  368

Query  1015  KGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYE  1194
             KG++ +L SYVAVKR+S  SKQG KEYASEV++ISR+RH+NLV LIGWCHE K  LLVYE
Sbjct  369   KGFIPDLNSYVAVKRISSSSKQGPKEYASEVKIISRLRHRNLVQLIGWCHERK-FLLVYE  427

Query  1195  FLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSN  1374
             F+ NGSLDSHL+K +SLLTW  RYKI Q LAS L YLHEE E+C++HRDIKSSN+MLDSN
Sbjct  428   FMPNGSLDSHLFKEQSLLTWEARYKIAQGLASGLFYLHEEWEQCVLHRDIKSSNVMLDSN  487

Query  1375  LNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIAC  1554
              NAKLGDFGLARLVDH K S+TT LAGTMGY+A + + +GKASKE+D+YSFG+V LEIAC
Sbjct  488   FNAKLGDFGLARLVDHGKQSQTTILAGTMGYMAPDYLNTGKASKESDVYSFGVVALEIAC  547

Query  1555  GRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPD  1734
             GRKPIDP       N+V+WVW+LYG  ++ +AADP LSGDF+ +++E +MIVGLWCAHPD
Sbjct  548   GRKPIDPKFGSIQSNMVEWVWELYGEDRVNEAADPKLSGDFDKKQMECLMIVGLWCAHPD  607

Query  1735  CSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW-PQRNV  1848
              ++RPSI+QAIQVLNFE PLP+LP  MPVAT++ P ++V
Sbjct  608   YNMRPSIQQAIQVLNFEVPLPNLPSKMPVATYFAPPKSV  646



>ref|XP_010026577.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=649

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/602 (49%), Positives = 397/602 (66%), Gaps = 14/602 (2%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSLVN-NSIQITPNQRNC-IGRATYSEPLHLWDKPTGKLS  225
             LSFN   F P    ++ +E  +  N  +I  T    +C +GRA Y+E L LWD  +G+L+
Sbjct  30    LSFNISRFDP-QATDMVYEGDARPNVGTIDFTSLTYSCHVGRAFYAEKLQLWDSASGRLT  88

Query  226   SFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNPFVA  405
              F+T F+F ID+   + Y  G AFFLAP+G +IP N+  GG  GL N     +SSN  V 
Sbjct  89    DFSTRFSFAIDTRNQSVYAAGLAFFLAPVGFQIPVNSI-GGFLGLFNTTNSDSSSNQIVT  147

Query  406   VEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSVVF  582
             VEFD ++N  +D   +HVGI+ +S+ S VT PW+        ++ WI Y+  + NLSV +
Sbjct  148   VEFDTFVNPEWDPPYEHVGINKNSIASAVTTPWNASFHSDDTADVWIVYNSTTKNLSVSW  207

Query  583   R-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQ  747
                   N      +SY +DL   LP+ V  GF+ ATG       + SW F+S L + E Q
Sbjct  208   SYQTTPNPHENTTMSYQIDLTAVLPQEVMIGFSAATGYYIERHQLGSWTFSSNLGVKEKQ  267

Query  748   ADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIGE-LGGGAGP  924
              + K T   + + + +G        +A S + WR RK R    +    +I E L  GAGP
Sbjct  268   GNAKGTKLVVGLAVPLGVLLCGM--VAISAILWR-RKRRSMGSEMAMTSINEELERGAGP  324

Query  925   KRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASE  1104
             +RF Y +LA ATN+F+++ KLG+GGFG+VY+GYL  L++ VAVKR+SRGSKQG KE+ +E
Sbjct  325   RRFAYADLASATNNFAEERKLGQGGFGAVYRGYLVGLDAAVAVKRISRGSKQGKKEFITE  384

Query  1105  VRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDL  1284
             V+VIS +RH+NLV LIGWCHE  + +LVYEF+ NGSLD HL+  KS L+W  RYKI+  L
Sbjct  385   VKVISSLRHRNLVLLIGWCHEANEFMLVYEFMPNGSLDRHLFGKKSPLSWAARYKILVGL  444

Query  1285  ASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMG  1464
             ASALLYLHEE E+C+VHRDIKSSN+MLDS  N KLGDFGLARL+DHE G +TT LAGT G
Sbjct  445   ASALLYLHEEWEQCVVHRDIKSSNVMLDSGFNVKLGDFGLARLMDHELGPQTTGLAGTFG  504

Query  1465  YIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLL  1644
             Y+A E V +G+ASKE+D+YSFG+V LEIA GR+ +DP      +++ +WVW LYG G+++
Sbjct  505   YMAPEYVSTGRASKESDVYSFGVVALEIATGRRSVDPMERSSQMSLAEWVWDLYGKGRVV  564

Query  1645  DAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVA  1824
             +A D  L   F+G+++E  + VGLWCAHPD  LRPS+RQA+QVLNFEA +P LP  MP+A
Sbjct  565   EAVDERLQAHFDGQQLECSVAVGLWCAHPDRGLRPSVRQALQVLNFEATVPVLPNKMPIA  624

Query  1825  TF  1830
              +
Sbjct  625   VY  626



>ref|XP_006364032.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Solanum tuberosum]
Length=647

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/620 (49%), Positives = 413/620 (67%), Gaps = 27/620 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNCIGR---ATYSEPLHLW  201
             +IP V+ +SF    F P +V +I +E  ++ +   +I  N+ N + R   A Y E + LW
Sbjct  16    LIPFVNSVSFQISRFGP-DVTDILYEGDAVASVG-EIEFNKANYLCRVAHAIYREKVPLW  73

Query  202   D--KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             D    + KL+ F+T F+F ID+   + YG G AFFLAP+G RIPPN + GG  GL N   
Sbjct  74    DPDHDSTKLADFSTRFSFTIDTQNRSSYGHGIAFFLAPVGFRIPPN-SDGGFLGLFNTST  132

Query  376   RLNSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
               ++ +  V+VEFD + N  +D   +HVGI+ +S+ S VT PW+  +  G   E WI Y+
Sbjct  133   SDSAQSQIVSVEFDSFSNVEWDPPFEHVGINNNSIASSVTTPWNVSLHSGDPIETWITYN  192

Query  553   PRSMNLSVVFRNFGSYGHVS--YILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
               + NLSV++ N+G+  + S  YI++LR  LP  VT GF+ ATG++     + SW F+S+
Sbjct  193   ATTNNLSVIW-NYGTGPNSSMFYIINLRDVLPPWVTIGFSAATGQNVERHTLESWEFSSS  251

Query  727   LDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMR--------EEFDDD  882
             LDI+E   + +     +     +GG   +   +A   L   +RK++          F+DD
Sbjct  252   LDITELGGNDREKIGLIAGLTTLGGILFVSAILALVVLRKCRRKVKGNPETISLTSFNDD  311

Query  883   IFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRV  1062
                    L  GAGP++F+Y+EL  +TN FS++ KLGEGGFG VYKGYL +L+  VAVK++
Sbjct  312   -------LEKGAGPRKFSYKELDTSTNHFSEERKLGEGGFGEVYKGYLIDLDIAVAVKKI  364

Query  1063  SRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKS  1242
             SRGSKQG KEY +EV+VISR+RH+NLV LIGWCH+  + LLVYEF+ NGSLD HL+  K+
Sbjct  365   SRGSKQGKKEYITEVKVISRLRHRNLVQLIGWCHDQGEFLLVYEFMPNGSLDFHLFGKKN  424

Query  1243  LLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDH  1422
              L+W +RYKI   LASALLYLHEE E+C++HRDIKSSNIMLDS+ N KLGDFGLARL+DH
Sbjct  425   PLSWTMRYKISLGLASALLYLHEEWEQCVIHRDIKSSNIMLDSSFNVKLGDFGLARLMDH  484

Query  1423  EKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNI  1602
             E G +TT LAGT+GY+A E + +G+ASKE+D+YSFGIV LEIA GRK +DP   +C   +
Sbjct  485   ELGPQTTGLAGTLGYLAPEYIKTGRASKESDVYSFGIVALEIATGRKSVDPGTGKCDAGL  544

Query  1603  VDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNF  1782
             V++VW  Y  G+LL   D  L+ DF   +VE++MI+ LWCAHP+ +LRPSI+QAI VLNF
Sbjct  545   VEYVWDFYEKGKLLSVVDEKLNMDFEQEQVERLMIIALWCAHPESNLRPSIKQAIHVLNF  604

Query  1783  EAPLPDLPETMPVATFWPQR  1842
             EA LP+LP  MPV  ++  R
Sbjct  605   EASLPNLPMKMPVPVYYSPR  624



>ref|XP_006856583.1| hypothetical protein AMTR_s00046p00199100 [Amborella trichopoda]
 gb|ERN18050.1| hypothetical protein AMTR_s00046p00199100 [Amborella trichopoda]
Length=681

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/615 (50%), Positives = 403/615 (66%), Gaps = 28/615 (5%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSLVN-NSIQITPNQ-----RNCIGRATYSEPLHLWDKPT  213
             ++FNFD F P ++ NI++E  +L N  +IQ+T  Q     ++ +GRA Y  P+ LWD  T
Sbjct  26    VTFNFDSF-PVSLPNISYEGDALPNGTAIQVTRTQTGDNLQDSVGRAFYKHPIRLWDSAT  84

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSN  393
             G +S F THF FVIDS+  +K GDG AFFLA   +   P+ + GG   L +     NS +
Sbjct  85    GIVSDFTTHFEFVIDSSDMSKSGDGLAFFLA--ANSTIPSKSWGGQLALFDSSLDNNSVS  142

Query  394   PFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLS  573
               VAVEFD Y N +D  + H+GID++S+ S  + PW+  ++ G  S AW+ Y+  + NLS
Sbjct  143   RVVAVEFDTYQNEWDPTRNHIGIDINSVVSKASRPWNSKLQNGSRSNAWVTYNATTRNLS  202

Query  574   VVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDIS  738
             V         F    ++SY +D+ K LPE VT GF+ ATG    L  I SW F S+L   
Sbjct  203   VFLTQENNPTFNGNSNLSYEVDMSKVLPECVTVGFSAATGWAIELHTILSWEFNSSLGSC  262

Query  739   ENQADTKSTgkglviglvvggcfliggSMAFS-------FLAWRKRKMREEFDDDIFGNI  897
             E   +TK     +         ++     AF         + WRK   +   + D+  + 
Sbjct  263   E---ETKQPNVIVDHKDRRWMVWMSLCLGAFMIGVLVLILIVWRKIAKKRRGNGDLHVDE  319

Query  898   G----ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVS  1065
                  E     GP+RF Y+EL  ATN FS++ KLGEGGFG VY G L + +  VAVKR+S
Sbjct  320   ESMDEEFERETGPRRFAYKELVSATNDFSEKGKLGEGGFGGVYMGLLSDTKETVAVKRIS  379

Query  1066  RGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSL  1245
             +GS+QG KEY +EVR+ISR+RH+NLV L+GWCH   +LLLVYEF+ NGSLD +L+  KS 
Sbjct  380   KGSRQGKKEYITEVRIISRLRHRNLVQLMGWCHYKTELLLVYEFMPNGSLDRYLFGKKSG  439

Query  1246  LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHE  1425
             LTW LRYKI   L+SALLYLHEE E+C+VHRDIKSSN+MLDS  NAKLGDFGLARLVDH 
Sbjct  440   LTWELRYKIALGLSSALLYLHEEWEQCVVHRDIKSSNVMLDSKFNAKLGDFGLARLVDHN  499

Query  1426  KGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIV  1605
             + S+TT +AGTMGY+A ECV  GKASKE+D++S G+V LEI CGR+ I+P AE   V +V
Sbjct  500   RDSQTTVVAGTMGYLAPECVTDGKASKESDVFSLGVVALEICCGRRAIEPLAEASKVRLV  559

Query  1606  DWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFE  1785
             +WVW+LYG G+L+D  D  LSG+F+ ++VE +M+VGLWCAHPD ++RPSIR+AIQVLNFE
Sbjct  560   EWVWELYGRGRLIDCVDEALSGEFDDKQVECLMVVGLWCAHPDYAMRPSIRRAIQVLNFE  619

Query  1786  APLPDLPETMPVATF  1830
             A LP LP  +PVA +
Sbjct  620   AQLPALPSKIPVAMY  634



>ref|XP_010668420.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Beta vulgaris subsp. vulgaris]
Length=704

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/623 (49%), Positives = 401/623 (64%), Gaps = 30/623 (5%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFERTSL-VNNSIQITPNQRNC-----IGRATYSEPLHLWD  204
             V  + F+F  F  +N QNI+++  S+  N  +Q+T N+ +      +GR +YS+P+ LWD
Sbjct  35    VESIFFHFTHFDLNNAQNISYQNDSMPANGVMQLTKNRADVGPQFSVGRTSYSQPVRLWD  94

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPL--GSRIPPNATKGGGFGLA---ND  369
             + T +  SF+THF+F I        GDGFAFFL      +   P+ + GG  GL    N 
Sbjct  95    RNTNETISFSTHFSFNITQMRRVA-GDGFAFFLTAFDESTAYAPDYSAGGCLGLIGGHNH  153

Query  370   DERLNSSNPFVAVEFDVYLNHYD----TEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
                + + +PFVAVEFD Y N YD        H+GIDV+SL S    PWS  +  G  +  
Sbjct  154   TCNITNKHPFVAVEFDTYNNWYDPGSFLRDAHLGIDVNSLNSTAYLPWS--VVNGTAANV  211

Query  538   WINYDPRSMNLSVVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMI  702
             WI YD  +MNLSV F       F    ++S++++L   LPE++  GF+ ATG D     I
Sbjct  212   WITYDSSTMNLSVYFSYDVNPVFNGEYNLSHVINLTAILPEKIRVGFSAATGTDFEFHNI  271

Query  703   NSWIFTSALDISENQADTKSTgkglviglvvggc---fliggSMAFSFLAWRKRKMREEF  873
              SW F S L+ +E    T+ +     + +V G      L+   + F    W +R+ RE  
Sbjct  272   LSWEFNSTLEDTEFSVLTRKSQSKHRVAIVGGVLGGIALLVIGLGFIVFLWWQRRARERS  331

Query  874   DDDI--FGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYV  1047
              D    F    +     GPKRFTY EL+ ATN+FS++ KLGEGGFG VY+G+L +L+ Y+
Sbjct  332   SDHEMNFDVDDDFDKETGPKRFTYNELSHATNNFSEEQKLGEGGFGGVYRGFLTDLDRYI  391

Query  1048  AVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHL  1227
             AVK++SR SKQG KE+ SEVR+IS +RHKNLV L+GWCHE  DLLLVYE + NGSLDSHL
Sbjct  392   AVKKISRESKQGKKEFMSEVRIISCLRHKNLVQLLGWCHERGDLLLVYECMPNGSLDSHL  451

Query  1228  Y--KGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFG  1401
             Y  K KS+L W +RY I Q LASALLYLHEE E+C++HRDIKSSN+MLD + NAKLGDFG
Sbjct  452   YRSKRKSVLQWTIRYNIAQGLASALLYLHEEWEQCVLHRDIKSSNVMLDIDFNAKLGDFG  511

Query  1402  LARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTA  1581
             LARLVDH   S+TT LAGT+GY+A E   +GKAS+E D+YSFG+VTLEIACGR+PID   
Sbjct  512   LARLVDHSTTSQTTLLAGTLGYLAPEVFNTGKASREADVYSFGVVTLEIACGRQPIDYKE  571

Query  1582  EECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQ  1761
             E   V +V+WVW LYG G+LL+A D  L G+ + ++++ +M+VGLWC HPD + RPSIRQ
Sbjct  572   EPTKVKMVEWVWNLYGEGRLLEAVDIELEGELDTQQIKCLMMVGLWCCHPDHTCRPSIRQ  631

Query  1762  AIQVLNFEAPLPDLPETMPVATF  1830
             AI VLN E+PLP LP   PV  +
Sbjct  632   AINVLNSESPLPTLPSKFPVPIY  654



>ref|XP_010026585.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1 
[Eucalyptus grandis]
 gb|KCW59673.1| hypothetical protein EUGRSUZ_H02428 [Eucalyptus grandis]
Length=653

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/612 (49%), Positives = 399/612 (65%), Gaps = 16/612 (3%)
 Frame = +1

Query  34    IPL--VHPLSFNFDLFTPSNVQNITFERTSLVNN---SIQITPNQRNC-IGRATYSEPLH  195
             +PL   + LSFN   F    V N+ +E  +  N    ++  T     C +GRA Y++ L 
Sbjct  22    VPLRSSYSLSFNISRFD-GKVTNMVYEGDARPNGGTGTVDFTSATYYCHVGRAFYTQKLR  80

Query  196   LWDKPTGKLSSFNTHFAFVIDS-NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
             LWD  T +L+ F+T F+F ID+ N S +YG G AFFLAP+G +IP N+  GG  GL N  
Sbjct  81    LWDSATRRLTDFSTRFSFTIDTWNRSLEYGAGLAFFLAPVGFQIPVNSV-GGFLGLFNTT  139

Query  373   ERLNSSNPFVAVEFDVYLNH-YDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
                +S N  VAVEFD   N  +D   +HVGI+++S+ SVVT PW+        ++AW+ Y
Sbjct  140   YSDSSLNRIVAVEFDPCANSDWDPPYEHVGININSIASVVTTPWNASFHSADSADAWVVY  199

Query  550   DPRSMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             +  + NLSV +      N      +SY +DL   LPE V  GF+ ATG       + SW 
Sbjct  200   NSTTKNLSVSWSYQTTSNPNESTSISYQIDLTTVLPEEVMIGFSAATGYYMERHQLESWS  259

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGN  894
             F+S L+  E   + K T   + + +  G        ++ + L  RKR+       ++   
Sbjct  260   FSSNLEFEEQHRNAKRTKLVVGVAVPPGVLLCGIVVIS-AILRRRKRRSEGSETANLMSI  318

Query  895   IGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGS  1074
              GEL  GAGP+RFTY +L  ATN+F ++ KLG+GGFG+VYKGYL  L++ VAVKR+SRGS
Sbjct  319   NGELERGAGPRRFTYADLVSATNNFDEERKLGQGGFGAVYKGYLVGLDAAVAVKRISRGS  378

Query  1075  KQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTW  1254
             KQG KE+ +EV+VIS +RH+NLV LIGWCHE  + +LVYE + NGSLD HL+  K +L W
Sbjct  379   KQGKKEFITEVKVISSLRHRNLVQLIGWCHEANEFMLVYELMPNGSLDRHLFGKKRILGW  438

Query  1255  PLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGS  1434
               R KI   LASA+LYLHEE E+C+VHRDIKSSN+MLDS  N KLGDFGLARL+DHE G 
Sbjct  439   AARLKISVGLASAILYLHEEWEQCVVHRDIKSSNVMLDSGFNVKLGDFGLARLMDHELGP  498

Query  1435  RTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWV  1614
             +TT LAGT GY+A E V +G+ASKE+D+YSFG+V +EIA GR+ +DP  +  HV++V WV
Sbjct  499   QTTGLAGTFGYLAPEYVSTGRASKESDVYSFGVVAIEIATGRRAVDPMEQSSHVSLVGWV  558

Query  1615  WKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPL  1794
             W LYG GQ+++A D  L  DF+  +VE++++VGLWCAHPD SLRP++RQ IQVLNFEA +
Sbjct  559   WDLYGRGQVIEAMDDKLQVDFDQNQVERLLVVGLWCAHPDRSLRPTVRQVIQVLNFEAAV  618

Query  1795  PDLPETMPVATF  1830
             P LP  +PVA +
Sbjct  619   PVLPNKLPVAVY  630



>ref|XP_007211329.1| hypothetical protein PRUPE_ppa022345mg [Prunus persica]
 gb|EMJ12528.1| hypothetical protein PRUPE_ppa022345mg [Prunus persica]
Length=689

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/579 (54%), Positives = 401/579 (69%), Gaps = 20/579 (3%)
 Frame = +1

Query  166   GRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKG  345
             GRATYS+P  L +K TGKL+ F T F F +DS   + YGDG AFF+AP GS +  +    
Sbjct  70    GRATYSQPFLLHEKATGKLADFTTSFNFALDSLKESTYGDGLAFFVAPSGSFLLNDTEPA  129

Query  346   GG--FGLANDDERLNSSNPFVAVEFDVY-LNHYDTEQKHVGIDVDSLQSVVTAPWSPDIE  516
             GG   GL  +    N +  FVAVEFD+Y  +  D    HVGIDV+SL S +  PW   I 
Sbjct  130   GGNNLGLPVNFASPNDT-AFVAVEFDIYAYSTTDPPYDHVGIDVNSLNSTIFRPWKGGIM  188

Query  517   GGWGSEAWINYDPRSMNLSVVFRNFG-------SYGHVSYILDLRKYLPERVTFGFAGAT  675
              G  + A I+Y+  S NLSV F  F           H S I+DL++YLP+ V  GF+ +T
Sbjct  189   EGKTNNATISYNSTSKNLSVAFTTFAPDSNVTQEMAHFSDIMDLKQYLPDLVVVGFSAST  248

Query  676   GKDTALQMINSWIFTS-ALDISENQADTKSTgkglviglvvggcfliggSMAFS-FLAWR  849
             G   +L  I SW F+S +L   +  ++ KS  K + + + +G             F+ W+
Sbjct  249   GNYISLNKIISWNFSSTSLGDRDTNSNRKSGNKSIGLAVGLGIGGCAVLVGGLGWFIMWK  308

Query  850   KRKMREEFDDDIFGNIGEL-----GGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVY  1014
             KR+   E  D+    + EL       GAGP++F+Y ELARAT++F + +KLGEGGFG VY
Sbjct  309   KRERAGESSDEDHPMVHELIDDEFEKGAGPRKFSYSELARATSNFEEGEKLGEGGFGGVY  368

Query  1015  KGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYE  1194
             KG++ +L SYVAVKR+S  SKQG KEYASEV++ISR+RH+NLV LIGWCHE K  LLVYE
Sbjct  369   KGFIPDLNSYVAVKRISSSSKQGPKEYASEVKIISRLRHRNLVQLIGWCHERK-FLLVYE  427

Query  1195  FLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSN  1374
             F+ NGSLDSHL+K +SLLTW  RYKI Q LAS L YLHEE E+C++HRDIKSSN+MLDSN
Sbjct  428   FMPNGSLDSHLFKEQSLLTWEARYKIAQGLASGLFYLHEEWEQCVLHRDIKSSNVMLDSN  487

Query  1375  LNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIAC  1554
              NAKLGDFGLARLVDH K S+TT LAGTMGY+A + + +GKASKE+D+YSFG+V LEIAC
Sbjct  488   FNAKLGDFGLARLVDHGKQSQTTILAGTMGYMAPDYLNTGKASKESDVYSFGVVALEIAC  547

Query  1555  GRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPD  1734
             GRKPIDP       N+V+WVW+LYG  ++ +AADP LSGDF+ +++E +MIVGLWCAHPD
Sbjct  548   GRKPIDPKFGGIQSNMVEWVWELYGEDRVNEAADPKLSGDFDKKQMECLMIVGLWCAHPD  607

Query  1735  CSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW-PQRNV  1848
              ++RPSI+QAIQVLNFE PLP+LP  MPVAT++ P ++V
Sbjct  608   YNMRPSIQQAIQVLNFEVPLPNLPSKMPVATYFAPPKSV  646



>ref|XP_010254612.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Nelumbo nucifera]
Length=733

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/612 (50%), Positives = 406/612 (66%), Gaps = 22/612 (4%)
 Frame = +1

Query  40    LVHPLSFNFDLFTPSNVQNITFER-TSLVNNSIQITPNQRNCIGRATYSEPLHLWDKPTG  216
             L  PL F+FD    S+ Q IT+E   S  +  IQ+     N   RA YS+PL LW++ T 
Sbjct  39    LSTPLRFSFD----SDAQEITYEGGASASDKFIQLNGPGGNQ-DRAIYSKPLQLWERETK  93

Query  217   KLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN-SSN  393
             +L+   T F+F+ID + +  +GD  AFFLAP GS IP   ++GG   L N     N S +
Sbjct  94    ELADLTTKFSFIIDPSNNTNHGDRLAFFLAPRGSTIPAADSRGGLLALVNSTLPSNFSRD  153

Query  394   PFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLS  573
               VAVEFD + + +D    H+GI+V+S+ SV  A W+  +  G  + AW+NYD  S NLS
Sbjct  154   QIVAVEFDTHQDSWDPSGNHIGINVNSIVSVADAIWNSSMWDGRIANAWVNYDSTSKNLS  213

Query  574   VVFRNFGSYG------HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDI  735
             V+     SY        +SY++DLR YLPE VT GF+ +TG         SW F S+L  
Sbjct  214   VILTYIDSYSVFKENSSLSYVIDLRDYLPEWVTVGFSASTGFPVEQHKTLSWEFDSSL--  271

Query  736   SENQADTKSTgkglviglvvggcfliggSMAFS-FLAWRKR-KMREEFDDDIFGNIG---  900
              E +   ++     +I  +    +++ G M    FL W KR K R E D+D+  +     
Sbjct  272   -ETETLDRANLVSKLITALSNEVYILMGCMGVGWFLLWMKRGKERREGDEDMVLDDSVND  330

Query  901   ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQ  1080
             E   G GPKRF+Y ELARAT+ F ++ KLGEGGFG VY+G+L++L   VAVKRVS+ SKQ
Sbjct  331   EFEKGTGPKRFSYGELARATSKFLEERKLGEGGFGGVYRGFLRDLNLDVAVKRVSKNSKQ  390

Query  1081  GIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPL  1260
             GIKEY +EV++ISR+RHKNLV L+GWCH+  +L+LVYE++ NGSLDS+L+K K LL+W  
Sbjct  391   GIKEYMAEVKIISRLRHKNLVQLVGWCHQRNELILVYEYMPNGSLDSYLFKQKGLLSWDS  450

Query  1261  RYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRT  1440
             RYKI   LASAL YLHE  E+C++HRDIKSSN+MLDS+ NAKLGDFGLA+LVDHE+ S+T
Sbjct  451   RYKIALGLASALFYLHEGWEQCVLHRDIKSSNVMLDSSFNAKLGDFGLAKLVDHEQLSQT  510

Query  1441  TALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWK  1620
             T  AGTMGY+A E   SGKASKE+D+YSFGIV LEIACGR+ ++   EE  + +V+WVW+
Sbjct  511   TVPAGTMGYMAPEYCTSGKASKESDVYSFGIVALEIACGRRSVELKFEEGKMMLVEWVWE  570

Query  1621  LYGTGQLLDAADPNLSG-DFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLP  1797
             LYG G++L+A DP L    ++  +VE +MIVGLWCAHPD   RPS+RQ + VL+FEA LP
Sbjct  571   LYGRGKVLEAIDPRLRDMSYDEEQVECLMIVGLWCAHPDHHSRPSMRQVMHVLSFEASLP  630

Query  1798  DLPETMPVATFW  1833
              LP  MPV T++
Sbjct  631   TLPSNMPVPTYY  642



>ref|XP_008386331.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Malus domestica]
Length=694

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/649 (49%), Positives = 419/649 (65%), Gaps = 48/649 (7%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNSI------QITPNQRNCIGRATYSEPLHL  198
             P + PL+F+F  F+ ++   I  E  + ++          +   +   +GRAT+ +P  L
Sbjct  27    PPITPLNFSFSSFSGADFATILPEGDAYLDPQFLRLTKSAVDQEKSGSVGRATFRQPFLL  86

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGL------  360
              +  TGKL+ F T+F F IDSN S  YGDG AFF+AP GS +     KG   GL      
Sbjct  87    RENATGKLADFTTNFIFAIDSNHSVNYGDGLAFFIAPNGSFLNATLGKGSSLGLPFDSTP  146

Query  361   ANDDERLNSSNPFVAVEFDVYLNHY-----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGW  525
             +ND   + +  PFVAVEFD++ N       D    HVGIDV+SL S +T+ W   I  G 
Sbjct  147   SNDTSIVRNQYPFVAVEFDIFPNGKQPAFDDPNFPHVGIDVNSLNSSITSCWDGGIMVGK  206

Query  526   GSEAWINYDPRSMNLSVVFRNFG------SYGHVSYILDLRKYLPERVTFGFAGATGKDT  687
              + A + Y+  + NLS+   +F          H+ YI+DL  YLP+ V  GF+ +TG   
Sbjct  207   PNSATVTYNSTTKNLSLAVTSFDYNYIELEMKHIYYIIDLNDYLPDWVVVGFSASTGSSV  266

Query  688   ALQMINSWIFTSALDISEN--------------------QADTKSTgkglviglvvggcf  807
             +LQ I SW FTS   +                        A        ++   V G   
Sbjct  267   SLQKIISWNFTSTSLVDHEVDAAPPPAVVAVPASNPMAGSAYRSKRIGLVIGLGVGGCAV  326

Query  808   liggSMAFSFLAWRKRKMREEFDDDIFGNI---GELGGGAGPKRFTYRELARATNSFSQQ  978
             ++GG     F+ W+KR+  E  D+D   +     +   GAGP++F+YRELA+ATN+F ++
Sbjct  327   VVGGLGLVLFILWKKRETGESSDEDPVVHELVDNDFEKGAGPRKFSYRELAQATNNFGEE  386

Query  979   DKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGW  1158
             + LGEGGFG VYKG + +L+S VAVKR+SRGSKQG+KEY SEV++ISR+RH+NLV LIGW
Sbjct  387   EMLGEGGFGGVYKGVIPDLKSPVAVKRMSRGSKQGLKEYVSEVKIISRLRHRNLVQLIGW  446

Query  1159  CHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHR  1338
             CHE K  LLVYEF+  GSLDSHL+K +S+LTW  RYKI Q LAS L YLH++ E+C++HR
Sbjct  447   CHERK-FLLVYEFMPKGSLDSHLFKEQSVLTWEARYKIAQGLASGLFYLHQQWEQCVLHR  505

Query  1339  DIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDI  1518
             DIKSSNIMLD+N ++KLGDFGLARLVDH +  +TTALAGT+GY+A E VV+GKASKE+D+
Sbjct  506   DIKSSNIMLDANFSSKLGDFGLARLVDHGQEPQTTALAGTLGYMAPEYVVTGKASKESDV  565

Query  1519  YSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQ  1698
             YSFGIV LEI CGRK IDP      VN+V+WVW+LYG  ++++AADP L GDF+G+++E 
Sbjct  566   YSFGIVALEICCGRKSIDPKFGSSKVNLVEWVWELYGEERVIEAADPKLCGDFDGQQMEC  625

Query  1699  MMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW-PQR  1842
             +MIVGLWCAHPD  +RPSI+QAIQ LNFEAPLP+LP  MPVAT++ P R
Sbjct  626   LMIVGLWCAHPDYKMRPSIQQAIQGLNFEAPLPNLPSKMPVATYFAPPR  674



>ref|XP_009772390.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Nicotiana sylvestris]
Length=649

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/615 (49%), Positives = 407/615 (66%), Gaps = 24/615 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVN-NSIQITPNQRNC-IGRATYSEPLHLWD  204
             +IP V+ + F    F P +V +I +E  ++ +   I+       C +  A Y E + +WD
Sbjct  20    LIPFVNSVYFKIPRFGP-DVTDILYEGDAVASVGEIEFNKFTYLCRVAHAIYKEKVPIWD  78

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
               + KL+ F+THF+F ID+  S+ YG G AFFLAP+G +IPPN + GG  GL N     +
Sbjct  79    PDSTKLADFSTHFSFTIDTLNSSLYGHGIAFFLAPVGFQIPPN-SDGGFLGLFNTTTSDS  137

Query  385   SSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
             + N  V VEFD + N  +D   +HVGI+ +S+ S  TAPW+  +  G   +AWI Y+  +
Sbjct  138   AQNQIVVVEFDSFSNPEWDPPFEHVGINKNSIASSETAPWNVSLHSGDPIDAWITYNSTT  197

Query  562   MNLSVVFRNFG--SYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDI  735
              NLSV F N+G  S   +SYI++LR+ LP  +T GF+ ATGK+     + SW F+S+LD+
Sbjct  198   KNLSV-FWNYGKGSNSSISYIINLREVLPSWITIGFSAATGKNVERHTLESWEFSSSLDM  256

Query  736   SENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMR---------EEFDDDIF  888
              E   + +     +     +GG   +   +A   L   +R+             F+DD  
Sbjct  257   EELGGNGRRKIGLIAGLTALGGVLFVSAILALVILRKWRRRKMKRNPETISLTSFNDD--  314

Query  889   GNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSR  1068
                  L  G GPK+F+Y EL  +TN FS++ KLGEGGFG VYKGYL +L+  +AVK++SR
Sbjct  315   -----LEKGTGPKKFSYEELDTSTNHFSEERKLGEGGFGEVYKGYLIDLDIAIAVKKISR  369

Query  1069  GSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLL  1248
             GSKQG KEY +EV+VISR+RH+NLV LIGWCH+    LLVYEF+ NGSLD HL+  ++ L
Sbjct  370   GSKQGKKEYITEVKVISRLRHRNLVQLIGWCHDQGKFLLVYEFMPNGSLDCHLFGKRNPL  429

Query  1249  TWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEK  1428
             +W  RYKI   LASALLYLHEE E+C++HRDIKSSN+MLDS+ N KLGDFGLARL+DHE 
Sbjct  430   SWNTRYKISLGLASALLYLHEEWEQCVIHRDIKSSNVMLDSSFNVKLGDFGLARLMDHEL  489

Query  1429  GSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVD  1608
             G +TT LAGT+GY+A E + +G+ASKE+D+YSFGIV LEIA GRK +DP   +    +V+
Sbjct  490   GPQTTGLAGTLGYLAPEYIKTGRASKESDVYSFGIVALEIATGRKSVDPGTGKSDAGLVE  549

Query  1609  WVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEA  1788
             +VW+LYG G+LL   D  L+ DF+ ++VE++MI GLWCAHP+ +LRPSIRQAI VLNFEA
Sbjct  550   YVWELYGKGKLLSVVDEKLNLDFDAKQVERLMITGLWCAHPESNLRPSIRQAIHVLNFEA  609

Query  1789  PLPDLPETMPVATFW  1833
              LP+LP  MPV  ++
Sbjct  610   SLPNLPVKMPVPVYY  624



>gb|AES82675.2| concanavalin A-like lectin kinase family protein, putative [Medicago 
truncatula]
Length=656

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/616 (50%), Positives = 408/616 (66%), Gaps = 35/616 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFE-RTSLVNNSIQITP-----NQRNCIGRATYSEPL  192
             +I  V PLSFN+         N+  E   SL+ +SIQ+T      ++   +GR T  EPL
Sbjct  20    MITSVKPLSFNYQ--QGFKYDNVKLEGDASLLYSSIQLTSTSSYEDETYSVGRVTCFEPL  77

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LW+K + KL+ F T F+FVI SN +  +GDG AFF A     +  +  +GGG GL ND 
Sbjct  78    QLWEKTSRKLTDFTTQFSFVIFSNKTY-FGDGLAFFFADPRLPLYYHIRQGGGLGLVNDY  136

Query  373   ERLNSSN-PFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
             + LNS+   FVAVEFD + N +D    HVGI+ +SL+S +T PW  DI         I Y
Sbjct  137   QILNSNGYSFVAVEFDTHQNDWDPPGTHVGINFNSLRSNITKPWFMDIRNKKAYHCKIEY  196

Query  550   DPRSMNLSVVF-RNFG----SYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             +  + +L V F  N      SY H+SY +DLR YLPERV FGF+ ATG    +  + SW 
Sbjct  197   NSSAHDLKVSFTENITNGEPSYSHLSYNVDLRDYLPERVIFGFSAATGYMFEMNKLLSWS  256

Query  715   FTSALDISENQA------DTKSTgkglviglvvggcfliggSMAFSFL--------AWRK  852
             F S+L+ +          + K + K       +     +G  +A SFL         W++
Sbjct  257   FNSSLNQTSPVESPSPVPNIKISIKTDSKAGSIWVGVGVGVGIASSFLILGWFCISMWKR  316

Query  853   RKMREEFDDDIFG--NIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYL  1026
              K  +E  D IF      E   G GPK+F Y +L  ATN+F++ +K+G+GGFG VYKGYL
Sbjct  317   SKGNKE--DSIFDLKMDDEFQKGTGPKKFCYNKLVSATNNFAEAEKIGQGGFGGVYKGYL  374

Query  1027  KELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSN  1206
             K++++ VA+KR+SR SKQGIKEYA+EV++I ++RH+NLV LIGWCH+ +D LL+YEF+ N
Sbjct  375   KDIDTNVAIKRISRESKQGIKEYATEVKIIGQLRHRNLVQLIGWCHKKRDFLLIYEFMQN  434

Query  1207  GSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAK  1386
             GSLDSHLY+GKS+LTW +RY I  DLASALLYLHEE E+C++HRD+KSSNIMLD+N NAK
Sbjct  435   GSLDSHLYRGKSVLTWQMRYNIAMDLASALLYLHEEWEQCVLHRDVKSSNIMLDNNFNAK  494

Query  1387  LGDFGLARLVDHEKGSR--TTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGR  1560
             LGDFGLARLVDHEKGS+  TT +AGTMGYIA E + +GKA+KE+DIYSFGIV+LE+A GR
Sbjct  495   LGDFGLARLVDHEKGSQSDTTIIAGTMGYIAPEYITTGKATKESDIYSFGIVSLELASGR  554

Query  1561  KPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCS  1740
             KP+D  A+E  + I DWVW+LY  G+LL+  D  L G F+  ++E+++++GLWCA+P+ S
Sbjct  555   KPVDLNAKEDQMAIFDWVWELYRLGRLLEVVDTKLGGAFDEEQMERLVVIGLWCANPNYS  614

Query  1741  LRPSIRQAIQVLNFEA  1788
              RPS+RQ IQVL  EA
Sbjct  615   FRPSVRQVIQVLKLEA  630



>ref|XP_008450172.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cucumis melo]
Length=685

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/657 (49%), Positives = 420/657 (64%), Gaps = 36/657 (5%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLV-NNSIQITPNQRN-----CIGRATYSEPL  192
             I+  V  LSF F  F  +N  N  FE  S   NN IQ+T NQ +       GRA+Y+ P+
Sbjct  26    ILFKVQSLSFTFPNFQQNN-PNFFFEGDSFTSNNVIQLTKNQADGPLTESSGRASYAHPV  84

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWD  TG+++ F THF+F I++   + +GDG AFF+ P  S +P N+T GG  GL + D
Sbjct  85    RLWDASTGQVTDFTTHFSFRINTLNESLFGDGIAFFIVPYESELPTNST-GGFLGLFSSD  143

Query  373   ERLN-SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
                + S N    VEFD   + +D    H+GI+V+S++S+    W+  ++    + AWI Y
Sbjct  144   LAFDPSKNQVFGVEFDSKQDDWDASDNHIGINVNSIRSIDHLMWNSSMKDNRTANAWITY  203

Query  550   DPRSMNLSVVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             +  + NLSV         F     +S  +DL+ +LPERV  GF+ ATGK   +  I SW 
Sbjct  204   NSATNNLSVFLTYVRDPIFNGTFSISTFVDLKSFLPERVRVGFSAATGKWFQIHNIISWS  263

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGN  894
             F S LD +    D K+   GL IGL VG   LI G +      W K+  +   DD     
Sbjct  264   FNSTLDDNLGGGD-KNKNIGLAIGLGVGFGVLICGLILLGIFWWGKKSRKRMEDDVDDSI  322

Query  895   IGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGS  1074
               E   G GPKRFTYREL +AT +F +  KLGEGGFG VYKG L E  + +AVKRVSRGS
Sbjct  323   DDEFEKGTGPKRFTYRELTQATKNFDEAGKLGEGGFGGVYKGLLTESNTEIAVKRVSRGS  382

Query  1075  KQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTW  1254
             +QG KEY SEV++ISR+RH+NLV L GWCHE  + LLVYEF+ NGSLD+HL++G+++L+W
Sbjct  383   RQGKKEYISEVKIISRLRHRNLVQLFGWCHEKGEFLLVYEFMPNGSLDTHLFRGQTMLSW  442

Query  1255  PLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGS  1434
             P+RYKI   LAS+LLYLHEE E+C+VHRDIKSSN+MLDSN NAKLGDFGLAR VDHE GS
Sbjct  443   PVRYKIAIGLASSLLYLHEEWEQCVVHRDIKSSNVMLDSNFNAKLGDFGLARFVDHELGS  502

Query  1435  RTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWV  1614
             +TT LAGTMGY+A ECV  GKASKE+D+YSFG+V LEIACGR+P++  AE   V +V+WV
Sbjct  503   QTTVLAGTMGYLAPECVTDGKASKESDVYSFGVVALEIACGRRPVESRAEPDQVRLVEWV  562

Query  1615  WKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPL  1794
             W++YG GQLL  AD  L  +F+ +++E +M+VGLWC HPD  LRPSIRQ I  LNFEA L
Sbjct  563   WEMYGRGQLLKTADKRLGMEFDEQQMEALMVVGLWCCHPDFKLRPSIRQVINALNFEASL  622

Query  1795  PDLPETMPVATFW-PQRNVQysssssyygsdvsqtsQTKSLVSSGN----TDCSCSS  1950
             P LP  +PV  ++ P  N+                 +  S  SSG     ++CSCS+
Sbjct  623   PALPAKLPVPMYFAPPMNL----------------CKFSSYTSSGTPVDRSECSCSN  663



>ref|XP_010099408.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis]
 gb|EXB78253.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis]
Length=653

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/613 (49%), Positives = 411/613 (67%), Gaps = 16/613 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRN--C-IGRATYSEPLHLW  201
             IIP  +PL+F    F  SN   I ++  ++ +       N+ N  C +GRATY+E + L+
Sbjct  22    IIPSSYPLNFQISRFD-SNDPRIAYQGDAIPSVGAIELINKVNYVCRVGRATYTEKVPLY  80

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             D  TGK + F THF+F I + GS +YG G  FFLAP+G +IPPN+  GG  GL N     
Sbjct  81    DPHTGKAADFTTHFSFTITTQGS-QYGHGITFFLAPVGFQIPPNSA-GGFLGLFNTTTSD  138

Query  382   NSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
             +S N  V +EFD ++N  +D   +HVGI+ +S+ S VT PW+        ++ WI+Y+  
Sbjct  139   SSRNQIVMIEFDSFVNPEWDPPHEHVGINNNSIHSAVTTPWNASKHSDDNTDVWISYNAS  198

Query  559   SMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
             + +LS  +    S       +SY +DL + LP+ VT GF+G TG      ++NSW F+S+
Sbjct  199   TKSLSARWSYQTSPRENVTGLSYHIDLMQVLPQWVTIGFSGTTGVYGERAVVNSWEFSSS  258

Query  727   LDISENQADT--KSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG  900
             L+I E   D   K     + + +  G        +    L+ RK+K+RE+       +I 
Sbjct  259   LEIKEKSGDDIGKKIRLIVGVTVSGGALIAALVIITLLVLSKRKQKIREKAKSTNCASIN  318

Query  901   --ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGS  1074
               +L  GAGP+RF+Y++LA ATN+FS + KLGEGGFG+VY+GYL +L++ +AVK++SRGS
Sbjct  319   NDDLERGAGPRRFSYKDLAEATNNFSGERKLGEGGFGAVYRGYLPDLDTLIAVKKISRGS  378

Query  1075  KQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLY-KGKSLLT  1251
             +QG KEY +EV++IS++RH+NLV LIGWCH+  + LLVYEF+ NGSL SHL+ K  S L+
Sbjct  379   RQGKKEYLTEVKIISQLRHRNLVQLIGWCHDRGEFLLVYEFMPNGSLASHLFDKRISPLS  438

Query  1252  WPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKG  1431
             W +RYKI   LASALLYLHEE E+C+VHRD+KSSNIMLDS+ N KLGDFGLARL+DHE G
Sbjct  439   WGVRYKISLGLASALLYLHEEWERCVVHRDVKSSNIMLDSSFNVKLGDFGLARLMDHELG  498

Query  1432  SRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDW  1611
              +TT L GT+GY+A E V +G+ASKE+D+YSFG+V LEIA GRK +D T ++  + +V W
Sbjct  499   PQTTGLVGTLGYLAPEYVSTGRASKESDVYSFGVVALEIATGRKAVDLTEKDSEMGLVQW  558

Query  1612  VWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAP  1791
             VW LYG G+L  A D  +  DF+ ++VE  MIVGLWCAHPD SLRPSI+QAIQVLNFEA 
Sbjct  559   VWDLYGKGKLAMAVDERIQLDFDQKQVECSMIVGLWCAHPDRSLRPSIKQAIQVLNFEAT  618

Query  1792  LPDLPETMPVATF  1830
              P+LP +MPV  +
Sbjct  619   WPNLPASMPVPVY  631



>ref|XP_011028142.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Populus euphratica]
Length=651

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/607 (48%), Positives = 405/607 (67%), Gaps = 11/607 (2%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNC-IGRATYSEPLHLWDKPT  213
             P  + +SF    F PS++  I     S    SI+   +   C +GRATY++ + LWD  T
Sbjct  25    PSANSISFQRTRFDPSDISIICEGGASTRVGSIEFNSDTYMCQVGRATYAKKVPLWDSST  84

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSN  393
              +L+ F+THF+F ID  G   Y  GFAFF+AP+   IPPN+  GG  GL N     +  N
Sbjct  85    TRLTDFSTHFSFYIDIQGRTSYAAGFAFFIAPVEFHIPPNSA-GGFLGLYNITTSDSPQN  143

Query  394   PFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNL  570
               V +EFD + N  +D   +HVGI+ +S+ S     W+  +  G  ++  I Y+  + NL
Sbjct  144   HIVHIEFDSFANPEWDPPIQHVGINNNSVSSATYTYWNTSLHSGDTADVRITYNSTTKNL  203

Query  571   SVVFRNFGSYG-----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDI  735
             +V ++   +        +SYI+DLRK LPE VT GF  AT       ++ SW F+S L++
Sbjct  204   TVSWKYQTTSTPQENTSLSYIIDLRKVLPEWVTIGFTAATSNRIERHVLQSWDFSSTLEM  263

Query  736   SENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDI-FGNIGE-LG  909
             SE    +    K +V   V G   +I  ++    L WR++ +R+E  + +   +I + + 
Sbjct  264   SETSGKSAKNIKLVVSLTVSGAVLIIVIAVVSGIL-WRRKLVRKETAETVNLTSINDDIE  322

Query  910   GGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIK  1089
               AGP+RF+Y++L  ATN+FS + KLGEGGFG+VY+G L  +++ VAVK++SRGSKQG K
Sbjct  323   RRAGPRRFSYKDLVSATNNFSAERKLGEGGFGAVYQGQLAGIDTAVAVKKISRGSKQGKK  382

Query  1090  EYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYK  1269
             EY +EV+VIS++RH+NLV LIGWCH+  + LLVYEF+SNGSLDSHL+  K  LTW  RY+
Sbjct  383   EYVTEVKVISQLRHRNLVQLIGWCHDRGEFLLVYEFMSNGSLDSHLFGKKIPLTWTARYR  442

Query  1270  IVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTAL  1449
             I   LASALLYLHEE E+C+VHRD+KSSNIMLDS+ N KLGDFGLARL+DHE G +TT L
Sbjct  443   IALGLASALLYLHEEWEQCVVHRDVKSSNIMLDSSFNVKLGDFGLARLMDHELGPQTTGL  502

Query  1450  AGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYG  1629
             AGT+GY+A E + +G+ASKE+D+YSFG+V+LEIA GRK +D   ++  +++V+W+W LYG
Sbjct  503   AGTLGYLAPEYISTGRASKESDVYSFGVVSLEIATGRKAVDAIEQKSEMSLVEWIWDLYG  562

Query  1630  TGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPE  1809
             TG+L  A D  L  +F+  ++E +MIVGLWCAHPD ++RPSIRQAI VLNFEAPLP+LP 
Sbjct  563   TGKLNLAVDEKLHSEFDENQMEYLMIVGLWCAHPDRNIRPSIRQAIHVLNFEAPLPNLPT  622

Query  1810  TMPVATF  1830
              MPV  +
Sbjct  623   KMPVPLY  629



>ref|XP_007214100.1| hypothetical protein PRUPE_ppa015941mg [Prunus persica]
 gb|EMJ15299.1| hypothetical protein PRUPE_ppa015941mg [Prunus persica]
Length=660

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/622 (49%), Positives = 395/622 (64%), Gaps = 51/622 (8%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPN------QRNCIGRATYSEPL  192
             + P V  L FNF  F P+    I+ E  + ++    +         +   +GRATYS+P 
Sbjct  30    VSPCVTSLDFNFSTF-PNGKNTISLEGDARIDGEFLLLTKSAVDDVKEQSVGRATYSQPF  88

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              L D  TGKL+ F T+F FVIDS G   Y DG AFF+ P GS +  N T G G       
Sbjct  89    LLHDNATGKLADFTTNFTFVIDSQGKTPYADGLAFFIVPNGSLL--NGTFGRG-------  139

Query  373   ERLNSSNPFVAVEFDVYLNHYDTEQ----KHVGIDVDSLQSVVTAPWSPDIEGGWGSEAW  540
                       AVEFD+Y N   + Q     HVG+D++++          +I  G  + A 
Sbjct  140   ----------AVEFDIYQNEVTSIQDPAGDHVGVDINTV----------NIAEGRVNSAG  179

Query  541   INYDPRSMNLSVVFRNF--GSYG--HVSYILDLRKYLPERVTFGFAGATGKDTALQMINS  708
             I+YD  S  L+VVF ++  G  G  ++  ++DL K L   V  GF+ AT   TAL  INS
Sbjct  180   ISYDSTSNGLNVVFTSYVNGVQGMSYIDCMVDLNKILQGWVIAGFSAATDATTALHKINS  239

Query  709   WIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFS------FLAWRKRKMREE  870
             W F S     E   +T       +   +V G  + G  +         F+ W+KR    E
Sbjct  240   WSFHSTQLFDEKPKNTTPKSGNGINIGLVLGLGIGGLIVLGGGLGLVWFICWKKRGESSE  299

Query  871   FDDDIFGNIG-ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYV  1047
              D  +  +I  E   G GPK+F YR+LA++T +F +  KLGEGGFG VY+GY+ +L   V
Sbjct  300   EDVTVNDSIDEEFENGIGPKKFPYRKLAQSTRNFYEGQKLGEGGFGGVYRGYITDLNLNV  359

Query  1048  AVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHL  1227
             AVKR+S GS+QG+KEYA+EVR+ISR+RH+NLV LIGWCHE K LLLVYEF+SNGSLDSHL
Sbjct  360   AVKRISSGSRQGLKEYAAEVRIISRLRHRNLVQLIGWCHERKQLLLVYEFMSNGSLDSHL  419

Query  1228  YKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLA  1407
             +K K+LL W  RY+I Q LAS L YLH E E+C++HRD KSSNIMLDSN NAKLGDFGLA
Sbjct  420   FKAKNLLAWDARYRIAQGLASGLFYLHVEWEQCVLHRDAKSSNIMLDSNFNAKLGDFGLA  479

Query  1408  RLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEE  1587
             RLVDH K S+TT LAGTMG++A EC+ +GK SKETD+YSFG+V LEIACGRKPIDP    
Sbjct  480   RLVDHGKQSQTTVLAGTMGHMAPECMTTGKTSKETDVYSFGVVALEIACGRKPIDPEYRS  539

Query  1588  CHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAI  1767
               + +V+WVW+LYG G++++AADP L GDF  R++E ++IVGLWCAHPD  +RP+I+Q I
Sbjct  540   SQITMVEWVWELYGEGRVIEAADPKLRGDFGKRQMECLLIVGLWCAHPDYKIRPAIQQTI  599

Query  1768  QVLNFEAPLPDLPETMPVATFW  1833
             QVLNF+ PLP LP  MPVA+++
Sbjct  600   QVLNFKVPLPILPSKMPVASYF  621



>ref|XP_010273782.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Nelumbo nucifera]
Length=688

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/637 (49%), Positives = 407/637 (64%), Gaps = 36/637 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNCIGRATYSEPLHLWDKP  210
             ++P  + LSFN   F       +     +   N +++T NQ+N  GRATY + + LWDK 
Sbjct  30    LVPCSNSLSFNISSFDQKPRDIVLTGDANFSKNGVELTNNQQNSRGRATYKDSVRLWDKE  89

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL---  381
             T  L+ F T F+  I +  ++   DG AFFLA      PP  + G   GL   D+ L   
Sbjct  90    TRNLTDFTTRFSLTIATINNSLPADGLAFFLATSNGSEPPPNSAGSCLGLLTYDDYLDKV  149

Query  382   ---NSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEG-GWGSEAWIN  546
                N+ N  +AVEFD Y +   D    HVGID++S++SV T  W   I   G   +  I 
Sbjct  150   CLNNTDNQLIAVEFDTYCDDRVDPLYNHVGIDLNSIKSVETTRWYGTITNIGSTVDVRIT  209

Query  547   YDPRSMNLSVVFRNFGSYGH-----------VSYILDLRKYLPERVTFGFAGATG-KDTA  690
             Y+  + NLSV    F +Y             +SY +D+RK+LPE VT GF+ ATG     
Sbjct  210   YNSSTQNLSV----FLAYPEKPVAISNGDPDLSYKVDMRKFLPEWVTIGFSAATGLGGLE  265

Query  691   LQMINSWIFTSALDISENQADT-------KSTgkglviglvvggcfliggSMAFSFLAWR  849
                I+SW F S++++   + ++       K+    L +GL VG   L+     F +L  R
Sbjct  266   THQIHSWEFYSSMEVETKKTNSSMEVEKKKTNNTRLFVGLFVGAGTLMVLGTIFIWLTMR  325

Query  850   KRKMREEFDDDIFGNIG---ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKG  1020
              ++ R+  + +   +     E   GAGPKRF Y ELARATN F ++ KLGEGGFG VY+G
Sbjct  326   MKRKRDTEEVEDDDDDSMNDEFEKGAGPKRFLYGELARATNDFHEEQKLGEGGFGGVYRG  385

Query  1021  YLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFL  1200
              L ++   VAVKRVS+ SKQGIKEY SEV++ISR+RHKNLV L+GWCH+ K+ LLVYEFL
Sbjct  386   LLSDVNLEVAVKRVSKRSKQGIKEYTSEVKIISRLRHKNLVQLVGWCHQRKEFLLVYEFL  445

Query  1201  SNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLN  1380
              NGSLDSHL+  K  LTW +RY I  DLASALLYL EE E+C+ HRDIKSSN+MLDSN N
Sbjct  446   PNGSLDSHLFGQKESLTWKVRYDIALDLASALLYLQEEWEQCVFHRDIKSSNVMLDSNFN  505

Query  1381  AKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGR  1560
             AKLGDFGLARLVDH + ++TT LAGTMGY+A ECV++GK+SKE+D+YS+GIV LEIACGR
Sbjct  506   AKLGDFGLARLVDHGQRAQTTVLAGTMGYMAPECVITGKSSKESDVYSYGIVALEIACGR  565

Query  1561  KPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGD-FNGREVEQMMIVGLWCAHPDC  1737
             +P++P  E   V +V+WVW+LYG G L +AAD  L    F+ +++E +M+VGLWCAHPD 
Sbjct  566   RPVEPRLESSKVRLVEWVWELYGRGMLFEAADSRLKNTGFDEKQMECLMVVGLWCAHPDS  625

Query  1738  SLRPSIRQAIQVLNFEAPLPDLPETMPVATFW-PQRN  1845
             +LRPSI+QA+QVLNFEAPLP LP  MP+ T+  PQ N
Sbjct  626   NLRPSIKQAMQVLNFEAPLPTLPPKMPIPTYCVPQFN  662



>ref|XP_004234636.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Solanum lycopersicum]
Length=650

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/620 (49%), Positives = 413/620 (67%), Gaps = 27/620 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNCIGR---ATYSEPLHLW  201
             +IP V+ +SF    F P +V +I +E  ++ +   ++  N+ N + R   A Y E + LW
Sbjct  19    LIPFVNSVSFQISRFGP-DVIDILYEGDAVASVG-EVEFNKANYLCRVAHAIYREKVPLW  76

Query  202   D--KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             D    + KL+ F+T F+F ID+   + YG G AFFLAP+G RIPPN + GG  GL N   
Sbjct  77    DPDHDSTKLADFSTRFSFTIDTQNRSSYGHGIAFFLAPVGFRIPPN-SDGGFLGLFNTTT  135

Query  376   RLNSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
               ++ +  V+VEFD + N  +D   +HVGI+ +S+ S VTAPW+  +  G   E WI Y+
Sbjct  136   SDSAQSQIVSVEFDTFSNVEWDPPFEHVGINNNSIASSVTAPWNVSLHSGNPIETWITYN  195

Query  553   PRSMNLSVVFRNFGSYGHVS--YILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
               + NLSV++ N+G+  + S  YI++LR  LP  VT GF+ ATG +     + SW F+S+
Sbjct  196   ATTNNLSVIW-NYGTGPNSSMFYIINLRDVLPPWVTIGFSAATGLNVERHTLESWEFSSS  254

Query  727   LDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMR--------EEFDDD  882
             L I+E   + +     +     +GG  L+   +A   L  R+RK++          F+DD
Sbjct  255   LVITELGGNDREKIGLIAGLTTLGGILLVSAILALIVLRKRRRKVKGNPETISLTSFNDD  314

Query  883   IFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRV  1062
                    L  GAGP++F+Y+EL  +TN FS++ KLGEGGFG VYKGYL +L+  VAVK++
Sbjct  315   -------LEKGAGPRKFSYKELDTSTNHFSEERKLGEGGFGEVYKGYLIDLDIAVAVKKI  367

Query  1063  SRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKS  1242
             SRGSKQG KEY +EV+VISR+RH+NLV LIGWCH+  + LLVYEF+ NGSLD HL+  ++
Sbjct  368   SRGSKQGKKEYITEVKVISRLRHRNLVQLIGWCHDQGEFLLVYEFMPNGSLDFHLFGKRN  427

Query  1243  LLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDH  1422
              L+W +RYKI   LASALLYLHEE E+C++HRDIKSSNIMLDS+ N KLGDFGLARL+DH
Sbjct  428   PLSWTMRYKISLGLASALLYLHEEWEQCVIHRDIKSSNIMLDSSFNVKLGDFGLARLMDH  487

Query  1423  EKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNI  1602
             E G +TT LAGT+GY+A E + +G+ASKE+D+YSFGIV LEIA GRK +DP    C   +
Sbjct  488   ELGPQTTGLAGTLGYLAPEYIKTGRASKESDVYSFGIVALEIATGRKSVDPGTGNCDAGL  547

Query  1603  VDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNF  1782
             V++VW  Y  G+LL   D  L+ DF   +VE+++I+ LWCAHP+ +LRPSI+QAI VLNF
Sbjct  548   VEYVWDFYEKGKLLTVVDEKLNMDFEREQVERLIIIALWCAHPESNLRPSIKQAIHVLNF  607

Query  1783  EAPLPDLPETMPVATFWPQR  1842
             EA LP+LP  MPV  ++  R
Sbjct  608   EASLPNLPMKMPVPVYYSPR  627



>ref|XP_003628872.1| Lectin receptor-like kinase Tg-20 [Medicago truncatula]
 gb|AET03348.1| lectin receptor kinase [Medicago truncatula]
Length=682

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/617 (50%), Positives = 411/617 (67%), Gaps = 29/617 (5%)
 Frame = +1

Query  46    HPLSFNFDLFTPSNVQNITFERTSLV-NNSIQITPNQRN-----CIGRATYSEPLHLWDK  207
             H +SFNF  F  SN+  I F+  +   NN +Q+T NQ +      +GRA++ +PL L+DK
Sbjct  36    HSISFNFTSF-QSNLYLIKFQGDAFSSNNVLQLTKNQLDGPITRSVGRASFDQPLKLYDK  94

Query  208   PTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNS  387
              T +L+ F THF F++ +   + +GDG +FF+AP  S IP N+  GG  GL + +  LN+
Sbjct  95    ETKELTDFTTHFTFIMRAVNLSLFGDGLSFFMAPFQSDIPENSA-GGYLGLFSKESALNT  153

Query  388   S-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSM  564
             S N  VAVEFD Y N +D    HVGI+V+S+QSV    W   I+ G  + AWI+Y+  + 
Sbjct  154   SKNQIVAVEFDSYRNDWDPNSDHVGINVNSIQSVQNVSWKSSIKTGAVANAWISYNSTTK  213

Query  565   NLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSAL  729
             NLSV         F     +SY +DL + LPE V  GF+ ATG+   +  I +W F S+L
Sbjct  214   NLSVFLTYVNNPTFHENSTLSYNIDLSEVLPEYVRIGFSAATGQWIEIHNILTWSFNSSL  273

Query  730   DISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKM--------REEFDDDI  885
                    + K+   GL +GL VG   L        F  WRKRK+          +FD  I
Sbjct  274   K----SGNGKNIKVGLGVGLSVGFGSLTCLVGLLWFTFWRKRKVINKGERDNNRDFDASI  329

Query  886   FGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYL-KELESYVAVKRV  1062
               +  E   G GPKRFTY+EL+ +TN F ++ KLGEGGFG VYKG L K  +  VAVKRV
Sbjct  330   --DEDEFERGTGPKRFTYKELSNSTNGFDEKGKLGEGGFGGVYKGLLEKNNKLEVAVKRV  387

Query  1063  SRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKS  1242
             S+GS+QG KEY SEVR+IS++RH+NLV L+GWCHE  +LLLVYE++ NGSLD HL+    
Sbjct  388   SKGSRQGKKEYISEVRIISKLRHRNLVQLLGWCHEKSELLLVYEYMPNGSLDYHLFGKGV  447

Query  1243  LLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDH  1422
             +LTW +RYKI   +AS+LLYLHEE E+C+VHRDIKSSN+MLD+N NAKLGDFGLARLVDH
Sbjct  448   MLTWSVRYKIALGIASSLLYLHEEWEQCVVHRDIKSSNVMLDANFNAKLGDFGLARLVDH  507

Query  1423  EKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNI  1602
             E GS+TT LAGTMGY+A ECV +GK+SKE+D+YSFG+V LEI CGR+ I+   E   + +
Sbjct  508   ELGSQTTVLAGTMGYLAPECVTTGKSSKESDVYSFGVVALEITCGRRSIESNEEAKKIRL  567

Query  1603  VDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNF  1782
             V+WVW+LYG G+L +  D  L+ +F+ R++E +M+VGLWC HPD ++RPSIRQ I VLNF
Sbjct  568   VEWVWELYGKGELFEGVDRGLNLEFDERKMECLMVVGLWCCHPDFTMRPSIRQVINVLNF  627

Query  1783  EAPLPDLPETMPVATFW  1833
             EAPLP LP  +PV  ++
Sbjct  628   EAPLPSLPSKLPVPMYF  644



>gb|KCW59667.1| hypothetical protein EUGRSUZ_H02420, partial [Eucalyptus grandis]
Length=590

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/575 (50%), Positives = 385/575 (67%), Gaps = 12/575 (2%)
 Frame = +1

Query  130   SIQITPNQRNC-IGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLA  306
             +I  T    +C +GRA Y+E L LWD  +G+L+ F+T F+F ID+   + Y  G AFFLA
Sbjct  13    TIDFTSLTYSCHVGRAFYAEKLQLWDSASGRLTDFSTRFSFAIDTRNQSVYAAGLAFFLA  72

Query  307   PLGSRIPPNATKGGGFGLANDDERLNSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQS  483
             P+G +IP N+  GG  GL N     +SSN  V VEFD ++N  +D   +HVGI+ +S+ S
Sbjct  73    PVGFQIPVNSI-GGFLGLFNTTNSDSSSNQIVTVEFDTFVNPEWDPPYEHVGINKNSIAS  131

Query  484   VVTAPWSPDIEGGWGSEAWINYDPRSMNLSVVFR-----NFGSYGHVSYILDLRKYLPER  648
              VT PW+        ++ WI Y+  + NLSV +      N      +SY +DL   LP+ 
Sbjct  132   AVTTPWNASFHSDDTADVWIVYNSTTKNLSVSWSYQTTPNPHENTTMSYQIDLTAVLPQE  191

Query  649   VTFGFAGATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMA  828
             V  GF+ ATG       + SW F+S L + E Q + K T   + + + +G        +A
Sbjct  192   VMIGFSAATGYYIERHQLGSWTFSSNLGVKEKQGNAKGTKLVVGLAVPLGVLLCGM--VA  249

Query  829   FSFLAWRKRKMREEFDDDIFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFG  1005
              S + WR RK R    +    +I E L  GAGP+RF Y +LA ATN+F+++ KLG+GGFG
Sbjct  250   ISAILWR-RKRRSMGSEMAMTSINEELERGAGPRRFAYADLASATNNFAEERKLGQGGFG  308

Query  1006  SVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLL  1185
             +VY+GYL  L++ VAVKR+SRGSKQG KE+ +EV+VIS +RH+NLV LIGWCHE  + +L
Sbjct  309   AVYRGYLVGLDAAVAVKRISRGSKQGKKEFITEVKVISSLRHRNLVLLIGWCHEANEFML  368

Query  1186  VYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIML  1365
             VYEF+ NGSLD HL+  KS L+W  RYKI+  LASALLYLHEE E+C+VHRDIKSSN+ML
Sbjct  369   VYEFMPNGSLDRHLFGKKSPLSWAARYKILVGLASALLYLHEEWEQCVVHRDIKSSNVML  428

Query  1366  DSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLE  1545
             DS  N KLGDFGLARL+DHE G +TT LAGT GY+A E V +G+ASKE+D+YSFG+V LE
Sbjct  429   DSGFNVKLGDFGLARLMDHELGPQTTGLAGTFGYMAPEYVSTGRASKESDVYSFGVVALE  488

Query  1546  IACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCA  1725
             IA GR+ +DP      +++ +WVW LYG G++++A D  L   F+G+++E  + VGLWCA
Sbjct  489   IATGRRSVDPMERSSQMSLAEWVWDLYGKGRVVEAVDERLQAHFDGQQLECSVAVGLWCA  548

Query  1726  HPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             HPD  LRPS+RQA+QVLNFEA +P LP  MP+A +
Sbjct  549   HPDRGLRPSVRQALQVLNFEATVPVLPNKMPIAVY  583



>ref|XP_004289510.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Fragaria vesca subsp. vesca]
Length=688

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/611 (52%), Positives = 410/611 (67%), Gaps = 21/611 (3%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQ-----RNCIGRATYSEPLHLWD  204
             V  +SFNF  FTP N+  + FE  +  ++  IQ+T NQ      +  GRA+Y+ P+ LWD
Sbjct  32    VVSVSFNFSNFTP-NMNELNFEGDAFPSSGVIQLTKNQVDGPLTSSTGRASYALPVRLWD  90

Query  205   KPTGKLSSFNTHFAFVIDS-NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
               TG+L+ F THF+FV+ + N +  YGDG +FF+AP  S+IP N++ GG   L + D   
Sbjct  91    ASTGRLTDFTTHFSFVMKALNETYYYGDGISFFIAPFDSQIPSNSS-GGFLALVSYDTAF  149

Query  382   NSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
             ++S N FVAVEFD   N +D    HVGIDV+S+ S     W   I+ G  + AW++Y+  
Sbjct  150   DASKNKFVAVEFDSNNNTWDPSGDHVGIDVNSIVSAANVTWKTTIKNGSVANAWVSYNST  209

Query  559   SMNLSVVF---RN---FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFT  720
             + NL+V     +N    G    +SYI+DLR  LPE+V  GF+ ATG    +  I SW F+
Sbjct  210   THNLTVFLTYAKNPTFTGRECSLSYIVDLRNELPEKVRVGFSAATGYWVEIHNILSWSFS  269

Query  721   SALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG  900
             S+L    N A       GL  G  +  C L      F F+ WRK K  +  DD       
Sbjct  270   SSLLEHNNGASKVRLAAGLGTGFGLLTCGLGL----FWFITWRK-KAAQRDDDYDMSMDD  324

Query  901   ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQ  1080
             E   G GP+RFTYRE++RATN+F++  KLGEGGFG VYKG L E  + VAVKRVSR SKQ
Sbjct  325   EFDKGTGPRRFTYREISRATNNFAEGGKLGEGGFGGVYKGLLNESNTEVAVKRVSRTSKQ  384

Query  1081  GIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPL  1260
             G KEY +EVR+ISR+RH+NLV LIGWCHE  + LLVYE + NGSLDS+L+     L+WP+
Sbjct  385   GKKEYVAEVRIISRLRHRNLVQLIGWCHEQGEFLLVYEIMPNGSLDSYLFGKSYSLSWPV  444

Query  1261  RYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRT  1440
             RYKI   LASA+LYLHEE E+C+VHRDIKSSN+MLDSN NAKLGDFGLARLVDHE GS+T
Sbjct  445   RYKIALGLASAVLYLHEEWEQCVVHRDIKSSNVMLDSNFNAKLGDFGLARLVDHELGSQT  504

Query  1441  TALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWK  1620
             T LAGTMGY+A ECV +GKASKE+D+YSFG+V LEI+CGRKP++  AE   V +V+WVW 
Sbjct  505   TVLAGTMGYLAPECVTTGKASKESDVYSFGVVALEISCGRKPVEAKAEASKVRLVEWVWD  564

Query  1621  LYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPD  1800
             LYG GQ+L A D  L   ++ +E+E +M VGLWC HPD ++RPSIRQ I VL+FEAP+P 
Sbjct  565   LYGKGQILQAVDERLKMKYDEKEIECLMAVGLWCCHPDPTVRPSIRQVINVLSFEAPMPS  624

Query  1801  LPETMPVATFW  1833
             LP  +PV  ++
Sbjct  625   LPSKLPVPMYF  635



>gb|KEH24603.1| lectin receptor kinase [Medicago truncatula]
Length=668

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/632 (48%), Positives = 405/632 (64%), Gaps = 35/632 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRN-----CIGRATYSEPLH  195
             +I LV P+SFN++ F   +V+       SL+++ IQ+T   R       +GR T+ EPL 
Sbjct  19    MITLVKPISFNYEGFKYDDVK--LEGDASLLDSYIQLTSTSRYQSNAFSVGRVTFFEPLQ  76

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDE  375
             LWDK + K++ F T F+FVI SN +  +GDG AFF+A           +GGG GL +  +
Sbjct  77    LWDKTSRKITDFTTKFSFVIYSNETG-FGDGLAFFIADPELPFVGYTKEGGGLGLVDKYQ  135

Query  376   RLNSS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSE-AWINY  549
              LNS+ + F+AVEFD + N +D    HVGI+ +S+ S  T PW  DI          I Y
Sbjct  136   ILNSTEHSFLAVEFDTHQNGWDPYGIHVGINFNSMVSQKTKPWLIDIRNKKTYYYCKIQY  195

Query  550   DPRSMNLSVVF-----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             +  +  L V F      +     ++SY +DLR YLPERV FGF+ ATG    +  I SW 
Sbjct  196   NSSAYTLKVSFTGNIVNDKPVKTYLSYNVDLRDYLPERVIFGFSAATGLMFEMNTIKSWS  255

Query  715   FTSALDISENQADTK-STgkglviglvvggcfliggSM------------------AFSF  837
             F S+L+I +++  +  ST                  ++                   F F
Sbjct  256   FNSSLEIQDDKLSSPISTTPSPSPIPNSLKISSNKRTVWAGLGVGVGIASIFLILGCFCF  315

Query  838   LAWRKRKMREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYK  1017
             L W++ K ++E  +       E   G GPK+F Y +L  ATN+F +  K+G+GGFG VYK
Sbjct  316   LMWKRAKEKKEDSNFDMKMDDEFQKGTGPKKFCYNKLVSATNNFEETQKIGQGGFGGVYK  375

Query  1018  GYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEF  1197
             GYLK+++S VA+KR+SR SKQGIKEYA+EV++IS++RH+NLV LIGWCH  KD LL+YEF
Sbjct  376   GYLKDIDSNVAIKRISRESKQGIKEYATEVKIISQLRHRNLVQLIGWCHMKKDFLLIYEF  435

Query  1198  LSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNL  1377
             + NGSLDSHLY+GKS+LTW +RY I  DLASALLYLHEE E+C++HRDIKSSNIMLD + 
Sbjct  436   MQNGSLDSHLYRGKSILTWQVRYNIAMDLASALLYLHEEWEQCVIHRDIKSSNIMLDDSF  495

Query  1378  NAKLGDFGLARLVDHEKGSR-TTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIAC  1554
             NAKLGDFGLARLVDHEK S+ TT +AGTMGYIA E   +GKA+KE+DIYSFGIV+LE+A 
Sbjct  496   NAKLGDFGLARLVDHEKVSQSTTIIAGTMGYIAPEYFTTGKATKESDIYSFGIVSLELAS  555

Query  1555  GRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPD  1734
             GRKPID  A+E  V I D VW LY  G+LL+  D  L G F+  ++E+++++GLWCA+P+
Sbjct  556   GRKPIDRKAKEGQVAIFDRVWDLYRLGRLLEVVDTKLGGAFDEEQMERLVVIGLWCANPN  615

Query  1735  CSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
              S RPS+RQ IQVL FEA LP L E M  +T+
Sbjct  616   YSCRPSVRQVIQVLKFEASLPILSEEMFESTY  647



>ref|XP_004155273.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing 
receptor kinase IX.1-like [Cucumis sativus]
Length=684

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/619 (50%), Positives = 403/619 (65%), Gaps = 18/619 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQ-----RNCIGRATYSEPL  192
             I+  V  LSF F  F  +N  N+ FE  S  +N  IQ+T NQ      +  GRA+Y++P+
Sbjct  26    ILFKVQSLSFTFPNFQQNN-PNLFFEGDSFTSNGLIQLTKNQADGPLTDSSGRASYAQPV  84

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWD  TG+++ F THF+F +    S+ +GDG AFF+ P  S++P N+T GG  GL + D
Sbjct  85    RLWDAATGQVTDFTTHFSFRVTQLQSS-FGDGIAFFIVPYESKLPANST-GGFLGLFSSD  142

Query  373   ERLN-SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
                + S N    VEFD   + +DT   H+GI+V+S++S+    W   ++    + AWI Y
Sbjct  143   LAFDPSKNQVFGVEFDSKQDDWDTSGDHLGINVNSIKSINHLVWKSSMKDSRTANAWITY  202

Query  550   DPRSMNLSVVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             +  + NLSV         F     +S  +DL+ +LPERV  GF+ ATGK   +  I SW 
Sbjct  203   NSATNNLSVFLTYDIDPIFTGTFTISTFVDLKSFLPERVRVGFSAATGKWFQIHNIISWS  262

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGN  894
             F S LD  +N           +   +  G  +    +    L W  +K+R   DD     
Sbjct  263   FNSTLD--DNLGGGDKNKNTGLAIGLGVGLGVGICGLILLGLFWWGKKLRRMEDDVDDSI  320

Query  895   IGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGS  1074
               E   G GPKRFTYREL RAT +F +  KLGEGGFG VYKG L E  + +AVKRVSRGS
Sbjct  321   DDEFEKGTGPKRFTYRELTRATKNFDEAGKLGEGGFGGVYKGLLTESNTEIAVKRVSRGS  380

Query  1075  KQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTW  1254
             +QG KEY SEV++ISR+RH+NLV L GWCHE  + LLVYEF+ NGSLD+HL++G+++L+W
Sbjct  381   RQGXKEYISEVKIISRLRHRNLVQLFGWCHEKGEFLLVYEFMPNGSLDTHLFRGQTMLSW  440

Query  1255  PLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGS  1434
             P+RYKI   LAS+LLYLHEE E+C+VHRDIKSSN+MLDSN NAKLGDFGLAR VDHE GS
Sbjct  441   PVRYKIAIGLASSLLYLHEEWEQCVVHRDIKSSNVMLDSNFNAKLGDFGLARFVDHELGS  500

Query  1435  RTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWV  1614
             +TT LAGTMGY+A ECV  GKASKE+D+YSFG+V LEIACGR+P++  AE   V +V+WV
Sbjct  501   QTTVLAGTMGYLAPECVTDGKASKESDVYSFGVVALEIACGRRPVESRAEPDQVRLVEWV  560

Query  1615  WKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPL  1794
             W+ YG G++L  AD  L  +F+ +++E +M+VGLWC HPD  LRPSIRQ I  LNFEA L
Sbjct  561   WESYGRGEVLKTADKRLEMEFDEQQMEALMVVGLWCCHPDFKLRPSIRQVINALNFEASL  620

Query  1795  PDLPETMPVATFW-PQRNV  1848
             P LP  +PV  ++ P  N+
Sbjct  621   PTLPAKLPVPMYFAPSMNL  639



>ref|XP_007047725.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
 gb|EOX91882.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
Length=651

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/615 (47%), Positives = 402/615 (65%), Gaps = 21/615 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSL-VNNSIQITPNQRNC-IGRATYSEPLHLWD  204
             ++P V+ + F    F P    NI +E  +     ++        C +GR +Y++ + +WD
Sbjct  20    LLPCVNSIHFKISRFDPE-ATNIVYEGDARPYVGAVDFNSVSYLCRVGRVSYAQSVPIWD  78

Query  205   KPTGKLSSFNTHFAFVIDS--NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
               T K++ F THF+F ID+     + Y  G AFFLAP+G  IPPN+  GG  GL N    
Sbjct  79    SGTNKVADFTTHFSFFIDTLNRNISMYAAGLAFFLAPVGFEIPPNSA-GGFLGLFNTTTS  137

Query  379   LNSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDP  555
              ++ N  V VEFD + N  +D   +HVGI+ +S+ S    PW+  +  G  ++AWI+Y+ 
Sbjct  138   DSTRNQIVLVEFDTFPNPEWDPPVQHVGINTNSISSAEYTPWNFSLYSGKTADAWISYNA  197

Query  556   RSMNLSVVF---------RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINS  708
              + NLSV +          NF     +S+ +DL++ LPE V  GF+ AT        +  
Sbjct  198   TTKNLSVTWNYQATTISQHNFS----LSHHIDLKQILPEWVKIGFSAATSHFQEGHRLLF  253

Query  709   WIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLA-WRKRKMREEFDDDI  885
             W F+S+L+I E +       K + +  V+ G  +   S+ F F   W+K K   E   ++
Sbjct  254   WEFSSSLEIKETKGKKTKNVKLIAVLAVLLGILVTVVSVLFVFFRRWKKMKEEREERTNL  313

Query  886   FGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVS  1065
                  +L  GAGP+RF+Y +L  ATN+FS Q KLGEGGFG+VYKGY  ++++ VAVK+++
Sbjct  314   TSINDDLERGAGPRRFSYTDLVVATNNFSNQRKLGEGGFGAVYKGYFNDIDTAVAVKKIA  373

Query  1066  RGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSL  1245
             +GS+QG KEY +E+++ISR+RH+NLV LIGWCH+  + LLVYEF+SNGSLDSHL+  K+ 
Sbjct  374   KGSRQGKKEYITEIKIISRLRHRNLVQLIGWCHDGVEFLLVYEFMSNGSLDSHLFGKKTP  433

Query  1246  LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHE  1425
             ++WP RYKI + LASALLYLHEE E+C+VHRDIKSSN+MLDS+ N KLGDFGLARL+DHE
Sbjct  434   ISWPFRYKIARGLASALLYLHEEWEQCVVHRDIKSSNVMLDSSFNVKLGDFGLARLMDHE  493

Query  1426  KGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIV  1605
              G  TT LAGT+GY+A E + +G+ASK +D+YSFGIV LEIA GRK +DP  E     +V
Sbjct  494   LGPLTTGLAGTLGYMAPEYIRTGRASKASDVYSFGIVALEIAAGRKSVDPIEENSQRGLV  553

Query  1606  DWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFE  1785
             +WVW LYGTG L+ A D  L  DF+ +++E +MIVGLWCAHPD +LRPSIRQAIQVL+F+
Sbjct  554   EWVWHLYGTGNLISAVDQRLHADFDEKQIECLMIVGLWCAHPDSNLRPSIRQAIQVLDFD  613

Query  1786  APLPDLPETMPVATF  1830
               LP+LP  MPV T+
Sbjct  614   VALPNLPVKMPVPTY  628



>ref|XP_009412465.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=602

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/567 (52%), Positives = 381/567 (67%), Gaps = 18/567 (3%)
 Frame = +1

Query  163   IGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGS-AKYGDGFAFFLAPLGSRIPPNAT  339
             +GRA Y EPL LWD  T +L+ F THF+FVI+S+     +GDG AFFL    S +P   +
Sbjct  5     VGRAVYREPLRLWDATTRELADFTTHFSFVINSSDPLTPHGDGLAFFLTAYPSTLPAY-S  63

Query  340   KGGGFGLANDDERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEG  519
             +G   GL ++    +S    VAVEFD + N +D    HVGID+DS+ S     W+  ++ 
Sbjct  64    RGAFLGLFSNSSVDSSRVSTVAVEFDTFPNGWDPLADHVGIDIDSITSSAAVQWNSSLKD  123

Query  520   GWGSEAWINYDPRSMNLSVVF---RN--FGSYGHVSYILDLRKYLPERVTFGFAGATGKD  684
             G  + AW +YD  + NLSV     RN  F     + +I+DLR  LPE V  GF+ +TG  
Sbjct  124   GRRASAWASYDAATHNLSVFLSYERNPAFSGNSSLHFIVDLRDVLPEMVAIGFSASTGNL  183

Query  685   TALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMR  864
             T    + SW F S L         K T  GL IGL VG   L+  S    F+  +K+   
Sbjct  184   TETHSLLSWSFNSTLQ------PRKQTKAGLEIGLGVGVGVLVAVSGLIWFVFSKKKASS  237

Query  865   EEFDDDIFGNIGELGGGA-----GPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLK  1029
                 +    +  E+         GPKRF Y ELA A  +FS++ KLGEGGFGSVYKGYLK
Sbjct  238   TNLKEAEDIDCDEIIDDEFERERGPKRFPYEELASAARNFSKEGKLGEGGFGSVYKGYLK  297

Query  1030  ELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNG  1209
             + +  VA+KRVSRGSKQG KEY SEV++ISR+RH+NLV L+GWCH+ ++ LLVYE + NG
Sbjct  298   DPKLDVAIKRVSRGSKQGRKEYVSEVKIISRLRHRNLVQLVGWCHDRREFLLVYELMPNG  357

Query  1210  SLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKL  1389
             SLDS+LY  K  L WP+R+KI   LASALLYLHEE E+C+VHRDIK SN+MLDS  NAKL
Sbjct  358   SLDSYLYTTKKTLQWPVRHKIALGLASALLYLHEEWEQCVVHRDIKPSNVMLDSAFNAKL  417

Query  1390  GDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPI  1569
             GDFGLARLVDH+  S+TT LAGTMGY+A ECV +GKASKE+D+YSFGIV LEIACGR+P+
Sbjct  418   GDFGLARLVDHDSHSQTTVLAGTMGYLAPECVTTGKASKESDVYSFGIVALEIACGRRPV  477

Query  1570  DPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRP  1749
             +P  ++  V +V+WVW+LYG G++L+AAD  L G+F+ +++  +M+VGLWCAHPDC++RP
Sbjct  478   EPMEQKGKVRLVEWVWELYGWGRVLEAADGKLDGEFDEKQMACLMVVGLWCAHPDCTMRP  537

Query  1750  SIRQAIQVLNFEAPLPDLPETMPVATF  1830
             SIRQAI VLNFE P P+LP  MPV  +
Sbjct  538   SIRQAINVLNFETPWPELPPKMPVPMY  564



>ref|XP_010026580.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=650

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/604 (48%), Positives = 398/604 (66%), Gaps = 13/604 (2%)
 Frame = +1

Query  46    HPLSFNFDLFTPSNVQNITFERTSLVN-NSIQITPNQRNC-IGRATYSEPLHLWDKPTGK  219
             + LSF+   F P    +I +E  +  N  +I  T       +GRA Y+E L L +  + +
Sbjct  28    YSLSFSISRFNP-QATDIIYEGDARPNVGTIDFTSATYFFHVGRAFYAEKLQLRNSTSKR  86

Query  220   LSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNPF  399
             L+ F+T F+F ID+   ++YG GFAFFLAP+G +IP N + GG  GL N     +SSN  
Sbjct  87    LTDFSTRFSFTIDTENQSEYGAGFAFFLAPVGYQIPVN-SNGGFLGLFNTTYSNSSSNQI  145

Query  400   VAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSV  576
             +AVEFD + N  +D   +HVGI+++S+ SVVT PW+        ++AWI Y+  + NLSV
Sbjct  146   IAVEFDTFTNPEWDPPYEHVGININSIASVVTTPWNASFHSADTADAWIVYNSTTKNLSV  205

Query  577   VFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISE  741
              +      N      +SY +DL   LPE V  GF+ AT   T    + SW F+S L+++E
Sbjct  206   SWSYRTTPNPHENTSISYQIDLTTVLPEEVMIGFSAATDYYTERHQLESWSFSSNLEVTE  265

Query  742   NQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG-ELGGGA  918
              Q +T      + + + +G        +A S + WR++   +  +     +I  EL  GA
Sbjct  266   KQGNTNRNKLVVGLAVPLGFLLCG--GVAISAILWRRKSRSKGSEMANLTSINDELERGA  323

Query  919   GPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYA  1098
             GP+RF Y +L  ATN+F+++ KLGEGGFG+VY+GYL  L++ VAVKR+SRGSKQG KE+ 
Sbjct  324   GPRRFRYTDLVAATNNFNEERKLGEGGFGAVYRGYLVSLDAAVAVKRISRGSKQGKKEFI  383

Query  1099  SEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQ  1278
             +EV+V+S +RH+NLV LIGWCHE  + LLVYE++ NGSLD HL+  KS L W  RYKI  
Sbjct  384   TEVKVVSSLRHRNLVQLIGWCHEANEFLLVYEYMPNGSLDMHLFGRKSPLGWAARYKISV  443

Query  1279  DLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGT  1458
              LASALLYLHEE E+C+VHRDIKSSN+MLDS  N KLGDFGLARL+DHE G +TT LAGT
Sbjct  444   GLASALLYLHEEWEQCVVHRDIKSSNVMLDSGFNVKLGDFGLARLMDHELGPQTTGLAGT  503

Query  1459  MGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQ  1638
              GY+A E V +G+ASKE+D+YS G+V LEI  GRK +DP  +   +++V+WVW LYG GQ
Sbjct  504   FGYLAPEYVSTGRASKESDVYSLGVVVLEIGTGRKSVDPMEQSLEMSLVEWVWHLYGRGQ  563

Query  1639  LLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMP  1818
             +++A D  L  DF  ++VE +++VGLWC HPD SLRP++RQA+QVLNFEA +P LP  MP
Sbjct  564   IVEAMDERLQVDFVRKQVECLLVVGLWCVHPDRSLRPTVRQALQVLNFEAAVPVLPNKMP  623

Query  1819  VATF  1830
             V  +
Sbjct  624   VTVY  627



>gb|KCW59668.1| hypothetical protein EUGRSUZ_H02421, partial [Eucalyptus grandis]
Length=610

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/563 (50%), Positives = 382/563 (68%), Gaps = 10/563 (2%)
 Frame = +1

Query  163   IGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATK  342
             +GRA Y+E L L +  + +L+ F+T F+F ID+   ++YG GFAFFLAP+G +IP N + 
Sbjct  35    VGRAFYAEKLQLRNSTSKRLTDFSTRFSFTIDTENQSEYGAGFAFFLAPVGYQIPVN-SN  93

Query  343   GGGFGLANDDERLNSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEG  519
             GG  GL N     +SSN  +AVEFD + N  +D   +HVGI+++S+ SVVT PW+     
Sbjct  94    GGFLGLFNTTYSNSSSNQIIAVEFDTFTNPEWDPPYEHVGININSIASVVTTPWNASFHS  153

Query  520   GWGSEAWINYDPRSMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKD  684
                ++AWI Y+  + NLSV +      N      +SY +DL   LPE V  GF+ AT   
Sbjct  154   ADTADAWIVYNSTTKNLSVSWSYRTTPNPHENTSISYQIDLTTVLPEEVMIGFSAATDYY  213

Query  685   TALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMR  864
             T    + SW F+S L+++E Q +T      + + + +G        +A S + WR++   
Sbjct  214   TERHQLESWSFSSNLEVTEKQGNTNRNKLVVGLAVPLGFLLCG--GVAISAILWRRKSRS  271

Query  865   EEFDDDIFGNIG-ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELES  1041
             +  +     +I  EL  GAGP+RF Y +L  ATN+F+++ KLGEGGFG+VY+GYL  L++
Sbjct  272   KGSEMANLTSINDELERGAGPRRFRYTDLVAATNNFNEERKLGEGGFGAVYRGYLVSLDA  331

Query  1042  YVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDS  1221
              VAVKR+SRGSKQG KE+ +EV+V+S +RH+NLV LIGWCHE  + LLVYE++ NGSLD 
Sbjct  332   AVAVKRISRGSKQGKKEFITEVKVVSSLRHRNLVQLIGWCHEANEFLLVYEYMPNGSLDM  391

Query  1222  HLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFG  1401
             HL+  KS L W  RYKI   LASALLYLHEE E+C+VHRDIKSSN+MLDS  N KLGDFG
Sbjct  392   HLFGRKSPLGWAARYKISVGLASALLYLHEEWEQCVVHRDIKSSNVMLDSGFNVKLGDFG  451

Query  1402  LARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTA  1581
             LARL+DHE G +TT LAGT GY+A E V +G+ASKE+D+YS G+V LEI  GRK +DP  
Sbjct  452   LARLMDHELGPQTTGLAGTFGYLAPEYVSTGRASKESDVYSLGVVVLEIGTGRKSVDPME  511

Query  1582  EECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQ  1761
             +   +++V+WVW LYG GQ+++A D  L  DF  ++VE +++VGLWC HPD SLRP++RQ
Sbjct  512   QSLEMSLVEWVWHLYGRGQIVEAMDERLQVDFVRKQVECLLVVGLWCVHPDRSLRPTVRQ  571

Query  1762  AIQVLNFEAPLPDLPETMPVATF  1830
             A+QVLNFEA +P LP  MPV  +
Sbjct  572   ALQVLNFEAAVPVLPNKMPVTVY  594



>ref|XP_010273743.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Nelumbo nucifera]
Length=709

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/601 (49%), Positives = 390/601 (65%), Gaps = 47/601 (8%)
 Frame = +1

Query  166   GRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKG  345
             GR  Y EP+ LWDK TG L+ FNT+F+F I     + +GDG AFFL P GS IPP +  G
Sbjct  81    GRVIYKEPVRLWDKETGDLTDFNTNFSFTIKLLSDSNFGDGLAFFLTPNGSIIPPQS-GG  139

Query  346   GGFGLANDDERL-NSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSP-DIEG  519
             G  GL + D R  N+ N  +AVEFD + N +D +  HVGIDV+S+ SV TA WS  +I  
Sbjct  140   GCLGLLSFDRRFDNTENQLIAVEFDTFPNDWDPDYNHVGIDVNSVFSVATAEWSSSNIIN  199

Query  520   GWGSEAWINYDPRSMNLSVVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKD  684
             G   +A I Y+  +  LSV F        G   ++S+I+D+RK+LPE VT G +  TGK 
Sbjct  200   GSTVDARIIYNSSTKLLSVFFTYDEKPVSGESRNLSHIVDMRKFLPEWVTIGLSATTGKF  259

Query  685   TALQMINSWIFTSALDISENQA--------------------------------DTKSTg  768
               L  ++SW F S+L++  + +                                 T +T 
Sbjct  260   VELHQLHSWDFYSSLEVKVSNSTVGNDGHNSTMGSNSTLGNGGHNSTSEATEIKKTNNTR  319

Query  769   kglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG----ELGGGAGPKRFT  936
               + + +       +   M +  +  ++ +  EE    +  N G    E   G GPKRF 
Sbjct  320   LIVGLVVGAVTSMGLLAGMIWFIMHMKRMRDMEEVKSAVLNNDGSMNDEFEMGVGPKRFL  379

Query  937   YRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVI  1116
             Y ELA+ATN F ++ KLGEGGFGSVY+G+L +L   VAVKRVS+GSKQGIKEY SEV++I
Sbjct  380   YGELAQATNDFDEEQKLGEGGFGSVYRGFLSDLNLEVAVKRVSKGSKQGIKEYMSEVKII  439

Query  1117  SRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLY--KGKSLLTWPLRYKIVQDLAS  1290
             S++RHKNLV L+GWCH+  + LLVYEF+ NGSLDSHL+  +    LTW +R+ I   LAS
Sbjct  440   SQLRHKNLVQLVGWCHQRNEFLLVYEFMPNGSLDSHLFGRQDSHSLTWKVRHNIAVGLAS  499

Query  1291  ALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYI  1470
              LLYLHEE E+C++HRDIKSSN+MLDS+ NAKLGDFG ARLVDH + ++TT LAGTMGY+
Sbjct  500   GLLYLHEEWEQCVLHRDIKSSNVMLDSSFNAKLGDFGFARLVDHGQLAQTTVLAGTMGYM  559

Query  1471  ALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDA  1650
             A ECV++ K SKE+D+YS+GIV LEIACGR+P++P  E   V +V+WVW+LYG G LL A
Sbjct  560   APECVMTPKYSKESDVYSYGIVALEIACGRRPVEPRLETSKVRLVEWVWELYGRGSLLQA  619

Query  1651  ADPNL-SGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVAT  1827
             AD  L S  F+ +++E +M+VGLWCAHPD +LRPSI+QA+QVL FEAPLP LP  MP+ T
Sbjct  620   ADSRLVSMGFDEKQMECLMVVGLWCAHPDFNLRPSIKQAMQVLCFEAPLPFLPPKMPMLT  679

Query  1828  F  1830
             F
Sbjct  680   F  680



>ref|XP_010026581.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
 gb|KCW59669.1| hypothetical protein EUGRSUZ_H02422 [Eucalyptus grandis]
Length=654

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/608 (49%), Positives = 403/608 (66%), Gaps = 17/608 (3%)
 Frame = +1

Query  46    HPLSFNFDLFTPSNVQNITFERTSLVN-NSIQITPNQRNC-IGRATYSEPLHLWDKPTGK  219
             + LSFN   F P +  ++ +E  +  N  +I  T    +C +GRA Y+E L LWD  + +
Sbjct  28    YSLSFNISRFDP-HATDMVYEGDARPNVGTIDFTSLTYSCHVGRAFYAEKLRLWDSASRR  86

Query  220   LSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNPF  399
             L+ F+THF+F ID+   + YG G AFFLAP+G +I  N+  GG  GL N     + SN  
Sbjct  87    LTDFSTHFSFTIDTRNQSGYGAGLAFFLAPVGFQIQVNSV-GGFLGLFNTTYSDSPSNQI  145

Query  400   VAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSV  576
             VAVEFD + N  +D   +HVGI+++S+ S VT PW+        ++AWI Y+  + N+SV
Sbjct  146   VAVEFDPFANPEWDPPYEHVGININSIASAVTTPWNASFHSADTADAWIVYNSETKNMSV  205

Query  577   VFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISE  741
              +      N      +SY +DL   LPE V  GF+ ATG       + SW F S L++ +
Sbjct  206   SWSYQTTPNPQENTSISYQIDLTTILPEEVMIGFSAATGYYIERHQLESWSFNSNLEVKQ  265

Query  742   NQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDI-FGNI----GEL  906
              Q + K T   + + + +G         A S + WR+R+ R+   + +   NI     EL
Sbjct  266   QQGNAKRTKLVVGLAVPLGVLLCGIA--ATSAILWRRRRRRQGRSERLETANITSINDEL  323

Query  907   GGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGI  1086
               GAGP+RF+Y +L  ATN+F+ + KLGEGGFG+VY+GYL  L++ VAVKR+SRGSKQG 
Sbjct  324   ERGAGPRRFSYTDLVSATNNFAAERKLGEGGFGAVYRGYLVGLDAVVAVKRISRGSKQGK  383

Query  1087  KEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRY  1266
             KE+ +EV+VIS +RH+NLV LIGWCHE  + LLVYE + NGSLD+HL+  KS L W  RY
Sbjct  384   KEFITEVKVISSLRHRNLVQLIGWCHEASEFLLVYELVPNGSLDTHLFGKKSPLGWAARY  443

Query  1267  KIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTA  1446
             KI   LASALLYLHEE E+C+VHRDIKSSN+MLDS  N KLGDFGLARL+DHE G +TT 
Sbjct  444   KISVGLASALLYLHEEWEQCVVHRDIKSSNVMLDSGFNVKLGDFGLARLMDHELGPQTTG  503

Query  1447  LAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLY  1626
             LAGT GY+A E V +G+ASKE+D+YSFG+V LEIA GRK +DP  +   +++V+WVW LY
Sbjct  504   LAGTFGYLAPEYVSTGRASKESDVYSFGVVALEIATGRKSVDPMYQSLEMSLVEWVWDLY  563

Query  1627  GTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLP  1806
             G GQ+++A D  L  DF+ ++VE +++VGLWCAHPD SLRP+IRQA+Q LNFEA +P LP
Sbjct  564   GRGQVVEAMDERLQVDFDRKQVECLLVVGLWCAHPDRSLRPTIRQALQDLNFEAAVPVLP  623

Query  1807  ETMPVATF  1830
               MPVA +
Sbjct  624   NKMPVAVY  631



>emb|CAN64356.1| hypothetical protein VITISV_020633 [Vitis vinifera]
Length=1852

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/613 (52%), Positives = 409/613 (67%), Gaps = 20/613 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLV--NNSIQITPNQRN-----CIGRATYSEP  189
             I P    LSFNF  F P+N Q I+FE  +    ++ IQ+T + ++       GRA Y E 
Sbjct  1242  IFPSATSLSFNFTTFEPNNGQ-ISFEGEARYSSDDDIQLTRDVQDKSMDSSWGRAIYKEQ  1300

Query  190   LHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAND  369
             L+LWD+ +  L+ F T+F+FVI+S   + YGDG  FFL   G+++P N + G   GL  D
Sbjct  1301  LYLWDRTSRNLTDFATNFSFVINSRNKSAYGDGITFFLN--GTQLPSNVS-GENLGLTKD  1357

Query  370   DERLNSSNPFVAVEFDVYLNH--YDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWI  543
             +    +   FVAVEFD + N    D    HVGID++S  SV T  WS +I  G  +   I
Sbjct  1358  NVTNTTVISFVAVEFDTFSNKAKRDPVSDHVGIDINSTISVKTVNWSSNIGEGKLNHVSI  1417

Query  544   NYDPRSMNLSVVF-----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINS  708
              Y   S NLSVV       N  +   +SY +DLR+YLPE VT GF+GATGK   +  I S
Sbjct  1418  RYTSSSQNLSVVLITEFMDNKTTSQSLSYKVDLREYLPEFVTIGFSGATGKAVQINNIYS  1477

Query  709   WIFTSALDISE--NQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDD  882
             W F+S L         D K TG  + + +         G +       R     E   D 
Sbjct  1478  WNFSSTLQPPNPVEPGDGKKTGFVVGLSVGAVVVVCGLGLVWHHLRKKRNNGGEENGTDS  1537

Query  883   IFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRV  1062
                   +   G GP++F++ ELA AT++F++++KLGEGGFG VY+G+L+EL SYVAVKRV
Sbjct  1538  DLVMDEDFEKGTGPRKFSFDELALATSNFAEEEKLGEGGFGGVYRGFLRELNSYVAVKRV  1597

Query  1063  SRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKS  1242
             SRGSKQG+KEYASEV++ISR+RH+NLV L+GWCH+ ++LLLVYE + NG+L S L   K+
Sbjct  1598  SRGSKQGMKEYASEVKIISRLRHRNLVQLMGWCHKKRELLLVYELMPNGNLSSRLLDEKT  1657

Query  1243  LLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDH  1422
             LLTW +RYKI   LAS+LLYLHEE E+C+VHRDIK SN+MLDS+ N KLGDFGLARLVDH
Sbjct  1658  LLTWAVRYKIALGLASSLLYLHEEWEQCVVHRDIKPSNVMLDSDFNTKLGDFGLARLVDH  1717

Query  1423  EKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNI  1602
              KGS+TT LAGTMGY+A E +++GKASKETD+YSFGIV LEI CGR+P++P A+E  V +
Sbjct  1718  GKGSQTTVLAGTMGYMAPEYLMTGKASKETDVYSFGIVALEIYCGRRPVEPKAKEKQVRL  1777

Query  1603  VDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNF  1782
             V+WVW LY  G+LLDAADP LSGDF+   +E++MIVGLWCAHPDC+LRPSIRQAI VLN 
Sbjct  1778  VEWVWDLYEVGKLLDAADPRLSGDFDEEHMERLMIVGLWCAHPDCNLRPSIRQAINVLNL  1837

Query  1783  EAPLPDLPETMPV  1821
             EA LP LP  MPV
Sbjct  1838  EASLPLLPLKMPV  1850



>ref|XP_010054304.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=698

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/636 (48%), Positives = 401/636 (63%), Gaps = 45/636 (7%)
 Frame = +1

Query  40    LVHPLSFNFDLFTPSNVQNITFE--RTSLV----------NNSIQITPNQRNCIGRATYS  183
             LV  LS  F     ++ Q I+F+    S++          NN IQITP+    IG  TY 
Sbjct  21    LVLFLSLGFAFNALASSQGISFQTFNNSIIRCQGNATIDSNNFIQITPDSPYSIGWVTYH  80

Query  184   EPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLA  363
             EP+ LWDK TG ++ F T F F IDS   + + DGF FFL   GS+ PPN + GG  G+ 
Sbjct  81    EPMRLWDKATGNVADFTTQFTFAIDSKNRSIFADGFTFFLVSNGSQ-PPNNSVGGALGIV  139

Query  364   NDDERLNSSNPFVAVEFDVYLNH------------------YDTEQKHVGIDVDSLQSV-  486
             N  +    S  FVA+EFD Y                      + E  H+GID+++L SV 
Sbjct  140   NSLDP--QSARFVAIEFDTYYTEVGGNFGGAINDQKCSQPPLNGEDSHIGIDLNNLTSVN  197

Query  487   -VTAPWSPD-IEGGWGSEAWINYDPRSMNLSVVFRNFGSYG------HVSYILDLRKYLP  642
                  W  D I  G   +A   Y+  + NLSV+  +    G       + Y ++L +YLP
Sbjct  198   STCVNWLNDKIRSGGQVKAVTTYNSNTQNLSVLIMDADPTGTSINSTAIDYKVNLVEYLP  257

Query  643   ERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggS  822
             E VTFGF+ +TG    L  I +W F+S + ++  +  +KS    ++         L+   
Sbjct  258   EWVTFGFSASTGSLFELHTIVAWEFSSTVQVAGKK--SKSWLWSILGSGSFFLLILVLAV  315

Query  823   MAFSFLAWRKRKMREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGF  1002
             + F   +  KR      +DD+  +  E    +GPK+FTY+EL  AT +F  +  LGEGGF
Sbjct  316   IWFRHRSNSKRANMSGEEDDLAID-EEFKQVSGPKKFTYKELVVATGNFVVERLLGEGGF  374

Query  1003  GSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLL  1182
             G VY+GYL  + + VA+K+++ GS+QGIKEYA+EV  ISR+RH+NLV LIGWCHE K+LL
Sbjct  375   GKVYEGYLTSVNANVAIKKINPGSRQGIKEYAAEVMTISRLRHRNLVQLIGWCHEKKELL  434

Query  1183  LVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIM  1362
             L+YEF+SNGSLDSHL+K +S L W  RYKI QD+ASALLYLHEE E+C++HRDIKSSNIM
Sbjct  435   LIYEFMSNGSLDSHLFKERSFLPWEKRYKIAQDIASALLYLHEEWEQCVIHRDIKSSNIM  494

Query  1363  LDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTL  1542
             LDS+ NAK+GDFGLARLVDH K  +TT LAGTMGY+ALECV +G+ASKE+D+YSFG+V L
Sbjct  495   LDSDFNAKIGDFGLARLVDHAKRLQTTVLAGTMGYMALECVYTGEASKESDVYSFGVVLL  554

Query  1543  EIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWC  1722
             EI CGR+ I P AEE  V +VDWVW+LYGT +LLDAAD  L  DF+G+++E +M+VGLWC
Sbjct  555   EITCGREVIKPRAEEGQVRLVDWVWELYGTKRLLDAADSKLGIDFDGKQLECLMVVGLWC  614

Query  1723  AHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
              HPD + RPSIR+A  VLNF A  P LP  +P+ T+
Sbjct  615   THPDYTARPSIREASNVLNFNASAPVLPSKLPIPTY  650



>ref|XP_004295778.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Fragaria vesca subsp. vesca]
Length=831

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/637 (49%), Positives = 413/637 (65%), Gaps = 42/637 (7%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQI-------TPNQRNCIGRATYSEPLH  195
             P   PL+FNF  F P++  ++  E  +   +  ++        P     IGRATYSEP  
Sbjct  20    PFATPLTFNFSTF-PNDTTSLFIEGDAYYTDGKRLRLTKTAKEPKLAGNIGRATYSEPFL  78

Query  196   LWDKPTGKL--SSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAND  369
             L    +GKL  + F THFAFVIDS G+  YGDGF FFLAP GS +      GG  GL   
Sbjct  79    LRGNDSGKLRLADFTTHFAFVIDSQGNKSYGDGFVFFLAPKGSVLNSILGGGGKLGLPVA  138

Query  370   DERLNSSNPFVAVEFDVYLN----HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
             D    +  PFVAVEFD+Y N    + D    HVG+DV++L+S +T  WS DI     + A
Sbjct  139   DLPGGNEYPFVAVEFDIYQNPPPTYLDPPYDHVGVDVNNLRSNITMAWSGDIPNAKINNA  198

Query  538   WINYDPRSMNLSVVFRNFGS---------YGHVSYILDLRKYLPERVTFGFAGATGKDTA  690
              I+Y+  S  L+V +    +           ++ Y++DL++YLP+ V  GF+  TG   +
Sbjct  199   SISYNSSSKTLTVAYTTLVNDTAGIQKQVMRYLRYVVDLKQYLPDWVIVGFSAGTGDRVS  258

Query  691   LQMINSWIFTSALDISE------------------NQADTKSTgkglviglvvggcflig  816
             L  I SW FTS   + E                  ++  +++    L+   +  G  ++ 
Sbjct  259   LPEIISWNFTSTSIVDEFVDSKDTTPPAAPNPDTVDEHKSRNNNIPLLAVGLGVGLSILV  318

Query  817   gSMAFSFLAWRKRKMR-EEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGE  993
              ++A  +  +R++ +     +D +     E   G GP +F Y ELARATN+F +++KLGE
Sbjct  319   AALALVWFIFRRKSVAGRNVEDTMMVLDDEFERGTGPMKFMYSELARATNNFDEEEKLGE  378

Query  994   GGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENK  1173
             GGFG VY+G++++L +YVAVKRVS+GSKQG+KEYA+EVR+I R+RH+NLV LIGWCHEN 
Sbjct  379   GGFGGVYRGFIRDLNAYVAVKRVSKGSKQGLKEYAAEVRIIGRLRHRNLVQLIGWCHENG  438

Query  1174  DLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSS  1353
             +LLLVYE + +GSLDS+L+K +S L W +RYKI   L S LLYLHE CE+CI+HRDIK+S
Sbjct  439   ELLLVYELMPHGSLDSYLFKARSFLNWEVRYKIALGLGSGLLYLHEGCEQCILHRDIKAS  498

Query  1354  NIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGI  1533
             N+MLD N N KLGDFGLARLV+HEKGS TT +AGT GY+AL+ VVSGKASKE+D+YSFG+
Sbjct  499   NVMLDLNFNVKLGDFGLARLVEHEKGSLTTVVAGTRGYMALDYVVSGKASKESDVYSFGV  558

Query  1534  VTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVG  1713
             V LEIACGRK +D   E   +N+VDWVW LYG G+L++AADP L GDF+ R++E +MIVG
Sbjct  559   VALEIACGRKSMDFDLENSRINLVDWVWGLYGEGKLIEAADPKLCGDFDERQMECLMIVG  618

Query  1714  LWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVA  1824
             LWCAHPD + RP I+QAIQVLNF+  LP LP  MP+A
Sbjct  619   LWCAHPDYTSRPPIQQAIQVLNFKDQLPTLPAIMPMA  655



>ref|XP_009371363.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like, 
partial [Pyrus x bretschneideri]
Length=617

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/600 (52%), Positives = 404/600 (67%), Gaps = 36/600 (6%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPNQRN-----CIGRATYSEPLHLWD  204
             V+  SFN   F  +N ++IT++  +  +   IQ+T NQ +       GRA++++P+HL+D
Sbjct  32    VNSFSFNISSF-DTNTKDITYQGDAFPSRGVIQLTKNQVDGPLTESAGRASFAQPVHLYD  90

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
               TG+L+ F THF FV+ +    +YGDG +FFLAP  S+IP N+T GG  GL + +   N
Sbjct  91    ASTGRLTDFTTHFTFVMKALDDTRYGDGISFFLAPPDSKIPENST-GGYLGLFSSNSNFN  149

Query  385   SS-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
             S+ N  VAVEFD + N +D    HVGI+V+S+ SV    W   I+ G  + AW++Y+  S
Sbjct  150   STKNQIVAVEFDSFKNSWDPSPDHVGINVNSVVSVANISWKTTIKNGSVANAWVSYNSTS  209

Query  562   MNLSVVFRNFGSYGH----------VSYILDLRKYLPERVTFGFAGATGKDTALQMINSW  711
              NLSV    F +Y            VSYI+DLRK LPE V+ GF+ ATG+   +  I SW
Sbjct  210   QNLSV----FLTYSKNPEFSAGDCSVSYIIDLRKVLPELVSVGFSAATGEWVEIHNILSW  265

Query  712   IFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKR--KMREEFD---  876
              F+S L+IS N    +    G+ +G   G      G   F F++ RKR  K+ E +D   
Sbjct  266   SFSSTLEISSNNEAERQIRIGVGLGAGFGFLSCGLG--LFWFISSRKRAKKINEAYDISM  323

Query  877   DDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVK  1056
             DD      E   G GP+RFTYREL RATN+F++  KLGEGGFG VYKG L E  + VAVK
Sbjct  324   DD------EFDKGTGPRRFTYRELNRATNNFAEGGKLGEGGFGGVYKGLLTESNTEVAVK  377

Query  1057  RVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKG  1236
             RVSRGSKQG KEY +EVR+ISR+RH+NLV LIGWCHE  + LLVYE + NGSLDSHL+  
Sbjct  378   RVSRGSKQGKKEYIAEVRIISRLRHRNLVQLIGWCHEQGEFLLVYEIMPNGSLDSHLFGM  437

Query  1237  KSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLV  1416
             K  LTW +R+KI   LASA+LYLHEE E+C+VHRDIKSSN+MLD+N NAKLGDFGLARLV
Sbjct  438   KLHLTWTVRHKIALGLASAILYLHEEWEQCVVHRDIKSSNVMLDANFNAKLGDFGLARLV  497

Query  1417  DHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHV  1596
             DH  GS+TT LAGTMGY+A ECV  G+ASKE+D+YSFG+V LEI+CGR+P++  AE    
Sbjct  498   DHGLGSQTTVLAGTMGYLAPECVTDGRASKESDVYSFGVVALEISCGRRPVEAKAEPSRA  557

Query  1597  NIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVL  1776
              +V+WVW LYG  Q+L+A D  L+ +F+ +++E +M VGLWC HPD ++RPSIRQ I VL
Sbjct  558   RLVEWVWDLYGKDQILEAVDERLNKEFDEQQIECLMTVGLWCCHPDPTVRPSIRQVINVL  617



>gb|KCW76070.1| hypothetical protein EUGRSUZ_D00438, partial [Eucalyptus grandis]
Length=627

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/596 (49%), Positives = 386/596 (65%), Gaps = 33/596 (6%)
 Frame = +1

Query  124   NNSIQITPNQRNCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFL  303
             NN IQITP+    IG  TY EP+ LWDK TG ++ F T F F IDS   + + DGF FFL
Sbjct  29    NNFIQITPDSPYSIGWVTYHEPMRLWDKATGNVADFTTQFTFAIDSKNRSIFADGFTFFL  88

Query  304   APLGSRIPPNATKGGGFGLANDDERLNSSNPFVAVEFDVYLNH-----------------  432
                GS+ PPN + GG  G+ N  +    S  FVA+EFD Y                    
Sbjct  89    VSNGSQ-PPNNSVGGALGIVNSLDP--QSARFVAIEFDTYYTEVGGNFGGAINDQKCSQP  145

Query  433   -YDTEQKHVGIDVDSLQSV--VTAPWSPD-IEGGWGSEAWINYDPRSMNLSVVFRNFGSY  600
               + E  H+GID+++L SV      W  D I  G   +A   Y+  + NLSV+  +    
Sbjct  146   PLNGEDSHIGIDLNNLTSVNSTCVNWLNDKIRSGGQVKAVTTYNSNTQNLSVLIMDADPT  205

Query  601   G------HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTKS  762
             G       + Y ++L +YLPE VTFGF+ +TG    L  I +W F+S + ++  +  +KS
Sbjct  206   GTSINSTAIDYKVNLVEYLPEWVTFGFSASTGSLFELHTIVAWEFSSTVQVAGKK--SKS  263

Query  763   TgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIGELGGGAGPKRFTYR  942
                 ++         L+   + F   +  KR      +DD+  +  E    +GPK+FTY+
Sbjct  264   WLWSILGSGSFFLLILVLAVIWFRHRSNSKRANMSGEEDDLAID-EEFKQVSGPKKFTYK  322

Query  943   ELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISR  1122
             EL  AT +F  +  LGEGGFG VY+GYL  + + VA+K+++ GS+QGIKEYA+EV  ISR
Sbjct  323   ELVVATGNFVVERLLGEGGFGKVYEGYLTSVNANVAIKKINPGSRQGIKEYAAEVMTISR  382

Query  1123  IRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLY  1302
             +RH+NLV LIGWCHE K+LLL+YEF+SNGSLDSHL+K +S L W  RYKI QD+ASALLY
Sbjct  383   LRHRNLVQLIGWCHEKKELLLIYEFMSNGSLDSHLFKERSFLPWEKRYKIAQDIASALLY  442

Query  1303  LHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALEC  1482
             LHEE E+C++HRDIKSSNIMLDS+ NAK+GDFGLARLVDH K  +TT LAGTMGY+ALEC
Sbjct  443   LHEEWEQCVIHRDIKSSNIMLDSDFNAKIGDFGLARLVDHAKRLQTTVLAGTMGYMALEC  502

Query  1483  VVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPN  1662
             V +G+ASKE+D+YSFG+V LEI CGR+ I P AEE  V +VDWVW+LYGT +LLDAAD  
Sbjct  503   VYTGEASKESDVYSFGVVLLEITCGREVIKPRAEEGQVRLVDWVWELYGTKRLLDAADSK  562

Query  1663  LSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             L  DF+G+++E +M+VGLWC HPD + RPSIR+A  VLNF A  P LP  +P+ T+
Sbjct  563   LGIDFDGKQLECLMVVGLWCTHPDYTARPSIREASNVLNFNASAPVLPSKLPIPTY  618



>ref|XP_010695030.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Beta vulgaris subsp. vulgaris]
Length=727

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/640 (47%), Positives = 405/640 (63%), Gaps = 47/640 (7%)
 Frame = +1

Query  43    VHPLSFNFDLFTPSNVQNITFERTSLVNNSI-QITPNQ-----RNCIGRATYSEPLHLWD  204
             V  L+FN   F  ++ +NI++   S V + + Q+T N+     ++ +GRA+YS+P+ LWD
Sbjct  43    VESLTFNITYFDINDAKNISYGNDSTVADGVLQLTRNRVDAELKHSVGRASYSQPVRLWD  102

Query  205   KPTGKLSSFNTHFAFVI-----DSNGSAKYGDGFAFFLAPLGSRI--PPNATKGGGFGLA  363
             + T + ++F+THF+F I     +S     YGDGFAFFL          P  + GG  GL 
Sbjct  103   RNTNETTNFSTHFSFNITQLENESTIDYSYGDGFAFFLTAFNESTVYAPEYSGGGSLGLI  162

Query  364   NDDERLN--SSNPFVAVEFDVYLNH------YDTEQKHVGIDVDSLQSVVTAPWSPDIEG  519
              ++E  N  S +PFVAVEFD + N       Y+T   H+G+DV+S+ S V++PWS  +  
Sbjct  163   CNNENCNVASKHPFVAVEFDTFNNDKFDPGIYET-YTHLGVDVNSVNSTVSSPWS--VRN  219

Query  520   GWGSEAWINYDPRSMNLSVVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKD  684
             G  +  WI YD  +MNLSV         F    ++S +++LR  LP+ V  GF+ ATG  
Sbjct  220   GTTANVWITYDSSTMNLSVYLTYDDHPVFTGKYNLSQMINLRTILPDEVRVGFSSATGDS  279

Query  685   TALQMINSWIFTSALD----------------ISENQADTKSTgkglviglvvggcflig  816
               L  I SW F S L+                +S  ++ +K     +   L      L+ 
Sbjct  280   LELHTILSWEFNSTLEDTQISVPTPAQNYTTPLSTRKSQSKRKAAIVDGVLASISVLLVI  339

Query  817   gSMAFSFLAWRKRKMREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEG  996
             G     FL W++R      +     +  +     GPKRFTY EL+ ATN+FS++ KLGEG
Sbjct  340   GLGFIVFLRWQRRSRERSSEMTYDVDDDDFDKETGPKRFTYNELSHATNNFSEERKLGEG  399

Query  997   GFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKD  1176
             GFG VY+G+L +L+  +AVK++SR SKQG KEY SEVR+ISR+RHKNLV L+GWCHE   
Sbjct  400   GFGGVYRGFLTDLDREIAVKKISRESKQGKKEYMSEVRIISRLRHKNLVQLLGWCHERGG  459

Query  1177  LLLVYEFLSNGSLDSHLYKGK--SLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKS  1350
             LLLVYEF+ NGSLDSHLY+GK  S+L W +RY I Q LASALLYLHEE E+C++HRDIKS
Sbjct  460   LLLVYEFMPNGSLDSHLYRGKTKSVLQWTIRYNIAQGLASALLYLHEEWEQCVLHRDIKS  519

Query  1351  SNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFG  1530
             SN+MLD + NAKLGDFGLARLVDH   S+TT LAGT+GY+A E   +GKAS+E D+YSFG
Sbjct  520   SNVMLDIDYNAKLGDFGLARLVDHSTTSQTTLLAGTLGYLAPEVFNTGKASREADVYSFG  579

Query  1531  IVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIV  1710
             +V LEIACGR+PID   E   V +V+WVW LYG G LL+A D  L G+F+ ++++ +++V
Sbjct  580   VVALEIACGRQPIDDKEEPTRVKMVEWVWNLYGKGCLLEAVDIELEGEFDTQQIKCLLMV  639

Query  1711  GLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             GLWC HPD + RP+IRQAI VL  E+PLP LP   PV  +
Sbjct  640   GLWCCHPDHAYRPTIRQAINVLKLESPLPSLPLKFPVPIY  679



>ref|XP_011012057.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Populus euphratica]
Length=648

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/573 (51%), Positives = 386/573 (67%), Gaps = 13/573 (2%)
 Frame = +1

Query  148   NQRNCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIP  327
             N  N +G  TY E + LWD  +GKLS F +HF+F ID+  +  YG G AFFLAP+G +IP
Sbjct  53    NYINRVGCTTYPERVRLWDSSSGKLSDFTSHFSFSIDTFNAPNYGHGIAFFLAPVGFQIP  112

Query  328   PNATKGGGFGLANDDERLNSSNPFVAVEFDVYLNH-YDTEQKHVGIDVDSLQSVVTAPWS  504
             PN+  GG  GL N     +S N  V+VEFD Y N  +D + +HVGI+ +S+ S    PW+
Sbjct  113   PNSA-GGFLGLFNTTTMKSSQNQIVSVEFDSYPNEEWDPKVEHVGINNNSIISAAYTPWN  171

Query  505   PDIEGGWGSEAWINYDPRSMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAG  669
                  G  +EAWI Y+    NLSV ++     N G    + YI+DL K+LPE +T GF+ 
Sbjct  172   ASFHSGDTAEAWITYNSTDRNLSVFWKYQTTSNPGENSSLFYIIDLSKFLPEWITVGFSA  231

Query  670   ATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWR  849
             ATG++     + SW F+S+L+I E +       K ++  +V     + G +  F  L  R
Sbjct  232   ATGQNLERHRLLSWEFSSSLNIEETKGKNSKKSKIIIGVIVSVLVLIAGATTTFVILWRR  291

Query  850   KRKMREEFDDDIFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYL  1026
             K+ +  +   +   +I E L  GAGP+RF+Y +L  ATN+FS Q KLGEGGFG+VY+GYL
Sbjct  292   KQMITRKGAAEKMTSINEALERGAGPRRFSYDDLVSATNNFSDQRKLGEGGFGAVYRGYL  351

Query  1027  KELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSN  1206
              ++   +AVK++SR S+QG KEY +EV+ IS++RH+NLV LIGWCH+  + ++VYEF+ N
Sbjct  352   NDMNVEIAVKKISRSSRQGKKEYITEVKTISQLRHRNLVQLIGWCHDKGEFMVVYEFMPN  411

Query  1207  GSLDSHLYKGKSL--LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLN  1380
             GSLDSHL+  K +  L+W +RYKI   LASALLYLHEE E C+VHRD+KSSN+MLDS  N
Sbjct  412   GSLDSHLFGKKKMSPLSWAVRYKISHGLASALLYLHEEWEWCVVHRDVKSSNVMLDSGFN  471

Query  1381  AKLGDFGLARLVDH-EKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACG  1557
              KLGDFGLA+LVDH E G RTT LAGT GY+A E + +G+ASKE+D+YSFG+V LEIA G
Sbjct  472   VKLGDFGLAKLVDHDELGPRTTGLAGTFGYLAPEYISTGRASKESDVYSFGVVALEIASG  531

Query  1558  RKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLS-GDFNG-REVEQMMIVGLWCAHP  1731
             RK  DP  ++  +++V+W+W LYG G L  A D  L   DF+  ++VE++MIVGLWCAHP
Sbjct  532   RKANDPIDQKSEMSLVEWIWDLYGCGNLSLAVDKRLDIKDFDDEKQVERLMIVGLWCAHP  591

Query  1732  DCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             D  LRPSIRQAI VLNFEA +P+LP  MPV  F
Sbjct  592   DYKLRPSIRQAIHVLNFEAAIPNLPPKMPVPVF  624



>ref|XP_006657862.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Oryza brachyantha]
Length=689

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/623 (47%), Positives = 397/623 (64%), Gaps = 28/623 (4%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSN---VQNITFERTSLVNNSIQITPNQRN-----CIGRATYSEP  189
             I  V PLSF  + FT SN      + F+  +  N ++++T ++ N      +GRA Y++P
Sbjct  21    IAHVSPLSFKLN-FTESNHNGSATVQFQEDAFYNKAVKLTKDELNGKITQSVGRAVYTDP  79

Query  190   LHLWDKPTGKLSSFNTHFAFVIDS-NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAN  366
             + LWD  TG+L++F T F F + +    + YG+G AFFL+   S +P N++  G  GL N
Sbjct  80    VPLWDSTTGQLANFTTRFTFKLYAPTNDSSYGEGLAFFLSSYPSVVP-NSSIDGYLGLFN  138

Query  367   D-DERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWI  543
             + +++ N  N  VA EFD + N +D +  HVGI + S+ SV    W   I  G  + AW+
Sbjct  139   NSNDQNNPLNQIVAGEFDSHKNTWDPDGTHVGITIHSIVSVANVTWKSSINDGRIANAWV  198

Query  544   NYDPRSMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINS  708
              Y   S NLSV         F     +SY +DLR+YL ++V  GF+ +TGK   L  I  
Sbjct  199   TYHANSKNLSVFLSYQDNPQFSGNSSLSYSVDLREYLTDKVAIGFSASTGKFVELHQILY  258

Query  709   WIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAW--------RKRKMR  864
             W F S  D+   +   K+    ++         +    + + FL +         + K  
Sbjct  259   WEFDST-DVHLMKTG-KTKAILVISLSTSASAVVCSMGLVYFFLHFRTVRRIRRSREKEE  316

Query  865   EEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESY  1044
             E+ D D   +  E   G GP+RF Y EL  ATN+F+++ KLGEGGFG+VY+G+LK+    
Sbjct  317   EKLDCDESID-SEFEKGRGPRRFRYNELIAATNNFAEERKLGEGGFGAVYQGFLKDQNIE  375

Query  1045  VAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSH  1224
             +A+KRV++GS QG KEY SEV++ISR+RH+NLV L+GWCHEN + LLVYEF+ N SLD H
Sbjct  376   IAIKRVAKGSTQGRKEYISEVKIISRLRHRNLVQLVGWCHENGEFLLVYEFMPNRSLDKH  435

Query  1225  LYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGL  1404
             LY   +L  WPLR+KI   +ASALLYLHEE E+C+VHRDIK SN+MLDS   AKLGDFGL
Sbjct  436   LYDSGNLFAWPLRFKITIGVASALLYLHEEWEQCVVHRDIKPSNVMLDSGFTAKLGDFGL  495

Query  1405  ARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAE  1584
             ARLVDH++G +TT LAGTMGY+A ECV SGKASKE+D+YSFGI+ LEIACGR+P+ P  +
Sbjct  496   ARLVDHDRGLQTTVLAGTMGYMAPECVTSGKASKESDVYSFGILALEIACGRRPVVPKED  555

Query  1585  ECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQA  1764
                +++V WVW LYG  +LL+A D    G+F+ REV  +M+VGLWCAHPD +LRPSI Q 
Sbjct  556   HDKISLVQWVWDLYGRNELLNAVDRRFDGEFDEREVVSLMVVGLWCAHPDYNLRPSIHQV  615

Query  1765  IQVLNFEAPLPDLPETMPVATFW  1833
             I VL FEAPLPDLP  MPVA ++
Sbjct  616   ISVLKFEAPLPDLPPKMPVAMYF  638



>ref|XP_010054306.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
 gb|KCW76074.1| hypothetical protein EUGRSUZ_D00446 [Eucalyptus grandis]
Length=696

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/597 (50%), Positives = 389/597 (65%), Gaps = 35/597 (6%)
 Frame = +1

Query  124   NNSIQITPNQRNCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFL  303
             NN IQITPN  N  G ATY EP+ LWDK T  ++ FNT F FVID  G   + DGF FFL
Sbjct  61    NNFIQITPNSPNSTGWATYHEPMRLWDKATSNVADFNTQFTFVIDLEGKPNFVDGFTFFL  120

Query  304   APLGSRIPPNATKGGGFGLANDDERLNSSNPFVAVEFDVY-----------LNHYDTEQ-  447
             AP GS++P N+  GG  G+ N  +    S  FVA+EFD +           +N     Q 
Sbjct  121   APNGSQLPNNSV-GGALGIVNAFDP--QSARFVAIEFDTFYTEVGGQFGGAINDKKCSQP  177

Query  448   ------KHVGIDVDSLQSV--VTAPWSPD-IEGGWGSEAWINYDPRSMNLSVVFRNFGSY  600
                    H+GID+++L SV      W  D I  G   +A I Y+  + NLSV+  +  + 
Sbjct  178   PLIGKDSHIGIDLNNLTSVNSTCVDWLQDKIISGGQIKAVITYNSNTQNLSVLIMDADAT  237

Query  601   G------HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTKS  762
             G      +  Y ++  + LPE VTFGF+ +TG  + L  I +W F S + ++  ++  KS
Sbjct  238   GTSINSANTHYKVNFTELLPEWVTFGFSASTGACSELHSIVAWEFGSTVQVAGQKS--KS  295

Query  763   TgkglviglvvggcfliggSMAFSFLAWRKRK-MREEFDDDIFGNIGELGGGAGPKRFTY  939
                 ++              + F   +  KR  M  E DD +     E    +GPK+FTY
Sbjct  296   WLWPILGSSSFLLLIFFLAFIWFRHRSKSKRADMSGEEDDLVIDE--EFDQVSGPKKFTY  353

Query  940   RELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVIS  1119
             +EL  AT++F+ +  LGEGGFG VY+GYL  + + VA+K+++ GS+QGIKE+A+EV  IS
Sbjct  354   KELVIATDNFTVERLLGEGGFGRVYEGYLTNVNANVAIKKINPGSRQGIKEFATEVMTIS  413

Query  1120  RIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALL  1299
             ++RH+NLV LIGWCHE K+L+LVYEF+SNGSLDSHL+K +S L W  RYKIVQ +ASALL
Sbjct  414   QLRHRNLVQLIGWCHEKKELILVYEFMSNGSLDSHLFKERSFLPWENRYKIVQGIASALL  473

Query  1300  YLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALE  1479
             YLHEE E+CI+HRDIKSSNIMLD + NAK+GDFGLARLVDH KG +TT LAGTMGY+A E
Sbjct  474   YLHEEWEQCIIHRDIKSSNIMLDYDFNAKIGDFGLARLVDHTKGLQTTVLAGTMGYMAPE  533

Query  1480  CVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADP  1659
             CV + KASKE+D+YSFG+V LEI CGR+ I P AEE  V +VDWVW+LYGT +LLDAADP
Sbjct  534   CVYTNKASKESDVYSFGVVLLEITCGREVIKPRAEEGQVRLVDWVWELYGTKRLLDAADP  593

Query  1660  NLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
              L  DF+GR++E +M+VGLWCAHPD + RPSIR+A  VLNF    P LP  +PV T+
Sbjct  594   KLGIDFDGRQLECLMVVGLWCAHPDYTARPSIREASNVLNFNTSAPVLPSKLPVPTY  650



>ref|XP_007211327.1| hypothetical protein PRUPE_ppa024926mg [Prunus persica]
 gb|EMJ12526.1| hypothetical protein PRUPE_ppa024926mg [Prunus persica]
Length=678

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/577 (54%), Positives = 394/577 (68%), Gaps = 27/577 (5%)
 Frame = +1

Query  166   GRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKG  345
             GRATYS+P  L +K TGKL+ F T F F IDS   + YGDG AFF+AP GS +  +    
Sbjct  70    GRATYSQPFLLHEKATGKLADFTTSFNFAIDSLKESTYGDGLAFFIAPSGSFLLNDTEPA  129

Query  346   GG--FGLANDDERLNSSNPFVAVEFDVY-LNHYDTEQKHVGIDVDSLQSVVTAPWSPDIE  516
             GG   GL  +    N +  FVAVEFD+Y  +  D    HVG DV+SL S +   W   I 
Sbjct  130   GGNNLGLPVNFASPNDT-AFVAVEFDIYAYSTTDPPYDHVGTDVNSLNSTIFRRWKGGIM  188

Query  517   GGWGSEAWINYDPRSMNLSVVFRNFG-------SYGHVSYILDLRKYLPERVTFGFAGAT  675
              G  + A I+Y+  S NLSV F  F           H S I+DL++YLP+ V  GF+ +T
Sbjct  189   EGKTNNATISYNSTSKNLSVAFTTFAPDSNVTQEMAHFSDIIDLKQYLPDLVVVGFSAST  248

Query  676   GKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKR  855
             G   +L  I SW F+S           KS G  + +G+      + G      F+ W+KR
Sbjct  249   GNYISLNKIISWNFSST------SLGNKSIGLAVGLGIGGCAVLVGGLGW---FIMWKKR  299

Query  856   KMREEFDDDIFGNIGEL-----GGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKG  1020
             +   E  D+    + EL       GAGP++F+Y ELARAT++F + +KLGEGGFG VYKG
Sbjct  300   ERAGESSDEDHPMVHELIDDEFEKGAGPRKFSYSELARATSNFEEGEKLGEGGFGGVYKG  359

Query  1021  YLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFL  1200
             ++ +L  YVAVKR+S  SKQG KEYASEV++ISR+RH+NLV LIGWCHE K  LLVYEF+
Sbjct  360   FIPDLNLYVAVKRISSSSKQGPKEYASEVKIISRLRHRNLVQLIGWCHERK-FLLVYEFM  418

Query  1201  SNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLN  1380
              NGSLDSHL+K +SLLTW  RYKI Q LAS L YLHEE E+C++HRDIKSSN+MLDSN N
Sbjct  419   PNGSLDSHLFKEQSLLTWEARYKIAQGLASGLFYLHEEWEQCVLHRDIKSSNVMLDSNFN  478

Query  1381  AKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGR  1560
             AKLGDFGLARLVDH K S+TT LAGTMGY+A + + +GKASKE+D+YSFG+V LEIACGR
Sbjct  479   AKLGDFGLARLVDHGKQSQTTILAGTMGYMAPDYLNAGKASKESDVYSFGVVALEIACGR  538

Query  1561  KPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCS  1740
             KPIDP       N+V+WVW+LYG  ++ +AADP LSGDF+ +++E +MIVGLWCAHPD +
Sbjct  539   KPIDPKFGSIQSNMVEWVWELYGEDRVNEAADPKLSGDFDKKQMECLMIVGLWCAHPDYN  598

Query  1741  LRPSIRQAIQVLNFEAPLPDLPETMPVATFW-PQRNV  1848
             +RPSI+QAIQVLNFE PLP+LP  MPVAT++ P ++V
Sbjct  599   MRPSIQQAIQVLNFEVPLPNLPSKMPVATYFAPPKSV  635



>ref|XP_008352704.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Malus domestica]
Length=703

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/635 (49%), Positives = 410/635 (65%), Gaps = 40/635 (6%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQIT--PNQRNCIGRATYSEPLHLWDK  207
             IP   PL+FN+D FT             +    I++T    Q   +G ATY +P  LW+ 
Sbjct  19    IPSASPLAFNYDSFTIGXTGIFLXGAAYIDEQXIKLTRSARQNKNVGXATYXQPFLLWET  78

Query  208   PTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD---ER  378
              TGK++ F THF F+IDS     + DG  FF+AP GS +  +A  GG  GL  ++   + 
Sbjct  79    STGKIADFTTHFTFMIDSG----HADGMVFFIAPSGSLLNISAGGGGHLGLPVEELPGDT  134

Query  379   LNSSNPFVAVEFDVYLNHYDTEQK----HVGIDVDSLQSVVTAPWSPDIEGGWGSEAWIN  546
               +  PFVAVEFD+Y N     +     HVGID++SL+S +T PW+ DI     ++AWI+
Sbjct  135   TRTLYPFVAVEFDIYRNEQPVIRXXVGDHVGIDINSLKSNITTPWNGDINEXKRNDAWIS  194

Query  547   YDPRSMNLSVVFRNF--GSYG-------HVSYILDLRKYLPERVTFGFAGATGKDTALQM  699
             Y+  S NLSV F +F  G+ G       ++SYI+DL++YLP+ V  GF+ A G+D A+  
Sbjct  195   YNSSSKNLSVAFTSFQNGTNGTEVEVIKYLSYIIDLKQYLPDWVIVGFSAAKGQDIAVHK  254

Query  700   INSWIFTSAL----DISENQADTKSTgkglviglvvggcfliggSMAFSF-------LAW  846
             I  W FTS      D + N+ ++ +               L+G  +A S        L W
Sbjct  255   IIPWNFTSTALVDDDPTHNKPESIAPSGVXPGPGKSKMGLLLGLGIAGSLILFAGLGLVW  314

Query  847   ----RKRKMREEFDDDIFGNI---GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFG  1005
                 +K K  +  D++ F N     EL    GP++F+Y ELA+AT++F + +KLGEGGFG
Sbjct  315   FIYRKKSKAVDGIDENPFCNKLIDKELENETGPRKFSYHELAQATSNFEEGEKLGEGGFG  374

Query  1006  SVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLL  1185
              VY+G++K+L   VAVKR+S GSKQG+KEYASEVR+ISR+RH+NLV LIGWCHE ++LLL
Sbjct  375   GVYRGFIKDLNLQVAVKRISSGSKQGMKEYASEVRIISRLRHRNLVQLIGWCHEKRELLL  434

Query  1186  VYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIML  1365
             VYEFL N SLDSHL+K  SLL+W + Y I + LASALLYLHEE E C++HRDIKSSN+ML
Sbjct  435   VYEFLPNRSLDSHLFKENSLLSWQVXYNIXKGLASALLYLHEEWEXCVLHRDIKSSNVML  494

Query  1366  DSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLE  1545
             D N N KLGDFGLARLVDH + S TT +AGT GY+ALE V +GK++KE+D+YSFG+V+LE
Sbjct  495   DXNFNVKLGDFGLARLVDHGEQSLTTIVAGTRGYMALEYVTTGKSTKESDVYSFGVVSLE  554

Query  1546  IACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCA  1725
             IACGRKPID   E   + +V WVW LY  G ++ AADP L G F+ +++E +MIVGLWCA
Sbjct  555   IACGRKPIDFKLEXSQIELVKWVWGLYEEGNVIQAADPKLYGHFDEKQMECLMIVGLWCA  614

Query  1726  HPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             HP    R SI Q IQVLNFE PLP LP  MPVAT+
Sbjct  615   HPQYIFRXSIXQXIQVLNFEXPLPILPSKMPVATY  649



>ref|XP_003528400.2| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Glycine max]
Length=697

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/612 (48%), Positives = 402/612 (66%), Gaps = 19/612 (3%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNCIGRATYSEPLHLWDKPTG  216
             P    LSFN+     + +      +    N+ I +T ++ +  GR TY E LHLWDK + 
Sbjct  53    PHAASLSFNYQQLGDTGIALNFSGKARRDNDVINLTRSEPDSYGRVTYYELLHLWDKNSE  112

Query  217   KLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN----  384
             K++ F THF+F I++     +GDG  FFLA      P +   G G GLA+ ++  N    
Sbjct  113   KVTDFTTHFSFTINTPNKTHHGDGITFFLAH--PDFPQSDIDGSGIGLASREQLKNLNFA  170

Query  385   SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSM  564
                PFVAVEFD ++N +D +  HVGIDV+S+ +  T  W   ++   G +A ++YD  S 
Sbjct  171   KDYPFVAVEFDTFVNDWDPKYDHVGIDVNSINTTDTTEWFTSMDER-GYDADVSYDSGSN  229

Query  565   NLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALD  732
              LSV F  +        H+  +++L   LPE V  GF+ ATG       ++SW F S+L 
Sbjct  230   RLSVTFTGYKDDKKIKQHLFSVVNLSDVLPEWVEIGFSSATGDFYEEHTLSSWSFNSSLG  289

Query  733   ISENQADTKSTgkglviglvvggcfliggSMAFSFLAW--RKRKMREE--FDDDIFGNIG  900
                 +  +K+     +   +  G   +   + F  + W  R R + E   FD  +  +  
Sbjct  290   PKPQKGGSKTGLVIGLSVGLGAGVLFVILGVTF-LVRWILRNRGVEEVSLFDHTMDNDFE  348

Query  901   ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQ  1080
              +   + PK+F+Y ELARATN+F+ ++K+G+GGFG+VY+G+++EL ++VA+K+VSRGS+Q
Sbjct  349   RM---SLPKKFSYEELARATNNFASENKIGQGGFGAVYRGFMRELNAHVAIKKVSRGSRQ  405

Query  1081  GIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPL  1260
             G+KEYASEV++I+++RHKNLV L GWCHEN DLLLVYEF+ NGSLDS+L+KGK LLTW +
Sbjct  406   GVKEYASEVKIITQLRHKNLVRLFGWCHENNDLLLVYEFMENGSLDSYLFKGKGLLTWKV  465

Query  1261  RYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRT  1440
             RY I + LASALLYLHEE E+C++HRDIKSSN+MLDSN NAKLGDFGLARL+DH  GS+T
Sbjct  466   RYDIARGLASALLYLHEEWEECVLHRDIKSSNVMLDSNFNAKLGDFGLARLMDHAIGSKT  525

Query  1441  TALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWK  1620
             T LAGT+GY+  E    GKAS+E+D+YSFG+VTLEIACGRK I+P   E  + +VDWVW+
Sbjct  526   TGLAGTIGYLPPEAATRGKASRESDVYSFGVVTLEIACGRKVIEPNLNEEQIYLVDWVWE  585

Query  1621  LYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPD  1800
              YG G LL A+D +L G F+ +E+E++MIVGLWC H D  LRP+IRQA+QVLNFEAPLP 
Sbjct  586   HYGMGALLKASDASLYGHFDEKEMERLMIVGLWCTHSDFLLRPTIRQAVQVLNFEAPLPI  645

Query  1801  LPETMPVATFWP  1836
             L     +++  P
Sbjct  646   LTSFSSMSSRTP  657



>ref|XP_008226465.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Prunus mume]
Length=679

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/614 (51%), Positives = 409/614 (67%), Gaps = 26/614 (4%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVNNS-IQITPN----QRN-CIGRATYSEPLHLWDKP  210
             PL+F+F  F+ S   NI+ +  +      +++T +    Q+N   GRA Y +P  L +K 
Sbjct  24    PLNFSFSNFSGSYYPNISTKGDAFFEGGYLRLTKSGEDQQKNGSAGRAIYRQPFLLREKA  83

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS  390
             TGKL+ F T F F IDS   + YGDG AFF+AP GS +  +    GG+ L      +N +
Sbjct  84    TGKLADFTTSFNFTIDSLKQSPYGDGLAFFIAPSGSFLLEDTKPAGGYNLG---LPVNFA  140

Query  391   NP----FVAVEFDVY-LNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDP  555
             +P    FVAVEFD+Y     D    HVGIDV+SL S +   W   I  G  + A I+Y+ 
Sbjct  141   SPNDTAFVAVEFDIYPYPTSDPPYDHVGIDVNSLNSTIFRRWKGGIMEGKTNNATISYNS  200

Query  556   RSMNLSVVFRNFG-------SYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
              S NLS+ F  F           H S I+DL++YLP+ V  GF+ +TG   +L  I SW 
Sbjct  201   TSKNLSIAFTTFAPDSNVTQEMTHFSDIIDLKQYLPDLVVVGFSASTGNFISLNKIISWN  260

Query  715   FTS-ALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFG  891
             F+S +L   +  ++ KS  K + + + +G             L W          D++  
Sbjct  261   FSSTSLGDRDTNSNRKSGNKSIGLAVGLGVGGCAVLFGGLG-LGWESSDEDHPVVDELID  319

Query  892   NIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRG  1071
             +  E   GAGP++F+Y EL+RAT++F + +KLGEGGFG VYKG++ +L SYVAVKR+S  
Sbjct  320   D--EFEKGAGPRKFSYSELSRATSNFEEGEKLGEGGFGGVYKGFIPDLNSYVAVKRISSS  377

Query  1072  SKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLT  1251
             SKQG K YASEV++ISR+RH+NLV LIGWCHE K  LLVYEF+ NGSLDSHL+K +SLLT
Sbjct  378   SKQGPKAYASEVKIISRLRHRNLVQLIGWCHERK-FLLVYEFMPNGSLDSHLFKEQSLLT  436

Query  1252  WPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKG  1431
             W  RYKI Q LAS L YLHEE E+C++HRDIKSSN+MLDSN NAKLGDFGLARLVDH K 
Sbjct  437   WEARYKIAQGLASGLFYLHEEWEQCVLHRDIKSSNVMLDSNFNAKLGDFGLARLVDHGKQ  496

Query  1432  SRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDW  1611
             S+TT LAGTMGY+A + + +GKASKE+D+YSFG+V LEIACGRKPIDP       N+V+W
Sbjct  497   SQTTVLAGTMGYMAPDYLNTGKASKESDVYSFGVVALEIACGRKPIDPKFGSIQSNMVEW  556

Query  1612  VWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAP  1791
             VW+LYG  +++ AADP L GDF+ +++E +MIVGLWCAHPD ++RPSI+QAIQVLNFE P
Sbjct  557   VWELYGEDRVIQAADPKLCGDFDKKQMECLMIVGLWCAHPDYNMRPSIQQAIQVLNFEVP  616

Query  1792  LPDLPETMPVATFW  1833
             LP+LP  MPVAT++
Sbjct  617   LPNLPSKMPVATYF  630



>gb|KCW59665.1| hypothetical protein EUGRSUZ_H02418, partial [Eucalyptus grandis]
Length=634

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/608 (49%), Positives = 399/608 (66%), Gaps = 18/608 (3%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPNQRNC-IGRATYSEPLHLWDKPTGKLS  225
             L FN   F P+   +I +E     +  ++ +T     C +GRATY+E + LWD  +GKLS
Sbjct  24    LEFNISRFDPA-ANDILYEGDAKPMVGAVDMTSQLYFCHVGRATYNEKVRLWDSGSGKLS  82

Query  226   SFNTHFAFVIDSNGS--AKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNPF  399
              F THF F ID+NG    +Y  GFAFF+AP+G +IP N+  GG  GL N     +S N  
Sbjct  83    DFTTHFQFTIDTNGQPHGRYAAGFAFFMAPVGFQIPVNSI-GGFLGLYNTTNSDSSQNQI  141

Query  400   VAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSV  576
             + VEFD + N  +D   +HVGI+  S+ S VT PW+     G   +AWINY+  +MNLSV
Sbjct  142   IHVEFDSFANPEWDPNYEHVGINTKSIASAVTTPWNVTYHSGDTIDAWINYNASTMNLSV  201

Query  577   VFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDIS-  738
              +      N      +SY +DLR  LPE V  GF+ A+G D     + SW F S+L +  
Sbjct  202   SWSFQTTPNPQENTSLSYQIDLRTVLPEWVIIGFSAASGYDMERHTLGSWDFKSSLAVEG  261

Query  739   ENQADTKSTgkglviglvvggcfliggSMAFSFLAW--RKRKMREEFDDD-IFGNIGE-L  906
              N  ++K  G  L + + +      G ++A   + W  RKRK  E+  +     +I +  
Sbjct  262   PNSGNSKRVGLILGLTIPLSVMVASGVAIAMGII-WMRRKRKNTEKITETATLTSINDDF  320

Query  907   GGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGI  1086
                AGP+RF+Y++LA ATN+FS   KLGEGGFG+VY+GYL  L++ +AVKRVSRGSKQG 
Sbjct  321   ERRAGPRRFSYQDLASATNNFSSDRKLGEGGFGAVYRGYLLNLDTMIAVKRVSRGSKQGK  380

Query  1087  KEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRY  1266
             +E+ +EV+VIS +RH+NLV LIGWCHE  +L+LVYE++ NGSLD HL+  K  L W +RY
Sbjct  381   REFVTEVKVISSLRHRNLVQLIGWCHEGNELMLVYEYMPNGSLDLHLFGKKGPLNWSIRY  440

Query  1267  KIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTA  1446
             +I   LASA+ YLHEE E+C++HRDIKSSN+MLDSN N KLGDFGLARL+DHE G +TT 
Sbjct  441   RISIGLASAIFYLHEEWEQCVIHRDIKSSNVMLDSNFNVKLGDFGLARLMDHELGPQTTG  500

Query  1447  LAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLY  1626
             LAGT GY+A E + +G+ASKE+D+YSFG+V LEIA G++  DP + E  +++V+WVW L+
Sbjct  501   LAGTFGYLAPEYMTTGRASKESDVYSFGVVALEIATGKRARDPKSPESEMSLVEWVWALF  560

Query  1627  GTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLP  1806
             G  +L +A D  +  D    +VE +++VGLWCAHPD +LRPSIRQAIQVL FEA +P+LP
Sbjct  561   GDKKLPEAVDERMGSDLEETQVECLIMVGLWCAHPDQTLRPSIRQAIQVLKFEADVPNLP  620

Query  1807  ETMPVATF  1830
               MPV  +
Sbjct  621   VKMPVPVY  628



>gb|EAZ40356.1| hypothetical protein OsJ_24802 [Oryza sativa Japonica Group]
Length=886

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/622 (47%), Positives = 398/622 (64%), Gaps = 26/622 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRN-----CIGRATYSEPLH  195
             +I L+     NF     +    I  +  +  N ++++T ++ N      +GRA Y++P+ 
Sbjct  219   VIELIPKDKLNFTESNHNGSATIQLQEDAFYNKAVKLTKDELNGKITQSVGRAIYTDPVP  278

Query  196   LWDKPTGKLSSFNTHFAFVIDS-NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
             LWD  TG+L+SF T F F I +    + YG+G AFFL+   S +P N+  G     +N +
Sbjct  279   LWDSTTGQLASFTTRFTFKIYAPTNDSSYGEGLAFFLSSYPSVVPNNSMDGYLGLFSNSN  338

Query  373   ERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
             ++ +  N  VAVEFD + N +D +  HVGI++ S+ SV    W   I  G  + AW+ Y 
Sbjct  339   DQSDPLNQIVAVEFDSHKNTWDPDGNHVGINIHSIVSVANVTWRSSINDGRIANAWVTYQ  398

Query  553   PRSMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
               S NLSV         F     +SY +DL KYLP++V+ GF+ +TGK   L  I  W F
Sbjct  399   ANSRNLSVFLSYQDNPQFSGNSSLSYSVDLSKYLPDKVSIGFSASTGKFVELHQILYWEF  458

Query  718   TSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAW----------RKRKMRE  867
              S  D+   + + K+ G  ++     G   +    +   FL +           K K + 
Sbjct  459   DST-DVHLMKTE-KTKGILVISLSTSGSVVVCSIGLVCFFLCFRRIRRTTRSREKEKEKL  516

Query  868   EFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYV  1047
             + D+ I     E   G GP+RF Y EL  AT++F+ + KLGEGGFG+VY+G+LK+    +
Sbjct  517   DCDESI---DSEFEKGKGPRRFQYNELVVATDNFAAERKLGEGGFGAVYQGFLKDQNIEI  573

Query  1048  AVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHL  1227
             A+KRV++GS QG KEY SEV++ISR+RH+NLV L+GWCHE+ + LLVYEF+ N SLD HL
Sbjct  574   AIKRVAKGSTQGRKEYISEVKIISRLRHRNLVQLVGWCHEHGEFLLVYEFMPNRSLDKHL  633

Query  1228  YKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLA  1407
             Y G +LL WPLR+KI   +ASALLYLHEE E+C+VHRD+K SN+MLDS  NAKLGDFGLA
Sbjct  634   YDGGNLLAWPLRFKITIGVASALLYLHEEWEQCVVHRDVKPSNVMLDSGFNAKLGDFGLA  693

Query  1408  RLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEE  1587
             RLVDH++GS+TT +AGTMGY+A ECV +GKASKETD+YSFGI+ LEIACGR+P+ P  + 
Sbjct  694   RLVDHDRGSQTTVIAGTMGYMAPECVTTGKASKETDVYSFGILALEIACGRRPVVPKEDN  753

Query  1588  CHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAI  1767
               +++V WVW LYG  ++L+A D  L G+F  REV  +M+VGLWCAHPD ++RPSIRQ I
Sbjct  754   DRISLVQWVWDLYGRNEILNAIDGRLDGEFEEREVISLMVVGLWCAHPDYNIRPSIRQVI  813

Query  1768  QVLNFEAPLPDLPETMPVATFW  1833
              VL FEAPLPDLP  MPVA ++
Sbjct  814   SVLKFEAPLPDLPPKMPVAMYF  835



>ref|XP_010023419.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=650

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/608 (49%), Positives = 399/608 (66%), Gaps = 18/608 (3%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPNQRNC-IGRATYSEPLHLWDKPTGKLS  225
             L FN   F P+   +I +E     +  ++ +T     C +GRATY+E + LWD  +GKLS
Sbjct  24    LEFNISRFDPA-ANDILYEGDAKPMVGAVDMTSQLYFCHVGRATYNEKVRLWDSGSGKLS  82

Query  226   SFNTHFAFVIDSNGS--AKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNPF  399
              F THF F ID+NG    +Y  GFAFF+AP+G +IP N+  GG  GL N     +S N  
Sbjct  83    DFTTHFQFTIDTNGQPHGRYAAGFAFFMAPVGFQIPVNSI-GGFLGLYNTTNSDSSQNQI  141

Query  400   VAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSV  576
             + VEFD + N  +D   +HVGI+  S+ S VT PW+     G   +AWINY+  +MNLSV
Sbjct  142   IHVEFDSFANPEWDPNYEHVGINTKSIASAVTTPWNVTYHSGDTIDAWINYNASTMNLSV  201

Query  577   VFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDIS-  738
              +      N      +SY +DLR  LPE V  GF+ A+G D     + SW F S+L +  
Sbjct  202   SWSFQTTPNPQENTSLSYQIDLRTVLPEWVIIGFSAASGYDMERHTLGSWDFKSSLAVEG  261

Query  739   ENQADTKSTgkglviglvvggcfliggSMAFSFLAW--RKRKMREEFDDD-IFGNIGE-L  906
              N  ++K  G  L + + +      G ++A   + W  RKRK  E+  +     +I +  
Sbjct  262   PNSGNSKRVGLILGLTIPLSVMVASGVAIAMGII-WMRRKRKNTEKITETATLTSINDDF  320

Query  907   GGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGI  1086
                AGP+RF+Y++LA ATN+FS   KLGEGGFG+VY+GYL  L++ +AVKRVSRGSKQG 
Sbjct  321   ERRAGPRRFSYQDLASATNNFSSDRKLGEGGFGAVYRGYLLNLDTMIAVKRVSRGSKQGK  380

Query  1087  KEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRY  1266
             +E+ +EV+VIS +RH+NLV LIGWCHE  +L+LVYE++ NGSLD HL+  K  L W +RY
Sbjct  381   REFVTEVKVISSLRHRNLVQLIGWCHEGNELMLVYEYMPNGSLDLHLFGKKGPLNWSIRY  440

Query  1267  KIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTA  1446
             +I   LASA+ YLHEE E+C++HRDIKSSN+MLDSN N KLGDFGLARL+DHE G +TT 
Sbjct  441   RISIGLASAIFYLHEEWEQCVIHRDIKSSNVMLDSNFNVKLGDFGLARLMDHELGPQTTG  500

Query  1447  LAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLY  1626
             LAGT GY+A E + +G+ASKE+D+YSFG+V LEIA G++  DP + E  +++V+WVW L+
Sbjct  501   LAGTFGYLAPEYMTTGRASKESDVYSFGVVALEIATGKRARDPKSPESEMSLVEWVWALF  560

Query  1627  GTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLP  1806
             G  +L +A D  +  D    +VE +++VGLWCAHPD +LRPSIRQAIQVL FEA +P+LP
Sbjct  561   GDKKLPEAVDERMGSDLEETQVECLIMVGLWCAHPDQTLRPSIRQAIQVLKFEADVPNLP  620

Query  1807  ETMPVATF  1830
               MPV  +
Sbjct  621   VKMPVPVY  628



>ref|XP_007047724.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
 gb|EOX91881.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
Length=659

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/611 (47%), Positives = 405/611 (66%), Gaps = 14/611 (2%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSL-VNNSIQITPNQRNC-IGRATYSEPLHLWD  204
             ++P V+ + F    F P    NI +E  +     ++        C +GR +Y++ + +WD
Sbjct  27    LLPRVNSIHFKISRFDPE-ATNIVYEGDAQPYVGAVDFNSVSYLCRVGRVSYAQSVPIWD  85

Query  205   KPTGKLSSFNTHFAFVIDS--NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
               T K++ F THF+F ID+     + Y  G AFFLAP+G  IPPN+  GG  GL N    
Sbjct  86    SGTNKVADFTTHFSFFIDTLNRNISMYAAGLAFFLAPVGFEIPPNSA-GGFLGLFNTTTS  144

Query  379   LNSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDP  555
              +  N  V VEFD + N  +D   +HVGI+ +S+ S    PW+  +  G  ++ WI+Y+ 
Sbjct  145   DSPRNQIVLVEFDTFPNPQWDPPVQHVGINTNSISSAKYTPWNFSLYSGKTADTWISYNA  204

Query  556   RSMNLSVVFRN-----FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFT  720
              + NLSV +       F     +S+ +DL++ LPE V  G + AT        + SW F+
Sbjct  205   TTKNLSVTWNYPNTTIFQLNFSLSHHIDLKQILPEWVKVGISAATSHFQEGHRLVSWEFS  264

Query  721   SALDISENQA-DTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNI  897
             S+L+I + +  + K+    +V+ ++     ++  S  F +  W+K K   E   ++    
Sbjct  265   SSLEIKKTKGKNIKNIKLIVVLAVLGILMTVVSISFVF-YRRWKKVKEEREERTNVSSIN  323

Query  898   GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSK  1077
              +L  GAGP+RF+Y +L  ATN+FS Q KLGEGGFG+VYKGY  ++++ VAVK+++RGS+
Sbjct  324   DDLERGAGPRRFSYGDLVVATNNFSNQRKLGEGGFGAVYKGYFNDIDTAVAVKKIARGSR  383

Query  1078  QGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWP  1257
             QG KEY +EV++ISR+RH+NLV LIGWCH+    LLVYEF+SNGSLDS+L+  K+ LTWP
Sbjct  384   QGKKEYITEVKIISRLRHRNLVQLIGWCHDGGKFLLVYEFMSNGSLDSYLFGKKAPLTWP  443

Query  1258  LRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSR  1437
             LRYKI   LASA+LYLHEE E+C+VHRDIKSSNIMLDS+ N KLGDFGLARL+DHE G  
Sbjct  444   LRYKIACGLASAVLYLHEEWEQCVVHRDIKSSNIMLDSSFNVKLGDFGLARLMDHELGPL  503

Query  1438  TTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVW  1617
             TT LAGT+GY+A E + +G+ASK +D+YSFG+V LEIA GR+ +DP  +  HV++V+WVW
Sbjct  504   TTGLAGTLGYMAPEYIRTGRASKASDVYSFGVVALEIATGRRSVDPKKKNSHVSLVEWVW  563

Query  1618  KLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLP  1797
              LYG+G LL + D  L  +F+G+++E++M+VGLWCAHPD +LRPSIRQAIQVL+F+  LP
Sbjct  564   HLYGSGNLLSSVDERLHTEFDGKQIERLMMVGLWCAHPDSNLRPSIRQAIQVLDFDVALP  623

Query  1798  DLPETMPVATF  1830
             +LP  MP+ T+
Sbjct  624   NLPLNMPIPTY  634



>ref|XP_011031284.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Populus euphratica]
Length=649

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/577 (51%), Positives = 385/577 (67%), Gaps = 21/577 (4%)
 Frame = +1

Query  148   NQRNCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIP  327
             N  N +G  TY E + LWD  +GKLS F +HF+F ID+  +  YG G AFFLAP+G +IP
Sbjct  53    NYINRVGCTTYPERVRLWDSSSGKLSDFTSHFSFSIDTFNAPNYGHGIAFFLAPVGFQIP  112

Query  328   PNATKGGGFGLANDDERLNSSNPFVAVEFDVYLNH-YDTEQKHVGIDVDSLQSVVTAPWS  504
             PN+  GG  GL N     +S N  V+VEFD Y N  +D + +HVGI+ +S+ S    PW+
Sbjct  113   PNSA-GGFLGLFNTTTMKSSQNQIVSVEFDSYPNEEWDPKVEHVGINNNSIISAAYTPWN  171

Query  505   PDIEGGWGSEAWINYDPRSMNLSVVFRNFGSYGHVS---------YILDLRKYLPERVTF  657
                  G  +EAWI Y+    NLSV    F  Y   S         YI+DL K+LPE +T 
Sbjct  172   ASFHSGDTAEAWITYNSTDRNLSV----FWEYQTTSDPRENSSLFYIIDLSKFLPEWITV  227

Query  658   GFAGATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSF  837
             GF+ ATG++     + SW F+S+L+I E +       K ++  +V     + G +  F  
Sbjct  228   GFSAATGQNLERHRLLSWEFSSSLNIEETKGKNSKKSKIIIGVIVSVLVLIAGATTTFVI  287

Query  838   LAWRKRKMREEFDDDIFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVY  1014
             L  RK+ +  +   +   +I E L  GAGP+RF+Y +L  ATN+FS Q KLGEGGFG+VY
Sbjct  288   LWRRKQMITRKGAAEKMTSINEALERGAGPRRFSYDDLVSATNNFSDQRKLGEGGFGAVY  347

Query  1015  KGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYE  1194
             +GYL +++  +AVK++SR S+QG KEY +EV+ IS++RH+NLV LIGWCH+  + ++VYE
Sbjct  348   RGYLNDMDMEIAVKKISRSSRQGKKEYITEVKTISQLRHRNLVQLIGWCHDKGEFMVVYE  407

Query  1195  FLSNGSLDSHLYKGKSL--LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLD  1368
             F+ NGSLDSHL+  K +  L+W +RYKI   LASALLYLHEE E C+VHRD+KSSN+MLD
Sbjct  408   FMPNGSLDSHLFGKKKMSPLSWAVRYKISHGLASALLYLHEEWEWCVVHRDVKSSNVMLD  467

Query  1369  SNLNAKLGDFGLARLVDH-EKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLE  1545
             S  N KLGDFGLA+LVDH E G RTT LAGT GY+A E + +G+ASKE+D+YSFG+V LE
Sbjct  468   SGFNVKLGDFGLAKLVDHDELGPRTTGLAGTFGYLAPEYISTGRASKESDVYSFGVVALE  527

Query  1546  IACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLS-GDFNG-REVEQMMIVGLW  1719
             IA GRK  DP  ++  +++V+W+W LYG G L  A D  L   DFN  ++ E++MIVGLW
Sbjct  528   IASGRKANDPIDQKSEMSLVEWIWDLYGCGNLSLAVDKRLDIKDFNDEKQAERLMIVGLW  587

Query  1720  CAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             CAHPD +LRPSIRQAIQVLN EA +PDLP  MPV  F
Sbjct  588   CAHPDHNLRPSIRQAIQVLNLEAAIPDLPPKMPVPVF  624



>ref|XP_002304348.2| hypothetical protein POPTR_0003s09340g [Populus trichocarpa]
 gb|EEE79327.2| hypothetical protein POPTR_0003s09340g [Populus trichocarpa]
Length=677

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/603 (48%), Positives = 407/603 (67%), Gaps = 13/603 (2%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSLVN-NSIQITPNQRNC-IGRATYSEPLHLWDKPTGKLS  225
             +SF    F PS+  NI +E  +  +  SI+   +   C +GRATY++ + LWD  T +L+
Sbjct  30    ISFQRTRFDPSDT-NIIYEGGASTHVGSIEFNSDTYMCQVGRATYAKKVPLWDSSTTRLT  88

Query  226   SFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNPFVA  405
              F+THF+F ID  G   Y  GFAFF+AP+   IPPN+  GG  GL N     +  N  V 
Sbjct  89    DFSTHFSFYIDIEGRTSYAAGFAFFIAPVEFHIPPNSA-GGFLGLYNITTSDSPQNHIVH  147

Query  406   VEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSVVF  582
             +EFD + N  +D   ++VGI+ +S+ S     W+  +  G  ++  + Y+  + NL+V +
Sbjct  148   IEFDSFANPEWDPPIQNVGINNNSVSSATYTYWNTSLHSGDTADVRVTYNSTTKNLTVSW  207

Query  583   RNFGSYG-----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQ  747
             +   +        +SYI+DLR+ LPE VT GF  AT       +++SW F+S L++SE  
Sbjct  208   KYQTTSSPQENTSLSYIIDLREVLPEWVTIGFTAATSNLIERHVLHSWDFSSTLEMSETS  267

Query  748   ADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDI-FGNIGE-LGGGAG  921
               +    K +V   V G   +I  ++    L WR++ +R+E  + +   +I + L   AG
Sbjct  268   GKSAKNIKLVVSLTVSGAVLIIVIAVVSGIL-WRRKLVRKETAETVNLTSINDDLERRAG  326

Query  922   PKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYAS  1101
             P+RF+Y++L  ATN+FS + KLGEGGFG+VY+G L  +++ VAVK++SRGSKQG KEY +
Sbjct  327   PRRFSYKDLVSATNNFSAERKLGEGGFGAVYQGQLTGIDTAVAVKKISRGSKQGKKEYVT  386

Query  1102  EVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQD  1281
             EV+VIS++RH+NLV LIGWCH+  + LLVYEF+SNGSLDSHL+  K  LTW  RY+I   
Sbjct  387   EVKVISQLRHRNLVQLIGWCHDRGEFLLVYEFMSNGSLDSHLFGKKIPLTWTARYRIALG  446

Query  1282  LASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTM  1461
             LASALLYLHEE E+C+VHRD+KSSNIMLDS+ N KLGDFGLARL+DHE G +TT LAGT+
Sbjct  447   LASALLYLHEEWEQCVVHRDVKSSNIMLDSSFNVKLGDFGLARLMDHELGPQTTGLAGTL  506

Query  1462  GYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQL  1641
             GY+A E + +G+ASKE+D+YSFG+V+LEIA GRK +D   ++  +++V+W+W LYGTG+L
Sbjct  507   GYLAPEYISTGRASKESDVYSFGMVSLEIATGRKAVDAIEQKSEMSLVEWIWDLYGTGKL  566

Query  1642  LDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPV  1821
               A D  L  +F+  ++E +MIVGLWCAHPD ++RPSIRQAI VLNFEAPLP+LP  MPV
Sbjct  567   NLAVDEKLQSEFDENQMECLMIVGLWCAHPDRNIRPSIRQAIHVLNFEAPLPNLPTKMPV  626

Query  1822  ATF  1830
               +
Sbjct  627   PLY  629



>ref|XP_007214773.1| hypothetical protein PRUPE_ppa023993mg [Prunus persica]
 gb|EMJ15972.1| hypothetical protein PRUPE_ppa023993mg [Prunus persica]
Length=660

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/620 (49%), Positives = 388/620 (63%), Gaps = 43/620 (7%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPN------QRNCIGRATYSEPLHL  198
             P V  L F+F  F  +    I  E  + ++    +         +   +GRATYS+P  L
Sbjct  13    PCVTSLHFSFSTFR-NGKNTICLEGDARIDGEFLLLTKSAVDDVKEQSVGRATYSQPFLL  71

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER  378
              D  TGKL+ + T+F FVIDS G   Y DG AFF+AP GS +     +GG  GLA ++ +
Sbjct  72    RDNATGKLADWTTNFTFVIDSQGKTPYADGLAFFIAPNGSLLNSTLGRGGSLGLAVENPQ  131

Query  379   LNSSN---PFVAVEFDVYLNHY----DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEA  537
              N+S    PFVAVEFD+Y N      D    HVGID  +L                   A
Sbjct  132   NNTSKSQYPFVAVEFDIYQNEVTSIEDPMGDHVGIDSSTLN------------------A  173

Query  538   WINYDPRSMNLSVVFRNFGSYGHVSYILD----LRKYLPERVTFGFAGATGKDTALQMIN  705
              I+Y+  +  + VVF ++     +   L+    L   L   V  GF+ AT  +TAL  IN
Sbjct  174   GISYNSTTNGIHVVFTSYVDGVQMMRYLNCEVPLDNILQGWVIAGFSAATDANTALHKIN  233

Query  706   SWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFS-----FLAWRKRKMREE  870
             SW F S     E   +T       +   +V    + G  +        F+  +KR   E 
Sbjct  234   SWSFHSTQLFDEKPKNTTPESGNGINIRLVLELGIGGLVLGGGLGLVWFICCKKRG--ES  291

Query  871   FDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVA  1050
              D+D      E   G GPK+F+YR+LA++T++F +  KLGEGGFG VY+GY+K+L   VA
Sbjct  292   SDEDATMIDEEFEKGTGPKKFSYRKLAQSTSNFHEGQKLGEGGFGGVYRGYIKDLNLNVA  351

Query  1051  VKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLY  1230
             VKR+S GS+QG+KEYA+EVR+ISR+RH+NLV L GWCHE K LLLVYEF+SNGSLDSHL+
Sbjct  352   VKRISSGSRQGLKEYAAEVRIISRLRHRNLVQLTGWCHERKQLLLVYEFMSNGSLDSHLF  411

Query  1231  KGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLAR  1410
             K KS L W +RY+I Q LAS L YLHEE E+C++HRD+KSSNIMLDSN NAKLGDFGLAR
Sbjct  412   KAKSSLAWDVRYRIAQGLASGLFYLHEEWEQCVLHRDVKSSNIMLDSNFNAKLGDFGLAR  471

Query  1411  LVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEEC  1590
             LVDH K S TT LAGTMGY+A E + +GKASKETD+YSFG+V LEIACGRKP D      
Sbjct  472   LVDHGKQSETTVLAGTMGYMAPEYMTTGKASKETDVYSFGVVALEIACGRKPNDLEFRSR  531

Query  1591  HVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQ  1770
              + +V+WVW LYG G++++AADP LSGDF  R++E ++IVGLWCAHPD  +RPSI+Q IQ
Sbjct  532   QITMVEWVWDLYGEGRVIEAADPKLSGDFEKRQMECLLIVGLWCAHPDYKIRPSIQQTIQ  591

Query  1771  VLNFEAPLPDLPETMPVATF  1830
             VLNFE PLP L   MPVA++
Sbjct  592   VLNFEVPLPILSSKMPVASY  611



>ref|XP_010255179.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Nelumbo nucifera]
Length=676

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/619 (51%), Positives = 412/619 (67%), Gaps = 33/619 (5%)
 Frame = +1

Query  55    SFNFDLFTPSNVQNITFERTSLV-----NNSIQITPNQR-----NCIGRATYSEPLHLWD  204
             +F+F  F+P N  NIT   T++V     +NSI++  NQ      N  GRA YS+P+ LWD
Sbjct  27    NFSFSSFSP-NDHNITLNGTAVVANVFNHNSIRLNDNQVAGNVFNSSGRAHYSQPIQLWD  85

Query  205   KPTGKLSSFNTHFAFVID--SNGSAKYGDGFAFFLAPLGS--RIPPNATKGGGFGLANDD  372
               T   + F T+F F I   S  S     G AFFLA   S   IP N+   G  GL N+ 
Sbjct  86    SITNSTTDFTTYFEFSITFFSGNSNLSSGGIAFFLASENSLSTIPSNSF-AGWLGLFNET  144

Query  373   ERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
                + SN  VAVEFD + + +D    HVGI+V+S+ S   + WS  +  G    A I+Y+
Sbjct  145   TDADPSNQMVAVEFDTFQDEWDPSNNHVGINVNSIISKANSTWSNTMVSGDTLGARISYN  204

Query  553   PRSMNLSVVFRN------FGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
               + NLSV  ++       GS  ++SY +DL   LPERV  GF+G+TG+   +Q+I SW 
Sbjct  205   GTTKNLSVHLKDPQVPVDAGSL-NLSYNVDLTGVLPERVFVGFSGSTGRAIPVQVIRSWN  263

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMR-----EEFDD  879
             FTS LD+   +A+       + +  +V     +G  +    + WR R+MR     +E D 
Sbjct  264   FTSTLDLVLPRAEDDEGDSKIWLVGLVVSILGVGIVLG---VLWRNRRMRMEDYQQENDM  320

Query  880   DIFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVK  1056
             D+  ++ E    G GPKRF+ +EL  ATN+FS++ KLG+GGFG VYKG+  EL   +AVK
Sbjct  321   DLDDSMDEEFEKGTGPKRFSCKELVSATNNFSEEGKLGQGGFGGVYKGFSNELNMAIAVK  380

Query  1057  RVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKG  1236
             ++SRGSKQG KEY SEV++ISR+RH+NLV L+GW HE  + LLVYE++ NGSLDSHL+  
Sbjct  381   KISRGSKQGKKEYMSEVKIISRLRHRNLVQLVGWSHERGEFLLVYEYMPNGSLDSHLFHK  440

Query  1237  KSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLV  1416
             KS LTW  R+KI   LASALLYLHEE EKC+VHRDIKSSN+MLDS+ NAKLGDFGLARLV
Sbjct  441   KSTLTWAQRHKISLGLASALLYLHEEWEKCVVHRDIKSSNVMLDSSFNAKLGDFGLARLV  500

Query  1417  DHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECH-  1593
             DHE GS+TT LAGTMGY+A EC+++GKASKE+D++SFG+V LEIACGRKP++  AEE + 
Sbjct  501   DHELGSQTTVLAGTMGYMAPECLITGKASKESDVFSFGVVALEIACGRKPVEQKAEEANK  560

Query  1594  VNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQV  1773
             V +V+WVW+ YG G++L+A D  L G+F   E E +MIVGLWC HPD SLRPSI+QAI V
Sbjct  561   VRLVEWVWEFYGRGRILEAVDEALCGEFEEMEAECLMIVGLWCVHPDHSLRPSIKQAIHV  620

Query  1774  LNFEAPLPDLPETMPVATF  1830
             LNFEAPLPDLP  MPV T+
Sbjct  621   LNFEAPLPDLPCKMPVPTY  639



>ref|XP_003608369.1| Heat shock protein 17a.17 [Medicago truncatula]
 gb|AES90566.1| concanavalin A-like lectin kinase family protein, putative [Medicago 
truncatula]
Length=797

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/604 (48%), Positives = 396/604 (66%), Gaps = 15/604 (2%)
 Frame = +1

Query  49    PLSFNFDLF--TPSNVQNITFERTSLVNNSIQITPNQRNCIGRATYSEPLHLWDKPTGKL  222
             PLSFN++      +N  NI+ +  S  N  +Q+T  + + +GR TYS+  HLWD  T ++
Sbjct  32    PLSFNYEQLGGDKTNTFNISGD-VSQDNQVLQLTKYKEHSLGRVTYSKLFHLWDIKTSEV  90

Query  223   SSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAN----DDERLNSS  390
             + FNT F+F I++     + DG  F+LA      P +   GGG GLA+     +      
Sbjct  91    TDFNTRFSFTINTPNKTHHADGMTFYLA--HPNFPMSQIYGGGIGLASLVQLSNPDYTKE  148

Query  391   NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNL  570
             NPFVAVEFD ++N +D    HVGIDV+S+ +     W   ++   G +A ++YD  S NL
Sbjct  149   NPFVAVEFDTFVNEWDPNYDHVGIDVNSISTNHATQWFTSMDER-GYDAEVSYDSSSNNL  207

Query  571   SVVFRNFGSYG----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDIS  738
             +V F  +        H+ Y+++LR  LP+ V FGF  ATG       ++SW F S+LD  
Sbjct  208   TVTFTGYQHNNTIQQHLFYVVNLRDVLPDWVEFGFTSATGTFWEYHTLSSWSFNSSLDFE  267

Query  739   ENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIGELGGGA  918
               +  TK+     +          + G +       +K+ M++    D+  +  +    +
Sbjct  268   AKEDGTKTGLVIGLGVGGAVALICVIGLVCLVKWKLKKKGMKDALHFDLAMD-SDFERIS  326

Query  919   GPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYA  1098
              PK+F Y ELAR+TN+F+ + K+G GGFG+VYKG++++L+ +VA+K+VS+ S QG+KEYA
Sbjct  327   LPKKFIYEELARSTNNFANEHKIGAGGFGAVYKGFIRDLKHHVAIKKVSKESNQGVKEYA  386

Query  1099  SEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQ  1278
             SEV+VIS++RHKNLV L GWCH+  DLLLVYEF+ NGSLDS+++KGK LL W +RY I +
Sbjct  387   SEVKVISQLRHKNLVQLYGWCHKQNDLLLVYEFVENGSLDSYIFKGKGLLIWTVRYNIAR  446

Query  1279  DLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGT  1458
              LASALLYLHEECE C++HRDIKSSN+MLDSN N KLGDFGLARL++HE  S+TT LAGT
Sbjct  447   GLASALLYLHEECEHCVLHRDIKSSNVMLDSNFNTKLGDFGLARLMNHETESKTTVLAGT  506

Query  1459  MGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQ  1638
              GY++ E    GKAS+E+D+YSFG+V LEIACGRK I+P+  E H+ +VDWV +LYG G 
Sbjct  507   YGYLSPEAATRGKASRESDVYSFGVVALEIACGRKAIEPSLSEEHIYLVDWVCELYGNGD  566

Query  1639  LLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMP  1818
             LL AAD  L G+FN +EVE++MIVGLWC H D   RP IRQ +QVLNF+APLP+LP  M 
Sbjct  567   LLKAADSRLYGEFNEKEVERLMIVGLWCTHTDHLQRPMIRQVVQVLNFDAPLPNLPLQMN  626

Query  1819  VATF  1830
              +T+
Sbjct  627   ASTY  630



>ref|XP_007047716.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
 gb|EOX91873.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
Length=666

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/612 (48%), Positives = 392/612 (64%), Gaps = 20/612 (3%)
 Frame = +1

Query  37    PLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQIT-PNQRNCIGRATYSEPLHLWDKPT  213
             P    +SF    F P+    I      LV  +++    N  N +G ATY++ + LWD  T
Sbjct  37    PYADSVSFKISRFDPTLSSIIYQGDAKLVVGTVEFNLVNYINRVGWATYADSVLLWDSET  96

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSN  393
             G+LS F THF+F I+      YG G  FFL+P+GS+IPPN+  GG  GL N     + SN
Sbjct  97    GRLSDFTTHFSFEINVQNDPIYGHGLCFFLSPVGSQIPPNSA-GGFLGLYNTTTSDSPSN  155

Query  394   PFVAVEFDVYLN-HYDTE--QKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSM  564
               V+VEFD + N  +D      HVGI+ +S+ S V  PW+        +  +I Y+  + 
Sbjct  156   QIVSVEFDSFENPEWDPYGIDGHVGINNNSIASAVYTPWNASFHSKDTANVFITYNSTTK  215

Query  565   NLSVVFRNFGSY-----GHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSAL  729
             NLSV +  F +       ++S  +DLR+ LPERV  GF+ ATGK     ++ SW F S+L
Sbjct  216   NLSVSWSYFTTTNPRENSNISLQIDLRRVLPERVMIGFSAATGKYVERHILKSWEFHSSL  275

Query  730   DISENQADTKSTgkglviglvvggcfliggSMAFSFLAW-----RKRKMREEFDDDIFGN  894
             +  E   D ++  +  ++        ++      +F+ W      KRK  E  +     N
Sbjct  276   E--EVGTDGRTARRINILVASAVPVSVLIAGTVIAFIIWWRWQQGKRKTAETTNLASINN  333

Query  895   IGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGS  1074
               EL  GAGP RF++++L  ATN+FS+  KLGEGGFG+VY+GYL +L+  +AVK++SRGS
Sbjct  334   --ELERGAGPWRFSFKDLVSATNNFSEGRKLGEGGFGAVYRGYLIDLDIAIAVKKISRGS  391

Query  1075  KQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTW  1254
             KQG KEYA+EV+VIS++RH+NLV LIGWCHE ++LLLVYEF+ NGSLD HL+  +  LTW
Sbjct  392   KQGKKEYATEVKVISQLRHRNLVQLIGWCHERRELLLVYEFMPNGSLDYHLFGQRIPLTW  451

Query  1255  PLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGS  1434
             P+RY+I   LASA+ YLHEECE+C+VHRDIKSSN+MLDS+ N KLGDFGLARLV HE G 
Sbjct  452   PVRYRISLGLASAIFYLHEECEQCVVHRDIKSSNVMLDSSFNVKLGDFGLARLVSHELGP  511

Query  1435  RTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWV  1614
             +TT LAGT+GY+A E + +G+ASKE+D++SFG+V LEIA GRK  D   E     +V+WV
Sbjct  512   KTTGLAGTLGYLAPEYISTGRASKESDVFSFGVVLLEIATGRKSAD-LREATETGLVEWV  570

Query  1615  WKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPL  1794
             W LYG G+LL A D  L  DF+ ++VE  MI GLWCAHPD   RPSIRQAIQVLN E  +
Sbjct  571   WDLYGEGKLLLAVDGKLKQDFDEKQVECSMITGLWCAHPDSRSRPSIRQAIQVLNLETAI  630

Query  1795  PDLPETMPVATF  1830
             P LP  MPV TF
Sbjct  631   PTLPTKMPVPTF  642



>emb|CAN70208.1| hypothetical protein VITISV_007745 [Vitis vinifera]
Length=626

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/613 (48%), Positives = 397/613 (65%), Gaps = 58/613 (9%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSLV--NNSIQITPNQR-----NCIGRATYSEPLHLWDKP  210
             LSF+F+ F P N   I FE  +    + +I +T NQ+     +  GRATY EP HLWDK 
Sbjct  39    LSFSFNDFDP-NGNQIHFEGQASYSGDKAIYLTRNQQEKKMNDSWGRATYREPFHLWDKA  97

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS  390
             + ++  F+T+F+F ID      +G+G AFFLAP                           
Sbjct  98    STRMVDFSTNFSFGIDLG--YFHGEGLAFFLAPY--------------------------  129

Query  391   NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNL  570
                  VEFD Y N +D +  HVGI+++S++SV    W     GG  +   I+Y   S NL
Sbjct  130   -----VEFDTYPNDWDPKYDHVGININSMKSVENMTWWSHTLGGKINHVSISYASSSKNL  184

Query  571   SVVFRNFGSYGHVS-----YILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDI  735
             SV+F     Y + +     Y ++L  YLPE VT GF+ A      + +I SW F S+   
Sbjct  185   SVIFGTDDLYDNTTPQSLYYKVNLSNYLPEFVTIGFSSARKNSYEINVIYSWSFRSS---  241

Query  736   SENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIF--GNIGELG  909
                  D + + + +V         + G  M F F  W+K    +  +D  F    + +  
Sbjct  242   -----DLQISDRVVVGLSFGVCALVAGLGMVF-FCLWKKGISEKGVEDPDFDLSMVEDFA  295

Query  910   GGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIK  1089
              G GP++FT +EL  ATN+F++ +KLGEGGFG VYKG+L+   SY+AVKRVSRGS+QG+K
Sbjct  296   TGTGPRKFTRQELVLATNNFAEAEKLGEGGFGGVYKGFLRNPSSYIAVKRVSRGSEQGVK  355

Query  1090  EYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYK  1269
             EYASEV++ISR+RH+NLV L+GW H+ ++LLLVY+F+ NGSL S L++GK+LLTW +RYK
Sbjct  356   EYASEVKIISRLRHRNLVQLMGWSHKKRELLLVYDFMPNGSLASCLFEGKTLLTWAMRYK  415

Query  1270  IVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTAL  1449
             I   LASALLYLHEE E+C+VHRD+KSSN+MLD++ NAKL DFGLARLVDH K S+TT L
Sbjct  416   IATGLASALLYLHEEWEQCVVHRDVKSSNVMLDTDFNAKLSDFGLARLVDHGKRSQTTVL  475

Query  1450  AGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYG  1629
             AGTMGY+A EC++ G ASKE+D+YSFG+V LEI CGRK ++P A+E  + +V+WVW LYG
Sbjct  476   AGTMGYMAPECLMKGNASKESDVYSFGVVALEICCGRKSVEPKAKENQIKLVEWVWTLYG  535

Query  1630  TGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPE  1809
              G+LL+AADP L  DF+ +++E++MIVGLWCAHPDC++RP+IRQA+ VLN+EA LP LP 
Sbjct  536   VGKLLEAADPRLCADFDEKQIERLMIVGLWCAHPDCNIRPAIRQAVNVLNYEASLPVLPS  595

Query  1810  TMPVATFW-PQRN  1845
              MPV  ++ P  N
Sbjct  596   NMPVPMYYAPPEN  608



>ref|XP_006380831.1| hypothetical protein POPTR_0007s14980g [Populus trichocarpa]
 gb|ERP58628.1| hypothetical protein POPTR_0007s14980g [Populus trichocarpa]
Length=659

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/616 (48%), Positives = 406/616 (66%), Gaps = 22/616 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNCIGR---ATYSEPLHLW  201
             I+P  + + F    F  +N+    + +   V +   I  N  N I R   ATY E + LW
Sbjct  15    ILPFTNSVYFQLSQFNETNM----YYQGDAVASGGHIEFNLMNYINRVGWATYPERVRLW  70

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             D  +GKLS F +HF+F ID+ G+  YG G AFFLAP+G +IPPN+  GG  GL N     
Sbjct  71    DSSSGKLSDFTSHFSFSIDTQGAPNYGHGIAFFLAPVGFQIPPNSA-GGFLGLFNTTTMK  129

Query  382   NSSNPFVAVEFDVYLNH-YDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
             +S N  V+VEFD Y N  +D + +HVGI+ +S+ S V  PW+     G  +EAWI Y+  
Sbjct  130   SSQNQIVSVEFDSYPNEEWDPKVEHVGINNNSIMSAVYTPWNASFHSGDTAEAWITYNST  189

Query  559   SMNLSVVFRNF-----GSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTS  723
               NLSV ++       G    + YI+DL K+LPE +T GF+ ATG++     + SW F S
Sbjct  190   DRNLSVFWKYQTTSIPGDNSSLFYIIDLSKFLPEWITVGFSAATGQNLERHRLLSWEFNS  249

Query  724   ALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKM--REEFDDDIFGNI  897
             +L + E +    S    ++IG++V    LI G+   S + WR+++M  R+   + +    
Sbjct  250   SLHVKEMKGKN-SKKSKIIIGVIVSVLVLIAGATTTSVILWRRKQMITRKRAAEKMTSLN  308

Query  898   GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSK  1077
               L  GAGP+RF+Y +L  ATN+FS Q KLGEGGFG+VY+GYL +++  +AVK++SR S+
Sbjct  309   EALERGAGPRRFSYDDLVSATNNFSDQRKLGEGGFGAVYRGYLNDMDMEIAVKKISRSSR  368

Query  1078  QGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSL--LT  1251
             QG KEY +EV+ IS++RH+NLV L+GWCH+  + ++VYEF+SNGSLDSHL+  K +  L+
Sbjct  369   QGKKEYITEVKTISQLRHRNLVQLLGWCHDKGEFMVVYEFMSNGSLDSHLFGKKKMSPLS  428

Query  1252  WPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDH-EK  1428
             W +RYKI   LASALLYLHEE E+C+VHRD+KSSNIMLDS+ N KLGDFGLA+L+DH E 
Sbjct  429   WAVRYKISLGLASALLYLHEEWERCVVHRDVKSSNIMLDSSFNVKLGDFGLAKLMDHDEP  488

Query  1429  GSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVD  1608
             G  TT LAGT GY+A E + + +ASKE+D+YSFG+V LEIA GRK  D   +   +++V+
Sbjct  489   GPTTTGLAGTFGYMAPEYISTRRASKESDVYSFGVVALEIASGRKANDLVDQNPEMSLVE  548

Query  1609  WVWKLYGTGQLLDAADPNLS-GDFNG-REVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNF  1782
             W+W LYG G L  A D  L   DF+  ++ E++MIVGLWCAHPD +LRPSIRQAI VLNF
Sbjct  549   WIWDLYGYGNLRLAVDKRLDIKDFDDEKQAERLMIVGLWCAHPDQNLRPSIRQAIHVLNF  608

Query  1783  EAPLPDLPETMPVATF  1830
             EA +P+LP  MPV  F
Sbjct  609   EAAIPNLPPKMPVPVF  624



>ref|XP_011073633.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1 
isoform X2 [Sesamum indicum]
Length=615

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/595 (50%), Positives = 394/595 (66%), Gaps = 20/595 (3%)
 Frame = +1

Query  73    FTPSNVQNITFERTSLVN-NSIQITPNQRNC-IGRATYSEPLHLWDKPTGKLSSFNTHFA  246
             FTP +V  I  E  ++ +  SIQ       C +G+  Y+  + LWD  +GKL+ F THFA
Sbjct  7     FTP-DVTTILLEGDAVTSLGSIQFNDVSYLCRVGQVIYNGKVPLWDSSSGKLADFTTHFA  65

Query  247   FVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNPFVAVEFDVYL  426
             FVID+   A+YG+G AFFLAP+G +IPPN+  GG  GL N   R       V+VEFD   
Sbjct  66    FVIDTPNRAQYGNGLAFFLAPVGFQIPPNSA-GGFLGLFNTSTRDQPQTQIVSVEFDSLA  124

Query  427   N-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSVVFR-NFGSY  600
             N  +D   +HVGI+ +SL S V  PW+  +  G  ++AWI Y+  + NLSV +    GS 
Sbjct  125   NPEWDPPYEHVGINKNSLNSSVATPWNVTLHSGDTADAWIAYNSTTRNLSVFWSYGGGSN  184

Query  601   GHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTKSTgkglv  780
               +SY +DL++ LPE VT G + ATG       + SW F+S L+I+ ++          +
Sbjct  185   SSLSYPIDLKEVLPEYVTVGISAATGMYVEQHTLESWEFSSNLEIAASKGKIG------L  238

Query  781   iglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFG-NI----GELGGGAGPKRFTYRE  945
             I  +     ++   +   F+ WRKR+      +   G N+     +L  GAGP+RF+Y++
Sbjct  239   ILGLTLSGCVLAAGVIVVFVVWRKRRHGVRNKNTSEGVNLTSINDDLERGAGPRRFSYKD  298

Query  946   LARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRI  1125
             LA ATN+FS   KLGEGGFG VYKG+L +L+  +AVK+ SR SKQG K+Y +EV++IS +
Sbjct  299   LAFATNNFSDDRKLGEGGFGGVYKGHLIDLDMPIAVKKFSRRSKQGKKQYVTEVKIISML  358

Query  1126  RHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYL  1305
             RH+NLV LIGWCH + + LLVYEF+ NGSLD HL+  ++ L W LRYKI   LASALLYL
Sbjct  359   RHRNLVQLIGWCHGHGEFLLVYEFMPNGSLDHHLFGKRNPLGWSLRYKIALGLASALLYL  418

Query  1306  HEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECV  1485
             HEE E+C+VHRDIKSSN+MLDS+ N KLGDFGLARL+DHE G + T LAGT+GY+A E V
Sbjct  419   HEEWEQCVVHRDIKSSNVMLDSSFNVKLGDFGLARLMDHELGQQITGLAGTLGYMAPEYV  478

Query  1486  VSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNL  1665
              +G+ASKE+D+YSFG+V LEI  GRK +D  +E+    +V WVW LYG GQLL A D  L
Sbjct  479   TTGRASKESDVYSFGVVALEIVTGRKSVDLQSEK---GLVQWVWDLYGDGQLLAAVDEKL  535

Query  1666  SGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
               D N ++VE +M+VGLWCA+PD ++RPSIR A  VLNFEAPLP+LP  MPV+T+
Sbjct  536   GTDHNPKQVECLMLVGLWCAYPDHNMRPSIRLASHVLNFEAPLPNLPAKMPVSTY  590



>gb|KDP35962.1| hypothetical protein JCGZ_09934 [Jatropha curcas]
Length=560

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/544 (52%), Positives = 374/544 (69%), Gaps = 34/544 (6%)
 Frame = +1

Query  289   FAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDV  468
               FFL+P+    P +   GGG  LA +++   S  PF+AVEFD + N +D   +HVGID+
Sbjct  1     MTFFLSPV--HFPLDNFAGGGLALARENQ--TSKYPFLAVEFDTFPNIWDPPYQHVGIDI  56

Query  469   DSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSVVFRNFGSYGHV-----SYILDLRK  633
             +S++S +T  W  +I+ G    A + Y+     L+V F  FGS  +V     SY +DLR 
Sbjct  57    NSVRSNITTAWLSNIQDGKKVFASVRYESTLKRLTVTFTGFGSSNNVIEQNLSYDVDLRD  116

Query  634   YLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADT----------------KST  765
             YLPE VT GF+ ATG  + +  + SW FTS+L+ ++   D                 KST
Sbjct  117   YLPEWVTVGFSAATGWSSEMHTLYSWSFTSSLEENDKPKDKAPTENTPKIIDVPRNDKST  176

Query  766   gkglviglvvggcfliggSMAFSFLAWRK----RKMREEFDDDIFGNIG---ELGGGAGP  924
              +   +  +V G  +         L+W      +K REE  +++  N+    +   G GP
Sbjct  177   NRSNKVTGLVIGLGVGVCVFVGVILSWLYFFLWKKSREEKGNEVISNLSMDDDFEKGTGP  236

Query  925   KRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASE  1104
             ++F+Y +L RATN+FS+Q+KLGEGGFG+VY+G+ KEL+ +VAVKR+S GSKQGI+EYASE
Sbjct  237   RKFSYNDLVRATNNFSEQEKLGEGGFGAVYRGFFKELDLFVAVKRISSGSKQGIREYASE  296

Query  1105  VRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDL  1284
             V+VIS++RH+NLV LIGWCHE ++LLLVYE + NGSLDSHL+K   LLTW +RY IV  L
Sbjct  297   VKVISQLRHRNLVQLIGWCHEKRELLLVYELMPNGSLDSHLFKENKLLTWEMRYNIVLGL  356

Query  1285  ASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMG  1464
             AS LLYL EEC++ +VHRDIKSSNIMLDSN NAKLGDFGLARLVDH KG +TT LAGT+G
Sbjct  357   ASGLLYLQEECQQLVVHRDIKSSNIMLDSNFNAKLGDFGLARLVDHNKGFQTTLLAGTLG  416

Query  1465  YIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLY--GTGQ  1638
             Y+A E V++GKASKE+D+YSFGIV LEIACG+KP++    E  +++V WVW LY  G  +
Sbjct  417   YMAPEYVITGKASKESDVYSFGIVALEIACGKKPLNLKGNEDQISMVQWVWDLYRGGNVK  476

Query  1639  LLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMP  1818
             LL+ ADP L+GDF+ +++E +M+VG+WCAHPD  LRPSIRQAIQVLNFEA LP LP  MP
Sbjct  477   LLEGADPRLNGDFDEQQLECLMVVGIWCAHPDAKLRPSIRQAIQVLNFEASLPVLPLKMP  536

Query  1819  VATF  1830
             V T+
Sbjct  537   VPTY  540



>gb|KCW76071.1| hypothetical protein EUGRSUZ_D00439, partial [Eucalyptus grandis]
Length=657

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/585 (51%), Positives = 388/585 (66%), Gaps = 31/585 (5%)
 Frame = +1

Query  133   IQITPNQRNC---IGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFL  303
             IQ+T    +     G ATY EP+ LWDK TG ++ F T F FVIDS G + + DG  FFL
Sbjct  66    IQLTKTNEDVDWSKGWATYHEPMRLWDKATGNVADFTTQFTFVIDSMGKSMFADGLTFFL  125

Query  304   APLGSRIPPNATKGGGFGLA----NDDERLNSSNPFVAVEFDVYLNH----YDTEQKHVG  459
              P GS++P N+    G  LA    N D   NSS  FVAVEFD   N+     D    HVG
Sbjct  126   VPEGSQLPINS---AGLNLALVSPNRDPS-NSSASFVAVEFDPLPNNSDGVMDPNCPHVG  181

Query  460   IDVDSLQSVVTA--PWSPD-IEGGWGSEAWINYDPRSMNLSVVFRNFGSYG------HVS  612
             ID+D+L S  ++   W  D I  G    A I Y+  + NLSV+  +  + G       + 
Sbjct  182   IDLDNLTSTNSSCVDWFRDKIMSGGQINATITYNSSTQNLSVLMIDADATGTDINSSAIY  241

Query  613   YILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglv  792
              I+++ KYLPE VTFGF+ +TG  + L  + +W F S +     Q   K +   L   L 
Sbjct  242   NIVNMTKYLPEWVTFGFSASTGTLSELHTLKAWEFRSNV-----QVVGKKSKLWLWSILG  296

Query  793   vggcfliggSMAFSFLAWRKRKMREEF--DDDIFGNIGELGGGAGPKRFTYRELARATNS  966
                  L+   +AF +   R ++MR     +DD      E    +GPK+F+Y++L  +TN+
Sbjct  297   SSSFILLILVLAFIWFRRRSKRMRAHTSGEDDDPAIEEEFEQVSGPKKFSYKDLVTSTNN  356

Query  967   FSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVH  1146
             F+ +   GEGGFG VY+GYL  + + VA+K++S GS+QGIKEYA+EV+ ISR+RHKNLV 
Sbjct  357   FAIERLHGEGGFGRVYEGYLTSVNASVAIKKISPGSRQGIKEYATEVKTISRLRHKNLVQ  416

Query  1147  LIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKC  1326
             LIGWCHE K+LLL+YEF+SNGSLDSHL+K ++ L W  RYKI Q +ASALLYLHEE E+C
Sbjct  417   LIGWCHEKKELLLIYEFMSNGSLDSHLFKKRTFLPWEKRYKIGQGIASALLYLHEEWEQC  476

Query  1327  IVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASK  1506
             +VHRDIKSSNIMLDS+ NAKLGDFGLARLVDH KG +TT LAGTMGY+A ECV  GKAS+
Sbjct  477   VVHRDIKSSNIMLDSDFNAKLGDFGLARLVDHAKGLQTTVLAGTMGYMAPECVYIGKASR  536

Query  1507  ETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGR  1686
             E+DIYSFG+V LEIACGRK ++P AEE  V +VDWVW+LYGTG++LDAA+  L  DF+ +
Sbjct  537   ESDIYSFGVVLLEIACGRKVVEPRAEEGQVRLVDWVWELYGTGRILDAAELKLGTDFDEK  596

Query  1687  EVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPV  1821
             ++E +M+VGLWCAHP+   RPSIR+A  VLNF AP P LP  +P+
Sbjct  597   QLECLMVVGLWCAHPNYIGRPSIREAFNVLNFNAPPPVLPSKLPI  641



>ref|XP_009144293.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Brassica rapa]
Length=648

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/615 (49%), Positives = 401/615 (65%), Gaps = 18/615 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNC-IGRATYSEPLHLWDK  207
             ++P    L FN   FTP +  NI ++  +  N +I++      C +G ATY++ + +WD 
Sbjct  13    VLPFATSLHFNISRFTPGD-PNIAYQGDATPNGAIELNNAGYTCRVGWATYAKKVAIWDP  71

Query  208   PTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNS  387
              TG+ + F T F F ID+  S ++G GFAFFLAP G  I PN+  GG  GL N+    +S
Sbjct  72    ETGRPTDFTTSFTFKIDTRNSTEFGHGFAFFLAPQGILISPNSA-GGFLGLFNETNGYSS  130

Query  388   SNPFVAVEFDVYLN-HYDTE--QKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
               P V VEFD + N  +D    + HVGI+ +SL S     W+  +       A I YD  
Sbjct  131   RFPLVHVEFDTFFNDEWDPLDIKSHVGINNNSLASSNYTSWNASLHSQDTCHARITYDSA  190

Query  559   SMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTS  723
             S NLS+ +      N      + YI+DL K LP  VT GF+G+TG +T    I SW F S
Sbjct  191   SRNLSISWSYEETSNPRESSSLFYIIDLAKVLPAEVTIGFSGSTGANTEAHRILSWEFNS  250

Query  724   ALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG-  900
              LD+ E +  T++    +V   + G   L    +A +F  +RKRK R+E       N+  
Sbjct  251   TLDVVEPRERTQNMKGIIVGVSLAGFVLLTSL-VAGAFALFRKRKQRKEKAGKTEENLTS  309

Query  901   ---ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRG  1071
                +L  GAGP+RF+Y++LA AT++F  + KLGEGGFG+VYKGYL +L++ VAVK+ S  
Sbjct  310   LHEDLERGAGPRRFSYKDLASATSNFLYERKLGEGGFGAVYKGYLNDLDTMVAVKKFSGA  369

Query  1072  SKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLT  1251
             SKQG KE+ +EV++IS +RH+NLV LIGWCHE ++LLLVYEF+ NGSLDSHL+  K  LT
Sbjct  370   SKQGKKEFITEVKIISSLRHRNLVQLIGWCHEKQELLLVYEFMPNGSLDSHLFGKKPHLT  429

Query  1252  WPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKG  1431
             W +R KI   +ASALLYLHEE E+CIVHRDIK+SNIMLDSN NAKLGDFGLARL+DHE G
Sbjct  430   WAVRCKISLSVASALLYLHEEWEQCIVHRDIKASNIMLDSNFNAKLGDFGLARLMDHELG  489

Query  1432  SRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPT--AEECHVNIV  1605
              +TT LAGT GY+A E + +G+ASKE+D+YSFGIV +EI  G+K ++P     E   ++V
Sbjct  490   PQTTGLAGTFGYMAPEYISTGRASKESDVYSFGIVLVEIVTGKKSVEPRQGKVEPEPSLV  549

Query  1606  DWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFE  1785
             + VW  YG G+L+ A D  +  D++ ++ E +MIVGLWCAHPD + RPSI+QAIQVLN E
Sbjct  550   ERVWDQYGRGELISAVDHQIGKDYDMKQAECVMIVGLWCAHPDINSRPSIKQAIQVLNLE  609

Query  1786  APLPDLPETMPVATF  1830
             APLP+LP  MP+AT+
Sbjct  610   APLPNLPHKMPIATY  624



>gb|KEH20097.1| L-type lectin-domain receptor kinase IX.1 [Medicago truncatula]
Length=670

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/608 (49%), Positives = 397/608 (65%), Gaps = 18/608 (3%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSLVNN---SIQITPNQRNCIGRATYSEPLHLWDKPTGKL  222
             + F +  F PS+  NI ++ ++   +   +  I  N    +GR  YSE + LWD  TGKL
Sbjct  44    IHFKYPSFDPSDA-NIVYQGSAAPRDGEVNFNINENYSCQVGRVFYSEKVLLWDSNTGKL  102

Query  223   SSFNTHFAFVIDSNGSAK--YGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNP  396
             + F TH+ FVI++ G +   YG G AFFL P G  IP N+  GG  GL N    ++SSN 
Sbjct  103   TDFTTHYTFVINTQGRSPSLYGHGLAFFLVPYGFEIPLNS-DGGFMGLFNTTTMVSSSNQ  161

Query  397   FVAVEFDVYLNHYDTEQK-HVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLS  573
              V VEFD + N    E + HVGI+++S+ S  T PW+     G  +E WI Y+  + NL+
Sbjct  162   IVHVEFDSFANREFREARGHVGININSIISSATTPWNASKHSGDTAEVWIRYNSTTKNLT  221

Query  574   VVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDIS  738
             V ++     N      +S  +DL K +PE +T GF+ AT     L  + SW F S L  S
Sbjct  222   VSWKYQTTSNPQENTSLSISIDLMKVMPEWITVGFSAATSYVQELNYLLSWEFNSTLATS  281

Query  739   ENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG---ELG  909
                + TK T   +++ +  G   +  G++    L WRKRK   +  ++         +L 
Sbjct  282   -GDSKTKETRLVIILTVSCGVIVIGVGALVAYALFWRKRKRSNKQKEEAMHLTSMNDDLE  340

Query  910   GGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIK  1089
              GAGP+RFTY+EL  ATN+FS+  KLG+GGFG+VYKGY  +L+  VAVK++SRGS+QG K
Sbjct  341   RGAGPRRFTYKELDLATNNFSKDRKLGQGGFGAVYKGYFADLDLQVAVKKISRGSRQGKK  400

Query  1090  EYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYK  1269
             EY +EV+VIS++RH+NLV L+GWCH+  + LLVYEF+ NGSLDSHL+  ++ L+W +R+K
Sbjct  401   EYVTEVKVISQLRHRNLVKLLGWCHDKGEFLLVYEFMPNGSLDSHLFGKRTPLSWGVRHK  460

Query  1270  IVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTAL  1449
             I   LAS LLYLHEE E+C+VHRDIKSSN+MLDS+ N KLGDFGLA+L+DHE G +TT L
Sbjct  461   IALGLASGLLYLHEEWERCVVHRDIKSSNVMLDSSFNVKLGDFGLAKLMDHELGPQTTGL  520

Query  1450  AGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVN-IVDWVWKLY  1626
             AGT GY+A E V +G+ASKE+D+YSFGIV LEI  G+K      ++     +++W+W  Y
Sbjct  521   AGTFGYLAPEYVSTGRASKESDVYSFGIVALEITTGKKATKVMKQKNEEQGMIEWIWDHY  580

Query  1627  GTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLP  1806
             G+G+LL A D NL  DF+ +EVE +MIVGLWCAHPD SLRPSIRQAIQVLNFE  LP+LP
Sbjct  581   GSGELLVAMDENLQNDFDEKEVECLMIVGLWCAHPDVSLRPSIRQAIQVLNFEVALPNLP  640

Query  1807  ETMPVATF  1830
                PVAT+
Sbjct  641   PKRPVATY  648



>ref|XP_011073632.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1 
isoform X1 [Sesamum indicum]
Length=692

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/602 (49%), Positives = 397/602 (66%), Gaps = 20/602 (3%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSLVN-NSIQITPNQRNC-IGRATYSEPLHLWDKPTGKLS  225
             ++F    FTP +V  I  E  ++ +  SIQ       C +G+  Y+  + LWD  +GKL+
Sbjct  77    VNFQLSGFTP-DVTTILLEGDAVTSLGSIQFNDVSYLCRVGQVIYNGKVPLWDSSSGKLA  135

Query  226   SFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNPFVA  405
              F THFAFVID+   A+YG+G AFFLAP+G +IPPN+  GG  GL N   R       V+
Sbjct  136   DFTTHFAFVIDTPNRAQYGNGLAFFLAPVGFQIPPNSA-GGFLGLFNTSTRDQPQTQIVS  194

Query  406   VEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSVVF  582
             VEFD   N  +D   +HVGI+ +SL S V  PW+  +  G  ++AWI Y+  + NLSV +
Sbjct  195   VEFDSLANPEWDPPYEHVGINKNSLNSSVATPWNVTLHSGDTADAWIAYNSTTRNLSVFW  254

Query  583   R-NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTK  759
                 GS   +SY +DL++ LPE VT G + ATG       + SW F+S L+I+ ++    
Sbjct  255   SYGGGSNSSLSYPIDLKEVLPEYVTVGISAATGMYVEQHTLESWEFSSNLEIAASKGKIG  314

Query  760   STgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFG-NI----GELGGGAGP  924
                   +I  +     ++   +   F+ WRKR+      +   G N+     +L  GAGP
Sbjct  315   ------LILGLTLSGCVLAAGVIVVFVVWRKRRHGVRNKNTSEGVNLTSINDDLERGAGP  368

Query  925   KRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASE  1104
             +RF+Y++LA ATN+FS   KLGEGGFG VYKG+L +L+  +AVK+ SR SKQG K+Y +E
Sbjct  369   RRFSYKDLAFATNNFSDDRKLGEGGFGGVYKGHLIDLDMPIAVKKFSRRSKQGKKQYVTE  428

Query  1105  VRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDL  1284
             V++IS +RH+NLV LIGWCH + + LLVYEF+ NGSLD HL+  ++ L W LRYKI   L
Sbjct  429   VKIISMLRHRNLVQLIGWCHGHGEFLLVYEFMPNGSLDHHLFGKRNPLGWSLRYKIALGL  488

Query  1285  ASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMG  1464
             ASALLYLHEE E+C+VHRDIKSSN+MLDS+ N KLGDFGLARL+DHE G + T LAGT+G
Sbjct  489   ASALLYLHEEWEQCVVHRDIKSSNVMLDSSFNVKLGDFGLARLMDHELGQQITGLAGTLG  548

Query  1465  YIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLL  1644
             Y+A E V +G+ASKE+D+YSFG+V LEI  GRK +D  +E+    +V WVW LYG GQLL
Sbjct  549   YMAPEYVTTGRASKESDVYSFGVVALEIVTGRKSVDLQSEK---GLVQWVWDLYGDGQLL  605

Query  1645  DAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVA  1824
              A D  L  D N ++VE +M+VGLWCA+PD ++RPSIR A  VLNFEAPLP+LP  MPV+
Sbjct  606   AAVDEKLGTDHNPKQVECLMLVGLWCAYPDHNMRPSIRLASHVLNFEAPLPNLPAKMPVS  665

Query  1825  TF  1830
             T+
Sbjct  666   TY  667



>ref|XP_004504942.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cicer arietinum]
Length=659

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/627 (51%), Positives = 413/627 (66%), Gaps = 30/627 (5%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPN---QRN--CIGRATYSEPL  192
             II + + LSF++  F   +V    +E   S    +IQIT N   Q N   +GR T  E +
Sbjct  20    IIHVANSLSFDYPYFKNGDVN---WEGDASPYKGTIQITSNSLDQNNNYSVGRVTSLEQM  76

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWD  +GKLS F T F+FV+ S  ++ YGDG  FF+A     +  N  +GGG GL + D
Sbjct  77    LLWDLSSGKLSDFTTKFSFVVFSK-TSNYGDGMVFFMADPNLPLLKNIKEGGGLGLVDGD  135

Query  373   ERLNSS-NPFVAVEFDVYLN-HYDT--EQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAW  540
             + LNS+ + FVA+EFD + N  +D   +  HVG + +S++S++T PW  +I         
Sbjct  136   QLLNSTQHSFVALEFDTFNNPSWDPFGQGPHVGFNFNSMRSIITKPWFTNILQWSVYNCS  195

Query  541   INYDPRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINS  708
             I+Y+  + NLSV F  +        ++SY +DLR +LPE+V  GF+ ATG    +  + S
Sbjct  196   IHYNSTTFNLSVSFTMYSDDKPVEDYISYKVDLRDFLPEKVIVGFSAATGILYEVHTLRS  255

Query  709   WIFTSALDISENQ----ADTKSTgkglviglvvggcfliggSMAFSF------LAWRKRK  858
             W F S+L   E +    A   S   G    + +     IG  +A S       L W++ K
Sbjct  256   WSFHSSLLRDETRYQITAPITSPISGKENKIGLKIGLGIGTGLAASLSGLICTLLWKRSK  315

Query  859   MR-EEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKEL  1035
              R EEF  D+  +  E   G GPKRF+Y EL  ATN FS+  K+G+GGFG VYKGYLKEL
Sbjct  316   RRKEEFSFDLNMD-DEFQKGTGPKRFSYNELMSATNKFSEAYKVGQGGFGGVYKGYLKEL  374

Query  1036  ESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSL  1215
              SYVA+KR+SR S+QGI+EYA+EV+VIS++RH+NLV L+GWCH+  D LLVYEF+SNGSL
Sbjct  375   NSYVAIKRISRESRQGIQEYATEVKVISQLRHRNLVQLLGWCHKKNDFLLVYEFMSNGSL  434

Query  1216  DSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGD  1395
             DSHLY  KS LTW +RYKI   LASALLYL EE E+C++HRDIKSSNIMLDS  NAKLGD
Sbjct  435   DSHLYGDKSSLTWTVRYKIAFGLASALLYLQEEWEQCVIHRDIKSSNIMLDSCFNAKLGD  494

Query  1396  FGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDP  1575
             FGLARLVDHEKGS+TT +AGT GYIA E   SGKA+KE+DIYSFG+V LEIA GRK I+ 
Sbjct  495   FGLARLVDHEKGSQTTLIAGTRGYIAPEYFTSGKATKESDIYSFGVVLLEIASGRKAIER  554

Query  1576  TAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSI  1755
               +E  +++V+WVW+LYG G+L +A DP L G F+ +++E ++IVGLWC HPD   RP I
Sbjct  555   EEKEGQISVVEWVWELYGLGKLHEACDPKLCGAFDEKQLECLVIVGLWCVHPDYLFRPCI  614

Query  1756  RQAIQVLNFEAPLPDLPETMPVATFWP  1836
             R  IQVL FE+PLP LPE MPV T++P
Sbjct  615   RHVIQVLKFESPLPILPEKMPVPTYFP  641



>ref|XP_010052170.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
 gb|KCW76082.1| hypothetical protein EUGRSUZ_D00457 [Eucalyptus grandis]
Length=696

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/619 (48%), Positives = 407/619 (66%), Gaps = 35/619 (6%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPNQRNCI------GRATYSEPLHLWDKP  210
             + F+F  F   +  +I F+   S+  N IQ+T    N +      G A Y EP+ LWDK 
Sbjct  39    IDFSFQTF---DNDSIRFQGDASISGNLIQLTRVYGNVVSGNVSGGWAMYHEPMRLWDKA  95

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN-S  387
             TG ++ F T+F F+IDS  ++ +GDGF FFL P GS+I  N+  G   GL N +   + S
Sbjct  96    TGNVADFTTNFTFIIDSQENSIFGDGFTFFLVPEGSQIQINSL-GRYLGLINPNSNPSIS  154

Query  388   SNPFVAVEFDVYLNHYD-------TEQKHVGIDVDSLQSVVTA--PWSPD-IEGGWGSEA  537
             S PFVAVEFD Y N+Y         +  HVGID+++L S V++   W  D I  G    A
Sbjct  155   STPFVAVEFDTYRNNYSGVVDPNCLQVAHVGIDLNNLTSAVSSCVDWFKDKIMSGGRINA  214

Query  538   WINYDPRSMNLSVVFRNFGSYG------HVSYILDLRKYLPERVTFGFAGATGKDTALQM  699
              I Y+  + NLSVV  +  + G       +  I+++ KYLPE V FGF+ ATG D  L  
Sbjct  215   TITYNSSTQNLSVVMIDADATGTDITASAIYDIVNMSKYLPEWVNFGFSAATGTDFELHT  274

Query  700   INSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFL--AWRKRKMREEF  873
             + +W F S +     Q   K +   L   L  G    +   +AF +     +++      
Sbjct  275   LEAWEFRSNV-----QVAGKKSKLWLWATLGSGSFIWLVLVLAFVWFRHCLKRKGTYMSG  329

Query  874   DDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAV  1053
             ++D      E     GPK+F+Y+E+  ATN+F+ +  +GEGGFG VY+GYL  + + VA+
Sbjct  330   EEDALAIDEEFEQVPGPKKFSYKEVVEATNNFAIERLVGEGGFGRVYEGYLTTVNAKVAI  389

Query  1054  KRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYK  1233
             K+++ GS+QGIKEYA+EV+ ISR+RH+NLV LIGWCHE K+LLL+YEF+SNGSLD+HL+K
Sbjct  390   KKINPGSRQGIKEYATEVKTISRLRHRNLVQLIGWCHEKKELLLIYEFMSNGSLDTHLFK  449

Query  1234  GKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARL  1413
              ++ L W  RYKI Q +ASALLYLHEE E+C++HRD+KSSNIMLDS+ +AKLGDFGLARL
Sbjct  450   ERTFLPWEKRYKIAQGIASALLYLHEEWEQCVLHRDVKSSNIMLDSDFSAKLGDFGLARL  509

Query  1414  VDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECH  1593
             VDH KG +TT +AGTMGY+A ECV +GKASKE+D+YSFGIV LEIACGRK ++P A+E  
Sbjct  510   VDHAKGLQTTIVAGTMGYLAPECVYTGKASKESDVYSFGIVLLEIACGRKVVEPRAKEGQ  569

Query  1594  VNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQV  1773
             + +V+WVW+ YG G++LDAA+  L  + + +++E +M+VGLWC+HPD   RPSIR+A+ V
Sbjct  570   IRLVNWVWEQYGIGRVLDAAESKLGINSDEKQLECLMVVGLWCSHPDHIARPSIREALNV  629

Query  1774  LNFEAPLPDLPETMPVATF  1830
             LNF APLP+LP  +PV T+
Sbjct  630   LNFNAPLPNLPSKLPVPTY  648



>ref|XP_003541778.2| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Glycine max]
Length=807

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/639 (48%), Positives = 406/639 (64%), Gaps = 51/639 (8%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRN-----CIGRATYSEPLH  195
             +I  V+PLSF++  F   N   I  + T L ++ IQ+T   R       +GR T  + L 
Sbjct  153   MITFVNPLSFHYQGFE-YNDARIEGDAT-LSHSEIQLTATTRYQSNAYSVGRVTSFKLLQ  210

Query  196   LWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAP---LGSRIPPNATKGGGFGLAN  366
             LWD  +GKL+ F T F+FVI SN ++       FF  P   L ++I     +GGG GL +
Sbjct  211   LWDMSSGKLTDFTTEFSFVIYSNETSFGDGFAFFFADPKLPLSNQI----QQGGGLGLVD  266

Query  367   DDERLNSSN-PFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWI  543
              +  L  +  PFVAVEFD + N +D    HVGI+ +S++S +T PWS DI         I
Sbjct  267   GNRLLKPTKYPFVAVEFDTHQNSWDPPGTHVGINFNSMRSNITVPWSIDIRQMKVYYCAI  326

Query  544   NYDPRSMNLSVVFRNFGSYG-----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINS  708
              Y+  + NL+V F      G     ++S  ++LR YLPERV FGF+ ATG    +  + S
Sbjct  327   EYNASTHNLNVSFTGNQINGKPIKSYISCNVNLRDYLPERVIFGFSAATGFMFEMNTLLS  386

Query  709   WIFTSALDISENQAD-------------------TKSTgkglviglvvggcfliggSMAF  831
             W F S+L   E  ++                   T +          +      G  +A 
Sbjct  387   WSFRSSLPSDEKVSNQIPPMAAPPIQNPSPSPFPTANISPKQEGNKGLLKGIEAGIGIAA  446

Query  832   SFLA--------WRKRKMREEFDDDIF--GNIGELGGGAGPKRFTYRELARATNSFSQQD  981
             SFL         W++ K+++E  D +F      E   G GPKRF Y+ELA ATN+F++  
Sbjct  447   SFLILGLVCIFIWKRAKLKKE--DSVFDLSMDDEFQKGIGPKRFCYKELASATNNFAEAQ  504

Query  982   KLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWC  1161
             K+G+GGFG VYKGYLK+L S VA+KR+SR S+QGIKEYA+EV++IS++RH+NLV LIGWC
Sbjct  505   KIGQGGFGGVYKGYLKKLNSNVAIKRISRESRQGIKEYAAEVKIISQLRHRNLVQLIGWC  564

Query  1162  HENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRD  1341
             H  KDLLL+YEF+ NGSLDSHLY+GKS+LTW +RY I  DLA A+LYLHEE E+C++HRD
Sbjct  565   HMKKDLLLIYEFMQNGSLDSHLYRGKSILTWQMRYNIAMDLALAVLYLHEEWEQCVLHRD  624

Query  1342  IKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIY  1521
             IKSSN+MLD + NAKLGDFGLARLVDHEKGS+TT LAGT+GYIA E   +GKA KE+DIY
Sbjct  625   IKSSNVMLDLSFNAKLGDFGLARLVDHEKGSQTTILAGTVGYIAPEYCTTGKARKESDIY  684

Query  1522  SFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQM  1701
             SFG+V LE+A GRKPID  A+E  + I +WVW+LY  G+LL+  D  L G F+  ++E +
Sbjct  685   SFGVVLLELASGRKPIDLNAKEGQITIFEWVWELYRLGKLLEVVDSKLGGAFDEEQMEHL  744

Query  1702  MIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMP  1818
             +IVGLWCA+PD + RPS+RQ IQVL FEAPLP LP+ MP
Sbjct  745   VIVGLWCANPDYTSRPSVRQVIQVLTFEAPLPVLPQKMP  783



>ref|XP_007047722.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
 gb|EOX91879.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
Length=659

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/566 (49%), Positives = 389/566 (69%), Gaps = 13/566 (2%)
 Frame = +1

Query  163   IGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDS--NGSAKYGDGFAFFLAPLGSRIPPNA  336
             +GR +Y++ + +WD  T K++ F THF+F+ID+    ++ Y  G AFFLAP+G  IPPN+
Sbjct  72    VGRVSYAQSVPIWDSGTDKVADFITHFSFIIDTLNRSTSLYAAGLAFFLAPVGFEIPPNS  131

Query  337   TKGGGFGLANDDERLNSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDI  513
               GG  GL N     +  N  V VEFD + N  +D   +HVGI+ +S+ S    PW+  +
Sbjct  132   A-GGFLGLFNTTTSDSPRNQIVLVEFDTFPNPEWDPPVQHVGINTNSISSAKYTPWNFSL  190

Query  514   EGGWGSEAWINYDPRSMNLSVVFRNFGSYG------HVSYILDLRKYLPERVTFGFAGAT  675
               G  ++ WI+Y+  + NLSV + N+ S         +S+ +DL++ LPE V  G + AT
Sbjct  191   YSGKTADTWISYNATTNNLSVTW-NYRSTTFSQLNFSLSHHIDLKQILPEWVKVGISAAT  249

Query  676   GKDTALQMINSWIFTSALDISENQA-DTKSTgkglviglvvggcfliggSMAFSFLAWRK  852
                     + SW F+S+L+I + +  + K+    +V+ ++     ++  S  F F  W+K
Sbjct  250   SHFQEGHRLVSWEFSSSLEIKKTKGKNVKNIKLIVVLSVLGILITVVSISFVF-FRRWKK  308

Query  853   RKMREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKE  1032
              K   E   ++     +L  GAGP+RF+Y +L  ATN+FS Q KLGEGGFG+VYKGYL +
Sbjct  309   VKEEREERTNLSSINDDLERGAGPRRFSYGDLVVATNNFSNQRKLGEGGFGAVYKGYLSD  368

Query  1033  LESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGS  1212
             +++ VAVK+++RGS+QG KEY +EV +I R+RH+NLV LIGWCH+  + LLVYE +SNGS
Sbjct  369   IDTAVAVKKIARGSRQGKKEYITEVTIICRLRHRNLVQLIGWCHDGGNFLLVYELMSNGS  428

Query  1213  LDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLG  1392
             LDS+L+  K+ LTWPLRYKI   LASA+LYLHEE E+C+VHRDIKSSNIMLDS  N KLG
Sbjct  429   LDSYLFGKKAPLTWPLRYKIAYGLASAVLYLHEEWEQCVVHRDIKSSNIMLDSGFNVKLG  488

Query  1393  DFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPID  1572
             DFGLARL+DHE G  TT LAGT+GY+A E + +G+ASK +D+YSFG+V LEIA GR+ +D
Sbjct  489   DFGLARLMDHELGPLTTGLAGTLGYMAPEYIRTGRASKASDVYSFGVVALEIATGRRSVD  548

Query  1573  PTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPS  1752
             P  +  HV++V+WVW LYG+G LL + D  L  +F+G+++E++M+VGLWCAHPD +LRPS
Sbjct  549   PKKKNSHVSLVEWVWHLYGSGNLLSSVDERLHTEFDGKQIERLMMVGLWCAHPDSNLRPS  608

Query  1753  IRQAIQVLNFEAPLPDLPETMPVATF  1830
             IRQAIQV +F+  LP+LP  MP+ T+
Sbjct  609   IRQAIQVRDFDVALPNLPLNMPIPTY  634



>ref|XP_003628861.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AET03337.1| L-type lectin-domain receptor kinase IX.1 [Medicago truncatula]
Length=651

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/616 (47%), Positives = 410/616 (67%), Gaps = 18/616 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDL--FTPSNVQNITFERTSLVNNSI--QITPNQRNCIGRATYSEPLHL  198
             I+   H  S +F +  F P++   I     + V+  +   I  N    +G A YS+ + L
Sbjct  16    ILLTFHAYSIHFQIPSFNPNDANIIYQGSAAPVDGEVDFNINGNYSCQVGWALYSKKVLL  75

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAK--YGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
             WD  TG+L+ F TH+ F+I++ G +   YG G AFFLA  G  IPPN++ GG  GL N  
Sbjct  76    WDSKTGQLTDFTTHYTFIINTRGRSPSFYGHGLAFFLAAYGFEIPPNSS-GGLMGLFNTT  134

Query  373   ERLNSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
               L+SSN  V VEFD + N  +    +HVGI+ +S++S ++ PW+  +  G  +E WI Y
Sbjct  135   TMLSSSNHIVHVEFDSFANSEFSETTEHVGINNNSIKSSISTPWNASLHSGDTAEVWIRY  194

Query  550   DPRSMNLSVVFRNFGSYG-----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             +  + NL+V +    +       ++SY +D +K LPE VT GF+ ATG +  +  + SW 
Sbjct  195   NSTTKNLTVSWEYQTTSSPQEKTNLSYQIDFKKVLPEWVTIGFSAATGYNGEVNNLLSWE  254

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGN  894
             F S L+ S++ +++K T   +++ + +G   +  G++    +  RKRK  E+  ++    
Sbjct  255   FNSNLEKSDD-SNSKDTRLVVILTVSLGAVIIGVGALVAYVILKRKRKRSEKQKEEAMHL  313

Query  895   IG---ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVS  1065
                  +L  GAGP+RFTY+EL  ATN+FS+  KLG+GGFG+V+KGY  +L+  VAVK++S
Sbjct  314   TSMNDDLERGAGPRRFTYKELELATNNFSKDRKLGQGGFGAVFKGYFADLDLQVAVKKIS  373

Query  1066  RGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSL  1245
             RGS+QG KEY +EV+VIS++RH+NLV L+GWCH+  + LL+YEF+ NGSLDSHL+  ++ 
Sbjct  374   RGSRQGKKEYVTEVKVISQLRHRNLVKLLGWCHDKGEFLLIYEFMPNGSLDSHLFGKRTP  433

Query  1246  LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHE  1425
             L+W +R+KI   LAS LLYLHEE E+C+VHRDIKSSN+MLDS+ N KLGDFGLA+L+DHE
Sbjct  434   LSWGVRHKITLGLASGLLYLHEEWERCVVHRDIKSSNVMLDSSFNVKLGDFGLAKLMDHE  493

Query  1426  KGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAE-ECHVNI  1602
              G +TT LAGT GY+A E V +G+ASKE+D+YSFGIV LEI  G+K  +   E +    +
Sbjct  494   LGPQTTGLAGTFGYLAPEYVSTGRASKESDVYSFGIVVLEITSGKKATEVMKEKDEEKGM  553

Query  1603  VDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNF  1782
             ++WVW  YG G+LL A D NL  DF+ ++VE +MIVGLWCAHPD SLRPSIRQAIQVLNF
Sbjct  554   IEWVWDHYGKGELLVAMDENLRKDFDEKQVECLMIVGLWCAHPDVSLRPSIRQAIQVLNF  613

Query  1783  EAPLPDLPETMPVATF  1830
             E  +P+LP   PVAT+
Sbjct  614   EVSMPNLPPKRPVATY  629



>ref|XP_008811470.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Phoenix dactylifera]
Length=674

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/636 (49%), Positives = 396/636 (62%), Gaps = 48/636 (8%)
 Frame = +1

Query  34    IPLVHPLSFNF---DLFTPSNVQNITFERTSLVN-NSIQITPNQ-------RNCIGRATY  180
             IP+  PL FNF   DL  P    NI+F   +  N  ++Q+T NQ        + +GRATY
Sbjct  24    IPVASPLYFNFAGIDLDKP----NISFSGDAYFNVRNVQLTKNQAGNGANLTHSVGRATY  79

Query  181   SEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGL  360
             S+P+ LWDK +G L++F T+F F ID  G     DG AFFL+P+ S+ PP++  G G GL
Sbjct  80    SKPVPLWDKASGTLANFTTNFTFAIDGLGKNYSADGLAFFLSPITSKAPPDSA-GAGLGL  138

Query  361   ANDDERLNSSNPFVAVEFDVYLNHY--DTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSE  534
                       +  VAVEFD Y N    DT   HVGID+ S+ S       P I       
Sbjct  139   FPSSGNETEESKVVAVEFDSYKNLAVKDTSDNHVGIDIWSIISKNQVNMYPSIRTNSQFN  198

Query  535   AWINYDPRSMNLSVVF-------RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTAL  693
             A ++YD  + NLSV         RN+  +    Y +DLRKYLPE VT GF+ +TG D   
Sbjct  199   ASVSYDAVAQNLSVFLINASNPLRNWSLF----YGVDLRKYLPENVTIGFSASTGDDYET  254

Query  694   QMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRK-----  858
               I SW F S+     N A  +S    +V   V  G  L G  + +S + WRKR      
Sbjct  255   HSIYSWEFNSS-----NLAKKRSKMSLVVGLAVGIGILLCGLGLLWS-VVWRKRARGGME  308

Query  859   ------MREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKG  1020
                     E   +    N  E GGG  P++F+Y  LA AT +F ++ KLGEGGFG VY G
Sbjct  309   AQEEEEEEEMALELSLNNAFERGGG--PRKFSYTALAIATRNFVREAKLGEGGFGEVYMG  366

Query  1021  YLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFL  1200
              L + +  VA+KR+SR SKQG KEY SEV +ISR+RH+NLV LIG+CH+  DLLLVYE++
Sbjct  367   MLDDTKQEVAIKRISRDSKQGKKEYISEVTIISRVRHRNLVQLIGYCHQKGDLLLVYEYM  426

Query  1201  SNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLN  1380
              N SLD HLY  + LLTWP RY+I   LASALLYLHEE E+C+VHRD+K SN+MLDS  N
Sbjct  427   PNKSLDRHLYSEERLLTWPERYRIAFGLASALLYLHEEWEQCVVHRDVKPSNVMLDSGFN  486

Query  1381  AKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGR  1560
             AKLGDFGLARLVDH+   +TT +AGT GYIA E   +GKASKE+D+YSFG+V LEIACGR
Sbjct  487   AKLGDFGLARLVDHDSNMQTTVMAGTRGYIAPEYATTGKASKESDVYSFGVVVLEIACGR  546

Query  1561  KPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCS  1740
             KPID   ++  VN+V+WVW+LYG      A D  L  +F+ +++E+ MIVGLWCA+PD +
Sbjct  547   KPIDLKEKQDKVNLVEWVWELYGKNMCFTAVDKRLKMEFDEKQMERFMIVGLWCAYPDYN  606

Query  1741  LRPSIRQAIQVLNFEAPLPDLPETMPVATFWPQRNV  1848
             LRP+IRQAI VL F+APLPDLP  MPVA ++P  ++
Sbjct  607   LRPTIRQAINVLKFDAPLPDLPPKMPVAMYFPPMDI  642



>ref|XP_010054312.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
 gb|KCW76084.1| hypothetical protein EUGRSUZ_D00460 [Eucalyptus grandis]
Length=689

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/611 (49%), Positives = 409/611 (67%), Gaps = 28/611 (5%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPNQRNCIGRATYSEPLHLWDKPTGKLSS  228
             + F+F  F   +  NI F+   S+ ++ IQ+T    +  G ATY +P+ LWDK TG ++ 
Sbjct  39    IDFSFRTF---DNDNIRFQGDASISSDLIQLTKATMSK-GWATYHKPMRLWDKATGNVAD  94

Query  229   FNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNPFVAV  408
             F T+F F+I+S G++K+GDGF FFL P GS++P ++       ++       SS  FVAV
Sbjct  95    FTTNFTFIINSQGNSKFGDGFTFFLVPKGSQMPFDSLGRYLALVSPSRNSSISSTSFVAV  154

Query  409   EFDVYLNHYD-------TEQKHVGIDVDSLQSVVTA--PWSPD-IEGGWGSEAWINYDPR  558
             EFD Y N++        ++  HVGID+++L S  ++   W  D I  G    A I Y+  
Sbjct  155   EFDTYRNNFSGVMDPNCSQVAHVGIDLNNLTSAASSCVDWFEDKIMSGGRINATITYNSS  214

Query  559   SMNLSVVFRNFGSYG------HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFT  720
             + NLS+V  +  + G       +  I+++ KYLPE V FGF+ ATG D  L  I +W F 
Sbjct  215   TQNLSIVMIDVDATGTNMNSSAIYNIVNMTKYLPEWVNFGFSAATGTDYELHTIEAWEFR  274

Query  721   SALDISENQADTKSTgkglviglvvggcfliggSMAF-SFLAWRKRK-MREEFDDDIFGN  894
             S + ++      K     L   L  G   L+   +AF SF    KRK   +  ++D    
Sbjct  275   SNVLVA-----GKKRKLWLWATLGSGSFILLVLVLAFVSFRHCSKRKGTYKSGEEDALAI  329

Query  895   IGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGS  1074
               E     GPK+F++++L  AT++F+ +  LGEGGFG VY+GYL  +   VA+K+++ GS
Sbjct  330   DEEFEQVPGPKKFSHKDLVVATDNFAIERLLGEGGFGRVYEGYLTTMNVKVAIKKINPGS  389

Query  1075  KQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTW  1254
             +QGIKEYA+EV+ IS++RH+NLV LIGWCHE K+LLL+YEF+SNGSLD+HL+K ++ L W
Sbjct  390   RQGIKEYATEVKTISQLRHRNLVQLIGWCHEKKELLLIYEFMSNGSLDTHLFKERTFLPW  449

Query  1255  PLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGS  1434
               RYKI Q +ASALLYLHEE E+C++HRDIKSSNIMLDS+ NAKLGDFGLARLVDH KG 
Sbjct  450   EKRYKIAQGIASALLYLHEEWEQCVLHRDIKSSNIMLDSDFNAKLGDFGLARLVDHAKGL  509

Query  1435  RTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWV  1614
             +TT LAGTMGY+A +CV +GKASKE+D+YSFGIV LEIACGRK ++P AEE  V +VDWV
Sbjct  510   QTTILAGTMGYMAPDCVYTGKASKESDVYSFGIVLLEIACGRKAVEPRAEESQVLLVDWV  569

Query  1615  WKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPL  1794
              +LYG G++LDAA+  LS +F+ +++E +M+VGLWC+HPD + RPSIR+A+ VLNF APL
Sbjct  570   RELYGIGRVLDAAESKLSTNFDEKQLECLMVVGLWCSHPDHTARPSIREALNVLNFNAPL  629

Query  1795  PDLPETMPVAT  1827
             P LP  +PV T
Sbjct  630   PSLPSKLPVPT  640



>ref|XP_004509794.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cicer arietinum]
Length=674

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/619 (50%), Positives = 408/619 (66%), Gaps = 35/619 (6%)
 Frame = +1

Query  46    HPLSFNFDLFTPSNVQNITFERTSLVNNSI-QITPNQ-----RNCIGRATYSEPLHLWDK  207
             + +SFNF  F P N+  I F+  +  +N + Q+T NQ      + +GRA++ +P+ L+D+
Sbjct  30    YSISFNFSNFQP-NLYLINFQGDAFSSNGVLQLTKNQLDGPITSSVGRASFDQPVKLYDQ  88

Query  208   PTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNS  387
              T KL+ F THF+FV+ +    ++GDG +FF+AP  S IP N++ GG  GL + D   N+
Sbjct  89    ETKKLTDFTTHFSFVMKAVVKTQFGDGLSFFMAPFQSDIPKNSS-GGYLGLFDMDSAFNT  147

Query  388   S-NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSM  564
             S N  VAVEFD + N +D    HVGI+V+S++SV    W  +I+ G  + AWI+Y+  + 
Sbjct  148   SKNQIVAVEFDSFKNDWDPSSDHVGINVNSIESVENVTWKSNIKNGSVANAWISYNSTTK  207

Query  565   NLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSAL  729
             NLSV         F     +SY++DLR  LPE V  GF+ ATG+   +  I SW F S L
Sbjct  208   NLSVFLTYANNPTFHGNSSLSYVIDLRDVLPEYVRIGFSAATGEWIEIHNILSWSFNSNL  267

Query  730   DISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRK--------MREEFDDDI  885
             +        ++   GL +GL VG   L        F  WRKRK        +    DDD 
Sbjct  268   E----SGSGRNIKIGLGVGLSVGFGSLTCFVGVLWFTFWRKRKGLIDNNRGIDASIDDD-  322

Query  886   FGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYL--KELESYVAVKR  1059
                  E   G GPKRF+Y+EL+ ATN F ++ KLGEGGFG VYKG L  K  +  VAVKR
Sbjct  323   -----EFERGTGPKRFSYKELSNATNDFDEKGKLGEGGFGGVYKGLLGSKNNKIEVAVKR  377

Query  1060  VSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGK  1239
             VS+GS+QG KEY SEVR+IS++RH+NLV L GWCHE  +LLLVYE++ NGSLD HL+   
Sbjct  378   VSKGSRQGKKEYISEVRIISKLRHRNLVQLFGWCHEKNELLLVYEYMPNGSLDFHLFGKG  437

Query  1240  SLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVD  1419
              +LTW  RYKI   LAS+LLYLHEE E+C+VHRDIKSSN+MLD+N NAKLGDFGLARLVD
Sbjct  438   VVLTWTTRYKIALGLASSLLYLHEEWEQCVVHRDIKSSNVMLDANFNAKLGDFGLARLVD  497

Query  1420  HEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVN  1599
             HE GS+TT LAGTMGY+A ECV +GK+SKE+D+YSFG+V LEI CGR+P++   E   V 
Sbjct  498   HELGSQTTVLAGTMGYLAPECVTTGKSSKESDVYSFGVVALEITCGRRPVEVKEEVKKVR  557

Query  1600  IVDWVWKLYGTGQLLDAADPNLSG-DFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVL  1776
             +V+W+W+LYG G+L +  D  L   +F+ +++E +M+VGLWC HPD ++RPSIRQ I VL
Sbjct  558   LVEWIWELYGQGKLNEGVDKGLLNLEFDEKQMEYLMVVGLWCCHPDYTMRPSIRQVINVL  617

Query  1777  NFEAPLPDLPETMPVATFW  1833
             NFEA LP LP  +PV  ++
Sbjct  618   NFEATLPSLPSKLPVPMYY  636



>ref|XP_003608363.1| Lectin-domain containing receptor kinase A4.1 [Medicago truncatula]
 gb|AES90560.1| L-type lectin-domain receptor kinase [Medicago truncatula]
Length=665

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/612 (50%), Positives = 406/612 (66%), Gaps = 24/612 (4%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVNNSI-QITPNQRNCIGRATYSEPLHLWDKPTGKLS  225
             PL+FN+D  +      + F      +N + Q+T  +++ +GR TYS+  HLW+  T +++
Sbjct  32    PLTFNYDNLSSDKTHALNFSGDVYHDNQVLQLTRYEKDSLGRVTYSKLFHLWNINTSEVT  91

Query  226   SFNTHFAFVIDSNGSAKYGDGFAFFLA----PLGSRIPPNATKGGGFGLANDDE----RL  381
              F T F+F I++     + DG  F+LA    PL     P    G G GL +  +      
Sbjct  92    DFTTRFSFTINTLNKTDHSDGITFYLAHPNFPL-----PVPRDGSGIGLMSSVQLATPNY  146

Query  382   NSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRS  561
                NPFVAVEFD ++N +D    HVGIDV+S+ +  T  W   ++   G +  I+Y+  S
Sbjct  147   TKENPFVAVEFDTFVNTWDPTYDHVGIDVNSISTSYTTQWFTSLDER-GYDVDISYNSSS  205

Query  562   MNLSVVFRNFGSYGHVSY----ILDLRKYLPERVTFGFAGATGKDTALQ-MINSWIFTSA  726
              NLSV F  +G    +      I++LR+ LP+ V FGF  ATG     +  + SW F S+
Sbjct  206   NNLSVTFTGYGDNNTIQQNLFQIVNLREVLPDWVEFGFTSATGLFWGEEHTLRSWSFNSS  265

Query  727   LDISENQADTKSTgkglviglvvggcfliggSMA-FSF-LAWRKRKMREEFDDDIFGNIG  900
             LD   ++ + K+     +   +  G F++ G +  FS  L  + +K  EE D +    +G
Sbjct  266   LDFEAHKDEGKTGLVMGLAVGLGIGGFVLIGVLGLFSIVLWKKWKKESEEEDGEFEEYMG  325

Query  901   E-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSK  1077
             E  G GAGP+++TY ELA A N F  + KLG+GGFG VY+G+LK+ +SYVAVKRVS  S 
Sbjct  326   EDFGRGAGPRKYTYAELAHAANDFKDEYKLGQGGFGGVYRGFLKDTKSYVAVKRVSEDSH  385

Query  1078  QGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWP  1257
             QGIKE+ASEV +IS++RH+NLV LIGWCHE K LLLVYE++ NGSLD HL+K +S L W 
Sbjct  386   QGIKEFASEVTIISKLRHRNLVQLIGWCHERKKLLLVYEYMPNGSLDIHLFKNQSFLKWG  445

Query  1258  LRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSR  1437
             +RY I + LASALLYLHEE E+C+VHRDIK+SNIMLDS  NAKLGDFGLAR VDH KG++
Sbjct  446   VRYTIARGLASALLYLHEEWEQCVVHRDIKASNIMLDSEFNAKLGDFGLARFVDHAKGAQ  505

Query  1438  TTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKP-IDPTAEECHVNIVDWV  1614
             TTALAGT+GY+A EC  +G+ASKETD+YSFGIV LEIACGRKP I+  A+E  ++IV+WV
Sbjct  506   TTALAGTLGYMAPECATTGRASKETDVYSFGIVALEIACGRKPIINLKAQENEIHIVEWV  565

Query  1615  WKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPL  1794
             W LYG G++L+A DP L GDF   +++ MMIVGLWCAHPD + RPSIRQAIQVLNFE PL
Sbjct  566   WGLYGRGKILEAVDPKLDGDFEQEQIKCMMIVGLWCAHPDPNNRPSIRQAIQVLNFEVPL  625

Query  1795  PDLPETMPVATF  1830
             P+L  +MPV T+
Sbjct  626   PNLSSSMPVPTY  637



>ref|XP_003628854.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=655

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/566 (49%), Positives = 389/566 (69%), Gaps = 12/566 (2%)
 Frame = +1

Query  163   IGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATK  342
             +GRA YS  + LWD  TG+++ F TH+ F+ID+  ++++G G AFFLAP G  IPPN+  
Sbjct  70    VGRAMYSRKVLLWDSKTGQVTDFKTHYTFIIDTQNNSRHGHGLAFFLAPFGFDIPPNSAT  129

Query  343   GGGFGLANDDERLNSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEG  519
                 GL N    ++SSN  V VEFD + N  +    +HVGI+V+S+ S V  PW+  +  
Sbjct  130   AF-MGLFNMTTMVSSSNQIVLVEFDSFPNGEWGETTEHVGINVNSIMSSVFTPWNASLHS  188

Query  520   GWGSEAWINYDPRSMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKD  684
             G  +E WI+++  + NL+V ++     N      +SY +DL K LPE VT GF+ + G  
Sbjct  189   GDIAEVWISFNSTTKNLTVSWKYQRTSNPEEKTSLSYEIDLMKVLPEWVTIGFSASIGNI  248

Query  685   TALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMR  864
               L  + SW F S L+ S++ +++K T   +++ + +G   +  G++    +  RKRK  
Sbjct  249   RELNNLLSWEFNSNLEKSDD-SNSKDTRLVVILTVSLGAVIIGVGALVAYVILKRKRKRS  307

Query  865   EEFDDDIFGNIG---ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKEL  1035
             E+  ++         +L  GAGP+RFTY+EL  ATN+FS+  KLG+GGFG+V+KGY  +L
Sbjct  308   EKQKEEAMHLTSMNDDLERGAGPRRFTYKELELATNNFSKDRKLGQGGFGAVFKGYFADL  367

Query  1036  ESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSL  1215
             +  VAVK++SRGS+QG KEY +EV+VIS++RH+NLV L+GWCH+  + LL+YEF+ NGSL
Sbjct  368   DLQVAVKKISRGSRQGKKEYVTEVKVISQLRHRNLVKLLGWCHDKGEFLLIYEFMPNGSL  427

Query  1216  DSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGD  1395
             DSHL+  ++ L+W +R+KI   LAS LLYLHEE E+C+VHRDIKSSN+MLDS+ N KLGD
Sbjct  428   DSHLFGKRTPLSWGVRHKITLGLASGLLYLHEEWERCVVHRDIKSSNVMLDSSFNVKLGD  487

Query  1396  FGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDP  1575
             FGLA+L+DHE G +TT LAGT GY+A E V +G+ASKE+D+YSFGIV LEI  G+K  + 
Sbjct  488   FGLAKLMDHELGPQTTGLAGTFGYLAPEYVSTGRASKESDVYSFGIVVLEITSGKKATEV  547

Query  1576  TAE-ECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPS  1752
               E +    +++WVW  YG G+LL A D NL  DF+ ++VE +MIVGLWCAHPD SLRPS
Sbjct  548   MKEKDEEKGMIEWVWDHYGKGELLVAMDENLRKDFDEKQVECLMIVGLWCAHPDVSLRPS  607

Query  1753  IRQAIQVLNFEAPLPDLPETMPVATF  1830
             IRQAIQVLNFE  +P+LP   PVAT+
Sbjct  608   IRQAIQVLNFEVSMPNLPPKRPVATY  633



>ref|XP_010093477.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis]
 gb|EXB54101.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis]
Length=685

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/601 (50%), Positives = 390/601 (65%), Gaps = 36/601 (6%)
 Frame = +1

Query  58    FNFDLFTPSNVQNITFE-RTSLVNNSIQITPNQR-------NCIGRATYSEPLHLWDKPT  213
             FNF  F  S  +NI F+  +S  N ++Q+T           N +GRA++S+P+ LW+  T
Sbjct  31    FNFTSF--SGDENIIFQGDSSAANGTLQLTKVDETTGFPVANSVGRASFSKPVQLWNNNT  88

Query  214   GKLSSFNTHFAFVIDSNGS-AKYGDGFAFFLAPLGSRIPPNATKGGGFGL-----ANDDE  375
             GK + F  HF F I +N + +KYGDG +FF+AP  S IP N++ GG   L     AND  
Sbjct  89    GKYADFTAHFTFRIKANDTKSKYGDGISFFIAPFESDIPANSS-GGYLALLSPESANDSR  147

Query  376   RLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDP  555
             R   SNP VAVEFD Y N +D    HVGI+VDS++S  T  W+  I+ G  + AW++Y  
Sbjct  148   R---SNPIVAVEFDSYQNSWDPSSDHVGINVDSIESATTIKWNSSIKDGRVANAWVSYVS  204

Query  556   RSMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFT  720
              S  LSV         +     +++ +D +++LP+ V  GF+ ATG       I SW F 
Sbjct  205   ASNILSVYLTYVENPEYSGQSVLAHRIDWKEFLPQSVRIGFSAATGDSYETHNILSWSFI  264

Query  721   SALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKR-----KMREEFDDDI  885
             S L+      + KS     +   V  G     G + F    WR+R     K+ E +D+ I
Sbjct  265   STLEDGNTDGEGKSNAGLGIGLGVGFGALGGLGLILFI--FWRRRAAKKKKLEEAYDESI  322

Query  886   FGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVS  1065
                 GE     GPKRFTYREL++ATN FS+Q KLG+GGFG VY+G L E    VAVKR+S
Sbjct  323   DVEFGE----TGPKRFTYRELSQATNEFSEQGKLGQGGFGGVYRGVLSESNMEVAVKRIS  378

Query  1066  RGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSL  1245
             +GS QG KEY SEV++ISR+RHKNLV LIGWCH   + LLVYE L NGSLD HL+ GK  
Sbjct  379   KGSTQGKKEYISEVKIISRLRHKNLVQLIGWCHTKGEFLLVYELLPNGSLDIHLFGGKPT  438

Query  1246  LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHE  1425
             L W +RYKI   LAS+LLYLHEE E+C+VHRDIKSSN+MLDSN NAKLGDFGLARL DHE
Sbjct  439   LIWSVRYKIAHGLASSLLYLHEEWEECVVHRDIKSSNVMLDSNFNAKLGDFGLARLADHE  498

Query  1426  KGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIV  1605
              G +TT LAGTMGY+A ECV +GKASKE+D+YSFG+V LEI CGR+P++  AE   V++V
Sbjct  499   SGLQTTVLAGTMGYMAPECVTTGKASKESDVYSFGVVALEICCGRRPVERNAEPSKVSLV  558

Query  1606  DWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFE  1785
             +W W LYG GQ+L+AAD  L+ +F+  ++E +M+VGLWC HP+ S RPSI+Q + VLNFE
Sbjct  559   EWAWNLYGKGQVLEAADTRLNLEFDEEQMECLMVVGLWCCHPEPSFRPSIKQVVNVLNFE  618

Query  1786  A  1788
             A
Sbjct  619   A  619



>ref|XP_010090631.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis]
 gb|EXC36487.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis]
Length=652

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/567 (51%), Positives = 377/567 (66%), Gaps = 12/567 (2%)
 Frame = +1

Query  163   IGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATK  342
             +GR   +E LHLWD  T  LS F T F+F ID+ G A Y  G AFFLAP+G  +PPN+  
Sbjct  67    VGRVISAEALHLWDANTNNLSHFRTSFSFTIDTLGRASYAAGLAFFLAPVGFEMPPNSV-  125

Query  343   GGGFGLANDDERLNS-SNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEG  519
              G  GL N     +S       VEFD + N +D   +HVGI+ +SL S V   W+     
Sbjct  126   AGFLGLFNTTTMADSFRKQIFLVEFDSFSNSWDPPFEHVGINNNSLSSAVFTRWNASFHS  185

Query  520   GWGSEAWINYDPRSMNLSVVF-----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKD  684
             G  ++  INY+  + +LSV +     RN      +SY +DL K LPE VTFGF+ AT   
Sbjct  186   GDTADVHINYNATTKHLSVYWSYRRRRNATENTSLSYHIDLSKILPEWVTFGFSAATSHF  245

Query  685   TALQMINSWIFTSALDI---SENQADTKSTgkglviglvvggcfliggSMAFSFL-AWRK  852
             +   ++ SW F+S+L++    + + DTK     + + +   G  +IG  + F  +   RK
Sbjct  246   SERHILKSWEFSSSLELDVKEKEREDTKKKTLLVGLIVSGTGVVIIGMVIVFMVMFRKRK  305

Query  853   RKMREEFDD-DIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLK  1029
             RK R E +  ++     +L  GAGP+RF+Y +LA ATN+FS++ KLG+GGFG VYKGYL 
Sbjct  306   RKNRGEAETVNLTSMNADLERGAGPRRFSYADLASATNNFSEKRKLGQGGFGEVYKGYLN  365

Query  1030  ELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNG  1209
             +L+  VAVK++S GS+QG KEY +EV+VIS +RH+NLV LIGWCH+  + LLVYEF+ NG
Sbjct  366   DLDLIVAVKKISSGSRQGKKEYVTEVKVISSLRHRNLVQLIGWCHDKGEFLLVYEFMPNG  425

Query  1210  SLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKL  1389
             SLD HL+   S LTWP RYKI   L SALLYLHEE E+C+VHRDIKSSN+MLDSN N KL
Sbjct  426   SLDYHLFGKISPLTWPARYKIALGLTSALLYLHEEWEQCVVHRDIKSSNVMLDSNFNVKL  485

Query  1390  GDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPI  1569
             GDFGLARLV+H+ G +TT L GT+GY+A E V +G+ASKE+DIYSFG+V LEIA G+K  
Sbjct  486   GDFGLARLVEHDMGPQTTGLVGTLGYLAPEYVSTGRASKESDIYSFGVVALEIATGKKST  545

Query  1570  DPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRP  1749
                 E+  + +V+WVW LYG G++L A D  +  DF  ++VE +MIVGLWCAHPD  LRP
Sbjct  546   AQMEEDSEMGLVEWVWDLYGKGKMLSAVDERMLMDFEQKQVECLMIVGLWCAHPDRCLRP  605

Query  1750  SIRQAIQVLNFEAPLPDLPETMPVATF  1830
             SI+QAIQVLNFEA  P+LP +MPV  +
Sbjct  606   SIKQAIQVLNFEAMWPNLPTSMPVPVY  632



>ref|XP_007047721.1| Concanavalin A-like lectin protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOX91878.1| Concanavalin A-like lectin protein kinase family protein, putative 
[Theobroma cacao]
Length=666

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/563 (50%), Positives = 375/563 (67%), Gaps = 38/563 (7%)
 Frame = +1

Query  163   IGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATK  342
             +G ATY+E + LWD  TGKLS F + F+  ID+  S+ YG G AFFLAP+GS+IPPN   
Sbjct  113   VGWATYAESVRLWDSNTGKLSDFTSRFSVTIDTQNSSTYGHGVAFFLAPVGSQIPPN-IA  171

Query  343   GGGFGLANDDERLNSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEG  519
             GG  GL N      S+N  + VEFD + N  +D    HVGI+ +S+ S V  PW+     
Sbjct  172   GGFLGLFNTTTSDLSTNQIIMVEFDTFPNPEWDPSVVHVGINNNSIASAVYTPWNASFHS  231

Query  520   GWGSEAWINYDPRSMNLSVVF-----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKD  684
                ++A I Y+  + NLSV +      N      +SY +DL K LPE V  GF+ ATG++
Sbjct  232   DDPADALITYNATTKNLSVSWSYKKTNNPKENSSLSYQIDLMKVLPEWVMVGFSAATGQN  291

Query  685   TALQMINSWIFTSALDISE-NQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKM  861
                  I SW F+S+ DI E N  + K+T                   +A S  A     +
Sbjct  292   VERHTIQSWEFSSSFDIKETNGKNAKNTRII----------------VATSISA---ASI  332

Query  862   REEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELES  1041
              ++F+            GAGP RF ++EL  ATN+F+ + KLGEGGFG+VY+ YL +L+ 
Sbjct  333   TDDFER-----------GAGPSRFAFQELVSATNNFANERKLGEGGFGTVYRVYLADLDI  381

Query  1042  YVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDS  1221
              VAVK++SRGS+QG +EY +EV++IS++RH++LV L+GWCH+  + LLVYEF+ NGSLDS
Sbjct  382   AVAVKKISRGSRQGKREYITEVKIISQLRHRHLVQLVGWCHDKGEFLLVYEFMPNGSLDS  441

Query  1222  HLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFG  1401
             HL+  K+LLTW  RYKI Q LAS LLYLHEE E+C++HRDIKSS+IMLDS+ N KLGDFG
Sbjct  442   HLFDKKTLLTWTSRYKIAQGLASVLLYLHEEWEQCVLHRDIKSSDIMLDSSFNVKLGDFG  501

Query  1402  LARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTA  1581
             LARL+DHE G +TT L GT+GY+A E + +G+ASKE+D++SFG+V LEIA GRK IDP  
Sbjct  502   LARLMDHELGGQTTRLVGTLGYMAPEYISTGRASKESDVFSFGVVALEIATGRKAIDPLK  561

Query  1582  EECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQ  1761
             ++  +++V W+W LY +G+ L A D  L+ +F+  +VE ++IVGLWCAHPD S+RPSIRQ
Sbjct  562   QDSQMSLVHWIWHLYESGEHLVAVDERLNAEFDRNQVECLIIVGLWCAHPDSSMRPSIRQ  621

Query  1762  AIQVLNFEAPLPDLPETMPVATF  1830
             AIQVLN EA LPDLP+ MPV  +
Sbjct  622   AIQVLNLEAELPDLPKKMPVPVY  644


 Score = 97.8 bits (242),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  1594  VNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQV  1773
             + + +W W LY  G+L  A D  L+  F+ ++ E +MIVGLWCAHPD + RPSIRQAIQV
Sbjct  1     MGLAEWTWGLYEKGELFLAVDEKLNKGFDEKQAECLMIVGLWCAHPDRNSRPSIRQAIQV  60

Query  1774  LNFEAPLPDLPETMPV  1821
             LNFE+ +P+LP  MPV
Sbjct  61    LNFESAIPNLPAKMPV  76



>ref|XP_003628848.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
Length=651

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/616 (47%), Positives = 408/616 (66%), Gaps = 18/616 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDL--FTPSNVQNITFERTSLVNNSI--QITPNQRNCIGRATYSEPLHL  198
             I+   H  S +F +  F P++   I     + V+  +   I  N    +G A YS+ + L
Sbjct  16    ILLTFHAYSIHFQIPSFNPNDANIIYQGSAAPVDGEVDFNINGNYSCQVGWALYSKKVLL  75

Query  199   WDKPTGKLSSFNTHFAFVIDSNGSAK--YGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
             WD  TG+L+ F TH+ F+I++ G +   YG G AFFLA  G  IPPN++ GG  GL N  
Sbjct  76    WDSKTGQLTDFTTHYTFIINTRGRSPSFYGHGLAFFLAAYGFEIPPNSS-GGLMGLFNTT  134

Query  373   ERLNSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINY  549
               L+SSN  V VEFD + N  +    +HVGI+ +S++S ++ PW+  +  G  +E WI Y
Sbjct  135   TMLSSSNHIVHVEFDSFANSEFSETTEHVGINNNSIKSSISTPWNASLHSGDTAEVWIRY  194

Query  550   DPRSMNLSVVFRNFGSYG-----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             +  + NL+V +    +       ++SY +D +K LPE VT GF+ ATG +  +  + SW 
Sbjct  195   NSTTKNLTVSWEYQTTSSPQEKTNLSYQIDFKKVLPEWVTIGFSAATGYNGEVNNLLSWE  254

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGN  894
             F S L+ S++ +++K T   +++ + +G   +  G++    +  RKRK  E+  ++    
Sbjct  255   FNSNLEKSDD-SNSKDTRLVVILTVSLGAVIIGVGALVAYVILKRKRKRSEKQKEEAMHL  313

Query  895   IG---ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVS  1065
                  +L  GAGP+RFTY+EL  ATN+FS+  KLG+GGFG+V+KGY  +L+  VAVK++S
Sbjct  314   TSMNDDLERGAGPRRFTYKELELATNNFSKDRKLGQGGFGAVFKGYFADLDLQVAVKKIS  373

Query  1066  RGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSL  1245
             RGS+QG KEY +EV+VIS++RH+NLV L+GWCH+  + LLVYEF+ NGSLDSHL+  ++ 
Sbjct  374   RGSRQGKKEYVTEVKVISQLRHRNLVKLLGWCHDKGEFLLVYEFMPNGSLDSHLFGKRTP  433

Query  1246  LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHE  1425
             L W +R+KI   LAS +LYLHEE E+C+VHRDIKSSN+MLDS+ N KLGDFGLA+L+DHE
Sbjct  434   LPWIVRHKIALGLASGVLYLHEEWERCVVHRDIKSSNVMLDSSFNVKLGDFGLAKLMDHE  493

Query  1426  KGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECH-VNI  1602
              G +TT +AGT+GY+A E + +GK SKE+D+YSFG+V LEIA G+K +    E+     +
Sbjct  494   IGPQTTVVAGTLGYMAPEYISTGKTSKESDVYSFGVVALEIATGKKAVQVMKEQGEDKGL  553

Query  1603  VDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNF  1782
             +DWVW  YG G+LL   D NL  DF+ ++VE ++IVGLWCAHPD SLRPSI QAIQVLNF
Sbjct  554   IDWVWDHYGRGELLVTMDENLQKDFDEKQVEFLLIVGLWCAHPDVSLRPSIVQAIQVLNF  613

Query  1783  EAPLPDLPETMPVATF  1830
             E  LP+LP   PVAT+
Sbjct  614   EVALPNLPPKKPVATY  629



>emb|CAN80079.1| hypothetical protein VITISV_041810 [Vitis vinifera]
Length=684

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/632 (48%), Positives = 415/632 (66%), Gaps = 46/632 (7%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVN-NSIQITPNQRNCI-----GRATYSEPLHLWDKP  210
             P+SFN   F   N   +  E  +L + ++I++T N R+       GRA Y E L+LWDK 
Sbjct  27    PMSFNITSF-HQNADLLRLEGDALYSSDAIELTTNARDKTSNRSWGRAIYKEQLYLWDKT  85

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS  390
             +G L+ F+T+F+FVI+S     YGDG  FFL+  G+++P + + G G GL N     +S+
Sbjct  86    SGNLTDFSTNFSFVINSLQDNSYGDGLTFFLS--GTQLPSDVS-GSGLGLVN-----SSA  137

Query  391   NP------------FVAVEFDVYLNHY---DTEQKHVGIDVDSLQSVVTAPWSPDIEGGW  525
              P            FVAVEFD Y N     D  + HVGI+++S+ SV T  WS DI  G 
Sbjct  138   TPATNSTTNSTTIRFVAVEFDTYPNSDTLGDPRKDHVGININSMISVKTMNWSNDITNGK  197

Query  526   GSEAWINYDPRSMNLSVVFRNFGSYG------HVSYILDLRKYLPERVTFGFAGATGKDT  687
              +   I+YD  S NLSVV     +         + Y +DLR  LPE V  GF+ +TG   
Sbjct  198   VNHVSISYDSISQNLSVVVITDSTANTSTLPQSLYYEVDLR-ILPEFVDIGFSASTGDSI  256

Query  688   ALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRK---  858
              L  I+SW F+S L+      + K T   + + +           +A  +   RK++   
Sbjct  257   QLNKISSWSFSSTLEFPP--GERKKTELVVGLSVCAFVVVG---GLALVWFYLRKKRNTG  311

Query  859   -MREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKEL  1035
               +E+  D       +   G GP++F++ ELA AT++FS+ +KLGEGGFG VY+G+L+EL
Sbjct  312   GYQEDGGDSDQAMDEDFEKGTGPRKFSFNELALATSNFSEGEKLGEGGFGGVYRGFLREL  371

Query  1036  ESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSL  1215
              SYVAVKRV+R S+QG+KEYASEV++  R+RH+NLV L+GWCH+ ++LLLVYE L NGSL
Sbjct  372   NSYVAVKRVTRNSQQGMKEYASEVKIFCRLRHRNLVQLMGWCHKKEELLLVYELLPNGSL  431

Query  1216  DSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGD  1395
              + L++ K+LLTW +RY+I   LAS+LLYLHEE E+C+VHRDIKSSN+MLDS+ NAKLGD
Sbjct  432   STCLFEEKTLLTWAMRYRIALGLASSLLYLHEEWEQCVVHRDIKSSNVMLDSDFNAKLGD  491

Query  1396  FGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDP  1575
             FGLARLVDH KGS+TT LAGTMGY+A EC  +GKASKE+D+YSFGIV LEI CGR+ ++ 
Sbjct  492   FGLARLVDHGKGSQTTVLAGTMGYMAPECFTTGKASKESDVYSFGIVALEICCGRRAVET  551

Query  1576  TAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSI  1755
              AEE  + +V+WVW LYG G+LL+AADP LS D++ +++E++MIVGLWCAHPDC+ RPS+
Sbjct  552   KAEENQIRLVEWVWDLYGVGKLLEAADPRLSADYDEQQMERLMIVGLWCAHPDCNARPSM  611

Query  1756  RQAIQVLNFEAPLPDLPETMPVATFWPQRNVQ  1851
             RQA+ VLN EA LP LP  MPV  ++    +Q
Sbjct  612   RQAMXVLNSEALLPLLPIKMPVPMYYAPPALQ  643



>ref|XP_006856580.1| hypothetical protein AMTR_s00046p00196890 [Amborella trichopoda]
 gb|ERN18047.1| hypothetical protein AMTR_s00046p00196890 [Amborella trichopoda]
Length=691

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/605 (49%), Positives = 395/605 (65%), Gaps = 14/605 (2%)
 Frame = +1

Query  55    SFNFDLFTPSNVQNITFERTSLVNNS--IQITPNQ-----RNCIGRATYSEPLHLWDKPT  213
             +FNF  F P N   I ++  +  +    IQ+T NQ     +   GRA Y  P+ LWD  T
Sbjct  28    TFNFTSF-PPNTPGIIYQGDAFPSGQGVIQLTRNQVDGTLQQSEGRAIYRYPIQLWDSKT  86

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSN  393
               ++ F THF F I+   +  YGDG AFFLAP+ + IP N++ GG  GL N+    NSS 
Sbjct  87    RTVTDFVTHFEFTINGLNATYYGDGLAFFLAPVDAVIPLNSS-GGWLGLYNETTDKNSSA  145

Query  394   PFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLS  573
               VAVE D Y N +D    H+GID++S+ SV T     +I  G   +AWI Y+  + +L 
Sbjct  146   QVVAVEIDTYQNPWDPSPNHIGIDINSITSVTTVICEDNIRNGSKGQAWIAYNATTKDLQ  205

Query  574   V--VFRNFGSYGH--VSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISE  741
             V   +   GS G   +S+ +DL + LPE V  GF+ ATG  T L  I SW F S   +  
Sbjct  206   VRLSYGEDGSAGQPSLSHNVDLMEILPEMVIVGFSAATGWSTELHTILSWDFQSNFGLGM  265

Query  742   NQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNI-GELGGGA  918
                 +K   K  V   + G   L+   MA     WRK K++   + DI  ++  +   G 
Sbjct  266   GMGASKGIHKKKVKWTIGGVVSLVVILMAIGLYLWRKLKLKGSSEIDIDASMEDKFIKGT  325

Query  919   GPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYA  1098
             GP++F Y+EL  AT +FS++ KLGEGGFG VYKG        VAVKRVS+GSKQG KEY 
Sbjct  326   GPRKFDYKELVNATKNFSEEGKLGEGGFGGVYKGVFDGSIGTVAVKRVSKGSKQGKKEYV  385

Query  1099  SEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQ  1278
             SEV +ISR+RH+NLV LIGWCH+ ++LLLVYEF+ NGSLDSHL+  ++ LTW  RYKI  
Sbjct  386   SEVTIISRLRHRNLVRLIGWCHDQRELLLVYEFMPNGSLDSHLFGKQAELTWETRYKIAL  445

Query  1279  DLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGT  1458
              LA+ALLYLHEE E+C+VHRDIKSSN+MLDSN NAKLGDFGLARLVDH+  S+TT +AGT
Sbjct  446   GLANALLYLHEEWEQCVVHRDIKSSNVMLDSNFNAKLGDFGLARLVDHDSASQTTVIAGT  505

Query  1459  MGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQ  1638
             MGY+A ECV +GKASKE+DI+SFG V LEIACGR+P++P A+   V +V+WVW+LYG   
Sbjct  506   MGYLAPECVTTGKASKESDIFSFGAVALEIACGRRPVEPFAQSNKVRLVEWVWELYGKDG  565

Query  1639  LLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMP  1818
             L +A D  L+  ++ +++E +M+VGLWC+HP+ ++RPSIRQ I VLNF++ +P LP  +P
Sbjct  566   LQEAVDQRLNDVYDAKQMECLMVVGLWCSHPEHTMRPSIRQVIHVLNFQSSMPVLPSKLP  625

Query  1819  VATFW  1833
             VA ++
Sbjct  626   VAMYY  630



>ref|XP_006584952.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
isoform X2 [Glycine max]
Length=681

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/581 (52%), Positives = 399/581 (69%), Gaps = 21/581 (4%)
 Frame = +1

Query  133   IQITPNQRNCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLA-P  309
             +Q+T  +    GR  Y + LHLWDK +GK++ F THF+F I++  +  Y DG  FFLA P
Sbjct  54    LQLTRYETFSYGRVIYHKQLHLWDKNSGKVADFTTHFSFTINARNNTNYADGMTFFLAHP  113

Query  310   LGSRIPPNATKGGGFGLANDDERLN----SSNPFVAVEFDVYLN-HYDTEQKHVGIDVDS  474
                 + P    G G GL +  + LN       PFVAVEFD Y+N  +D +  HVGI V+S
Sbjct  114   SFPELDPR--DGVGIGLLSRTQLLNPNFTKEYPFVAVEFDTYVNPEWDPKYHHVGIQVNS  171

Query  475   LQSVV--TAPWSPDIEGGWGSEAWINYDPRSMNLSVVFR----NFGSYGHVSYILDLRKY  636
               + V  T  W   ++   G +A I+YD  S  LSV F     N     ++S +++L+  
Sbjct  172   FVTSVSDTTQWFTSMDQR-GYDADISYDSASNRLSVSFTGYKDNVKIKQNLSSVVNLKDK  230

Query  637   LPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcflig  816
             LP+ V FG + ATG       ++SW F S+    +++  +K    GL +G+ +GG  LIG
Sbjct  231   LPDWVEFGVSAATGMYYEEHTLSSWSFNSSFVFDKHKGGSKK---GLAVGMGIGGFVLIG  287

Query  817   gSMAFSFLAWRK-RKMREEFDDDIFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLG  990
             G+   S   W+K +K+ EE +  +   +GE    GAGP++++Y ELA A N F  + KLG
Sbjct  288   GTGLISLGLWKKWKKVDEEENHIVEEYMGEDFERGAGPRKYSYAELAHAANGFKDEHKLG  347

Query  991   EGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHEN  1170
             +GGFG VYKGYLK+++S+VA+K+VS GS QGIKE+ASEV +ISR+RH+NLV+LIGWCHE 
Sbjct  348   QGGFGGVYKGYLKDIKSHVAIKKVSEGSDQGIKEFASEVIIISRLRHRNLVNLIGWCHER  407

Query  1171  KDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKS  1350
             K LLLVYE++SNGSLD HL+K +S+L W +RY I + LASALLYLHEE E+C+VHRDIK 
Sbjct  408   KKLLLVYEYMSNGSLDIHLFKKQSILQWAVRYNIARGLASALLYLHEEWEQCVVHRDIKP  467

Query  1351  SNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGK-ASKETDIYSF  1527
             SNIMLDS  NAKLGDFGLAR VDH K ++TTALAGTMGY+A EC +  + ASKE+D+YSF
Sbjct  468   SNIMLDSEFNAKLGDFGLARFVDHAKSAQTTALAGTMGYMAPECTLGYRPASKESDVYSF  527

Query  1528  GIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMI  1707
             G+V LEIACGR PI+  A+E  ++IV WVW LYG G++L+AAD  L G F   +++ +MI
Sbjct  528   GVVALEIACGRIPINHRAQENEISIVQWVWGLYGEGRILEAADQRLEGKFEEEQIKCLMI  587

Query  1708  VGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             VGLWCAHPD + RPS+RQAIQVLNFEAPLP+LP ++PV T+
Sbjct  588   VGLWCAHPDHNNRPSMRQAIQVLNFEAPLPNLPSSLPVPTY  628



>ref|XP_003532593.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
isoform X1 [Glycine max]
Length=689

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/581 (52%), Positives = 399/581 (69%), Gaps = 21/581 (4%)
 Frame = +1

Query  133   IQITPNQRNCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLA-P  309
             +Q+T  +    GR  Y + LHLWDK +GK++ F THF+F I++  +  Y DG  FFLA P
Sbjct  62    LQLTRYETFSYGRVIYHKQLHLWDKNSGKVADFTTHFSFTINARNNTNYADGMTFFLAHP  121

Query  310   LGSRIPPNATKGGGFGLANDDERLN----SSNPFVAVEFDVYLN-HYDTEQKHVGIDVDS  474
                 + P    G G GL +  + LN       PFVAVEFD Y+N  +D +  HVGI V+S
Sbjct  122   SFPELDPR--DGVGIGLLSRTQLLNPNFTKEYPFVAVEFDTYVNPEWDPKYHHVGIQVNS  179

Query  475   LQSVV--TAPWSPDIEGGWGSEAWINYDPRSMNLSVVFR----NFGSYGHVSYILDLRKY  636
               + V  T  W   ++   G +A I+YD  S  LSV F     N     ++S +++L+  
Sbjct  180   FVTSVSDTTQWFTSMDQR-GYDADISYDSASNRLSVSFTGYKDNVKIKQNLSSVVNLKDK  238

Query  637   LPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcflig  816
             LP+ V FG + ATG       ++SW F S+    +++  +K    GL +G+ +GG  LIG
Sbjct  239   LPDWVEFGVSAATGMYYEEHTLSSWSFNSSFVFDKHKGGSKK---GLAVGMGIGGFVLIG  295

Query  817   gSMAFSFLAWRK-RKMREEFDDDIFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLG  990
             G+   S   W+K +K+ EE +  +   +GE    GAGP++++Y ELA A N F  + KLG
Sbjct  296   GTGLISLGLWKKWKKVDEEENHIVEEYMGEDFERGAGPRKYSYAELAHAANGFKDEHKLG  355

Query  991   EGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHEN  1170
             +GGFG VYKGYLK+++S+VA+K+VS GS QGIKE+ASEV +ISR+RH+NLV+LIGWCHE 
Sbjct  356   QGGFGGVYKGYLKDIKSHVAIKKVSEGSDQGIKEFASEVIIISRLRHRNLVNLIGWCHER  415

Query  1171  KDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKS  1350
             K LLLVYE++SNGSLD HL+K +S+L W +RY I + LASALLYLHEE E+C+VHRDIK 
Sbjct  416   KKLLLVYEYMSNGSLDIHLFKKQSILQWAVRYNIARGLASALLYLHEEWEQCVVHRDIKP  475

Query  1351  SNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGK-ASKETDIYSF  1527
             SNIMLDS  NAKLGDFGLAR VDH K ++TTALAGTMGY+A EC +  + ASKE+D+YSF
Sbjct  476   SNIMLDSEFNAKLGDFGLARFVDHAKSAQTTALAGTMGYMAPECTLGYRPASKESDVYSF  535

Query  1528  GIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMI  1707
             G+V LEIACGR PI+  A+E  ++IV WVW LYG G++L+AAD  L G F   +++ +MI
Sbjct  536   GVVALEIACGRIPINHRAQENEISIVQWVWGLYGEGRILEAADQRLEGKFEEEQIKCLMI  595

Query  1708  VGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             VGLWCAHPD + RPS+RQAIQVLNFEAPLP+LP ++PV T+
Sbjct  596   VGLWCAHPDHNNRPSMRQAIQVLNFEAPLPNLPSSLPVPTY  636



>ref|XP_003532594.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.2-like 
[Glycine max]
 gb|KHN46240.1| L-type lectin-domain containing receptor kinase IX.1 [Glycine 
soja]
Length=682

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/573 (49%), Positives = 385/573 (67%), Gaps = 19/573 (3%)
 Frame = +1

Query  139   ITPNQRNCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGS  318
             +T  + +  GR TY E LHLWDK +GK++ F THF+F I++     +GDG  FFLA    
Sbjct  64    LTRYEPDSYGRVTYYENLHLWDKNSGKVTDFTTHFSFTINTPNKTHHGDGITFFLAH--P  121

Query  319   RIPPNATKGGGFGLANDDERLN----SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSV  486
               P +   G G GLA+ ++  N       PFVAVEFD ++N +D +  HVGIDV+S+ + 
Sbjct  122   DFPQSGIDGSGIGLASREQLKNLNYAKDYPFVAVEFDTFVNDWDPKYDHVGIDVNSINTT  181

Query  487   VTAPWSPDIEGGWGSEAWINYDPRSMNLSVVFRNFGS----YGHVSYILDLRKYLPERVT  654
              T  W   ++   G +A I+YD  S  LSV    +        H+  +++L   LPE V 
Sbjct  182   DTTEWFTSMDER-GYDADISYDSASNRLSVTLTGYKDSVKIKQHLFSVVNLSDVLPEWVE  240

Query  655   FGFAGATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFS  834
              GF+ ATG       ++SW F S+LD  + +  +K      +   +  G  ++      +
Sbjct  241   IGFSSATGFFYEEHTLSSWSFNSSLDKEQQKGGSKIGLVIGLSVGLGAGLSVLIVIWGVT  300

Query  835   FLA-W--RKRKMREE--FDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGG  999
             FL  W  + R + E   FD  +  +   +   + PK+F+Y ELARATN+F++++K+GEGG
Sbjct  301   FLVRWMLKNRGLEEVSLFDHAMDNDFERM---SLPKKFSYEELARATNNFARENKIGEGG  357

Query  1000  FGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDL  1179
             FG+VY+G ++EL  +VA+K+VSR S QG+KEYASEV++IS++RHKNLV L+GWCH+N DL
Sbjct  358   FGAVYRGLIRELNIHVAIKKVSRRSSQGVKEYASEVKIISQLRHKNLVQLLGWCHQNNDL  417

Query  1180  LLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNI  1359
             LLVYEF+ NGSLDS+L+KGK LL W +RY I + LASALLYLHEE E+C++HRDIKSSN+
Sbjct  418   LLVYEFMENGSLDSYLFKGKGLLAWKVRYDIARGLASALLYLHEEWEECVLHRDIKSSNV  477

Query  1360  MLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVT  1539
             MLDSN +AKLGDFGLARL+DH  GS+TT LAGT+GY+  E V  GKAS+E+D++SFG+  
Sbjct  478   MLDSNFDAKLGDFGLARLMDHAIGSKTTVLAGTIGYLPPEAVTRGKASRESDVFSFGVAA  537

Query  1540  LEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLW  1719
             LEIACGRK I+P   E  + +VDWVW+L+G   LL A+DP+L G F+ +E+E++MIVGLW
Sbjct  538   LEIACGRKAIEPNVNEEQLYLVDWVWELHGMVDLLKASDPSLYGHFDEKEMERLMIVGLW  597

Query  1720  CAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMP  1818
             C + D  LRP+IRQ +QVLNFEAPLP L   +P
Sbjct  598   CTYTDFHLRPTIRQVVQVLNFEAPLPTLSPQVP  630



>ref|XP_008363633.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Malus domestica]
Length=703

 Score =   543 bits (1399),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 312/637 (49%), Positives = 402/637 (63%), Gaps = 44/637 (7%)
 Frame = +1

Query  34    IPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQIT--PNQRNCIGRATYSEPLHLWDK  207
             IP   PL+FN+D FT             +    I++T    Q   +G ATY +P  LW+ 
Sbjct  19    IPSASPLAFNYDSFTIGXTGIFLXGAAYIDEQXIKLTRSARQNKNVGXATYXQPFLLWET  78

Query  208   PTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFG-----LANDD  372
              TGK++ F THF F+IDS     + DG  FF+AP GS +   A   G  G     L  D 
Sbjct  79    STGKIADFTTHFTFMIDSG----HADGMVFFIAPSGSLLNIXAGGXGHLGLPVEELPGDT  134

Query  373   ERLNSSNPFVAVEFDVYLNHYDTEQK----HVGIDVDSLQSVVTAPWSPDIEGGWGSEAW  540
              R  +  PFVAVEFD+Y N     +     HVGID++SL+S +T PW  DI     ++AW
Sbjct  135   TR--TLYPFVAVEFDIYRNEQPVIRXXVGDHVGIDINSLKSNITTPWXGDINEXKRNDAW  192

Query  541   INYDPRSMNLSVVFRNF--GSYG-------HVSYILDLRKYLPERVTFGFAGATGKDTAL  693
             I+Y+  S NLSV F +F  G  G       ++SYI+DL++YLP+ V  GF+ A G+D A+
Sbjct  193   ISYNSXSKNLSVAFTSFQNGXNGTEVEVIKYLSYIIDLKQYLPDWVIVGFSAAXGQDIAV  252

Query  694   QMINSWIFTSAL----DISENQADTKSTgkglviglvvggcfliggSMAFSF-------L  840
               I  W FTS      D + N+ ++ +               L+G  +A S        L
Sbjct  253   HKIIXWNFTSTALVDDDPTHNKPESIAPSGVXPGPGKSKMGLLLGLGIAGSLILFAGLGL  312

Query  841   AW----RKRKMREEFDDDIFGNI---GELGGGAGPKRFTYRELARATNSFSQQDKLGEGG  999
              W    +K K  +  D++ F N     EL    GP++F+Y ELA AT++F + +KLGEGG
Sbjct  313   VWFIYRKKSKAVDGXDENXFCNKLIDKELENXTGPRKFSYHELAXATSNFEEGEKLGEGG  372

Query  1000  FGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDL  1179
             FG VY+G++K+L   VAVKR+S GSKQG+KEYASEVR+ISR+RH+NLV LIGWCHE ++L
Sbjct  373   FGGVYRGFIKDLNLQVAVKRISSGSKQGMKEYASEVRIISRLRHRNLVQLIGWCHEKREL  432

Query  1180  LLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNI  1359
             LLVYEFL N SLDSHL+K  SLL+W + Y I + LASALLYLHEE E C++HRDIKSSN+
Sbjct  433   LLVYEFLPNRSLDSHLFKENSLLSWQVXYNIXKGLASALLYLHEEWEXCVLHRDIKSSNV  492

Query  1360  MLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVT  1539
             MLD N N KLGDFGLARLVDH + S TT +AGT GY+ALE V +GK++KE+D YSFG+V+
Sbjct  493   MLDXNFNVKLGDFGLARLVDHGEQSLTTIVAGTRGYMALEYVTTGKSTKESDXYSFGVVS  552

Query  1540  LEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLW  1719
             LEIACGRKPID   E   + +V WVW LY  G ++ AADP L G F+ +++E +MIVGLW
Sbjct  553   LEIACGRKPIDFKLEXSQIELVKWVWGLYEEGNVIQAADPKLYGHFDEKQMECLMIVGLW  612

Query  1720  CAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             CAHP    R SI Q IQVLNFE PLP LP  MP AT+
Sbjct  613   CAHPQYXFRXSIXQXIQVLNFEXPLPILPSKMPXATY  649



>ref|XP_006380832.1| hypothetical protein POPTR_0007s15000g [Populus trichocarpa]
 gb|ERP58629.1| hypothetical protein POPTR_0007s15000g [Populus trichocarpa]
Length=615

 Score =   539 bits (1389),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 283/573 (49%), Positives = 381/573 (66%), Gaps = 20/573 (3%)
 Frame = +1

Query  157   NCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNA  336
             N +G ATY E + LWD  +G+LS F +HF+F I++ G+  YG G AFFLAP+G +IPPN+
Sbjct  23    NRVGWATYPERVRLWDSSSGQLSDFTSHFSFTINTQGATNYGHGIAFFLAPVGFQIPPNS  82

Query  337   TKGGGFGLANDDERLNSSNPFVAVEFDVYLNH-YDTEQKHVGIDVDSLQSVVTAPWSPDI  513
               GG  GL N     +  +  V+VEFD Y N  +D +  HVGI+ +S+ S V  PW+   
Sbjct  83    A-GGFLGLFNTTTMKSPQSQIVSVEFDSYPNDGWDPKVGHVGINKNSISSAVYTPWNASF  141

Query  514   EGGWGSEAWINYDPRSMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATG  678
                  +EAWI Y+  + NLSV ++     N G    + YI+DL K+LPE VT GF+ ATG
Sbjct  142   HSEDTAEAWITYNSTNQNLSVFWKYQTTSNPGENSSLFYIIDLSKFLPEWVTVGFSAATG  201

Query  679   KDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRK  858
              +   Q + SW F S+L++ ++  D KS     V   V+        ++    + WR+++
Sbjct  202   SNVEQQRLLSWEFNSSLNV-KDMKDKKSRIIIGVTVSVLVLIAGATTAVV---ILWRRKQ  257

Query  859   MREEFDDDIFGNIG----ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYL  1026
             M          N+     +L  GAGP+RF+Y +L  ATN+FS Q KLGEGGFG+VY+GYL
Sbjct  258   MMTRKGATEIINVTSINEDLERGAGPRRFSYDDLVSATNNFSDQRKLGEGGFGAVYRGYL  317

Query  1027  KELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSN  1206
              +++  +AVK++SR S+QG KEY +EV+ IS++RH+NLV L+GWCH+  + ++VYEF+SN
Sbjct  318   NDMDMEIAVKKISRSSRQGKKEYITEVKTISQLRHRNLVQLLGWCHDKGEFMVVYEFMSN  377

Query  1207  GSLDSHLYKGKSL--LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLN  1380
             GSLDSHL+  K +  L+W +RYKI   LASALLYLHEE E+C+VHRD+KSSNIMLDS+ N
Sbjct  378   GSLDSHLFGKKKMSPLSWAVRYKISLGLASALLYLHEEWERCVVHRDVKSSNIMLDSSFN  437

Query  1381  AKLGDFGLARLVDH-EKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACG  1557
              KLGDFGLAR +DH E G  TT LAGT GY+A E + + +ASKE+D+YSFG+V LEIA G
Sbjct  438   VKLGDFGLARFMDHDEPGPTTTGLAGTFGYMAPEYISTRRASKESDVYSFGVVALEIATG  497

Query  1558  RKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLS-GDFNG-REVEQMMIVGLWCAHP  1731
             RK  D   +   +++V+W+W LYG G L  A D  L   DF+  ++ E +MIVGLWCAHP
Sbjct  498   RKANDLVDQNPEMSLVEWIWDLYGCGDLNLAVDKRLDIKDFDDEKQAECLMIVGLWCAHP  557

Query  1732  DCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             D +LRPSIRQAI VLN EA +PDLP  MPV  F
Sbjct  558   DHNLRPSIRQAIHVLNLEAAIPDLPLKMPVPVF  590



>ref|XP_008226463.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Prunus mume]
Length=693

 Score =   542 bits (1396),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 303/620 (49%), Positives = 408/620 (66%), Gaps = 26/620 (4%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRN------CIGRATYSEPLHLWDKP  210
             PL+F+F  F  S++  IT E  +  +  I    N          +GRATY +P  L +K 
Sbjct  37    PLNFSFSSFNGSDLATITTEGDAFFDTKILRLTNSGTDDENIFSVGRATYRQPFLLREKA  96

Query  211   TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN--  384
             TGKL+ F T F F +DSN ++KYGDG AFF+AP  S +     KGG  GL  D    N  
Sbjct  97    TGKLADFTTSFNFALDSNNNSKYGDGLAFFIAPNDSSLNSVLGKGGNLGLPVDTVTPNVI  156

Query  385   ---SSNPFVAVEFDVYLNHYDT----EQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWI  543
                +  PFVAVEFD+Y N  +T      +HVGI+V+SL S++T  W+  I  G  + A +
Sbjct  157   GPRNQYPFVAVEFDIYQNTRETIKDHAHEHVGINVNSLYSIITKNWTAGILNGTTNSAAV  216

Query  544   NYDPRSMNLSVVFRNF----GSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSW  711
             +Y+  + N SV F  F        ++ Y +DL+ YLP+ V  GF+ +TG   AL  I SW
Sbjct  217   SYNSTTKNFSVAFTTFVDGVQVIHYLDYKVDLKDYLPDWVVVGFSASTGSSVALFKIFSW  276

Query  712   IF--TSALDISENQADTKSTgkglviglvvggcfliggSMAFS-FLAWRKRKMREEFDDD  882
              F  TS +D  E ++   +    ++   + G   ++ G +    F+ W+KR   E  D++
Sbjct  277   NFNSTSLVDRHEVKSGNDNRIGLIIGVSIGGCAVVLVGVLGLVWFILWKKRDGGESSDEN  336

Query  883   IFGN---IGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAV  1053
                N     E     GP++F+Y EL  AT++F + +KLGEGGFG VYKG+L +L+S+VAV
Sbjct  337   PMVNELIDEEFEKRVGPRKFSYSELVCATSNFGEGEKLGEGGFGGVYKGFLPDLKSFVAV  396

Query  1054  KRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYK  1233
             KR+S  SKQG+KEYASEV++IS++RH++LV LIGWCHE K  +LVYEF+ NGSLD+HL+K
Sbjct  397   KRISMESKQGLKEYASEVKIISQLRHRHLVKLIGWCHERK-FILVYEFMPNGSLDAHLFK  455

Query  1234  GKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARL  1413
              +  LTW  RYKI   LAS LLYLHE  E+C++HRDIKSSN+MLDSN NAKLGDFGLARL
Sbjct  456   EQRFLTWDARYKIALGLASGLLYLHEGWEQCVLHRDIKSSNVMLDSNFNAKLGDFGLARL  515

Query  1414  VDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECH  1593
             VDH +   TTALAGTMGY+A + + +GKASKE+D+YS G+V LEIACGRK IDP      
Sbjct  516   VDHGQEPETTALAGTMGYMAPDYLNTGKASKESDVYSLGVVALEIACGRKAIDPKFGTGK  575

Query  1594  VNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQV  1773
             +N+V+WVW+L+G G+ ++A DP L GDF+  ++E ++IVGLWCAHPD ++RPSI+QAIQ+
Sbjct  576   INMVEWVWELHGEGRAIEAVDPKLCGDFDEEQMECLIIVGLWCAHPDYNMRPSIQQAIQM  635

Query  1774  LNFEAPLPDLPETMPVATFW  1833
             LNFE PLP LP  MP AT++
Sbjct  636   LNFEIPLPPLPSKMPAATYF  655



>ref|XP_002527233.1| kinase, putative [Ricinus communis]
 gb|EEF35159.1| kinase, putative [Ricinus communis]
Length=652

 Score =   540 bits (1392),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 283/612 (46%), Positives = 398/612 (65%), Gaps = 15/612 (2%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQ--RNC-IGRATYSEPLHLW  201
             ++P  H + F  + F  S+  +I +   ++ +  +    N+    C +G ATY + + +W
Sbjct  21    LVPCAHSIHFIKNRFD-SDATDIVYHGDAVPSVGVAELINKLTYTCRVGSATYHQKVPIW  79

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             D  +G+LS F+THF+F+ID+ G  +YG G AFFLAP+G +IP N+  G   GL N     
Sbjct  80    DSSSGQLSDFSTHFSFIIDTRGLKQYGHGLAFFLAPVGFQIPLNSASGF-LGLFNTSTVD  138

Query  382   NSSNPFVAVEFDVYLNH-YDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
             +S N  V VEFD Y N  +D   +HVGI+ +SL S     W+     G  +  WI Y+  
Sbjct  139   SSQNQIVMVEFDSYPNEEWDPLVEHVGINNNSLASANYTHWNASYHSGDTANVWITYNSS  198

Query  559   SMNLSVVF-----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTS  723
             + NLS+++      N      +SY++DL K LPE VT GF+ ATG +     + SW F S
Sbjct  199   TKNLSLLWTYQNTSNPLEKTSLSYVIDLMKVLPEWVTVGFSAATGANGERHQLLSWEFNS  258

Query  724   ALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG-  900
              LD+ E + +T       V   V      IG  +   F  WR++KM +   ++       
Sbjct  259   TLDVKETKGNTSQRTGITVGIAVSVCVVGIGVILGILFF-WRRKKMMKRKGEEKMNLTSI  317

Query  901   --ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGS  1074
               +L  GAGP+RF+Y +L  ATN+FS +  LG+GGFG+VYKGYL +++  +AVK++SRGS
Sbjct  318   NKDLERGAGPRRFSYEDLVAATNNFSNERMLGKGGFGAVYKGYLIDMDMAIAVKKISRGS  377

Query  1075  KQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTW  1254
             +QG KEY +EV+ I ++RH+NLV L+GWCH+  + LLVYEF+ NGSLDSHL+  KS LTW
Sbjct  378   RQGKKEYIAEVKTIGQLRHRNLVQLLGWCHDKGEFLLVYEFMPNGSLDSHLFGKKSSLTW  437

Query  1255  PLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGS  1434
              +R+KI   LASALLYLHEE E+C+VHRD+KSSN+MLDSN +AKLGDFGLARL+DHE G 
Sbjct  438   AVRHKISLGLASALLYLHEEWEQCVVHRDVKSSNVMLDSNCSAKLGDFGLARLMDHELGP  497

Query  1435  RTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWV  1614
             +TT LAGT+GY+A E + + +ASKE+D+YSFG+V LEI  GR+ ID   ++  +++V+W+
Sbjct  498   QTTGLAGTLGYLAPEYISTRRASKESDVYSFGVVALEIVSGRRAIDHINDKNEMSLVEWI  557

Query  1615  WKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPL  1794
             W+LYG G+L  A D  +  +F+ +E E +MIVGLWCAHPD ++RPS+ QAIQVL FE  L
Sbjct  558   WELYGQGKLHLAVDRAIHMEFDEKEAECLMIVGLWCAHPDRNIRPSMSQAIQVLKFETAL  617

Query  1795  PDLPETMPVATF  1830
             P+LP  MPV  +
Sbjct  618   PNLPAKMPVPMY  629



>ref|XP_003628853.1| Lectin-domain containing receptor kinase A4.2 [Medicago truncatula]
 gb|AET03329.1| L-type lectin-domain receptor kinase IX.1 [Medicago truncatula]
Length=650

 Score =   539 bits (1388),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 283/607 (47%), Positives = 403/607 (66%), Gaps = 17/607 (3%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSL-VNNSIQITPNQ---RNCIGRATYSEPLHLWDKPTGK  219
             + F    F PS+  NI ++ ++  ++  +    N     + +GR  +S+ + LWD   G+
Sbjct  25    IHFQISHFNPSDA-NIVYQGSAAPIDGEVDFNINDAYYTSQVGRVIFSKKVLLWDSKIGQ  83

Query  220   LSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNPF  399
             L+ F TH+ F+ID+  S++YG G AFFL P G  IPPN+  G  FGL N    +NS++  
Sbjct  84    LTDFTTHYTFIIDTQNSSRYGHGIAFFLVPFGFEIPPNSA-GAFFGLFNT-TTMNSTSNL  141

Query  400   VAVEFDVYLNH-YDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSV  576
             + VEFD Y N  +    +HVGI+ +S+ S V+ PW+  +  G  +E WINY+  + NL+V
Sbjct  142   LHVEFDSYANRPWGETTEHVGINNNSIISSVSTPWNASLHSGETTEVWINYNSTTKNLNV  201

Query  577   VFRNFGSYG-----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISE  741
              ++   +Y       +SY +DL K LPE VT G + +TG       + SW F+S L+ S+
Sbjct  202   SWKYQNTYDPQEKTSISYEIDLIKVLPEWVTIGISASTGSIGEKHKLLSWEFSSTLEQSD  261

Query  742   NQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIF---GNIGELGG  912
             N  +TK T   +++ +  G   +  G++A   L WRK K  ++  ++         +L  
Sbjct  262   NDNNTKRTRLVVILAVTCGIVVMGVGALAIYALLWRKIKRSKKKKEEAMHLRTMNDDLQR  321

Query  913   GAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKE  1092
             GAGP+RFTY+EL  ATN F+   KLG+GGFG+VYKGY  + +  VAVK++SRGS+QG KE
Sbjct  322   GAGPRRFTYQELDLATNKFTDDRKLGQGGFGAVYKGYFFDQDLAVAVKKISRGSRQGKKE  381

Query  1093  YASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKI  1272
             Y +EV+VIS++RH+NLV L+GWCH+  + LLVYEF+ NGSLDSHL+  ++ L+W +R+KI
Sbjct  382   YVTEVKVISQLRHRNLVKLLGWCHDKGEFLLVYEFMPNGSLDSHLFGKRTPLSWSVRHKI  441

Query  1273  VQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALA  1452
                LA  +LYLHEE E+C+VHRDIKSSN+MLDS+ N KLGDFGLA+L+DHE G +TT +A
Sbjct  442   ALGLAFGVLYLHEEWERCVVHRDIKSSNVMLDSSFNVKLGDFGLAKLMDHEIGPQTTVVA  501

Query  1453  GTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAE-ECHVNIVDWVWKLYG  1629
             GT+GY+A E + +GKASKE+D+YSFG+V LEI  GRK ++   + +    +++WVW  +G
Sbjct  502   GTLGYLAPEYISTGKASKESDVYSFGVVALEITTGRKAVEVMRDKDGDKGLIEWVWDHHG  561

Query  1630  TGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPE  1809
              G+LL   D NL  DF+ ++VE ++IVGLWCAHPD SLRPSIRQAIQVLNFE  LP+LP 
Sbjct  562   RGELLVTMDENLRKDFDEKQVECLLIVGLWCAHPDVSLRPSIRQAIQVLNFEIALPNLPL  621

Query  1810  TMPVATF  1830
               P+AT+
Sbjct  622   NRPIATY  628



>ref|XP_007206505.1| hypothetical protein PRUPE_ppa019242mg [Prunus persica]
 gb|EMJ07704.1| hypothetical protein PRUPE_ppa019242mg [Prunus persica]
Length=714

 Score =   541 bits (1394),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 293/614 (48%), Positives = 400/614 (65%), Gaps = 17/614 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRN--C-IGRATYSEPLHLW  201
             ++P    ++F  + F  S+  NI ++  ++ +       N+R   C +G ATY++ + +W
Sbjct  21    LLPYACSINFQINRFE-SSADNIVYQGDAVASVGAVELINRRTYVCRVGWATYAKRVPIW  79

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             D  TGKL+ F+THF+F+ID+ G   YG G AFFLAP+G +IPPN+  GG  GL N     
Sbjct  80    DPDTGKLTDFSTHFSFIIDTTGENPYGHGIAFFLAPVGFQIPPNSA-GGFLGLFNTTTSD  138

Query  382   NSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
              S N    VEFD ++N  +D + +HVGI+ +S+ S VT PW+  I  G  ++ WI Y+  
Sbjct  139   FSGNQIFLVEFDSFVNPEWDPDYEHVGINNNSIYSAVTTPWNASIHSGDITDVWIAYNAT  198

Query  559   SMNLSV-----VFRNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTS  723
             + NLSV        N      + + +DL++ LPE VT GF+  TGK      I SW F S
Sbjct  199   TKNLSVHWSYQATSNPNESTSLFHQIDLKEILPEWVTIGFSAGTGKYGERDTILSWEFNS  258

Query  724   ALDISE---NQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGN  894
              L+  E   N A  K+   GL +   V     +  ++      W K+K RE  +     +
Sbjct  259   TLERKESSGNNAKKKTLVVGLTVSGGVLLIAGVFIALIVRRWKW-KQKQRETLETVNLTS  317

Query  895   IGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRG  1071
             I E L  GAGP+RF+Y +L  ATN+FS + KLGEGGFG+VYKGYL +L+  VAVK++S G
Sbjct  318   INEDLERGAGPRRFSYSDLVTATNNFSNERKLGEGGFGAVYKGYLTDLDIAVAVKKISSG  377

Query  1072  SKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSL-L  1248
             S+QG KEY +EV+VIS +RH+NLV LIGWCH+    LLVYEF+ NGSLD HL+  +S+ L
Sbjct  378   SRQGRKEYITEVKVISSLRHRNLVQLIGWCHDGGQFLLVYEFMPNGSLDIHLFGKRSVVL  437

Query  1249  TWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEK  1428
             +W +RYKI   LASALLYLHE  E+C+VHRD+KSSN+MLDS+ N KLGDFGLARL+DHE 
Sbjct  438   SWAVRYKISLGLASALLYLHEGWEQCVVHRDVKSSNVMLDSSFNVKLGDFGLARLMDHEL  497

Query  1429  GSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVD  1608
             G +TT L GT+GY+A E + +G+ASKE+D+YSFG+V LEIA G++ +D   ++  + +++
Sbjct  498   GPQTTRLVGTIGYLAPEYISTGRASKESDVYSFGVVALEIATGKRSMDRMGKDFEMGLIE  557

Query  1609  WVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEA  1788
             WVW LYG G+L    D  L  ++  ++VE +MIVGLWCAHPD S RPSIRQA QVLNFEA
Sbjct  558   WVWDLYGKGKLFLTVDERLHLEYEEKQVECLMIVGLWCAHPDKSSRPSIRQANQVLNFEA  617

Query  1789  PLPDLPETMPVATF  1830
              LP+LP  MPV  +
Sbjct  618   ALPNLPLKMPVPVY  631


 Score = 86.3 bits (212),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 68/121 (56%), Gaps = 5/121 (4%)
 Frame = +1

Query  1468  IALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLD  1647
             + L C    K+S+ +   +  ++  E A    P+     +  V + +     +G+G L+ 
Sbjct  591   VGLWCAHPDKSSRPSIRQANQVLNFEAALPNLPL-----KMPVPVYEVPTPSFGSGMLVL  645

Query  1648  AADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVAT  1827
             A D  L  + + ++VE +MIVGLWCAHPD +LRPSIRQAIQ LNFEA  P L   MPV  
Sbjct  646   AVDEKLDLEHDEKQVECLMIVGLWCAHPDQNLRPSIRQAIQTLNFEAAFPSLSPKMPVPD  705

Query  1828  F  1830
             +
Sbjct  706   Y  706



>ref|XP_007047720.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
 gb|EOX91877.1| Concanavalin A-like lectin protein kinase family protein [Theobroma 
cacao]
Length=818

 Score =   544 bits (1402),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 298/613 (49%), Positives = 395/613 (64%), Gaps = 18/613 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNC--IGRATYSEPLHLWD  204
             + P V+ ++F    F P N   I ++  +  ++ I    +  N   +G  TY+  + LW+
Sbjct  188   VFPSVNSVNFQISRFEP-NDDRILYQGEASPSDGIIKFNSLGNLFRVGWVTYANRVPLWE  246

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
               TGKLS F+T FAF I+ N  + YG GF FFLAP GS+IPPN+   G  GL N  + ++
Sbjct  247   PKTGKLSDFSTRFAFSININNLSDYGHGFVFFLAPAGSQIPPNSA-AGRLGLFNTSQWVS  305

Query  385   SSNPFVAVEFDVYLNHYDTEQ--KHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
             +    V VEFD   N +D +Q   HVGI+ +S+ S V   W+  I  G  ++  I Y+  
Sbjct  306   TLGQVVLVEFDTNKNSWDPDQLDNHVGINNNSIVSAVYTRWNASIHNGDTADVLITYNAT  365

Query  559   SMNLSVVF-----RNFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTS  723
             + NLS  +      N      +SY +DL K LPE V  GF+ ATG  T   ++ SW F S
Sbjct  366   TKNLSASWSYRATNNPQENSSLSYQIDLMKALPEWVMVGFSAATGVSTEQHILQSWEFNS  425

Query  724   ALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNI--  897
              L+  E    T    K +   +V  G  + G  +       RK+ M+ + +    GN+  
Sbjct  426   TLEREETGRTTARNVKIVEGTVVALGVLVAGTVITLIIFRQRKKNMKRKTEGT--GNLTS  483

Query  898   --GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRG  1071
                +L   AGP+RF+Y +L  ATN+FS+Q KLGEGGFG+VY+GYL +L+  VAVKR+SRG
Sbjct  484   INDDLERRAGPRRFSYSDLVSATNNFSEQRKLGEGGFGAVYRGYLPDLDMVVAVKRISRG  543

Query  1072  SKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLT  1251
             SKQG KEY +EV+VIS++RH+NLV LIGWCH+  + +LVYEF+ NGSLD HL+  KS L+
Sbjct  544   SKQGKKEYVTEVKVISQLRHRNLVQLIGWCHDRSEFILVYEFMPNGSLDFHLFGQKSPLS  603

Query  1252  WPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKG  1431
             WP+RYKI   LASALLYLHEE E+C+VHRDIKSSN+MLDS+ N KLGDFGLARL+DHE G
Sbjct  604   WPVRYKISLGLASALLYLHEEWEQCVVHRDIKSSNVMLDSSFNVKLGDFGLARLMDHELG  663

Query  1432  SRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDW  1611
              +TT LAGT+GY+A E V +G+ASKE+D+YSFG+V LEIA GRK I    E   + +V W
Sbjct  664   PKTTGLAGTLGYLAPEYVSTGRASKESDVYSFGVVLLEIATGRKSIH-RIENFEMGLVAW  722

Query  1612  VWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAP  1791
             VW LYG G+L  A D  L+ + + ++VE +MIVGLWCAHPDC  RPSIRQAIQVLNF+  
Sbjct  723   VWDLYGQGKLPLAVDEKLNKEVDEKQVEYLMIVGLWCAHPDCCSRPSIRQAIQVLNFDIE  782

Query  1792  LPDLPETMPVATF  1830
              P+LP  MPV T+
Sbjct  783   KPNLPMEMPVPTY  795



>ref|XP_004509713.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cicer arietinum]
Length=647

 Score =   538 bits (1386),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 291/598 (49%), Positives = 393/598 (66%), Gaps = 14/598 (2%)
 Frame = +1

Query  73    FTPSNVQNITFERTSLVNNSIQITPNQR-NC-IGRATYSEPLHLWDKPTGKLSSFNTHFA  246
             F PS+   I     S     +    N +  C +GR  YS+ + LWD  TG+L+ F TH+ 
Sbjct  30    FNPSDANLIYQGSASPSEGEVDFNINDKYTCQVGRVMYSKKVLLWDSKTGQLTDFTTHYT  89

Query  247   FVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNPFVAVEFDVYL  426
             FVID+  S  YG G AFFLA  G  IPPN++ GG  GL N     +SSN  V VEFD Y 
Sbjct  90    FVIDTQNSQTYGHGLAFFLATFGIEIPPNSS-GGFLGLFNTTTMDSSSNQIVHVEFDSYA  148

Query  427   N-HYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSVVFRNFGS--  597
             N  +D   +HVGI+ +S++S V+ PW+  +  G  +E WI+Y+  + +LSV ++   +  
Sbjct  149   NSEWDETTQHVGINNNSIKSSVSTPWNASLHSGDVAEVWISYNSTTKDLSVSWKYKSTSI  208

Query  598   ---YGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTKSTg  768
                   +SY +DL+K LPE VT GF+ ATG +     + SW F   LD  ++    +   
Sbjct  209   PQEKTTLSYQIDLKKALPEWVTIGFSAATGYNAEKHNLLSWEFNFTLDKDDDSDSKERRL  268

Query  769   kglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG---ELGGGAGPKRFTY  939
               +V          +G  +A+  L WRKRK  ++  ++         +L  GAGP+RFTY
Sbjct  269   VVIVTVSCGVVVLGMGALVAY-VLFWRKRKRSKKQKEEAMHLTSMNDDLERGAGPRRFTY  327

Query  940   RELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVIS  1119
             +EL  ATNSFS+  KLG+GGFG+VYKGY  +L+  VAVK++SRGS+QG KEY +EV+VIS
Sbjct  328   KELDLATNSFSKDRKLGQGGFGAVYKGYFADLDLPVAVKKISRGSRQGKKEYVTEVKVIS  387

Query  1120  RIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALL  1299
             ++RH+NLV L+GWCH+  + LLVYEF+ NGSLDSHL+  ++ L W +R+KI   L S LL
Sbjct  388   QLRHRNLVKLLGWCHDKGEFLLVYEFMPNGSLDSHLFGKRTPLPWNVRHKIALGLTSGLL  447

Query  1300  YLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALE  1479
             YLHEE E+C+VHRDIKSSN+MLDS+ N KLGDFGLA+L+DHE G +TT LAGT+GY+A E
Sbjct  448   YLHEEWERCVVHRDIKSSNVMLDSSFNVKLGDFGLAKLMDHELGPQTTGLAGTLGYLAPE  507

Query  1480  CVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAE-ECHVNIVDWVWKLYGTGQLLDAAD  1656
              V +G+ASKE+D+YSFGIV LEI  G+K I+   + +    ++DWVW  YG G+LL A D
Sbjct  508   YVSTGRASKESDVYSFGIVALEITTGKKAIEVMKDKDDEKGMIDWVWDHYGRGELLVAMD  567

Query  1657  PNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
              NL  DF+ ++VE +MIVGLWCAHPD + RPSIRQAIQVL+FE  +P+LP   P+AT+
Sbjct  568   ENLKTDFDEKQVECLMIVGLWCAHPDVNHRPSIRQAIQVLHFEVAMPNLPSKRPIATY  625



>ref|XP_002310340.2| hypothetical protein POPTR_0007s14990g [Populus trichocarpa]
 gb|EEE90790.2| hypothetical protein POPTR_0007s14990g [Populus trichocarpa]
Length=652

 Score =   538 bits (1385),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 286/577 (50%), Positives = 386/577 (67%), Gaps = 24/577 (4%)
 Frame = +1

Query  157   NCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNA  336
             N +G ATY E + LWD  +G+LS F +HF+F I++ G+  YG G AFFLAP+G +IPPN+
Sbjct  56    NRVGWATYPERVRLWDSSSGQLSDFTSHFSFTINTQGATNYGHGIAFFLAPVGFQIPPNS  115

Query  337   TKGGGFGLANDDERLNSSNPFVAVEFDVYLNH-YDTEQKHVGIDVDSLQSVVTAPWSPDI  513
               GG  GL N     +  +  V+VEFD + N+ +D +  HVGI+ +S+ S +  PW+   
Sbjct  116   A-GGFLGLFNTTTMQSPQSQIVSVEFDSFPNYGWDPKVGHVGINNNSISSALYTPWNASF  174

Query  514   EGGWGSEAWINYDPRSMNLSVVFRNFGSYGHVS---------YILDLRKYLPERVTFGFA  666
               G  +EAWI Y+    NLSV    F  Y   S         YI+DL K+LPE VT GF+
Sbjct  175   HSGDTAEAWITYNSTDRNLSV----FWEYQTTSDPRENSSLFYIIDLSKFLPEWVTVGFS  230

Query  667   GATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAW  846
              ATG +   Q + SW F S+L++ E + +  S    + I ++V    LI G+     + W
Sbjct  231   AATGSNVEQQRLLSWEFNSSLNVKEMKGNKNSKKSKIKIDVIVPVLVLIAGATTALVILW  290

Query  847   RKRKM----REEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVY  1014
             R+++M    R     ++     +L  GAGP+RF+Y +L  ATN+FS Q KLGEGGFG+VY
Sbjct  291   RRKQMMTRKRAAEKMNVTSINEDLERGAGPRRFSYDDLVSATNNFSDQRKLGEGGFGAVY  350

Query  1015  KGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYE  1194
             +GYL +++  +AVK++SR S+QG KEY +EV+ IS++RH+NLV LIGWCH+  + ++VYE
Sbjct  351   RGYLNDMDMEIAVKKISRSSRQGKKEYITEVKTISQLRHRNLVQLIGWCHDKDEFMVVYE  410

Query  1195  FLSNGSLDSHLYKGKSL--LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLD  1368
             F+SNGSLDSHL+  K +  L+W +RYKI   LASALLYLHEE E+C+VHRD+KSSNIMLD
Sbjct  411   FMSNGSLDSHLFGKKKVNPLSWVVRYKISLGLASALLYLHEEWERCVVHRDVKSSNIMLD  470

Query  1369  SNLNAKLGDFGLARLVDHEK-GSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLE  1545
             S+ N KLGDFGLARL+DH+K G  TT LAGT GY+A E + + +A KE+D+YSFG+V LE
Sbjct  471   SSFNLKLGDFGLARLMDHDKPGPTTTGLAGTFGYMAPEYISTRRAGKESDVYSFGVVALE  530

Query  1546  IACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLS-GDFNG-REVEQMMIVGLW  1719
             IA GRK  DP  +   +++V+W+W LYG G L  A D  L   DF+  ++ E++MIVGLW
Sbjct  531   IASGRKANDPVDQNPEMSLVEWIWDLYGCGHLSLAVDKRLDIKDFDDEKQAERLMIVGLW  590

Query  1720  CAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             CAHPD +LRPSI QAI VLN EA +PDLP  MPV  F
Sbjct  591   CAHPDRNLRPSIGQAIHVLNLEAAIPDLPPKMPVPVF  627



>ref|XP_004292023.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Fragaria vesca subsp. vesca]
Length=953

 Score =   548 bits (1411),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 304/632 (48%), Positives = 395/632 (63%), Gaps = 62/632 (10%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRN-----CIGRATYSEPLHLWDKPT  213
             PL+FNF  F P+   NI+ E  +  + S+++T + R+      +GRAT+ E   L     
Sbjct  30    PLTFNFSSFPPAVTNNISMEGDAFSDGSLRLTKSARDEVINGSVGRATFKETFLL-----  84

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSN  393
                                 + GDG  FFLAP GS +     +G   GL  +    N + 
Sbjct  85    --------------------RSGDGLVFFLAPPGSLLNHTLGQGSSLGLPVNSRLANKTM  124

Query  394   -----PFVAVEFDVYLNHYDTEQK------HVGIDVDSLQSVVTAPWSPDIEGGWGSEAW  540
                  PFVAVEFD++ N+            H GID++SL+S VT PW   I     + A 
Sbjct  125   SSTEYPFVAVEFDIFPNNKSESIDWCLNYVHAGIDINSLKSNVTEPWDGGISTAKENNAT  184

Query  541   INYDPRSMNLSVVFR--NFGSYG-------HVSYILDLRKYLPERVTFGFAGATGKDTAL  693
             I Y+  S NLSV F     G  G        + +++DL +YLP+RV  GF+ +TG   AL
Sbjct  185   ITYNSTSKNLSVAFTTIQIGVDGDEVQMIKSMYFLVDLLRYLPDRVIVGFSASTGNAVAL  244

Query  694   QMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAW----RKRK-  858
               I SW FTS   + +N A T  +       +V  G       +    L W    RKR+ 
Sbjct  245   HKIMSWNFTSTPLLDDNAALTTRSNNNREGLIVGLGVGGGATLVGLLALVWLILYRKRRE  304

Query  859   -MREEFDDDI--FGNI--GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGY  1023
               RE  DDDI    ++   E   G  P +F Y ELA AT++F   +KLGEGGFG VYKG+
Sbjct  305   TARESSDDDISVLNDMIPEEFEKGTVPTKFKYNELALATSNFVHGEKLGEGGFGGVYKGF  364

Query  1024  LKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLS  1203
             +K++ SYVAVK++S GSKQG+KEYA+EV +ISR+RH+NLV LIGWCH+ K LLLVYEF+ 
Sbjct  365   IKDMNSYVAVKKISSGSKQGLKEYAAEVNIISRLRHRNLVQLIGWCHDKK-LLLVYEFMP  423

Query  1204  NGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNA  1383
             NGSLDSHL+  KSLLTW +RYKI   LAS LLYLH+  E+C++HRDIKSSN+MLDSN N 
Sbjct  424   NGSLDSHLFNEKSLLTWEVRYKIAHGLASGLLYLHQGWEQCVLHRDIKSSNVMLDSNFNT  483

Query  1384  KLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRK  1563
             KLGDFGLARLVDH K S+TT +AGT GY+ALE V +GKASK++D+YSFG+V LEIACGRK
Sbjct  484   KLGDFGLARLVDHGKMSQTTIVAGTRGYMALEYVTTGKASKQSDVYSFGVVALEIACGRK  543

Query  1564  PIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSL  1743
             PID   E   V++V+WVW LYG G++++AADP L G F+ +++E +M+VGLWCAHPD ++
Sbjct  544   PIDLNLENTRVDMVEWVWGLYGEGKVIEAADPKLCGYFDEKQMEFLMMVGLWCAHPDYNM  603

Query  1744  RPSIRQAIQVLNFEAPLPDLPETMPVATFWPQ  1839
             RPS++QAIQVLNFE   P LP  MP+ATF PQ
Sbjct  604   RPSMQQAIQVLNFEVAWPFLPLEMPMATF-PQ  634



>ref|XP_010052163.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=706

 Score =   538 bits (1387),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 307/641 (48%), Positives = 408/641 (64%), Gaps = 63/641 (10%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQ---NITFERTSLVNNSIQITPNQRN-----CIGRATYSEPLHLWDK  207
             + F+F +F  S +Q   + T++ +S     IQIT   R+      +G ATY EP+ LWDK
Sbjct  40    IDFSFQIFNDSILQRQGDATYDSSSF----IQITQANRDKVLSASVGWATYHEPMRLWDK  95

Query  208   PTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDER--L  381
              TG ++ F T F F I+S G + + DG  FFL P GS++P N+   G F    D  R   
Sbjct  96    ATGNVADFTTQFTFAINSLGESSFADGLTFFLVPRGSQLPVNSE--GRFLALVDPNRDPS  153

Query  382   NSSNPFVAVEFDVYLNHYD---------TEQKHVGIDVDSLQSVVTA--PWSPD-IEGGW  525
             NSS  FVAVEFD + N+           ++  HVGID+++L S+V++   W  D I  G 
Sbjct  154   NSSTSFVAVEFDTFRNNAPNFNVVDPNCSKVAHVGIDLNNLTSIVSSCVDWFMDKIMNGG  213

Query  526   GSEAWINYDPRSMNLSVVFRNFGSYG------HVSYILDLRKYLPERVTFGFAGATGKDT  687
                A I Y+  + NLSV+  +  + G       +S I+++ KYLPE VTFGF+  TG   
Sbjct  214   RINATIAYNSSTQNLSVLMIDADATGTNINSSAISNIVNMTKYLPEWVTFGFSATTGSLF  273

Query  688   ALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMRE  867
              L  I +W F+S + +    A TKS      I        LI   +  +F+ +R+R  R+
Sbjct  274   ELHTIEAWEFSSNVQV----AGTKSKSWLWSILGSCSFILLI---LVLAFIWFRQRSKRK  326

Query  868   ------EFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLK  1029
                   E +D       E    +GP++FTY++L  AT++F+ +  LGEGGFG VY+GYL 
Sbjct  327   RAYMSGEGEDPAIDE--EFEQVSGPRKFTYKDLVVATDNFAIERLLGEGGFGRVYEGYLT  384

Query  1030  ELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNG  1209
              +   VA+K+++ GS+QGIKEYASEV+ ISR+RH+NLV LIGWCHE K+LLL+YEF+SNG
Sbjct  385   SMSINVAIKKINPGSRQGIKEYASEVKTISRLRHRNLVQLIGWCHEKKELLLIYEFMSNG  444

Query  1210  SLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKL  1389
             SLDSHL+K +S L W  RYKIV  +ASALLYLHEE E+C+VHRDIKSSNIMLDS+ NAKL
Sbjct  445   SLDSHLFKERSFLPWEKRYKIVLGIASALLYLHEEWEQCVVHRDIKSSNIMLDSDFNAKL  504

Query  1390  GDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPI  1569
             GDFGLARLV+H KG +TT LAGTMGY+A E + +GKASKE+D+YSFG+V LEIACGRK I
Sbjct  505   GDFGLARLVEHAKGLQTTVLAGTMGYMAPEFIYTGKASKESDVYSFGVVLLEIACGRKVI  564

Query  1570  DPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRP  1749
             +  A E    +VDWVW+LYG G+LLDAAD  L  DF  +++E +M+VGLWCAHPD + RP
Sbjct  565   ELRANEGQDQLVDWVWELYGIGRLLDAADSKLGTDFVEKQLECLMVVGLWCAHPDHTARP  624

Query  1750  SIRQAIQVLNFEAPL--------------PDLPETMPVATF  1830
             SIR+ + VLNF APL              P +P   P++TF
Sbjct  625   SIREVLNVLNFNAPLPVLPLKLPVPTYLAPLVPTLAPLSTF  665



>ref|XP_008459178.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cucumis melo]
Length=660

 Score =   536 bits (1382),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 280/577 (49%), Positives = 378/577 (66%), Gaps = 19/577 (3%)
 Frame = +1

Query  145   PNQRNCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRI  324
             P     +G A Y + + +WD  TGK++ F THF+F ID+   + +G G AFFLAP G +I
Sbjct  59    PQYFCSVGWAIYKDAVPIWDSQTGKITDFTTHFSFTIDTQQVSNFGHGIAFFLAPPGFQI  118

Query  325   PPNATKGGGFGLANDDERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWS  504
             PPN+  GG  GL N     +S+N  V VEFD + N +D   +HVGI+++SL S     W+
Sbjct  119   PPNSA-GGYLGLFNKTYADSSTNQIVHVEFDTFSNEWDPNFEHVGININSLASSNFTRWN  177

Query  505   PDIEGGWGSEAWINYDPRSMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAG  669
                  G   + WI+Y+  S NLS  ++     N      ++Y +DL K LP+R T GF+ 
Sbjct  178   VSFHSGDIIDVWISYNSTSKNLSASWKYKYTSNSSEDTALNYQIDLMKVLPQRATIGFSA  237

Query  670   ATGKDTALQMINSWIFTSALDISENQADTKSTgkglvig----------lvvggcfligg  819
             +TG       + SW F S+LDI  N     +  KG              +++     +  
Sbjct  238   STGTFLEQHSLFSWEFNSSLDILSNPTSENNNNKGGKFNIVVVVVTPLGVLMMIIAAVSF  297

Query  820   SMAFSFLAWRKRKMREEFDDDI-FGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGE  993
             ++ F  L   KRK  EE  +++   +I E    GAGP+RF+ + LA ATN+FS + KLGE
Sbjct  298   TLVFRRLKQNKRKAEEENVEEVKLTSINEDFERGAGPRRFSRKLLAMATNNFSNKRKLGE  357

Query  994   GGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENK  1173
             GGFG+VY+GYL +++S VAVK+VSRGSKQG KEY +EV++ISR+RH+NLV LIGWCH+  
Sbjct  358   GGFGAVYRGYLPDIDSTVAVKKVSRGSKQGRKEYITEVKIISRLRHRNLVQLIGWCHDKG  417

Query  1174  DLLLVYEFLSNGSLDSHLY-KGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKS  1350
             + LLVYE++ NGSLD HL+ +  S L W  RY I   LASALLYLHEE E+C++HRDIKS
Sbjct  418   EFLLVYEYMPNGSLDFHLFGRRSSHLAWGTRYNIALGLASALLYLHEEWEQCVIHRDIKS  477

Query  1351  SNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFG  1530
             SNIMLDS+ N KLGDFGLARL+DH+ G++TT L GT+GY+A E + +GKASKE+DIYSFG
Sbjct  478   SNIMLDSSFNVKLGDFGLARLIDHDLGAQTTGLVGTLGYLAPEYISTGKASKESDIYSFG  537

Query  1531  IVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIV  1710
             +V LEI  GR       EE H  +V+WVW LYG+G+LL A D  L  D++ ++VE++M++
Sbjct  538   VVVLEIVTGRMSRTVIEEESHKGLVEWVWDLYGSGRLLVAVDEKLQSDYDKQQVERLMLI  597

Query  1711  GLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPV  1821
             GLW AHPD +LRPSI+QAIQVLNFE  +P+LP  MP+
Sbjct  598   GLWSAHPDPNLRPSIKQAIQVLNFETRIPNLPTEMPI  634



>ref|XP_010065734.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
 ref|XP_010065735.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Eucalyptus grandis]
Length=681

 Score =   536 bits (1382),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 295/612 (48%), Positives = 391/612 (64%), Gaps = 25/612 (4%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPNQR-----NCIGRATYSEPLHLWDKPT  213
             +SFNF  F   N + ITF+   S++N+ IQ+T  +        +GRA Y +P+HLWD  T
Sbjct  38    ISFNFPSFQ-LNDERITFQGNASVLNSIIQLTIGEPLEEPIYIVGRALYHQPMHLWDSST  96

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLA-NDDERLNSS  390
             G ++ F + F F I+S     + DGF FFLAP GS+IP   ++GG  GL  ++    NSS
Sbjct  97    GNVADFVSQFTFSINSRMKPLHADGFVFFLAPSGSQIP-ERSEGGFLGLTGSNPNSTNSS  155

Query  391   NPFVAVEFDVYLNH----YDTEQKHVGIDVDSLQSV--VTAPWSPD-IEGGWGSEAWINY  549
              PFVAVEFD + NH    +D    HVGIDV+SL SV      W  D I  G    A + Y
Sbjct  156   TPFVAVEFDTFYNHSTNPWDPLCYHVGIDVNSLTSVSNTCVSWMNDKILLGQRLHAQVTY  215

Query  550   DPRSMNLSVVFRNFG-SYGHVSY-ILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTS  723
             + R+MNLSVVFR+   +Y  + Y  ++L KYLPE V FGFA  TG+      I SW F S
Sbjct  216   NSRAMNLSVVFRDDADNYTSLYYHPINLTKYLPEWVVFGFAATTGQLFEAHTIFSWEFNS  275

Query  724   ALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEF---DDDIFGN  894
             +L       D KS        L +     +     F +  ++  +   +    ++D+   
Sbjct  276   SL----RTLDKKSKSWVKGAILGLISLVFLILVAGFGWYGYKLTRNGNDHSGEEEDVLTV  331

Query  895   IGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGS  1074
                     GPK+++Y+ LA ATN+F+    LG GGFG VY+G+L + +S+VA+K+++  S
Sbjct  332   DEGFEQSKGPKKYSYKVLAVATNNFANSRLLGAGGFGEVYEGHLADAKSHVAIKKITPNS  391

Query  1075  KQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTW  1254
             KQGIKEYA+EV+ I  +RHKNLV LIGWCHE  + LL+YEF++NGSLDSHL+K K  LTW
Sbjct  392   KQGIKEYATEVKTIRHLRHKNLVELIGWCHEKNEFLLMYEFMANGSLDSHLFKDKIPLTW  451

Query  1255  PLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGS  1434
               RY I Q +A  L YLHE+ + C+VHRDIKSSNI+LD++  AKLGDFGLAR+ DH KGS
Sbjct  452   ERRYNIAQGIALGLKYLHEDLKHCVVHRDIKSSNILLDTHFEAKLGDFGLARMFDHAKGS  511

Query  1435  RTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWV  1614
             +TT  AGT+GY+A EC+  GKASKE+DIYSFG+V LEI+CGRK ID  A E  V +V+WV
Sbjct  512   QTTVSAGTLGYLAPECIYKGKASKESDIYSFGVVLLEISCGRKAIDLRASEDQVQLVEWV  571

Query  1615  WKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPL  1794
             W+LYG G+LL+AADP L   F+ R++E +MIVGLWCAHPD   RP I +AI  LNF+A  
Sbjct  572   WELYGIGKLLNAADPKLGKIFDTRQIECLMIVGLWCAHPDPKERPPISRAIAFLNFDASP  631

Query  1795  PDLPETMPVATF  1830
             P LP  +P+ T+
Sbjct  632   PILPLKLPIPTY  643



>ref|XP_004148108.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cucumis sativus]
 ref|XP_004156775.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cucumis sativus]
 gb|KGN63410.1| hypothetical protein Csa_2G439180 [Cucumis sativus]
Length=650

 Score =   535 bits (1378),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 278/581 (48%), Positives = 380/581 (65%), Gaps = 30/581 (5%)
 Frame = +1

Query  145   PNQRNCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRI  324
             P   + +GR  Y + + +WD  T KL+ F+THF F ID+    KYG G AFFLAP  S+I
Sbjct  59    PKSYSHVGRVIYKDTIPIWDSKTRKLTDFSTHFTFSIDTQNRTKYGSGIAFFLAPPDSQI  118

Query  325   PPNATKGGGFGLANDDERLNSSNPFVAVEFDVYLN-HYDTEQKHVGIDVDSLQSVVTAPW  501
             P N+  GG  GL N   +    N  + VEFD ++N  +D   +HVGI+++S+ S  T  +
Sbjct  119   PTNSA-GGYLGLYNKTYKNTPINQILHVEFDTHINDEWDPSYEHVGININSVSSSNTTHF  177

Query  502   SPDIEGGWGSEAWINYDPRSMNLSVVFRNFGSYGHV-----SYILDLRKYLPERVTFGFA  666
             +  +  G  ++ WI+Y   + NLSV ++   +   +     SY +DLR  LPE VT G  
Sbjct  178   NVTLHSGDLADVWIDYSSTTKNLSVSWKYQKTSTSLENTTLSYHIDLRDILPEWVTVGIT  237

Query  667   GATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAW  846
             GA G +     + SW F S LD+ +   D+ +    +V   V  G  +I   + F+ L W
Sbjct  238   GANGANVERHTLFSWEFNSTLDMKQPSKDSGNKVTVIVGVTVSVGVLII---VLFAVLWW  294

Query  847   RKRKMRE-------------EFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKL  987
              KRK R+               +DD       L  GAGP+RF+++ LA ATN+FS + KL
Sbjct  295   LKRKKRKLGEEENLEEVNLTSINDD-------LETGAGPRRFSHKLLAMATNNFSNERKL  347

Query  988   GEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHE  1167
             GEGGFG+VY+GY+  ++  VAVK++SRGS+QG  EY +EV++ISR+RH+NLV LIGWCH+
Sbjct  348   GEGGFGAVYRGYIPSIDLTVAVKKISRGSRQGRNEYITEVKIISRLRHRNLVQLIGWCHD  407

Query  1168  NKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIK  1347
               + LLVYEF+SNGSLDSHL+  ++ L W +RYKI   LASALLYLHEE E+C+VHRDIK
Sbjct  408   KGEFLLVYEFMSNGSLDSHLFGKRTPLGWTVRYKIALGLASALLYLHEEWEQCVVHRDIK  467

Query  1348  SSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSF  1527
             SSN+MLDSN N KLGDFGLARL++HE G+RTT LAGT+GY+A E + + +ASKE+D++SF
Sbjct  468   SSNVMLDSNFNVKLGDFGLARLMEHELGARTTRLAGTLGYLAPEYISTNRASKESDVFSF  527

Query  1528  GIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMI  1707
             G+V LEIA G+K      EE H  +V+WVW LYG+GQL    D  L  D++ ++VE +M+
Sbjct  528   GVVALEIATGKKSRTSLEEESHKGLVEWVWDLYGSGQLHVGIDEKLHSDYDKKQVECLML  587

Query  1708  VGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             VGLW A+PD +LRPSI+Q IQVL+FE  +P+LP  MPV T+
Sbjct  588   VGLWSAYPDPNLRPSIKQVIQVLSFETMMPNLPNKMPVPTY  628



>ref|XP_008459179.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cucumis melo]
Length=651

 Score =   535 bits (1378),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 290/613 (47%), Positives = 404/613 (66%), Gaps = 17/613 (3%)
 Frame = +1

Query  34    IPL-VHPLSFNFDLFTPSNVQNITFERTSLV-NNSIQITPNQRNC-IGRATYSEPLHLWD  204
             +PL V  +SF  D F   +   I ++  ++V    I ++  + +C +GRA Y +P+ +WD
Sbjct  20    LPLSVISVSFKIDQFKTDD-NTILYQGDAVVLGGEILLSDPEFSCHLGRAIYKDPIQIWD  78

Query  205   KPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
               T KL+ F THF F ID+  + KYG GFAFFLAP G +IPPN+  GG  GL N     +
Sbjct  79    SETAKLTDFTTHFTFTIDTQKNTKYGQGFAFFLAPSGFQIPPNSA-GGFLGLYNKTYSNS  137

Query  385   SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSM  564
              +N  V VEFD   N +D   +HVGI+++S+ S     W+  +  G  ++ WI+Y+    
Sbjct  138   VTNQIVHVEFDTGSNDWDPPYEHVGININSVTSSNDTRWNVSLHSGDLADVWISYNSTIK  197

Query  565   NLSVVFRNFGSYG-----HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSAL  729
              LSV +    +        +SY +DL   LP++ T GF+ ATG       ++SW F S L
Sbjct  198   ILSVSWLYLKTSTLLENTTLSYPIDLMTVLPQQATVGFSAATGALLERHAVSSWEFNSTL  257

Query  730   DISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG---  900
             D+      T +    +V   V  G  ++ G + F  L WR ++ + + D +    +    
Sbjct  258   DLKPTSKSTGNNVSVIVGVTVPVGGLILVGIIVFVIL-WRLKQKKRKTDQENLEEVNLTS  316

Query  901   ---ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRG  1071
                +L  GAGP+RF+++ LA ATN+FS + KLGEGGFG+VY+GY+++L+  +AVK++SRG
Sbjct  317   INDDLERGAGPRRFSHKLLAMATNNFSNERKLGEGGFGAVYRGYIQDLDLNIAVKKISRG  376

Query  1072  SKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLT  1251
             S+QG KEY +EV++ISR+RH+NLV LIGWCH+  + LLVYEF+SNGSLDSHL+  ++ L 
Sbjct  377   SRQGRKEYITEVKIISRLRHRNLVQLIGWCHDKGEFLLVYEFMSNGSLDSHLFGKRTPLA  436

Query  1252  WPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKG  1431
             W +RYKIV  L SALLYLHEE E+C+VHRDIKSSNIMLDSN N KLGDFGLARL+DHE G
Sbjct  437   WTVRYKIVLGLGSALLYLHEEGEQCVVHRDIKSSNIMLDSNFNVKLGDFGLARLMDHELG  496

Query  1432  SRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDW  1611
             ++TT L GT+GY+A E + +G+ASKE+D++SFG+V LEIA GR       +E H  +V+W
Sbjct  497   AQTTGLVGTLGYLAPEYINTGRASKESDVFSFGVVALEIATGRVSRTSMEKESHKGLVEW  556

Query  1612  VWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAP  1791
             VW LYG+GQLL+  D  L  +F+ ++VE +MIVGLW A+PD S RPSI+Q IQVLNFEA 
Sbjct  557   VWDLYGSGQLLEGVDAKLQSNFDKKQVECLMIVGLWSAYPDPSFRPSIKQVIQVLNFEAT  616

Query  1792  LPDLPETMPVATF  1830
             +P+LP  MP+ T+
Sbjct  617   VPNLPNKMPIPTY  629



>ref|XP_010919002.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Elaeis guineensis]
Length=684

 Score =   535 bits (1379),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 299/610 (49%), Positives = 395/610 (65%), Gaps = 32/610 (5%)
 Frame = +1

Query  58    FNFDLFTPSNVQNITFERTSLV--NNSIQITPNQRN-----CIGRATYSEPLHLWDKPTG  216
             FNF  FTP N   I F   +    +N IQ+T N  +       G A Y+ P+ LW+  T 
Sbjct  31    FNFTSFTP-NTPGINFSGDAFTSGDNVIQLTRNSADGSLLQSSGHAVYATPIQLWNPATL  89

Query  217   KLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNP  396
              ++ F THF F+I +     YGDG AFF+AP+G  +P N + G   GL N     + S  
Sbjct  90    AIADFTTHFRFIIKALHPTTYGDGLAFFIAPVGYELPLN-SNGSWLGLFNSTTNNSISTQ  148

Query  397   FVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSV  576
              VAVEFD ++N +D +  H+GI+V+S+ S VT  W  DI+      A I Y+  S  LSV
Sbjct  149   LVAVEFDTFMNSWDPDDNHIGINVNSIVSNVTLTWGSDIKNESTGSARIGYNSTSGQLSV  208

Query  577   VFRNFGSYGHVSY--------ILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALD  732
                 F +YG   Y         L+L + LPERV  GF+ +TG  T L  I SW F+S+  
Sbjct  209   ----FLTYGDDRYNGTPSLWRRLNLTEVLPERVIIGFSASTGGLTELHQIISWDFSSSF-  263

Query  733   ISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFD---DDIFGNIGE  903
             +++ +A +K   K   +   V     +  +  F +  + K+K RE+     D +F    E
Sbjct  264   VNDQEAPSKKMRKKTPLVAAVVVGVGLMVA-CFGYFLFIKKKSREKGGKEADLVFNESME  322

Query  904   --LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELES----YVAVKRVS  1065
               L  G GP+RFTY+EL RAT +FS++ KLG+GGFG VY G LK   S     VAVKR S
Sbjct  323   DKLAEGTGPRRFTYKELVRATRNFSEEGKLGQGGFGGVYMGLLKGNPSSEMVMVAVKRFS  382

Query  1066  RGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSL  1245
             RGS QG KEY SEV +I R+RH+NLV LIGWCH+N + LLVYE++ NGSLD++L+  KS 
Sbjct  383   RGSSQGRKEYVSEVTIIGRLRHRNLVRLIGWCHDNGEFLLVYEYMPNGSLDAYLFGKKSS  442

Query  1246  LTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHE  1425
             L+WP+RY+IV  LASALLYLHEE E+C+VHRDIK+SN+MLDS+ NAKLGDFGLARLVDHE
Sbjct  443   LSWPVRYRIVLGLASALLYLHEEWEQCVVHRDIKASNVMLDSSFNAKLGDFGLARLVDHE  502

Query  1426  KGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIV  1605
              GS+TT LAGT+GY+A ECV +GKA +E+D+YSFG+V LE+ACGRK IDP AEE    +V
Sbjct  503   LGSQTTVLAGTLGYLAPECVTTGKAGRESDVYSFGVVVLEVACGRKAIDPKAEEVEQRLV  562

Query  1606  DWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFE  1785
             DWVW+LY  G++++AAD  L G+ + R++E++  +GLWCA PD  LRPS+RQ +QVL  E
Sbjct  563   DWVWELYERGRVVEAADGRLEGELDERQMERVTALGLWCAQPDYKLRPSMRQVVQVLTAE  622

Query  1786  APLPDLPETM  1815
             AP+P LP+ M
Sbjct  623   APVPSLPKPM  632



>ref|XP_009420627.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Musa acuminata subsp. malaccensis]
Length=671

 Score =   535 bits (1377),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 295/571 (52%), Positives = 377/571 (66%), Gaps = 22/571 (4%)
 Frame = +1

Query  115   SLVNNSIQITP-NQRNCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDS-NGSAKYGDG  288
             SL N  + +T       +GRA Y EPL LWD  TG+L+ F T F+FVIDS   ++ +GDG
Sbjct  50    SLQNKEVNLTSYPMLYSVGRAVYREPLRLWDAATGELADFTTQFSFVIDSFEPASTHGDG  109

Query  289   FAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDV  468
              AFFL+   + IP   ++G   GL  +     S+   VAVEFD + N +D    HVGIDV
Sbjct  110   LAFFLSSYPTSIPA-YSRGAFLGLFGNSSLDGSTASTVAVEFDTFPNAWDPPADHVGIDV  168

Query  469   DSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSV--------VFRNFGSYGHVSYILD  624
             DS+ S     WS  +  G  +  W++Y+  + NLSV         FR   S  H  +++D
Sbjct  169   DSINSSAVVEWSSSLRNGRRANVWVSYNASTYNLSVFLTYETNPAFRAGDSSLH--FVVD  226

Query  625   LRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggc  804
             LR  LPE V  GF+ +TG  T    + SW F S L     Q   K     L IGL +G  
Sbjct  227   LRDVLPEMVAIGFSASTGNATETHSLLSWSFDSTL-----QPRRKKNKVCLKIGLAIGVG  281

Query  805   fliggSMAFSFLAWRKRKMREEFD-DDIFGNIG---ELGGGAGPKRFTYRELARATNSFS  972
              L+  S    F+  +K   R+  + DDI  +     E     GP+RF Y ELA AT +FS
Sbjct  282   VLMLVSGLVWFVFSKKASSRDLKEIDDIECDEAIDDEFERERGPQRFPYEELASATRNFS  341

Query  973   QQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLI  1152
             ++ KLGEGGFGSVYKGYLK+L+  VA+KRVSR SKQG KEY SEV++ISR+RH+NLV L+
Sbjct  342   KEGKLGEGGFGSVYKGYLKDLKLDVAIKRVSRCSKQGRKEYVSEVKIISRLRHRNLVQLV  401

Query  1153  GWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIV  1332
             GWCH+ ++ LLVYEF+ NGSLDS+LY  K  L WP R+KI   LA+ALLYLHEE E+C+V
Sbjct  402   GWCHDRREFLLVYEFMPNGSLDSYLYSTKKNLQWPERHKIALGLAAALLYLHEEWEQCVV  461

Query  1333  HRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKET  1512
             HRD+K SN+MLDS  NAKLGDFGLARLVDH+  S+TT LAGTMGY+A EC+ +GKASKE+
Sbjct  462   HRDVKPSNVMLDSTFNAKLGDFGLARLVDHDSHSQTTVLAGTMGYLAPECITTGKASKES  521

Query  1513  DIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREV  1692
             D+YSFGIV LEIACGR+P++P  ++  V +V+WVW+LYG   +L+AAD  L GDF+G+ +
Sbjct  522   DVYSFGIVALEIACGRRPVEPKEQKSKVRLVEWVWELYGRRSILEAADEKLHGDFDGKRM  581

Query  1693  EQMMIVGLWCAHPDCSLRPSIRQAIQVLNFE  1785
             E +M+VGLWCAHPDC LRPSIRQAI  LN E
Sbjct  582   ECLMVVGLWCAHPDCGLRPSIRQAINALNLE  612



>gb|KCW63377.1| hypothetical protein EUGRSUZ_G01016, partial [Eucalyptus grandis]
Length=644

 Score =   533 bits (1373),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 291/611 (48%), Positives = 398/611 (65%), Gaps = 27/611 (4%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFE-RTSLVNNSIQIT---PNQR-NCI-GRATYSEPLHLWDKPT  213
             +SFNF  F   N Q I F+   +++N  IQ+T   P +   C+ GRA Y++P+HLWD  T
Sbjct  30    ISFNFPSFQ-LNDQRIDFQGNATVLNFIIQLTLGAPMESPTCVVGRAIYNQPMHLWDSST  88

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSN  393
             G ++ F THF F IDS+ +  + DG  FFLAP GS+I  + ++G   GL+ +    NSS 
Sbjct  89    GNVADFVTHFTFAIDSHMNFSHADGLVFFLAPNGSQISAH-SEGRFLGLSANLSSTNSST  147

Query  394   PFVAVEFDVYLNH----YDTEQKHVGIDVDSLQSV--VTAPWSP-DIEGGWGSEAWINYD  552
              FVAVEFD + +H    +D    HVGI+V+S+ SV      W   +I  G    A + YD
Sbjct  148   AFVAVEFDTFYDHSTNTWDPLCDHVGINVNSVASVSKTCVSWMDYNIRHGQELHAQVTYD  207

Query  553   PRSMNLSVVFRNFGSYGHVSYI--LDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
              R+MNLSV+F +        Y   L+L +YLPE V FGF+  TG+      I SW F S+
Sbjct  208   SRAMNLSVIFGDDAENSVSLYYQPLNLTEYLPEWVVFGFSATTGQLFEAHSIFSWEFNSS  267

Query  727   LDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEF---DDDIFGNI  897
             L I +    T +T      G+  G          F +  +R ++ R +    ++++    
Sbjct  268   LRILDTVNGTTNTVNTPDGGMTRGKKR-------FGWYGYRLKRNRTDQSGEEENVPRMD  320

Query  898   GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSK  1077
              E     GPK+++Y+ LA AT++F+    LG+GGFG VY+G+L +++S+VA+K+++  SK
Sbjct  321   EEFEQSKGPKKYSYKVLAIATDNFANARLLGKGGFGGVYEGHLVDVDSHVAIKKITPNSK  380

Query  1078  QGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWP  1257
             QG+KEYA+EV+ I  +RHKNLV L+GWCHE  + LLVYEF+SNGSLDSHL++ K+ LTW 
Sbjct  381   QGVKEYATEVKTIRHLRHKNLVELVGWCHERNNFLLVYEFMSNGSLDSHLFEDKAPLTWE  440

Query  1258  LRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSR  1437
              RY I Q +A  L YLHE+ ++C++HRDIKSSNI+LD++  AKLGDFGLAR+VDH KGS+
Sbjct  441   KRYNIAQGVAFGLKYLHEDLKQCVMHRDIKSSNILLDAHFEAKLGDFGLARIVDHAKGSQ  500

Query  1438  TTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVW  1617
             TT +AGTMGY+A EC+   KASKE+DIYSFG+V LEIACGRK I+  A E  V +V+WVW
Sbjct  501   TTLVAGTMGYLAPECIYMSKASKESDIYSFGVVLLEIACGRKAIEQRASEDQVRLVEWVW  560

Query  1618  KLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLP  1797
             +LYGTG+LLD ADP L  +FN R++E  MIVGLWC HPD + RP I +AI  LNF+A  P
Sbjct  561   ELYGTGKLLDVADPKLGENFNARQMECSMIVGLWCIHPDPNERPPISKAISFLNFDASPP  620

Query  1798  DLPETMPVATF  1830
              LP  MP+ T+
Sbjct  621   ILPPKMPIPTY  631



>ref|XP_009131168.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Brassica rapa]
Length=653

 Score =   533 bits (1374),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 293/615 (48%), Positives = 397/615 (65%), Gaps = 17/615 (3%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNC-IGRATYSEPLHLWDK  207
              +P V  + FN   F  S++  + ++  +  N ++++T     C  G ATY + + LWD 
Sbjct  13    FLPFVCSVHFNIPRFG-SDIPEVVYQGDARANGAVELTNIDYTCRSGWATYGKKIPLWDP  71

Query  208   PTGKLSSFNTHFAFVIDSNGSA--KYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
               GK S F T F+F ID+ G A   YG GFAFFLAP G ++PPN+  GG  GL N+   L
Sbjct  72    EIGKPSDFTTSFSFRIDTRGVAFGNYGHGFAFFLAPAGIQMPPNSA-GGFLGLFNETNVL  130

Query  382   NSSNPFVAVEFDVYLN-HYDT--EQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
             +SS P V VEFD + N ++D      HVGI+ +SL S     W+            I YD
Sbjct  131   SSSYPLVHVEFDTFTNTNWDPLDMTSHVGINNNSLVSSNVTSWNASTHSRDIGRVVIVYD  190

Query  553   PRSMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
                 NLSV +R     +      +SYI+DL K LP  VT GF+  +G  T    + SW +
Sbjct  191   SARRNLSVSWRYDTTSDPKENSSLSYIIDLSKVLPSEVTVGFSATSGGSTEGNRLLSWEY  250

Query  718   TSALD-ISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGN  894
             +S+L+ I ++  +     +  +I  V    F++   +  S + + KRK R E   ++   
Sbjct  251   SSSLELIRDDDVEKTEKDRKGLIIGVSASGFVLLTFLTVSLVVFLKRKKRAEEIANLTSI  310

Query  895   IGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGS  1074
               +L  GAGP++FTYRELA A N+FS+  KLGEGGFG+VYKGYL  L+  VAVK+ + GS
Sbjct  311   NEDLERGAGPRKFTYRELASAANNFSEDRKLGEGGFGAVYKGYLNGLDMMVAVKKFAGGS  370

Query  1075  KQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTW  1254
             KQG +E+ +EV++IS +RH+NLV LIGWCHE  + L+VYEF+ NGSLD+HL+  K  L W
Sbjct  371   KQGKREFITEVKIISSLRHRNLVQLIGWCHEKDEFLMVYEFMPNGSLDAHLFGKKPHLAW  430

Query  1255  PLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGS  1434
             P+R K+   +ASALLYLHEE E+C+VHRDIK+SN+MLDSN NAKLGDFGLARL+DHE G 
Sbjct  431   PVRCKVTLGIASALLYLHEEWEQCVVHRDIKASNVMLDSNFNAKLGDFGLARLMDHELGP  490

Query  1435  RTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAE--ECHVNIVD  1608
             +TT LAGT GY+A E + +G+ASKE+D+YSFG+VTLEI  GRK +DP     E   ++V+
Sbjct  491   QTTGLAGTFGYMAPEYISTGRASKESDVYSFGVVTLEIVTGRKSVDPRQGRVEPETSLVE  550

Query  1609  WVWKLYGTGQLLDAADPNLSGD-FNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFE  1785
              VW LYG G+++ A D  L  D F+ ++ E +M+VGLWCAHPD + RPSI+QAIQVL+FE
Sbjct  551   RVWDLYGRGEVVTAVDDKLGVDSFDEKQAECLMVVGLWCAHPDRNSRPSIKQAIQVLSFE  610

Query  1786  APLPDLPETMPVATF  1830
             APLP LP  MPVA++
Sbjct  611   APLPHLPSKMPVASY  625



>ref|XP_010905487.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Elaeis guineensis]
Length=684

 Score =   535 bits (1377),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 314/642 (49%), Positives = 395/642 (62%), Gaps = 49/642 (8%)
 Frame = +1

Query  34    IPLVHPLSFNF---DLFTPSNVQNITFE-RTSLVNNSIQITPNQ-----RNCIGRATYSE  186
             IPLV+PLSF +    L  P    N+ F    +  NN+IQ+T  Q      N  G ATY +
Sbjct  23    IPLVNPLSFKYTGNQLDEP----NLNFSGDATFGNNAIQLTKAQWGSQIGNSSGSATYPQ  78

Query  187   PLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAN  366
              + LWDK +G L++F T+F+F  D   +   GDG AFFL+P     PPN ++GGGFGL N
Sbjct  79    RVPLWDKVSGMLANFTTNFSFAFDKGETDNGGDGLAFFLSPFPFEAPPN-SRGGGFGLFN  137

Query  367   DDERLNSSNPFVAVEFDVY--LNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAW  540
                   S N  VAVEFD Y  L   DT   HVGID+ SL+S      +  IE      A 
Sbjct  138   ----ATSENNVVAVEFDSYRNLEFNDTFTIHVGIDIRSLRSKKQLYLNNGIERIVQFNAS  193

Query  541   INYDPRSMNLSVVFRNFGSYG---HVSYILDLRKYLPERVTFGFAGATGKDTALQMINSW  711
             + YD  + NLS+   N         +S ++DLR YLPE VT GF+G+TG    L  I +W
Sbjct  194   VGYDAITRNLSIFVSNASDPRMNWSLSDVVDLRDYLPEYVTIGFSGSTGASIELHSIYAW  253

Query  712   IFTSA----LDISENQ----------ADTKSTgkglviglvvggcfliggSMAFSFLAWR  849
              F S+     D++ N           A  KS    +V   V  G  L G  + +S + W 
Sbjct  254   EFNSSNLSSQDLAPNAGPSPSNETSVAKKKSKMGLVVGLAVGTGILLCGLGLVWSAV-WH  312

Query  850   KRK---------MREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGF  1002
             KR            E   +    N  E GGG  PK+F+Y  LA AT +F ++ KLGEGGF
Sbjct  313   KRARGGMEAEEEEEEMALELSINNAFERGGG--PKKFSYSALAIATRNFVKEAKLGEGGF  370

Query  1003  GSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLL  1182
             G VY G L + +  VA+KR+SR SKQG KEY +EV +ISR+RH+NLV LIG+CHE  DLL
Sbjct  371   GEVYMGVLHDTKQEVAIKRISRDSKQGKKEYIAEVSIISRLRHRNLVQLIGYCHERGDLL  430

Query  1183  LVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIM  1362
             LVYE++ N SLD HLY  + LLTWP RYKI   LASALLYLHEE E+C+VHRD+K SN+M
Sbjct  431   LVYEYMPNKSLDYHLYSEERLLTWPERYKIAFGLASALLYLHEEWEQCVVHRDVKPSNVM  490

Query  1363  LDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTL  1542
             LDS  NAKLGDFGLARLVDHE   +TT +AGT GYIA E   +GKASKE+D+YSFG+V L
Sbjct  491   LDSGFNAKLGDFGLARLVDHESNMQTTVMAGTRGYIAPEYATTGKASKESDVYSFGVVLL  550

Query  1543  EIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWC  1722
             EIACGRKPID   +   +N+V+W+W+LYG    L A D  L  +F  +++E+ MIVGLWC
Sbjct  551   EIACGRKPIDVKEKPNKINLVEWIWELYGKNMCLTAVDKGLKMEFEEKQMERFMIVGLWC  610

Query  1723  AHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFWPQRNV  1848
              +PD +LRPSIRQAI VL F+APLPDLP  MPVA F+P  ++
Sbjct  611   VYPDHNLRPSIRQAINVLKFDAPLPDLPPKMPVAMFFPPMDI  652



>gb|ACL53102.1| unknown [Zea mays]
 gb|AFW84901.1| putative lectin-domain receptor-like protein kinase family protein 
[Zea mays]
Length=679

 Score =   534 bits (1375),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 292/623 (47%), Positives = 397/623 (64%), Gaps = 39/623 (6%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQ--NITFERTSLVNNSIQITPNQR-----NCIGRATYSEPLHLWDK  207
             P SF ++  +PS+     I F+  +  N +I++T ++R     +  GRA YS  + L D 
Sbjct  27    PFSFTYNFTSPSDTPPPGIAFQGDAFYNKAIRLTRDERLGPITSSTGRAFYSHAVPLADP  86

Query  208   PTGKLSSFNTHFAFVIDS-NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
              + + +SF T FAF I + + ++  GDG AFFL+P  S +P  ++ GG  GL N      
Sbjct  87    VSRRPASFVTAFAFSIAAPDPASASGDGLAFFLSPFPSVLP-ESSAGGLLGLFNSSS--V  143

Query  385   SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSM  564
              +   VAVEFD + N +D    HVG+D+  + S  TA W   ++ G  + A + YD  + 
Sbjct  144   RAGTLVAVEFDTHKNEWDPSGDHVGVDLGGIVSSATADWPTSMKDGRTAHARVEYDGVAK  203

Query  565   NLSVVFRNFGSYGHVS----------YILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             NL+V      SYG             Y +DLR +LP+ V  GF+ ATG+   L  +  W 
Sbjct  204   NLTVSL----SYGSARPNTTGDVLLWYAVDLRDHLPDSVAVGFSAATGEAAELHQVLYWE  259

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMRE----EFDDD  882
             FTS +D  E     ++    +V+GL      L+G  + +    WRK    +    E DD 
Sbjct  260   FTSTVDPKE-----ETVVLWVVLGLCALLLVLVGAGIVWFVRQWRKAGQFDDGDIEVDDV  314

Query  883   IFGNIGELGG----GAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVA  1050
             + G   EL        GP+RF Y ELA AT +F+++ KLG+GGFG+VY+G+LKEL   VA
Sbjct  315   MGGEYDELADEFVVQCGPRRFRYAELAAATKNFAEERKLGQGGFGAVYRGFLKELGFEVA  374

Query  1051  VKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENK-DLLLVYEFLSNGSLDSHL  1227
             +KRVS+GS QG KEYA+EVR+IS++RH++LV L+GWCHE++ D LLVYE + NGS+D HL
Sbjct  375   IKRVSKGSTQGRKEYAAEVRIISQLRHRHLVRLVGWCHEHRGDFLLVYELMPNGSVDHHL  434

Query  1228  YKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLA  1407
             Y    LLTWP+RY I   LASA+LYLHEEC +CIVHRD+K SN+MLD+  NAKLGDFGLA
Sbjct  435   YGKGMLLTWPMRYDISLGLASAMLYLHEECPQCIVHRDVKPSNVMLDAAFNAKLGDFGLA  494

Query  1408  RLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEE  1587
             +LV+H     TT LAGT+GY+A ECV++GKAS+E+D+YSFG+V LEIACGR+P +   E 
Sbjct  495   KLVEHGSQPYTTVLAGTLGYLAPECVMTGKASRESDVYSFGVVALEIACGRRPAELNNEP  554

Query  1588  CHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAI  1767
                 +V WVW+LYG   LL+AAD  L G F+ +++E++MIVGLWCAHPD + RPSIRQA+
Sbjct  555   SKARLVPWVWELYGKNALLEAADWRLKGQFDEKQMERLMIVGLWCAHPDYAHRPSIRQAL  614

Query  1768  QVLNFEAPLPDLPETMPVATFWP  1836
              VL FEAPLP LPE MPV T++P
Sbjct  615   NVLTFEAPLPVLPEKMPVPTYFP  637



>ref|XP_006856581.1| hypothetical protein AMTR_s00046p00197110 [Amborella trichopoda]
 gb|ERN18048.1| hypothetical protein AMTR_s00046p00197110 [Amborella trichopoda]
Length=682

 Score =   533 bits (1374),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 295/614 (48%), Positives = 394/614 (64%), Gaps = 28/614 (5%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSLVN-NSIQITPNQR-----NCIGRATYSEPLHLWDKPT  213
             ++FNF  F  S   +I +   +  N N +Q+T N+R     N +GRA Y  P+ LWD  T
Sbjct  29    VNFNFSSFNQS-TPDIRYVGDAFSNGNGLQVTRNERGDNLTNSVGRAFYEFPIRLWDSNT  87

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSS-  390
             G ++ F +HF FVI++   + YGDG AF LA   +   P+ ++GG  GL +   R NSS 
Sbjct  88    GAVADFTSHFQFVINAFNESLYGDGLAFILA--ANLDIPSDSRGGNLGLYDTAVRTNSSS  145

Query  391   NPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNL  570
             NP VAVEFD   N +D    HVGI+V+S++SV    W+  I  G  + AW+ Y+  +  L
Sbjct  146   NPVVAVEFDSLKNDWDPNDNHVGINVNSIESVANVSWNSSIRDGRRANAWVTYNGTTKRL  205

Query  571   SVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSAL--  729
             SV         F     +S+ +DL K LPE V  GF+ ATG    +  + SW F+S+L  
Sbjct  206   SVFLTYVNNPTFRGNSSLSHEVDLSKVLPECVNIGFSAATGNLVEVHTVFSWEFSSSLGS  265

Query  730   -DISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKR---KMREE--FDDDIFG  891
              D  +   D +     ++  +           +    + WR+R   K+RE    ++D   
Sbjct  266   CDEGKVAGDKRWVIWFVLCLVFFMVGM-----LVLIMVVWRRRVKKKLRERGDMEEDEES  320

Query  892   NIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRG  1071
                +   G GP+RF Y+EL  ATN F+++ KLGEGGFG VY G L +    VAVKRVS G
Sbjct  321   MDEDFERGNGPRRFKYKELVSATNGFNEEGKLGEGGFGGVYMGLLTDTNEAVAVKRVSSG  380

Query  1072  SKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLT  1251
             SKQG KE+ SEV +ISR+RH+NLV LIGWCH   +LLLVYEF+ NGSLD +L+  K+ LT
Sbjct  381   SKQGKKEFVSEVTIISRLRHRNLVQLIGWCHYRAELLLVYEFMPNGSLDQYLFGKKTELT  440

Query  1252  WPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKG  1431
             W LRYK+   LAS++LYLHEE E+C+VHRDIKSSNIMLD+N NAKLGDFGLARLVDH++ 
Sbjct  441   WDLRYKVAMGLASSMLYLHEEWEQCVVHRDIKSSNIMLDTNFNAKLGDFGLARLVDHDQP  500

Query  1432  SRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDW  1611
             S+TT +AGTMGY+A ECV +GKAS+E+D+YSFG+V LEI CGR+ I+P A+   V +V+W
Sbjct  501   SQTTVIAGTMGYLAPECVTTGKASRESDVYSFGVVALEICCGRRAIEPLAKASRVRLVEW  560

Query  1612  VWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAP  1791
             VW+ YG G+LLD  D  L  DF+ R++E +M+VGLWCAHPD + RPSIRQ IQVLNF+  
Sbjct  561   VWECYGEGRLLDCVDEKLFSDFDKRQIECLMVVGLWCAHPDPTPRPSIRQVIQVLNFDVA  620

Query  1792  LPDLPETMPVATFW  1833
             +P LP  MPV  ++
Sbjct  621   MPLLPSKMPVPMYF  634



>gb|EYU41346.1| hypothetical protein MIMGU_mgv1a020039mg [Erythranthe guttata]
Length=642

 Score =   532 bits (1370),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 281/567 (50%), Positives = 387/567 (68%), Gaps = 14/567 (2%)
 Frame = +1

Query  163   IGRATYSEPLHLWDKP---TGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPN  333
             +GR  Y+  + LWD     + KL+ F THF+F +D+  ++ +G G +FFLAPLG +IPPN
Sbjct  55    VGRVIYNGKVPLWDDDDDDSKKLADFTTHFSFTVDTRNASSFGHGLSFFLAPLGFQIPPN  114

Query  334   ATKGGGFGLANDDERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDI  513
             +  GG  GL N     ++    V+VEFD + N +D    HVGI+V+S+ S+VT PW+  +
Sbjct  115   SA-GGYLGLFNTTTINSNRTQIVSVEFDSFSNGWDPNYTHVGINVNSVTSIVTTPWNLTL  173

Query  514   EGGWGSEAWINYDPRSMNLSVVFRNFG-SYGHVSYILDLRKYLPERVTFGFAGATGKDTA  690
               G  ++AWI+Y+  + NLSV     G S   +SY++DLR+ LP+ VT G + +TG +  
Sbjct  174   YSGKLADAWISYNGTTRNLSVSLTYGGESNSSLSYLIDLREVLPQWVTIGISASTGVNVE  233

Query  691   LQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREE  870
                + SW F+S+LDI+   A+  +   G ++GL +  C LI G +  +++  RK++ R  
Sbjct  234   QHTLGSWDFSSSLDINGTDANNNAKMIGFIVGLSLSVCVLIAGGV-LAYVVLRKKR-RHG  291

Query  871   FDD-------DIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLK  1029
             F D       ++     +L  GAGP+RF+Y++LA AT++FS + KLGEGGFG VYKGYL 
Sbjct  292   FVDKNNPEAANLTSMNDDLERGAGPRRFSYKDLASATSNFSDKKKLGEGGFGGVYKGYLI  351

Query  1030  ELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNG  1209
             +L+  +AVK+ S+ SK G K+Y +EV++IS +RH+NLV LIGW H+  + LLVYEF+ NG
Sbjct  352   DLDIPIAVKKSSKQSKHGRKQYITEVKIISMLRHRNLVQLIGWSHDQGEFLLVYEFMPNG  411

Query  1210  SLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKL  1389
             SLD HL+  KS+L+W  RYKI   LA ALLYLHEE ++C+VHRDIKSSN+MLD + N KL
Sbjct  412   SLDHHLFGKKSILSWTQRYKIALGLAFALLYLHEEGDQCVVHRDIKSSNVMLDLSFNVKL  471

Query  1390  GDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPI  1569
             GDFGLARL+DH  G +TT LAGT GY+A E V S +ASKE+D+YSFG+V LEIA G+K I
Sbjct  472   GDFGLARLMDHGLGPQTTGLAGTFGYMAPEYVSSRRASKESDVYSFGVVVLEIATGKKSI  531

Query  1570  DPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRP  1749
             DP  EE ++++V+WVW++YG G+LL   D     DF+ ++ E++MIVGLWCAHPD S RP
Sbjct  532   DPLNEESNISLVEWVWEMYGNGELLSCVDECARVDFDTKQAERLMIVGLWCAHPDFSQRP  591

Query  1750  SIRQAIQVLNFEAPLPDLPETMPVATF  1830
             SIRQA  VLNFEA LP L   MPV  F
Sbjct  592   SIRQASSVLNFEADLPKLETKMPVPGF  618



>gb|AFW84902.1| LOW QUALITY PROTEIN: putative lectin-domain receptor-like protein 
kinase family protein [Zea mays]
Length=705

 Score =   534 bits (1375),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 292/623 (47%), Positives = 397/623 (64%), Gaps = 39/623 (6%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQ--NITFERTSLVNNSIQITPNQR-----NCIGRATYSEPLHLWDK  207
             P SF ++  +PS+     I F+  +  N +I++T ++R     +  GRA YS  + L D 
Sbjct  53    PFSFTYNFTSPSDTPPPGIAFQGDAFYNKAIRLTRDERLGPITSSTGRAFYSHAVPLADP  112

Query  208   PTGKLSSFNTHFAFVIDS-NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
              + + +SF T FAF I + + ++  GDG AFFL+P  S +P  ++ GG  GL N      
Sbjct  113   VSRRPASFVTAFAFSIAAPDPASASGDGLAFFLSPFPSVLP-ESSAGGLLGLFNSSS--V  169

Query  385   SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSM  564
              +   VAVEFD + N +D    HVG+D+  + S  TA W   ++ G  + A + YD  + 
Sbjct  170   RAGTLVAVEFDTHKNEWDPSGDHVGVDLGGIVSSATADWPTSMKDGRTAHARVEYDGVAK  229

Query  565   NLSVVFRNFGSYGHVS----------YILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             NL+V      SYG             Y +DLR +LP+ V  GF+ ATG+   L  +  W 
Sbjct  230   NLTVSL----SYGSARPNTTGDVLLWYAVDLRDHLPDSVAVGFSAATGEAAELHQVLYWE  285

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMRE----EFDDD  882
             FTS +D  E     ++    +V+GL      L+G  + +    WRK    +    E DD 
Sbjct  286   FTSTVDPKE-----ETVVLWVVLGLCALLLVLVGAGIVWFVRQWRKAGQFDDGDIEVDDV  340

Query  883   IFGNIGELGG----GAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVA  1050
             + G   EL        GP+RF Y ELA AT +F+++ KLG+GGFG+VY+G+LKEL   VA
Sbjct  341   MGGEYDELADEFVVQCGPRRFRYAELAAATKNFAEERKLGQGGFGAVYRGFLKELGFEVA  400

Query  1051  VKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENK-DLLLVYEFLSNGSLDSHL  1227
             +KRVS+GS QG KEYA+EVR+IS++RH++LV L+GWCHE++ D LLVYE + NGS+D HL
Sbjct  401   IKRVSKGSTQGRKEYAAEVRIISQLRHRHLVRLVGWCHEHRGDFLLVYELMPNGSVDHHL  460

Query  1228  YKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLA  1407
             Y    LLTWP+RY I   LASA+LYLHEEC +CIVHRD+K SN+MLD+  NAKLGDFGLA
Sbjct  461   YGKGMLLTWPMRYDISLGLASAMLYLHEECPQCIVHRDVKPSNVMLDAAFNAKLGDFGLA  520

Query  1408  RLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEE  1587
             +LV+H     TT LAGT+GY+A ECV++GKAS+E+D+YSFG+V LEIACGR+P +   E 
Sbjct  521   KLVEHGSQPYTTVLAGTLGYLAPECVMTGKASRESDVYSFGVVALEIACGRRPAELNNEP  580

Query  1588  CHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAI  1767
                 +V WVW+LYG   LL+AAD  L G F+ +++E++MIVGLWCAHPD + RPSIRQA+
Sbjct  581   SKARLVPWVWELYGKNALLEAADWRLKGQFDEKQMERLMIVGLWCAHPDYAHRPSIRQAL  640

Query  1768  QVLNFEAPLPDLPETMPVATFWP  1836
              VL FEAPLP LPE MPV T++P
Sbjct  641   NVLTFEAPLPVLPEKMPVPTYFP  663



>ref|XP_010232431.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Brachypodium distachyon]
Length=672

 Score =   533 bits (1372),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 285/619 (46%), Positives = 391/619 (63%), Gaps = 40/619 (6%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQR-----NCIGRATYSEPLHLWDKPTG  216
              ++NF     S    I+F+  +  N  I++T ++R     + +GRA +S P+ L D  + 
Sbjct  26    FTYNFTAAADSAPSGISFQGDAFFNKFIRLTRDERVGPITSSVGRAFFSRPVPLSDPVSR  85

Query  217   KLSSFNTHFAFVIDS-NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSN  393
             + +SF T F+F I +   SA  GDG AFFL+P  S +P +++ GG  GL N         
Sbjct  86    RPASFATAFSFSIAAPEPSAASGDGLAFFLSPFPSALP-SSSAGGLLGLFNSSAG-GGGR  143

Query  394   PFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLS  573
               VAVEFD Y N +D    HVGID+  + S  TA W   ++ G  + A + YD  + NL+
Sbjct  144   HLVAVEFDTYKNEWDPSDDHVGIDIGGIVSAATANWPTSMKDGRMAHARVAYDGDAKNLT  203

Query  574   VVFRNFGSYGHVS-------YILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALD  732
             V      SYG  S       Y +DLR++LP+ V  GF+ ATG+   L  +  W FTS++D
Sbjct  204   VAL----SYGDASPTDVLLWYAVDLREHLPDAVAVGFSAATGEAAELHQVLYWEFTSSVD  259

Query  733   ISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIGELGG  912
               E             +   + G       +  + + W  R+ R+  +  ++G+I +  G
Sbjct  260   PKEETV----------MLWAILGSCGFLVVLVAAGVVWFVRQWRKAGECVLYGDIDDAMG  309

Query  913   ----------GAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRV  1062
                        +GP+RF Y ELA ATN+FS++ KLG+GGFG+VY+G+L+EL   VA+KRV
Sbjct  310   YEELPDEFVMDSGPRRFRYAELAAATNNFSEERKLGQGGFGAVYRGFLRELGLEVAIKRV  369

Query  1063  SRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENK-DLLLVYEFLSNGSLDSHLYKGK  1239
             S+GS QG KEYA+EVR+IS++RH++LV L+GWCHE + D LLVYE + NGS+D HLY   
Sbjct  370   SKGSTQGRKEYAAEVRIISQLRHRHLVRLVGWCHEQRGDFLLVYELMPNGSVDHHLYGKG  429

Query  1240  SLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVD  1419
              LLTWP RY+I   LASA+LYLHEEC +CIVHRDIK SN+MLD+   AKLGDFGLA+LV+
Sbjct  430   VLLTWPTRYEIALGLASAMLYLHEECLQCIVHRDIKPSNVMLDATFGAKLGDFGLAKLVE  489

Query  1420  HEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVN  1599
             H     TT LAGT+GY+A ECV++GKAS+E+D+YSFG+V LEIACGR+P +   E     
Sbjct  490   HGSQPYTTVLAGTLGYLAPECVMTGKASQESDVYSFGVVALEIACGRRPAELAQEPSKAR  549

Query  1600  IVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLN  1779
             +V WVW+LYG   LL+AAD  L G+F+ +++E +M+VGLWC+HPD + RPSIRQA+ VL 
Sbjct  550   LVPWVWELYGKKALLEAADWRLKGEFDEKQMEHLMVVGLWCSHPDYTHRPSIRQALNVLK  609

Query  1780  FEAPLPDLPETMPVATFWP  1836
             FEAPLP L   MPV TF+P
Sbjct  610   FEAPLPVLAPMMPVPTFFP  628



>ref|XP_002527235.1| kinase, putative [Ricinus communis]
 gb|EEF35161.1| kinase, putative [Ricinus communis]
Length=632

 Score =   531 bits (1368),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 285/587 (49%), Positives = 388/587 (66%), Gaps = 22/587 (4%)
 Frame = +1

Query  127   NSIQITPNQRNCI--GRATYSEPLHLWDK------PTGKLSSFNTHFAFVIDSNGSAKYG  282
             NSI    N+ N +  G A  S  +  ++K        G+LS F THF+F+ID+N S ++G
Sbjct  26    NSIHFRLNRTNMLYYGDAVLSVGVVEFNKVKSYAYRVGRLSDFLTHFSFIIDTNDSMEHG  85

Query  283   DGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSNPFVAVEFDVYLNH-YDTEQ--KH  453
              GFAFFLAP+G +IPPN+   G  GL N     +S N  V VEFD Y N  +D +   +H
Sbjct  86    HGFAFFLAPVGFQIPPNSA-SGYLGLFNTSTVDSSQNQIVFVEFDSYPNKAWDPKPLVEH  144

Query  454   VGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSVV--FRNFGS---YGHVSYI  618
             VGI+++SL S  + PW+     G  +  WI Y+  + NLS++  +RN  +      +SY+
Sbjct  145   VGININSLASANSTPWNASYHSGDTANVWITYNSSTKNLSLLWNYRNTSNPLEKTSLSYV  204

Query  619   LDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvg  798
             +DL K LPE VT GF+ ATG       + SW F S LD+  N   +K TG  + + + V 
Sbjct  205   IDLMKVLPEWVTVGFSAATGVYKERHQLLSWEFNSTLDVETNGKSSKRTGIVVGVSVSVC  264

Query  799   gcfliggSMAFSFLAWRKRKM--REEFDDDIFGNIG-ELGGGAGPKRFTYRELARATNSF  969
                +    +A   L+ R++ M  R+  +     +I  +L  GA P+RF+Y EL  ATN+F
Sbjct  265   VAGIGM--IAGIVLSQRRKTMIARKRKEKLNLTSINKDLERGAAPRRFSYEELVSATNNF  322

Query  970   SQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHL  1149
             S +  LG+GGFG+VYKGYL +++  +AVK++SRGS+QG +EY +EV+ I ++RH+NLV L
Sbjct  323   SNERMLGKGGFGAVYKGYLIDMDMAIAVKKISRGSRQGKREYITEVKTIGQLRHRNLVQL  382

Query  1150  IGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCI  1329
             +GWCH+  + LLVYEF+ NGSLDSHL+  KS L W +R+KI   LAS LLYLHEE E+C+
Sbjct  383   LGWCHDKGEFLLVYEFMPNGSLDSHLFGKKSSLPWAVRHKIALGLASGLLYLHEEWEQCV  442

Query  1330  VHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKE  1509
             VHRD+KSSN+MLDSN NAKLGDFGLARL DHE G +TT LAGT+GY+A E + + +ASKE
Sbjct  443   VHRDVKSSNVMLDSNFNAKLGDFGLARLTDHELGPQTTGLAGTLGYLAPEYITTRRASKE  502

Query  1510  TDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGRE  1689
             +D+YSFG+V LEI  GR+ ID   ++  +++V+W+W+LYG G L  A D  L   FN +E
Sbjct  503   SDVYSFGMVALEIISGRRVIDHINDKYEMSLVEWIWELYGEGNLHLAVDKELYSKFNEKE  562

Query  1690  VEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
              E++MIVGLWCAHPDC+LRPSIRQAIQVL FE  LP+LP  M V  +
Sbjct  563   AERLMIVGLWCAHPDCNLRPSIRQAIQVLKFEIALPNLPAKMLVPVY  609



>ref|XP_006466350.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Citrus sinensis]
Length=658

 Score =   531 bits (1369),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 288/617 (47%), Positives = 406/617 (66%), Gaps = 24/617 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVN-NSIQITPN-QRNC-IGRATYSEPLHLW  201
             ++P  + +SF    F  SN ++I ++  ++ +  +I++  N Q  C +G ATY++ + LW
Sbjct  26    LVPSANSVSFRMSSFD-SNRKDIIYQGDAVPSVGAIELIKNYQYLCRVGWATYADRVPLW  84

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             +  TG+L+ F+T F+F I++   + YG G  FFLAP+G +IPPNA  GG  GL N     
Sbjct  85    NSDTGELADFSTKFSFQINTLDRSTYGHGLVFFLAPVGFQIPPNA-DGGFLGLFNTTTSF  143

Query  382   NSSNPFVAVEFDVYLN-HYDTE--QKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
             +SSN  V VEFD + N  +D    Q HVGI+ +S+ S V   W+        ++  I Y+
Sbjct  144   SSSNHIVHVEFDTFFNSEWDPSGVQDHVGINNNSIASAVHTRWNASFHSEDTADVRIAYN  203

Query  553   PRSMNLSVVFRNFGSYGHVS---------YILDLRKYLPERVTFGFAGATGKDTALQMIN  705
               + NLSV +    +Y   S         YI+DL K LP+ VT GF+ ATG      ++ 
Sbjct  204   STTKNLSVSW----TYRQTSDPRENTSLFYIIDLMKVLPQWVTIGFSAATGLSGERHILE  259

Query  706   SWIFTSALDISE-NQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDD  882
             SW F+S+LD+ + N  D K     + + + +G       +        +K++ +   + +
Sbjct  260   SWEFSSSLDMKQTNGTDGKKIRIVVSVTVSIGVLIAGMITGLLILRRHKKKERKSTAERE  319

Query  883   IFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKR  1059
                +I + L  GAGP+RF+Y +LA AT++F++  KLGEGGFGSVYKGYL +L+  VAVK+
Sbjct  320   TLTSINDDLERGAGPRRFSYTDLASATSNFAENKKLGEGGFGSVYKGYLIDLDMAVAVKK  379

Query  1060  VSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGK  1239
             VSRGSKQG KEY +EV+ IS++RH+ LV L+GWCH+  + LLVYEF+ NGSLD+HL+  K
Sbjct  380   VSRGSKQGKKEYVTEVKTISQLRHRYLVQLLGWCHDRGEFLLVYEFMPNGSLDAHLFGKK  439

Query  1240  SLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVD  1419
             S L W +RY+I   LA+ALLYL EE E+C++HRDIKSSNIMLDSN NAKLGDFGLARL+D
Sbjct  440   SPLAWAVRYRISLGLATALLYLQEEWEQCVLHRDIKSSNIMLDSNFNAKLGDFGLARLMD  499

Query  1420  HEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVN  1599
             HE G +TT LAGT+GY+A E + +G+ASKE+D++SFG+V LEIA GRK +D   +E  + 
Sbjct  500   HELGPKTTGLAGTLGYMAPEYISTGRASKESDVFSFGVVALEIATGRKAVD-RYKESEMG  558

Query  1600  IVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLN  1779
             +V WVW LYG G+LL AAD +L   F+ +++  ++IVGLWCAHPD S RPSIRQAIQVL+
Sbjct  559   LVAWVWDLYGEGKLLSAADESLDSGFDEQQMTCLLIVGLWCAHPDRSFRPSIRQAIQVLS  618

Query  1780  FEAPLPDLPETMPVATF  1830
              E  +P+LP  MPV ++
Sbjct  619   SETAMPNLPSKMPVPSY  635



>ref|XP_003608360.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90557.1| L-type lectin-domain receptor kinase [Medicago truncatula]
Length=668

 Score =   531 bits (1369),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 311/629 (49%), Positives = 406/629 (65%), Gaps = 32/629 (5%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPN---QRN--CIGRATYSEPL  192
             II + + LSF +  F   +V    +E   S    +IQIT N   Q N   +GR T  + +
Sbjct  27    IIHIANSLSFEYPYFKNGDVN---WEGDASPYKGAIQITSNTLDQNNNYSVGRVTSFKQM  83

Query  193   HLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDD  372
              LWD  +G LS F T F+FV+ SN    YGDG  FFLA     +  N ++GGG GL + +
Sbjct  84    RLWDLNSGNLSDFTTKFSFVVYSN-KRDYGDGMVFFLADPALPLLKNISEGGGLGLVDGN  142

Query  373   ERLNSS-NPFVAVEFDVYLNHYDT--EQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWI  543
             + L S+ + FVAVEFD + N +D   E  HVG++ +S++S +T PW  +I+        I
Sbjct  143   QVLKSTQHSFVAVEFDTFNNPWDPPGEGTHVGLNFNSMRSNITKPWLTNIQERRVYNCSI  202

Query  544   NYDPRSMNLSVVFRNFGS------YGHVSYILDLRKYLPERVTFGFAGATG--KDTALQM  699
              Y   ++NLSV F  +          ++S+ +DLR  LPERV  GF+ ATG   +     
Sbjct  203   EYKSSTLNLSVSFTMYDDDDDKPFEEYISHKVDLRDVLPERVIVGFSAATGILYEVHTLR  262

Query  700   INSWIFTSALDISENQA---------DTKSTgkglviglvvggcfliggSMAFSFLAWR-  849
               S+  +   D ++NQ            K    GL +GL +G    +  S     L W+ 
Sbjct  263   SWSFSSSLLSDETKNQVVAPIPSPIISEKENKMGLKVGLGIGTGLAVSLSGLVCTLLWKM  322

Query  850   KRKMREEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLK  1029
              R  +EEF  D+  +  E   G+GPKRF+Y EL  ATN FS+  K+G+GGFG VYKGYLK
Sbjct  323   SRGRKEEFGFDLNMD-DEFQKGSGPKRFSYNELVSATNKFSESGKVGQGGFGGVYKGYLK  381

Query  1030  ELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNG  1209
             +L SYVAVKR+SR S+QGI EYA+EV+VIS++RH+NLV L+GWCH   D LL+YEF+SNG
Sbjct  382   DLNSYVAVKRISRESRQGILEYATEVKVISQLRHRNLVQLLGWCHRKNDFLLIYEFMSNG  441

Query  1210  SLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKL  1389
             SLDSHLY  KSLLTW +RY I   LASALLYL EE E+C++HRDIKSSNIMLDS  NA+L
Sbjct  442   SLDSHLYSKKSLLTWTMRYNIALGLASALLYLQEEWEQCVLHRDIKSSNIMLDSCFNARL  501

Query  1390  GDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPI  1569
             GDFGLARLVDHE GS+TT +AGT GYIA E   SGK +KE+DI+SFG+V LEIA GRK I
Sbjct  502   GDFGLARLVDHETGSQTTIIAGTRGYIAPEYFTSGKPTKESDIFSFGVVLLEIASGRKAI  561

Query  1570  DPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRP  1749
             +   +E  +++V+WVW+LYG G+ L+A DP L G F+ +++E+++IVGLWC HPD S RP
Sbjct  562   EREEKEGQISVVEWVWELYGLGKFLEAVDPKLCGAFDEQQLERLVIVGLWCVHPDYSFRP  621

Query  1750  SIRQAIQVLNFEAPLPDLPETMPVATFWP  1836
             SIRQ IQVL FE+P P LPE MPV T+ P
Sbjct  622   SIRQVIQVLKFESPSPILPEKMPVPTYLP  650



>ref|XP_006856579.1| hypothetical protein AMTR_s00046p00196610 [Amborella trichopoda]
 gb|ERN18046.1| hypothetical protein AMTR_s00046p00196610 [Amborella trichopoda]
Length=660

 Score =   531 bits (1368),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 290/589 (49%), Positives = 384/589 (65%), Gaps = 28/589 (5%)
 Frame = +1

Query  133   IQITPNQ-----RNCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAF  297
             I +TP +      N  GR  Y +P+ +W      + SF T F F I  + +   G G AF
Sbjct  51    IPLTPQEIGGKWGNSTGRVFYKDPIDIWGPQNTNVVSFTTEFVFAIHGSVTNGSGGGLAF  110

Query  298   FLAPLGSRIPPNATKGGGFGLANDDERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSL  477
             FL+P+GS IP N+  GG  GL N+    +SSN  VAVEFD + + +D    HVGIDV+S+
Sbjct  111   FLSPVGSVIPENS-YGGWLGLFNETTNNSSSNQMVAVEFDTFQDSWDLPVDHVGIDVNSI  169

Query  478   QSVVTAPWSPDIEGGWGSEAWINYDPRSMNLSVVFRN------FGSYGHVSYILDLRKYL  639
              S  +  W+  +         I+YD  S NLSV  ++      FGS  ++++ +DL + L
Sbjct  170   VSNASKTWTDTMTSSDFVYVRIDYDGASKNLSVFLKHEEVPVAFGSL-NLTHEIDLSQVL  228

Query  640   PERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfligg  819
             P++V  GF+ +TG       I  W FTS      +     +   G +I   +   F    
Sbjct  229   PQQVIMGFSASTGSQIIRHEIFKWNFTSNFIQVRDDVTISNIALGFIIASAILVFF----  284

Query  820   SMAFSFLAWRKR---KMREE---FDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQD  981
              +  +   W +R   K +EE   FD+ +  N  +   G GP+RF+Y+EL  AT++FS+  
Sbjct  285   -VGLALGVWCRRVKGKEKEEDWGFDEKMDENFMK---GTGPRRFSYKELMSATHNFSEDG  340

Query  982   KLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWC  1161
             KLGEGGFG VYKG L E    +AVKR+S+GSKQG KEY SEV VISR+RH+NLV L+GWC
Sbjct  341   KLGEGGFGGVYKGVLGEYNDMIAVKRISKGSKQGTKEYVSEVTVISRLRHRNLVQLLGWC  400

Query  1162  HENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRD  1341
             H   DLLLVYEF+ NGSLDSHL+     LTW +RYKI   LASALLYLHEE E+C+VHRD
Sbjct  401   HNRGDLLLVYEFMPNGSLDSHLFGATVGLTWEVRYKIACGLASALLYLHEEWEQCVVHRD  460

Query  1342  IKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIY  1521
             IKSSN+MLDSN NAKLGDFGLARLVDH + S TT +AGTMGY+A EC+++GKAS+E+D++
Sbjct  461   IKSSNVMLDSNFNAKLGDFGLARLVDHGRASETTVIAGTMGYLAPECIITGKASRESDVF  520

Query  1522  SFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQM  1701
             SFG+VTLEIACGR+P+D  A+     +V+WVW LYG G+L DA D  L  +++  ++E++
Sbjct  521   SFGVVTLEIACGRRPVDRKADSLQARLVEWVWDLYGRGRLFDAVDERLGLNYDKDQMERL  580

Query  1702  MIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATFW-PQRN  1845
             M+VGLWCAHPD S+RPSIRQAIQV+NF+ P+PDLP  MPV T++ P RN
Sbjct  581   MVVGLWCAHPDESMRPSIRQAIQVMNFQEPIPDLPSQMPVPTYYAPPRN  629



>ref|XP_010518988.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
isoform X1 [Tarenaya hassleriana]
Length=641

 Score =   530 bits (1365),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 295/614 (48%), Positives = 397/614 (65%), Gaps = 22/614 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNC-IGRATYSEPLHLWDK  207
             +IP VH L FNF  F P + + I ++  +  N +I  T       +G AT++  + + D 
Sbjct  13    VIPFVHSLEFNFTSFRPRDPKEIAYQGDATPNGAIDFTTMVDPARVGWATFTGKVPILDP  72

Query  208   PTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNS  387
              +GK  SF+T F+F+ID+  + KYG G  FFLAP+G +IPPN+     FGL N     NS
Sbjct  73    GSGKALSFSTSFSFIIDNLDNPKYGHGLIFFLAPVGVQIPPNSA-AAFFGLFNRSNNYNS  131

Query  388   SNPFVAVEFDVYLNH-YDT--EQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
               P V +EFD Y N  +D    + HVGI+VDSL+S     W+          A ++YD  
Sbjct  132   LFPLVHIEFDTYHNQRWDPIGVESHVGINVDSLKSYSYTSWNASSHMKDICHARVSYDSA  191

Query  559   SMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTS  723
             + NLSV +      +      + YI+DL K LP++VT GF+ ATG +  L  + SW F S
Sbjct  192   TSNLSVSWTYELSADPREASSLFYIIDLAKVLPKKVTVGFSAATGSNKELHKLLSWEF-S  250

Query  724   ALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIG-  900
               DI E    T       +I  V    F++  S+    +A+++RK R++   D    +  
Sbjct  251   IEDIEETPNRTG------MIVGVSVSAFVLLVSLVGILVAFQRRKQRKKRARDAINLVSI  304

Query  901   --ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGS  1074
               +L  GAGP+RF+Y+ELA ATN+F  + KLGEGGFG+VY+GYL E +  VAVK+ +  S
Sbjct  305   NEDLERGAGPRRFSYKELASATNNFLDERKLGEGGFGAVYRGYLNEFDMMVAVKKFAGRS  364

Query  1075  KQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTW  1254
              QG+KE+ +EV++IS +RH+NLV LIGWCHE  + LLVYEF+ NGSLDSHL+  ++ L W
Sbjct  365   NQGMKEFITEVKIISGLRHRNLVQLIGWCHEKDEFLLVYEFMPNGSLDSHLFGKRAPLAW  424

Query  1255  PLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGS  1434
              +RYK+   LASAL YLHEE E+C+VHRDIK SNIMLDSN N KLGDFGLARL+DHE G 
Sbjct  425   AVRYKVTLGLASALQYLHEEWEQCVVHRDIKPSNIMLDSNFNVKLGDFGLARLMDHELGP  484

Query  1435  RTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAE--ECHVNIVD  1608
             +TT LAGT GY+A E + +G+ASKE+DIYS+G+VTLEI  GRK +DP     E   ++V+
Sbjct  485   QTTGLAGTFGYMAPEYISTGRASKESDIYSYGVVTLEIVTGRKSVDPRQGKIEPETSLVE  544

Query  1609  WVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEA  1788
              VW LYG G+L+ A D  L  DF+  + E +M+VGLWCAHP+ S RPS++QAIQVLNFEA
Sbjct  545   RVWNLYGRGELVSAIDQKLGSDFDRMKAEWLMVVGLWCAHPNRSSRPSMKQAIQVLNFEA  604

Query  1789  PLPDLPETMPVATF  1830
             PLP+LP  MP+AT+
Sbjct  605   PLPNLPPKMPLATY  618



>ref|NP_001147903.1| protein kinase [Zea mays]
 gb|ACG29070.1| protein kinase [Zea mays]
Length=703

 Score =   532 bits (1370),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 291/623 (47%), Positives = 397/623 (64%), Gaps = 39/623 (6%)
 Frame = +1

Query  49    PLSFNFDLFTPSNVQ--NITFERTSLVNNSIQITPNQR-----NCIGRATYSEPLHLWDK  207
             P SF ++  +PS+     I F+  +  N +I++T ++R     +  GRA YS  + L D 
Sbjct  51    PFSFTYNFTSPSDTPPPGIAFQGDAFYNKAIRLTRDERLGPITSSTGRAFYSRAVPLADP  110

Query  208   PTGKLSSFNTHFAFVIDS-NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLN  384
              + + +SF T FAF I + + ++  GDG AFFL+P  S +P  ++ GG  GL N      
Sbjct  111   VSRRPASFVTAFAFSIAAPDPASASGDGLAFFLSPFPSVLP-ESSAGGLLGLFNSSS--V  167

Query  385   SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSM  564
              +   VAVEFD + + +D    HVG+D+  + S  TA W   ++ G  + A + YD  + 
Sbjct  168   RAGTLVAVEFDTHKDEWDPSGDHVGVDLGGIVSSATADWPTSMKDGRTAHARVEYDGVAK  227

Query  565   NLSVVFRNFGSYGHVS----------YILDLRKYLPERVTFGFAGATGKDTALQMINSWI  714
             NL+V      SYG             Y +DLR +LP+ V  GF+ ATG+   L  +  W 
Sbjct  228   NLTVSL----SYGSARPNTTGDVLLWYAVDLRDHLPDSVAVGFSAATGEAAELHQVLYWE  283

Query  715   FTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMRE----EFDDD  882
             FTS +D  E     ++    +V+GL      L+G  + +    WRK    +    E DD 
Sbjct  284   FTSTVDPKE-----ETVVLWVVLGLCALLLVLVGAGIVWFVRQWRKAGQFDDGDIEVDDV  338

Query  883   IFGNIGELGG----GAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVA  1050
             + G   EL        GP+RF Y ELA AT +F+++ KLG+GGFG+VY+G+LKEL   VA
Sbjct  339   MGGEYDELADEFVVQCGPRRFRYAELAAATKNFAEERKLGQGGFGAVYRGFLKELGFEVA  398

Query  1051  VKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENK-DLLLVYEFLSNGSLDSHL  1227
             +KRVS+GS QG KEYA+EVR+IS++RH++LV L+GWCHE++ D LLVYE + NGS+D HL
Sbjct  399   IKRVSKGSTQGRKEYAAEVRIISQLRHRHLVRLVGWCHEHRGDFLLVYELMPNGSVDHHL  458

Query  1228  YKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLA  1407
             Y    LLTWP+RY I   LASA+LYLHEEC +CIVHRD+K SN+MLD+  NAKLGDFGLA
Sbjct  459   YGKGLLLTWPMRYDISLGLASAMLYLHEECPQCIVHRDVKPSNVMLDAAFNAKLGDFGLA  518

Query  1408  RLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEE  1587
             +LV+H     TT LAGT+GY+A ECV++GKAS+E+D+YSFG+V LEIACGR+P +   E 
Sbjct  519   KLVEHGSQPYTTVLAGTLGYLAPECVMTGKASRESDVYSFGVVALEIACGRRPAELNNEP  578

Query  1588  CHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAI  1767
                 +V WVW+LYG   LL+AAD  L G F+ +++E++MIVGLWCAHPD + RPSIRQA+
Sbjct  579   SKARLVPWVWELYGKNALLEAADWRLKGQFDEKQMERLMIVGLWCAHPDYAHRPSIRQAL  638

Query  1768  QVLNFEAPLPDLPETMPVATFWP  1836
              VL FEAPLP LPE MPV T++P
Sbjct  639   NVLTFEAPLPVLPEKMPVPTYFP  661



>gb|KCW63383.1| hypothetical protein EUGRSUZ_G01024 [Eucalyptus grandis]
Length=565

 Score =   527 bits (1357),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 278/559 (50%), Positives = 381/559 (68%), Gaps = 24/559 (4%)
 Frame = +1

Query  190   LHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLAN-  366
             +HLWDK TG ++ F THF+F I+S GS  Y DG +FFLAP GS IPP+ ++GG   L N 
Sbjct  1     MHLWDKSTGNVADFTTHFSFAINSLGSKVYADGMSFFLAPNGSNIPPH-SEGGKLALVNL  59

Query  367   -DDERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGS-EAW  540
               D+  +S+  FVAVEFD Y+N +D + +H+GID++S+ S    PW  +  G  G   A 
Sbjct  60    QSDDSDSSNASFVAVEFDTYVNSWDPQYEHIGIDINSVNSTTFVPWKWNRIGSGGRVRAT  119

Query  541   INYDPRSMNLSVVFRNFGS-------YGHVSYILDLRKYLPERVTFGFAGATGKDTALQM  699
             I YD    NLSV+  +  S          +S I++L +YLPE VT GFA  +G  +A+++
Sbjct  120   IAYDSSVHNLSVLLIDDESDETLSKNQSSLSLIINLTEYLPEWVTIGFAATSG--SAIEI  177

Query  700   INSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDD  879
               S + T  L    ++  +KS    ++          +  ++ +S       ++R   DD
Sbjct  178   HTSIVPTDNL---SSEKKSKSWIWVVIGLSSAFLLISLIFTITWS-------EIRHTHDD  227

Query  880   -DIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVK  1056
              D+     ELG  AGPK+F+Y ELA AT++F+    LG+GGFG VY+GYL  + S VAVK
Sbjct  228   HDVMRMEEELGEVAGPKQFSYSELAVATDNFTDDRLLGQGGFGRVYEGYLDGIHSSVAVK  287

Query  1057  RVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKG  1236
             +V   + QG+KEYA+EV+ I ++RH+NLV L+GWCH+ K+LLLVY+F+SNGSLDSHL+KG
Sbjct  288   KVKPEAGQGMKEYAAEVKTIGQLRHRNLVRLLGWCHDEKELLLVYKFMSNGSLDSHLFKG  347

Query  1237  KSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLV  1416
             K+LL+W  RYKI Q LASAL +LHE  ++C+VHRDIKSSN+MLD + NAKLGDFGLARLV
Sbjct  348   KTLLSWETRYKIAQGLASALFFLHEGWDQCVVHRDIKSSNVMLDLHFNAKLGDFGLARLV  407

Query  1417  DHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHV  1596
             DH KG+ TT LAGT+GY+A EC+ +GKA+KE+DIYSFG+V LEIACG K + P     H+
Sbjct  408   DHAKGAHTTILAGTIGYLAPECISTGKATKESDIYSFGVVLLEIACGLKALGPMEANGHM  467

Query  1597  NIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVL  1776
             ++V+ VW++YG  +LLD ADP L G FN  ++E +MIVGLWCAHP+ +LRPS+R+A+ VL
Sbjct  468   HLVERVWEVYGARKLLDVADPKLCGKFNEEQMECLMIVGLWCAHPNYTLRPSVREAVNVL  527

Query  1777  NFEAPLPDLPETMPVATFW  1833
             NF+ P P+L    PV T++
Sbjct  528   NFDLPPPNLLGKAPVPTYF  546



>emb|CDY10744.1| BnaA05g11920D [Brassica napus]
Length=615

 Score =   528 bits (1361),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 290/609 (48%), Positives = 387/609 (64%), Gaps = 39/609 (6%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQRNC-IGRATYSEPLHLWDK  207
             ++P    L FN   FTP +  NI ++  +  N +I+++     C +G ATY++ + +WD 
Sbjct  13    VLPFATSLHFNISRFTPGD-PNIAYQGDATPNGAIELSNAGYTCRVGWATYAKRVAIWDP  71

Query  208   PTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNS  387
              TG+ + F T F F ID+  S ++G GFAFFLAP G  I PN+  GG  GL N+    +S
Sbjct  72    ETGRPTDFTTSFTFKIDTRNSTEFGHGFAFFLAPQGILISPNSA-GGFLGLFNETNGYSS  130

Query  388   SNPFVAVEFDVYLN-HYDTE--QKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPR  558
               P V VEFD + N  +D    + HVGI+ +SL S     W+  +       A I YD  
Sbjct  131   RFPLVHVEFDTFFNDEWDPLDIKSHVGINNNSLASSNYTSWNASLHSQDTCHARITYDSA  190

Query  559   SMNLSVVFR-----NFGSYGHVSYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTS  723
             S NLS+ +      N      + YI+DL K LP  VT GF+G+TG +T    I SW F S
Sbjct  191   SRNLSISWSYEETSNPRESSSLFYIIDLAKVLPAEVTIGFSGSTGANTEAHRILSWEFNS  250

Query  724   ALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDDIFGNIGE  903
              LD+ E +  T++    +V   + G        +  S +A        E          +
Sbjct  251   TLDVVEPRERTQNMKGIIVGVSLAGFV------LLTSLVAEENLTSLHE----------D  294

Query  904   LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQG  1083
             L  GAGP+RF+Y++LA AT++F  + KLGEGGFG+VYKGYL +L++ VAVK+ S  SKQG
Sbjct  295   LERGAGPRRFSYKDLASATSNFLYERKLGEGGFGAVYKGYLNDLDTMVAVKKFSGASKQG  354

Query  1084  IKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPLR  1263
              KE+ +EV++IS +RH+NLV LIGWCHE ++LLLVYEF+ NGSLDSHL+  K  LTW +R
Sbjct  355   KKEFITEVKIISSLRHRNLVQLIGWCHEKQELLLVYEFMPNGSLDSHLFGKKPHLTWAVR  414

Query  1264  YKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRTT  1443
              KI   +ASALLYLHEE E+CIVHRDIK+SNIMLDSN NAKLGDFGLARL+DHE G +TT
Sbjct  415   CKISLGVASALLYLHEEWEQCIVHRDIKASNIMLDSNFNAKLGDFGLARLMDHELGPQTT  474

Query  1444  ALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWKL  1623
              LAGT GY+A E + +G+ASKE+D+YSFGIV +EI  G+            N+V+ VW  
Sbjct  475   GLAGTFGYMAPEYISTGRASKESDVYSFGIVLVEIVTGK------------NLVERVWDQ  522

Query  1624  YGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLPDL  1803
             YG G+L+ A D  +  D++ ++ E +MIVGLWCAHPD + RPSI+QAIQVLN EAPLP+L
Sbjct  523   YGRGELISAVDHQIGKDYDMKQAECVMIVGLWCAHPDINSRPSIKQAIQVLNLEAPLPNL  582

Query  1804  PETMPVATF  1830
             P  MP+AT+
Sbjct  583   PHKMPIATY  591



>ref|XP_006426230.1| hypothetical protein CICLE_v10027339mg [Citrus clementina]
 gb|ESR39470.1| hypothetical protein CICLE_v10027339mg [Citrus clementina]
Length=658

 Score =   528 bits (1360),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 286/617 (46%), Positives = 405/617 (66%), Gaps = 24/617 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVN-NSIQITPN-QRNC-IGRATYSEPLHLW  201
             ++P  + +SF    F  SN ++I ++  ++ +  +I++  N Q  C +G ATY++ + LW
Sbjct  26    LVPSANSVSFRMSSFD-SNRKDIIYQGDAVPSVGAIELIKNYQYLCRVGWATYADRVPLW  84

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             +  TG+L+ F+T F+F I++   + YG G  FFLAP+G +IPPN + GG  GL N     
Sbjct  85    NSDTGELADFSTKFSFQINTLDRSTYGHGLVFFLAPVGFQIPPN-SDGGFLGLFNTTTSF  143

Query  382   NSSNPFVAVEFDVYLN-HYDTE--QKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
             +SSN  V VEFD + N  +D    Q HVGI+ +S+ S V   W+        ++  I Y+
Sbjct  144   SSSNHIVHVEFDTFFNSEWDPSGVQDHVGINNNSIASAVHTRWNASFHSEDTADVRIAYN  203

Query  553   PRSMNLSVVFRNFGSYGHVS---------YILDLRKYLPERVTFGFAGATGKDTALQMIN  705
               + NLSV +    +Y   S         YI+DL K LP+ VT GF+ ATG      ++ 
Sbjct  204   STTKNLSVSW----TYRQTSDPRENTSLFYIIDLMKVLPQWVTIGFSAATGLSGERHILE  259

Query  706   SWIFTSALDISE-NQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDD  882
             SW F+S+LD+ + N  D K     + + + +G       +        +K++ +   + +
Sbjct  260   SWEFSSSLDMKQRNGTDGKKIRIIVSVTVSIGVLVAGMITGLLILRRHKKKERKSTAERE  319

Query  883   IFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKR  1059
                +I + L  G GP+RF+Y +LA AT++F++  KLGEGGFGSVYKGYL +L+  VAVK+
Sbjct  320   TLTSINDDLERGTGPRRFSYTDLASATSNFAENKKLGEGGFGSVYKGYLIDLDMAVAVKK  379

Query  1060  VSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGK  1239
             VSRGSKQG KEY +EV+ IS++RH+ LV L+GWCH+  + LLVYEF+ NGSLD+HL+  K
Sbjct  380   VSRGSKQGKKEYVTEVKTISQLRHRYLVQLLGWCHDRGEFLLVYEFMPNGSLDAHLFGKK  439

Query  1240  SLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVD  1419
             S L W +RY+I   LA+ALLYL EE E+C++HRDIKSSNIMLDSN NAKLGDFGLARL+D
Sbjct  440   SPLAWAVRYRISLGLATALLYLQEEWEQCVLHRDIKSSNIMLDSNFNAKLGDFGLARLMD  499

Query  1420  HEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVN  1599
             HE G +TT LAGT+GY+A E + +G+ASKE+D++SFG+V LEIA GRK +D   +E  + 
Sbjct  500   HELGPKTTGLAGTLGYMAPEYISTGRASKESDVFSFGVVALEIATGRKAVD-RYKESEMG  558

Query  1600  IVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLN  1779
             +V WVW LYG G+LL AAD +L   F+ +++  ++IVGLW AHPD S RPSIRQAIQVL+
Sbjct  559   LVAWVWGLYGEGKLLSAADESLDSGFDEQQMTCLLIVGLWSAHPDRSFRPSIRQAIQVLS  618

Query  1780  FEAPLPDLPETMPVATF  1830
             FE  +P+LP  MPV ++
Sbjct  619   FETAMPNLPSKMPVPSY  635



>ref|XP_004970179.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Setaria italica]
Length=676

 Score =   528 bits (1361),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 286/622 (46%), Positives = 396/622 (64%), Gaps = 39/622 (6%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQ--NITFERTSLVNNSIQITPNQR-----NCIGRATYSEPLHLWDKP  210
              SF ++  +PS+     I F+  +  N +I++T ++R     +  GRA YS  + L D  
Sbjct  27    FSFTYNFTSPSDTPPPGIAFQGDAFYNKAIRLTRDERLGPITSSAGRAFYSRAVPLADPV  86

Query  211   TGKLSSFNTHFAFVIDS-NGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNS  387
             T + +SF T FAF I + + +A  GDG AFFL+P  S +P  ++ GG  GL N       
Sbjct  87    TRRPASFATAFAFSIAAPDPAAASGDGLAFFLSPFPSALP-GSSAGGLLGLFNSSA--PR  143

Query  388   SNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMN  567
             + P VAVEFD Y N +D    HVG+D+  + S  TA W   ++ G  + A + YD  + N
Sbjct  144   AGPLVAVEFDTYKNEWDPSGDHVGVDLGGIVSAATADWPTSMKDGRTAHARVAYDGAAKN  203

Query  568   LSVVFRNFGSYGHVS----------YILDLRKYLPERVTFGFAGATGKDTALQMINSWIF  717
             L+V      SYG             Y +DLR++LP+ V  GF+ ATG+   L  +  W F
Sbjct  204   LTVAL----SYGAARPNATGDVLLWYAVDLREHLPDSVAVGFSAATGEAAELHQVLYWEF  259

Query  718   TSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMRE----EFDDDI  885
             TS +D  +     ++    +V+GL      L+G  + +    WRK    +    E DD +
Sbjct  260   TSTIDPKK-----ETVILWVVLGLCCLLLVLVGAGVVWFVRQWRKAGELDDGDIEVDDVM  314

Query  886   FGNIGELGGG----AGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAV  1053
              G   EL       +GP+RF Y ELA AT +F++  KLG+GGFG+VY+G+L++L   VA+
Sbjct  315   GGEYDELADEFVVESGPRRFRYAELAAATRNFAEDRKLGQGGFGAVYRGFLRDLGLDVAI  374

Query  1054  KRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENK-DLLLVYEFLSNGSLDSHLY  1230
             KRVS+GS QG KEYA+EVR+IS++RH++LV L+GWCHE++ D LLVYE + NGS+D HLY
Sbjct  375   KRVSKGSTQGRKEYAAEVRIISQLRHRHLVRLVGWCHEHRGDFLLVYELMPNGSVDHHLY  434

Query  1231  KGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLAR  1410
                + L WP RY +   L SA+LYLHEEC +C+VHRDIK SN+MLD+  +AKLGDFGLA+
Sbjct  435   GKGAPLAWPARYDVALGLTSAVLYLHEECAQCVVHRDIKPSNVMLDATFSAKLGDFGLAK  494

Query  1411  LVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEEC  1590
             LV+H     TTALAGT+GY+A ECV++GKAS+E+D+YSFG+V LEIACGR+P + + E  
Sbjct  495   LVEHGSQPYTTALAGTLGYLAPECVMTGKASRESDVYSFGVVALEIACGRRPAELSEEPS  554

Query  1591  HVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQ  1770
                +V WVW+LYG   LL+AAD  L G F+ +++E++M+VGLWCAHPD + RPSIRQA+ 
Sbjct  555   KARLVPWVWELYGKNALLEAADWRLKGQFDEKQMERLMVVGLWCAHPDYAHRPSIRQALN  614

Query  1771  VLNFEAPLPDLPETMPVATFWP  1836
             VL FEAPLP LP  MPV T++P
Sbjct  615   VLKFEAPLPVLPPKMPVPTYFP  636



>ref|XP_010273724.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Nelumbo nucifera]
Length=699

 Score =   529 bits (1363),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 290/619 (47%), Positives = 391/619 (63%), Gaps = 43/619 (7%)
 Frame = +1

Query  115   SLVNNSIQITPNQRNCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFA  294
             S   N + +T +Q +  GRA Y + + +WDK T  L+ F T F   I S  +   GDGFA
Sbjct  60    SFNGNGVTLTVDQPSLGGRAAYKDLVRIWDKQTTNLADFTTRFMITIASTSNCT-GDGFA  118

Query  295   FFLAPLGSRIPPNATKGGGFGLAND---------DERLNSSNPFVAVEFDVYLN-HYDTE  444
             FFL    + +   +  G   GL ++         D R  + N  +AVEFD Y N ++D  
Sbjct  119   FFLLTPSNDLAYQSEAGNCLGLVSNNRFAADGWCDNR--TENQLIAVEFDTYYNTNWDPP  176

Query  445   QKHVGIDVDSLQSVVTAPWSPDIEG-GWGSEAWINYDPRSMNLSVVF----RNFGSYGHV  609
               HVGIDV S++SV TA W+  I   G   +A I Y+  + NLSV      +   S   +
Sbjct  177   YNHVGIDVHSVESVATASWNSTINNNGSTIDARITYNSSTHNLSVFLTYDKKPASSTPDL  236

Query  610   SYILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALDISENQADTKSTgkglvigl  789
             S+ +D+R  LPE V  GF+ ATG  T    +  W F S+L++  + +     G     G 
Sbjct  237   SHTIDMRDILPEWVLTGFSAATGGCTEQHELRYWEFNSSLEVEVSNSTVGKDGLKSTTGS  296

Query  790   vvggcfliggS---------------MAFSFLAWRKRKMR-----EEFDDDIFGNIG---  900
                     GG+               M    + W   +M+     EE +D +F +     
Sbjct  297   NSTSTLRNGGANSTLLVGLLVGAGSLMGLLGMTWFIIRMKTKGDTEEMEDALFDDDSMND  356

Query  901   ELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSKQ  1080
             E   GAGPKRF + EL+RATN+F  + KLGEGGFG VY+G+L ++   VA+KRVS+ S+Q
Sbjct  357   EFEKGAGPKRFLFGELSRATNNFDAERKLGEGGFGGVYRGFLSDVNLEVAIKRVSKRSQQ  416

Query  1081  GIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLLTWPL  1260
             GIKEY SEV++ISR+RHKNLV L+GWCH+  + LLVYEF++NGSLDSHL+  K  LTW L
Sbjct  417   GIKEYMSEVKIISRLRHKNLVQLVGWCHQRNEFLLVYEFMTNGSLDSHLFGQKESLTWQL  476

Query  1261  RYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGSRT  1440
             RY I   LASALLYLHEE E+C++HRDIKSSN+MLDS+ NAKLGDFGLARLVDH + ++T
Sbjct  477   RYNIALGLASALLYLHEEWEQCVMHRDIKSSNVMLDSSFNAKLGDFGLARLVDHGQQAQT  536

Query  1441  TALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWVWK  1620
             T LAGTMGY+A ECV +GK+SKE+D+YSFGIV LEIACGR+P++P  E   V +++WVW+
Sbjct  537   TVLAGTMGYMAPECVATGKSSKESDVYSFGIVALEIACGRRPVEPWLETNKVRLIEWVWE  596

Query  1621  LYGTGQLLDAADPNLSG-DFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPLP  1797
             LYG   L++  DP L+   F+ +++E +M+VGLWCAHPD +LRPSI+QA+QVL+F+APLP
Sbjct  597   LYGREMLVEGIDPRLTNMGFDEKQLECLMVVGLWCAHPDSNLRPSIKQAMQVLSFQAPLP  656

Query  1798  DLPETMPVATFW-PQRNVQ  1851
             +LP  MPV  +  PQ +V+
Sbjct  657   NLPPKMPVPIYCVPQFSVR  675



>ref|XP_006426232.1| hypothetical protein CICLE_v10027177mg [Citrus clementina]
 gb|ESR39472.1| hypothetical protein CICLE_v10027177mg [Citrus clementina]
Length=658

 Score =   528 bits (1359),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 290/617 (47%), Positives = 401/617 (65%), Gaps = 24/617 (4%)
 Frame = +1

Query  31    IIPLVHPLSFNFDLFTPSNVQNITFERTSLVNNSI--QITPNQRNC-IGRATYSEPLHLW  201
             ++P  + +SF    F P N ++I ++  ++ +  +   I   Q  C +G ATY++ + LW
Sbjct  26    LVPSANSVSFRMSSFDP-NGKDIIYQGDAVPSVGVIELINRYQYVCRVGWATYADRVPLW  84

Query  202   DKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERL  381
             D  TG+L+ F+T F+F ID+     YG G  FFLAP G +IPPN+  GG  GL N     
Sbjct  85    DSDTGELTDFSTKFSFQIDTQSRPTYGHGLVFFLAPAGFQIPPNSA-GGFLGLFNTTTSF  143

Query  382   NSSNPFVAVEFDVYLN-HYDTE--QKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYD  552
             +SSN  V VEFD Y N  +D    Q HVGI+ +S+ S V   W+        ++  I Y+
Sbjct  144   SSSNHIVHVEFDTYFNREWDPSGVQDHVGINNNSIASAVHTRWNASFHSEDTADVRIAYN  203

Query  553   PRSMNLSVVFRNFGSYGHVS---------YILDLRKYLPERVTFGFAGATGKDTALQMIN  705
               + NLSV +    +Y   S         YI+DL K LP+ VT GF+ AT +     ++ 
Sbjct  204   STTKNLSVSW----TYRQTSDPRENTSLFYIIDLTKVLPQWVTIGFSAATSQFGERHILE  259

Query  706   SWIFTSALDI-SENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFDDD  882
             SW F+S+LDI S N  D K     + + + +G       +        +K++ +   + +
Sbjct  260   SWEFSSSLDIKSTNGTDGKKIRIIVGVTVSIGVLIAAAITGLLILRRRKKKERKSTAERE  319

Query  883   IFGNIGE-LGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKR  1059
                +I + L  GAGP+RF+Y +LA AT++F++  KLGEGGFGSVYKGYL +L+  VAVK+
Sbjct  320   TLTSINDDLERGAGPRRFSYTDLASATSNFAENKKLGEGGFGSVYKGYLIDLDMAVAVKK  379

Query  1060  VSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGK  1239
             VSRGSKQG KEY +EV+ IS++RH+ LV L+GWCH+  + LLVYEF+ NGSLD+HL+  K
Sbjct  380   VSRGSKQGKKEYVTEVKTISQLRHRYLVQLLGWCHDRGEFLLVYEFMPNGSLDAHLFGKK  439

Query  1240  SLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVD  1419
             S L W +RY+I   LA+ALLYL EE E+C++HRDIKSSNIMLDSN NAKLGDFGLARL+D
Sbjct  440   SPLAWAVRYRISLGLATALLYLQEEWEQCVLHRDIKSSNIMLDSNFNAKLGDFGLARLMD  499

Query  1420  HEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVN  1599
             HE G +TT LAGT+GY+A E + +G+ASKE+D++SFG+V LEIA GRK +D   +E  + 
Sbjct  500   HELGPKTTGLAGTLGYMAPEYISTGRASKESDVFSFGVVALEIATGRKAVD-RYKESEMG  558

Query  1600  IVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLN  1779
             +V WVW LYG G+LL AAD +L   F+ +++  ++IVGLW AHPD S RPSIRQAIQVL+
Sbjct  559   LVAWVWGLYGEGKLLSAADESLDSGFDEQQMTCLLIVGLWSAHPDRSFRPSIRQAIQVLS  618

Query  1780  FEAPLPDLPETMPVATF  1830
             FE  +P+LP  MPV ++
Sbjct  619   FETAMPNLPSKMPVPSY  635



>ref|XP_008459183.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
[Cucumis melo]
Length=652

 Score =   527 bits (1358),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 275/580 (47%), Positives = 374/580 (64%), Gaps = 29/580 (5%)
 Frame = +1

Query  145   PNQRNCIGRATYSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRI  324
             P   + +GR  Y + + +WD  T KL+ F+THF F ID+     YG G AFFLAP  S+I
Sbjct  62    PKSYSHVGRVIYKDTIPIWDSKTRKLTDFSTHFTFSIDTQNQTNYGSGIAFFLAPPDSQI  121

Query  325   PPNATKGGGFGLANDDERLNSSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWS  504
             P N+  GG  GL N   +    N  + VEFD ++N++D   +HVGI+++S+ S  T  ++
Sbjct  122   PTNSA-GGYLGLYNKTYKNTPINQILHVEFDTHINNWDPSYEHVGININSVSSSNTTHFN  180

Query  505   PDIEGGWGSEAWINYDPRSMNLSVVF---RNFGSYGH--VSYILDLRKYLPERVTFGFAG  669
                  G  ++ WI+Y   + NLSV +   R   S  +  +SY +DLR  L E VT G  G
Sbjct  181   VKSHSGDLADVWIDYRSTTKNLSVSWKYQRTSTSLENTTLSYHIDLRDILSEWVTVGITG  240

Query  670   ATGKDTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWR  849
             A G +     + SW F S LD+ +   D+ +    +V   V  G  +I     F  L W 
Sbjct  241   ANGANVERHTLFSWEFNSTLDMKQPSKDSGNKVSVIVAVTVSVGVSIIA---VFVVLWWL  297

Query  850   KRKMRE-------------EFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLG  990
             KR  R+               +DD       L  G GP+RF+ + LA ATN+FS + KLG
Sbjct  298   KRNKRKLGEEENLEEVNLTSINDD-------LETGVGPRRFSRKLLAMATNNFSNERKLG  350

Query  991   EGGFGSVYKGYLKELESYVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHEN  1170
             EGGFG+VY+GY+  ++  VAVK++S+GS+QG  EY +EV++ISR+RH+NLV LIGWCH+ 
Sbjct  351   EGGFGAVYRGYIPSIDLTVAVKKISKGSRQGRNEYITEVKIISRLRHRNLVQLIGWCHDK  410

Query  1171  KDLLLVYEFLSNGSLDSHLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKS  1350
              + LLVYEF+SNGSLDSHL+  ++ L W +RYKI   LASALLYLHEE E+C+VHRDIKS
Sbjct  411   GEFLLVYEFMSNGSLDSHLFGKRTPLGWTVRYKIALGLASALLYLHEEWEQCVVHRDIKS  470

Query  1351  SNIMLDSNLNAKLGDFGLARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFG  1530
             SN+MLDSN N KLGDFGLARL++HE  ++TT LAGT+GY+A E + + +ASKE+D++SFG
Sbjct  471   SNVMLDSNFNVKLGDFGLARLMEHELSAQTTRLAGTLGYLAPEYISTNRASKESDVFSFG  530

Query  1531  IVTLEIACGRKPIDPTAEECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIV  1710
             +V LEIA G+K      EE H  +V+WVW LYG+GQL    D  L  D++ ++VE +M+V
Sbjct  531   VVVLEIATGKKSRTSLEEESHKGLVEWVWDLYGSGQLHVGIDEKLHSDYDKKQVECLMLV  590

Query  1711  GLWCAHPDCSLRPSIRQAIQVLNFEAPLPDLPETMPVATF  1830
             GLW A+PD +LRPSIRQAIQVLNFE  +P+LP  MP+ T+
Sbjct  591   GLWSAYPDPNLRPSIRQAIQVLNFETMMPNLPNKMPIPTY  630



>gb|KHN33572.1| L-type lectin-domain containing receptor kinase IX.1 [Glycine 
soja]
Length=653

 Score =   527 bits (1357),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 287/623 (46%), Positives = 395/623 (63%), Gaps = 52/623 (8%)
 Frame = +1

Query  1     VGCffllllfIIPLVHPLSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPNQRNCIGRAT  177
             +G    +L F+IP   PL F+F  F  +    + FE   S  N  +Q+T  +++ +GR T
Sbjct  18    LGITIAILSFLIPHAAPLDFSFQQFL-NKESTLNFEGDVSYDNGLLQLTQLKKDSVGRVT  76

Query  178   YSEPLHLWDKPTGKLSSFNTHFAFVIDSNGSAKYGDGFAFFLA----PLGSRIPPNATKG  345
             Y +PLHLW K + KL+ F ++F+F+I+       GDG  FFLA    PL   IPP+   G
Sbjct  77    YYKPLHLWVKDSRKLTDFTSNFSFIINQPNKTHIGDGITFFLASPKFPL--PIPPD---G  131

Query  346   GGFGLANDDERLN----SSNPFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDI  513
              G  L +  +  +    + +PFVAVEFD + NH+D +  HVGI++ +++S  T      I
Sbjct  132   SGISLVSGQQMADPNYINEHPFVAVEFDTFWNHFDPQYDHVGINIKTIKSPFTTELF-SI  190

Query  514   EGGWGSEAWINYDPRSMNLSVVFR----NFGSYGHVSYILDLRKYLPERVTFGFAGATGK  681
               G   +A I+Y+  + NLS++F     N     H S ++DLR+ LP+ V FGF+ ATG 
Sbjct  191   NDGRVHDAQISYNSSTCNLSIIFTGYEDNVTVKQHYSQVIDLREVLPDWVEFGFSSATGL  250

Query  682   DTALQMINSWIFTSALDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKM  861
              + +  + SW F++ LD+  ++ ++ +     ++  +  G  ++   +  ++L   K K 
Sbjct  251   LSEIHTLCSWSFSANLDLKVHKDESNT----RMVIGLSIGGGVLVVGIGLAWLLKLKMKT  306

Query  862   REEFDDDIFGNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELES  1041
             R + DD       +   G GPKRF+Y EL R TN+F+ + KLGEGG              
Sbjct  307   RGKEDDLDLIMDSDFERGTGPKRFSYNELVRTTNNFANELKLGEGG--------------  352

Query  1042  YVAVKRVSRGSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDS  1221
                           ++EYASEV++IS++RH+NLV L+GWCH+  DLLL+YE + NGSLDS
Sbjct  353   --------------VEEYASEVKIISKLRHRNLVQLLGWCHKKNDLLLIYELMPNGSLDS  398

Query  1222  HLYKGKSLLTWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFG  1401
             HL+ GKSLLTW  RY I   LASALLYLHEE E+C++HRD+KSSN+MLDSN NAKLGDFG
Sbjct  399   HLFGGKSLLTWAARYNIAGGLASALLYLHEEWEQCVLHRDLKSSNVMLDSNFNAKLGDFG  458

Query  1402  LARLVDHEKGSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTA  1581
             LARLVDH KGS+TT LAGTMGY+A E    GKAS+E+D+YSFG+V LEIACGRKPI+  A
Sbjct  459   LARLVDHGKGSQTTVLAGTMGYMAPESATRGKASRESDVYSFGVVVLEIACGRKPIELRA  518

Query  1582  EECHVNIVDWVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQ  1761
              E  + +V+WVW+LYG G LL+AAD  L GDF+ + +E++MIVGLWCAHPD S RP+IR+
Sbjct  519   SEEQIVMVEWVWELYGMGNLLEAADSRLCGDFDEQAMERLMIVGLWCAHPDYSARPTIRE  578

Query  1762  AIQVLNFEAPLPDLPETMPVATF  1830
             A+ VLNFEA LP LP  MP AT+
Sbjct  579   AMHVLNFEAHLPTLPSKMPKATY  601



>dbj|BAK02100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=671

 Score =   528 bits (1359),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 290/614 (47%), Positives = 388/614 (63%), Gaps = 30/614 (5%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFERTSLVNNSIQITPNQR-----NCIGRATYSEPLHLWDKPTG  216
              ++NF   + S    I+F+  +  N  I++T ++R     +  GRA +S P+ L+D  + 
Sbjct  27    FTYNFTAVSDSAPSGISFQGDAFFNKFIRLTRDERVGPLTSSAGRAFFSRPIPLFDPVSR  86

Query  217   K-LSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSN  393
             +  S  +     +     SA  GDG AFFL+P  S + PN + GG  GL N   R N   
Sbjct  87    RPASFASAFSFSISAPEPSAASGDGLAFFLSPFPS-VLPNRSAGGLLGLFNSSAR-NGGR  144

Query  394   PFVAVEFDVYLNHYDTEQKHVGIDVDSLQSVVTAPWSPDIEGGWGSEAWINYDPRSMNLS  573
               VAVEFD Y N +D    HVGID+  + SV TA W   ++ G  + A + YD  + NL+
Sbjct  145   SLVAVEFDTYRNDWDPSDDHVGIDLGGIASVATADWPTSMKDGRTAHARVAYDAEAKNLT  204

Query  574   VVFRNFGSYGHVS-------YILDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSALD  732
             V      SYG          Y +DLR++LP+ V  GF+ ATG+   L  +  W FTS++D
Sbjct  205   VAL----SYGDAPPTDVLLWYAVDLREHLPDSVAVGFSAATGEAAELHKVLYWDFTSSVD  260

Query  733   ISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEF--DDDIFGN---I  897
               E     ++    +++GL      L+G  + +    WRK      +   DD  G     
Sbjct  261   SKE-----QTVMLWVILGLCGFLVVLVGAGVVWFVKEWRKTGECVPYVDIDDAMGYDELT  315

Query  898   GELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSRGSK  1077
              E    +GP+RF Y EL  ATN+FS+Q KLG+GGFG+VY+G+LKEL   VA+KRVS+GS 
Sbjct  316   DEFIVQSGPRRFRYAELVAATNNFSEQRKLGQGGFGAVYRGFLKELRQEVAIKRVSKGST  375

Query  1078  QGIKEYASEVRVISRIRHKNLVHLIGWCHENK-DLLLVYEFLSNGSLDSHLYKGKSLLTW  1254
             QG KEYA+EVR+IS++RH++LV L+GWCHE++ D LLVYE + NGS+D HLY     LTW
Sbjct  376   QGRKEYAAEVRIISQLRHRHLVRLVGWCHEHRGDFLLVYELMPNGSVDQHLYGKGVHLTW  435

Query  1255  PLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEKGS  1434
             P RY I   LASALLYLHEEC +CIVHRDIK SN+MLD+  +AKLGDFGLA+LV+H    
Sbjct  436   PTRYDIALGLASALLYLHEECLQCIVHRDIKPSNVMLDATFSAKLGDFGLAKLVEHGSQP  495

Query  1435  RTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVDWV  1614
              TT LAGT+GY+A EC+ +GKAS+E+D+YSFG+V LEIACGR+P +PTAE     +V WV
Sbjct  496   YTTVLAGTLGYLAPECLTTGKASRESDVYSFGVVALEIACGRQPSEPTAEPSKARLVPWV  555

Query  1615  WKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEAPL  1794
             W+LYG   LL+AAD  L G+F+ +++E +M+VGLWCAHPD + RPSIRQA+  L FEAPL
Sbjct  556   WELYGKKALLEAADWRLKGEFDEKQMEHLMVVGLWCAHPDYTHRPSIRQALNALKFEAPL  615

Query  1795  PDLPETMPVATFWP  1836
             P L   MPV TF+P
Sbjct  616   PVLAPKMPVPTFFP  629



>gb|KCW63380.1| hypothetical protein EUGRSUZ_G01019 [Eucalyptus grandis]
Length=664

 Score =   527 bits (1357),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 285/600 (48%), Positives = 382/600 (64%), Gaps = 26/600 (4%)
 Frame = +1

Query  52    LSFNFDLFTPSNVQNITFE-RTSLVNNSIQITPNQ-----RNCIGRATYSEPLHLWDKPT  213
             +SFNF  F  SN Q I F+   S++++ IQ+T  +      + +GRATY  P+HLWD  T
Sbjct  18    MSFNFPSFQ-SNDQRIIFQGNASVLDSKIQLTQGEPLECPTDAVGRATYQRPMHLWDSST  76

Query  214   GKLSSFNTHFAFVIDSNGSAKYGDGFAFFLAPLGSRIPPNATKGGGFGLANDDERLNSSN  393
             G ++ F ++F F IDS+ ++ + DG  FFLAP GS+IP + + G   GL N     N SN
Sbjct  77    GNVADFVSNFTFAIDSHRNSSHADGLVFFLAPNGSQIPEH-SDGCFLGLTNSTLNTNPSN  135

Query  394   PFVAVEFDVYL----NHYDTEQKHVGIDVDSLQSV--VTAPWSP-DIEGGWGSEAWINYD  552
              FVAVEFD +     N  D +  H+GIDV+SL SV      W   +I  G    A + Y+
Sbjct  136   AFVAVEFDTFYDRATNALDPQCDHIGIDVNSLDSVNKTCVSWMDYNILHGKKLHAQVTYN  195

Query  553   PRSMNLSVVFRNFGSYGHVSYI--LDLRKYLPERVTFGFAGATGKDTALQMINSWIFTSA  726
              R M+LSVVFR+        Y   L+L +YLPE V FGF+ +TG+      I SW F S+
Sbjct  196   SREMSLSVVFRDDAHNSTSLYYQPLNLTEYLPEWVVFGFSASTGQSLEAHTILSWKFNSS  255

Query  727   LDISENQADTKSTgkglviglvvggcfliggSMAFSFLAWRKRKMREEFD------DDIF  888
             L I +  +  K       + L +    L+     F    W   K+  E +      DD+ 
Sbjct  256   LQILDTPSGQKIKSWARGVILGLSPLVLLILVAGF---GWYYYKLEREKNGQSGGGDDVV  312

Query  889   GNIGELGGGAGPKRFTYRELARATNSFSQQDKLGEGGFGSVYKGYLKELESYVAVKRVSR  1068
             G         GPK+++YR LA AT++F+    LGEGGFG VY+G+L +  S+VA+K+++ 
Sbjct  313   GIDERFEQSKGPKKYSYRVLAMATSNFANTRLLGEGGFGEVYEGHLADENSHVAIKKITP  372

Query  1069  GSKQGIKEYASEVRVISRIRHKNLVHLIGWCHENKDLLLVYEFLSNGSLDSHLYKGKSLL  1248
              S QG+KEYA+EV+ I  +RHKNLV L+GW HE +  LLVYEF+SNGSLDSHL+K K+LL
Sbjct  373   ESNQGLKEYATEVKTIRNLRHKNLVELLGWSHEKEKFLLVYEFMSNGSLDSHLFKDKALL  432

Query  1249  TWPLRYKIVQDLASALLYLHEECEKCIVHRDIKSSNIMLDSNLNAKLGDFGLARLVDHEK  1428
             TW  RY I Q +A  L YLHE+ ++C+VHRDIKSSNI+LD+   AKLGDFGLAR+VDH K
Sbjct  433   TWGKRYSIAQGIALGLKYLHEDLKQCVVHRDIKSSNILLDAQFEAKLGDFGLARIVDHAK  492

Query  1429  GSRTTALAGTMGYIALECVVSGKASKETDIYSFGIVTLEIACGRKPIDPTAEECHVNIVD  1608
             GS+TT LAGTMGY+A EC+ + +ASKETD+YSFG+V LEI CGRK I+  A E  V +V+
Sbjct  493   GSQTTLLAGTMGYLAPECIYTSRASKETDVYSFGVVLLEIVCGRKAIELRASEDQVQLVE  552

Query  1609  WVWKLYGTGQLLDAADPNLSGDFNGREVEQMMIVGLWCAHPDCSLRPSIRQAIQVLNFEA  1788
             WVW+L+G G+LL+A DP L  +F+ R++E +MIVGLWC HPD   RP I + I  LNF+A
Sbjct  553   WVWELHGIGKLLNAVDPKLGENFDARQMECLMIVGLWCTHPDPKERPPISKVITFLNFDA  612



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6388251163432