BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25417_g1_i1 len=1273 path=[2131:0-38 2170:39-61 2193:62-90
2222:91-128 2260:129-152 2284:153-171 2303:172-214 2344:215-270
419:271-402 803:403-473 2598:474-497 6272:498-511 6286:512-534
2657:535-546 2669:547-574 6330:575-576 2698:577-578 6333:579-600
2722:601-627 6370:628-635 2756:636-699 2820:700-735 2856:736-771
6419:772-776 2896:777-790 6437:791-800 2920:801-819 2939:820-1013
3130:1014-1100 114:1101-1272]

Length=1273
                                                                      Score     E

sp|Q9LEH3.1|PER15_IPOBA  RecName: Full=Peroxidase 15; Short=Prx15...    567   0.0      Ipomoea batatas [batate]
gb|AAP42504.1|  anionic peroxidase swpa5                                567   0.0      Ipomoea batatas [batate]
gb|KDP24640.1|  hypothetical protein JCGZ_25556                         501   2e-173   
ref|XP_009784679.1|  PREDICTED: peroxidase 15-like                      493   3e-170   
ref|XP_009610510.1|  PREDICTED: peroxidase 15 {ECO:0000303|PubMed...    488   2e-168   
ref|XP_010257485.1|  PREDICTED: peroxidase A2-like                      484   5e-167   
ref|XP_002530724.1|  Peroxidase 53 precursor, putative                  484   5e-167   Ricinus communis
ref|XP_008240914.1|  PREDICTED: peroxidase A2-like                      482   4e-166   
ref|XP_011078985.1|  PREDICTED: peroxidase 15-like                      482   4e-166   
ref|XP_007029017.1|  Peroxidase 2                                       480   2e-165   
ref|XP_003521220.1|  PREDICTED: peroxidase 15-like                      479   3e-165   
ref|XP_007202211.1|  hypothetical protein PRUPE_ppa008390mg             479   6e-165   
emb|CDP10156.1|  unnamed protein product                                479   1e-164   
gb|KHN07440.1|  Peroxidase 15                                           478   1e-164   
ref|XP_010058197.1|  PREDICTED: peroxidase A2-like                      474   8e-163   
ref|XP_004251296.1|  PREDICTED: peroxidase 15-like                      473   1e-162   
ref|XP_009369457.1|  PREDICTED: peroxidase A2-like                      473   3e-162   
gb|KDO70903.1|  hypothetical protein CISIN_1g019976mg                   472   4e-162   
ref|XP_008387221.1|  PREDICTED: peroxidase A2-like                      472   5e-162   
ref|XP_007162335.1|  hypothetical protein PHAVU_001G143300g             471   7e-162   
ref|XP_006363346.1|  PREDICTED: peroxidase 15-like                      470   2e-161   
gb|AGF25268.1|  peroxidase 1                                            470   3e-161   
ref|XP_006492847.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    469   4e-161   
ref|XP_011039460.1|  PREDICTED: peroxidase A2-like                      469   7e-161   
ref|XP_006373791.1|  hypothetical protein POPTR_0016s05860g             468   2e-160   
ref|XP_003625275.1|  Peroxidase                                         469   2e-160   
emb|CDX98949.1|  BnaC09g48860D                                          464   4e-159   
gb|EYU20688.1|  hypothetical protein MIMGU_mgv1a009598mg                463   1e-158   
ref|XP_003553432.1|  PREDICTED: peroxidase 15-like                      463   1e-158   
gb|KHN45426.1|  Peroxidase 15                                           463   2e-158   
ref|XP_003535116.1|  PREDICTED: peroxidase 53-like                      460   2e-157   
gb|AFN41087.1|  peroxidase precursor                                    459   4e-157   
ref|XP_006399146.1|  hypothetical protein EUTSA_v10014029mg             459   4e-157   
ref|XP_008787874.1|  PREDICTED: peroxidase 15                           459   9e-157   
dbj|BAF33316.1|  peroxidase                                             458   1e-156   Populus alba [abele]
ref|XP_006288143.1|  hypothetical protein CARUB_v10001380mg             458   1e-156   
gb|AAM65211.1|  peroxidase                                              458   1e-156   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196290.1|  peroxidase 53                                         457   2e-156   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122283.1|  PREDICTED: peroxidase A2                           457   4e-156   
emb|CCJ34825.1|  horseradish peroxidase isoenzyme HRP_A2A               456   5e-156   
emb|CCJ34826.1|  horseradish peroxidase isoenzyme HRP_A2B               455   2e-155   
gb|KHN41710.1|  Peroxidase 53                                           454   3e-155   
gb|AFK39887.1|  unknown                                                 454   3e-155   
ref|XP_010491252.1|  PREDICTED: peroxidase 53                           454   4e-155   
ref|XP_010423310.1|  PREDICTED: peroxidase 53-like                      454   4e-155   
ref|XP_006399147.1|  hypothetical protein EUTSA_v10013916mg             455   5e-155   
ref|XP_006575205.1|  PREDICTED: peroxidase 53-like                      453   8e-155   
ref|XP_010520028.1|  PREDICTED: peroxidase A2-like                      453   1e-154   
ref|XP_006362277.1|  PREDICTED: peroxidase 15-like                      452   2e-154   
ref|XP_010452613.1|  PREDICTED: peroxidase 54                           453   3e-154   
ref|XP_004497888.1|  PREDICTED: peroxidase 53-like                      451   5e-154   
pdb|1PA2|A  Chain A, Arabidopsis Thaliana Peroxidase A2                 449   1e-153   
ref|XP_010491253.1|  PREDICTED: peroxidase 54-like                      451   2e-153   
ref|XP_002304885.1|  peroxidase family protein                          446   8e-152   Populus trichocarpa [western balsam poplar]
emb|CCJ34833.1|  horseradish peroxidase isoenzyme HRP_4663              446   2e-151   
gb|AHL39126.1|  class III peroxidase                                    445   2e-151   
gb|KEH41719.1|  peroxidase family protein                               444   3e-151   
gb|AAM66044.1|  peroxidase                                              445   4e-151   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006386069.1|  hypothetical protein POPTR_0003s21640g             444   5e-151   
ref|NP_196291.1|  peroxidase 54                                         442   3e-150   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004249178.1|  PREDICTED: peroxidase A2                           442   4e-150   
emb|CAA66037.1|  peroxidase                                             441   7e-150   Populus trichocarpa [western balsam poplar]
ref|XP_007145698.1|  hypothetical protein PHAVU_007G260700g             441   8e-150   
dbj|BAF33314.1|  peroxidase                                             439   2e-149   Populus alba [abele]
sp|P80679.1|PERA2_ARMRU  RecName: Full=Peroxidase A2                    438   3e-149   Armoracia rusticana [horseradish]
pir||S60054  peroxidase (EC 1.11.1.7) A3a precursor - Japanese as...    440   3e-149
ref|XP_004497889.1|  PREDICTED: peroxidase 53-like                      437   1e-148   
ref|XP_011025201.1|  PREDICTED: peroxidase A2-like                      437   4e-148   
ref|XP_007145699.1|  hypothetical protein PHAVU_007G260800g             434   2e-147   
gb|ABG46370.1|  rubber peroxidase 1                                     434   3e-147   Hevea brasiliensis [jebe]
emb|CDX70074.1|  BnaA10g24230D                                          435   4e-147   
emb|CDX98950.1|  BnaC09g48850D                                          434   5e-147   
ref|XP_009122284.1|  PREDICTED: peroxidase A2                           434   6e-147   
ref|XP_002873275.1|  peroxidase                                         432   8e-147   
ref|XP_009409636.1|  PREDICTED: peroxidase A2-like                      432   3e-146   
ref|XP_010058152.1|  PREDICTED: peroxidase A2-like                      429   2e-145   
ref|XP_006849541.1|  hypothetical protein AMTR_s00024p00166170          429   3e-145   
ref|XP_006492671.1|  PREDICTED: peroxidase 15-like                      429   4e-145   
ref|XP_009375132.1|  PREDICTED: peroxidase A2-like                      427   3e-144   
ref|XP_002285649.1|  PREDICTED: lignin-forming anionic peroxidase       426   4e-144   Vitis vinifera
ref|XP_010058168.1|  PREDICTED: peroxidase A2-like                      426   5e-144   
gb|AFY97686.1|  peroxidase 3                                            426   6e-144   
ref|XP_009375169.1|  PREDICTED: peroxidase A2-like                      426   6e-144   
dbj|BAA06335.1|  peroxidase                                             423   2e-143   Populus sieboldii x Populus grandidentata
gb|KDO62915.1|  hypothetical protein CISIN_1g018873mg                   424   3e-143   
ref|XP_006492677.1|  PREDICTED: peroxidase 15-like                      424   6e-143   
ref|XP_011025398.1|  PREDICTED: uncharacterized protein LOC105126277    436   7e-143   
ref|XP_006492672.1|  PREDICTED: peroxidase 15-like                      422   2e-142   
ref|XP_006494804.1|  PREDICTED: peroxidase 15-like                      422   3e-142   
ref|XP_002285652.2|  PREDICTED: peroxidase A2                           422   3e-142   Vitis vinifera
gb|AAR15704.3|  peroxidase                                              420   5e-142   Brassica napus [oilseed rape]
pdb|4A5G|A  Chain A, Raphanus Sativus Anionic Peroxidase                420   5e-142   
ref|XP_002279920.1|  PREDICTED: peroxidase A2                           421   7e-142   Vitis vinifera
ref|XP_007206842.1|  hypothetical protein PRUPE_ppa027053mg             420   9e-142   
ref|XP_008228052.1|  PREDICTED: peroxidase A2-like                      421   1e-141   
ref|XP_010257484.1|  PREDICTED: peroxidase 15-like                      419   1e-141   
ref|XP_007207695.1|  hypothetical protein PRUPE_ppa023946mg             419   1e-141   
gb|KDP44301.1|  hypothetical protein JCGZ_19168                         420   3e-141   
ref|XP_006492673.1|  PREDICTED: peroxidase 15-like                      418   2e-140   
ref|XP_010937006.1|  PREDICTED: peroxidase 15-like                      417   2e-140   
gb|ABG49115.1|  peroxidase                                              416   5e-140   Citrus maxima [buntan]
ref|XP_010058176.1|  PREDICTED: peroxidase A2-like                      416   6e-140   
ref|XP_009381003.1|  PREDICTED: peroxidase A2-like                      415   1e-139   
ref|XP_002299142.2|  hypothetical protein POPTR_0001s04840g             414   2e-139   Populus trichocarpa [western balsam poplar]
ref|XP_006492678.1|  PREDICTED: peroxidase 15-like                      415   2e-139   
ref|XP_008228153.1|  PREDICTED: peroxidase 15-like                      413   3e-139   
ref|XP_008798950.1|  PREDICTED: peroxidase 15-like                      412   7e-139   
ref|XP_010111368.1|  Peroxidase 53                                      412   1e-138   
ref|XP_008390167.1|  PREDICTED: peroxidase A2-like                      411   1e-138   
ref|XP_007205419.1|  hypothetical protein PRUPE_ppa007654mg             412   2e-138   
ref|XP_009620837.1|  PREDICTED: lignin-forming anionic peroxidase       411   2e-138   
ref|XP_010058158.1|  PREDICTED: peroxidase A2-like                      411   3e-138   
ref|XP_010265937.1|  PREDICTED: peroxidase A2-like                      411   3e-138   
dbj|BAA11853.1|  peroxidase                                             410   1e-137   Populus nigra [black poplar]
gb|AHL39106.1|  class III peroxidase                                    409   2e-137   
gb|KHG02293.1|  Peroxidase 15                                           409   2e-137   
ref|XP_010058186.1|  PREDICTED: peroxidase A2-like                      409   3e-137   
ref|XP_008227949.1|  PREDICTED: peroxidase A2-like isoform X2           410   1e-136   
gb|ACI03400.1|  peroxidase 2                                            408   1e-136   Litchi chinensis [litchi]
ref|XP_007205439.1|  hypothetical protein PRUPE_ppa007826mg             408   1e-136   
ref|XP_008229447.1|  PREDICTED: peroxidase A2-like                      407   2e-136   
ref|XP_011037955.1|  PREDICTED: peroxidase A2-like                      406   5e-136   
dbj|BAF33315.1|  peroxidase                                             405   1e-135   Populus alba [abele]
ref|XP_008352115.1|  PREDICTED: peroxidase A2-like                      405   1e-135   
ref|XP_002299141.2|  hypothetical protein POPTR_0001s04820g             405   1e-135   Populus trichocarpa [western balsam poplar]
emb|CAA66034.1|  peroxidase                                             404   3e-135   Populus trichocarpa [western balsam poplar]
ref|XP_008227874.1|  PREDICTED: peroxidase A2-like isoform X1           406   1e-134   
ref|XP_002299144.2|  hypothetical protein POPTR_0001s04850g             402   1e-134   Populus trichocarpa [western balsam poplar]
ref|XP_009766291.1|  PREDICTED: lignin-forming anionic peroxidase...    402   1e-134   
emb|CAA66035.1|  peroxidase                                             402   1e-134   Populus trichocarpa [western balsam poplar]
ref|XP_008363339.1|  PREDICTED: peroxidase A2-like                      402   2e-134   
ref|XP_011037954.1|  PREDICTED: peroxidase E5-like                      402   2e-134   
gb|AAL92037.1|AF488305_1  apoplastic anionic gaiacol peroxidase         402   2e-134   Gossypium hirsutum [American cotton]
pdb|4CUO|A  Chain A, Banyan Peroxidase With Glycosylation               400   3e-134   
ref|XP_002299152.2|  hypothetical protein POPTR_0001s05050g             401   3e-134   Populus trichocarpa [western balsam poplar]
ref|XP_006354190.1|  PREDICTED: lignin-forming anionic peroxidase...    400   5e-134   
dbj|BAA11852.1|  peroxidase                                             400   9e-134   Populus nigra [black poplar]
ref|XP_002304884.1|  hypothetical protein POPTR_0003s21610g             400   1e-133   Populus trichocarpa [western balsam poplar]
gb|AHL39125.1|  class III peroxidase                                    400   1e-133   
ref|XP_008352125.1|  PREDICTED: peroxidase A2-like                      400   1e-133   
ref|XP_007014789.1|  Peroxidase superfamily protein, putative           400   1e-133   
ref|XP_006492676.1|  PREDICTED: peroxidase C3-like isoform X3           399   5e-133   
ref|XP_008344683.1|  PREDICTED: peroxidase A2-like                      399   5e-133   
ref|XP_009404154.1|  PREDICTED: peroxidase A2-like                      397   6e-133   
ref|XP_009763841.1|  PREDICTED: lignin-forming anionic peroxidase       397   9e-133   
ref|XP_004295156.1|  PREDICTED: peroxidase 15-like                      397   1e-132   
ref|XP_006492674.1|  PREDICTED: peroxidase C3-like isoform X1           397   1e-132   
gb|KDO62916.1|  hypothetical protein CISIN_1g018871mg                   397   2e-132   
pir||S60055  peroxidase (EC 1.11.1.7) A4a precursor - Japanese as...    397   2e-132
ref|XP_009375114.1|  PREDICTED: peroxidase A2-like                      396   2e-132   
ref|XP_009364089.1|  PREDICTED: peroxidase A2-like                      396   2e-132   
sp|P11965.1|PERX_TOBAC  RecName: Full=Lignin-forming anionic pero...    395   4e-132   Nicotiana tabacum [American tobacco]
ref|XP_006492675.1|  PREDICTED: peroxidase C3-like isoform X2           396   4e-132   
gb|AFU51540.1|  anionic peroxidase                                      395   4e-132   
pir||JQ2217  peroxidase (EC 1.11.1.7) precursor, anionic - Japane...    395   5e-132
gb|AAL58444.1|AF455807_1  anionic peroxidase                            395   5e-132   Nicotiana tomentosiformis
dbj|BAA01992.1|  peroxidase                                             394   8e-132   Nicotiana tabacum [American tobacco]
dbj|BAD97836.2|  peroxidase                                             394   2e-131   Populus alba [abele]
emb|CAA66036.1|  peroxidase                                             394   2e-131   Populus trichocarpa [western balsam poplar]
ref|XP_002299145.1|  peroxidase family protein                          393   2e-131   Populus trichocarpa [western balsam poplar]
gb|KDO62910.1|  hypothetical protein CISIN_1g018796mg                   394   3e-131   
ref|XP_006354189.1|  PREDICTED: lignin-forming anionic peroxidase...    393   3e-131   
gb|KHG23473.1|  Peroxidase 15                                           394   3e-131   
ref|NP_001234132.1|  peroxidase precursor                               393   4e-131   
emb|CAB67121.1|  peroxidase                                             391   2e-130   Solanum lycopersicum
ref|XP_011037953.1|  PREDICTED: peroxidase 15-like                      390   3e-130   
gb|AAB47602.1|  peroxidase                                              391   4e-130   Linum usitatissimum
ref|XP_008354993.1|  PREDICTED: peroxidase 15-like                      390   5e-130   
dbj|BAF33313.1|  peroxidase                                             390   5e-130   Populus alba [abele]
ref|XP_006492732.1|  PREDICTED: peroxidase 15-like                      388   2e-129   
ref|XP_010109818.1|  Peroxidase 54                                      389   2e-129   
gb|AHL39111.1|  class III peroxidase                                    389   2e-129   
dbj|BAF33317.1|  peroxidase                                             387   3e-129   Populus alba [abele]
ref|XP_008352139.1|  PREDICTED: peroxidase 15-like                      388   3e-129   
gb|EYU17994.1|  hypothetical protein MIMGU_mgv1a025866mg                387   3e-129   
ref|XP_008344212.1|  PREDICTED: lignin-forming anionic peroxidase...    388   4e-129   
ref|XP_002304018.2|  hypothetical protein POPTR_0003s21600g             388   7e-129   Populus trichocarpa [western balsam poplar]
ref|XP_006649693.1|  PREDICTED: peroxidase 15-like                      387   1e-128   
ref|XP_011025199.1|  PREDICTED: peroxidase A2-like                      387   1e-128   
ref|XP_007147501.1|  hypothetical protein PHAVU_006G129900g             387   2e-128   
ref|XP_007147498.1|  hypothetical protein PHAVU_006G129600g             387   3e-128   
gb|AAD37427.1|AF149277_1  peroxidase 1 precursor                        386   3e-128   Phaseolus vulgaris [French bean]
dbj|BAA06334.1|  peroxidase                                             385   3e-128   Populus sieboldii x Populus grandidentata
ref|XP_007147502.1|  hypothetical protein PHAVU_006G130000g             385   5e-128   
dbj|BAD97438.1|  peroxidase                                             385   1e-127   Pisum sativum [garden pea]
gb|KEH37050.1|  peroxidase family protein                               384   2e-127   
gb|KDP44300.1|  hypothetical protein JCGZ_19167                         384   3e-127   
gb|AFK35177.1|  unknown                                                 383   5e-127   
gb|KHN22987.1|  Peroxidase 15                                           383   6e-127   
ref|NP_001242766.1|  uncharacterized protein LOC100804829 precursor     382   8e-127   
gb|AES64746.2|  peroxidase family protein                               382   1e-126   
ref|XP_009386276.1|  PREDICTED: peroxidase A2-like                      381   1e-126   
dbj|BAK05179.1|  predicted protein                                      381   2e-126   
ref|NP_001049482.1|  Os03g0234900                                       381   2e-126   Oryza sativa Japonica Group [Japonica rice]
gb|KHG17888.1|  Peroxidase 15                                           376   6e-126   
emb|CBI16466.3|  unnamed protein product                                379   1e-125   
gb|AII99873.1|  peroxidase                                              380   1e-125   
ref|XP_004228671.1|  PREDICTED: lignin-forming anionic peroxidase...    379   2e-125   
emb|CAA62227.1|  peroxidase1C                                           379   2e-125   Medicago sativa [alfalfa]
dbj|BAD97437.1|  peroxidase                                             379   4e-125   Pisum sativum [garden pea]
ref|XP_004985087.1|  PREDICTED: peroxidase 15-like                      379   6e-125   
ref|XP_003594495.1|  Peroxidase                                         384   7e-125   
gb|AAO13837.1|AF403735_1  extensin peroxidase                           378   7e-125   Lupinus albus
gb|AFK40247.1|  unknown                                                 376   3e-124   
gb|AGN03454.1|  class III secretory peroxidase                          374   1e-123   
gb|AFK40001.1|  unknown                                                 374   2e-123   
ref|XP_008679463.1|  PREDICTED: uncharacterized protein LOC100192...    374   2e-123   
gb|ABK22032.1|  unknown                                                 373   2e-123   Picea sitchensis
ref|XP_007014794.1|  Peroxidase 2, putative                             373   2e-123   
emb|CAA62226.1|  peroxidase1B                                           374   3e-123   Medicago sativa [alfalfa]
gb|KEH37049.1|  peroxidase family protein                               373   4e-123   
ref|XP_007014795.1|  Peroxidase 2, putative                             372   5e-123   
dbj|BAD97439.1|  peroxidase                                             373   5e-123   Pisum sativum [garden pea]
ref|XP_006597070.1|  PREDICTED: peroxidase, pathogen-induced isof...    385   6e-123   
gb|AII99875.1|  peroxidase                                              380   1e-122   
ref|XP_002465591.1|  hypothetical protein SORBIDRAFT_01g041770          371   1e-122   Sorghum bicolor [broomcorn]
gb|AFK35578.1|  unknown                                                 372   1e-122   
gb|AAL85344.1|AF479623_1  peroxidase                                    372   2e-122   Ficus carica
gb|AES64745.2|  peroxidase family protein                               371   3e-122   
ref|XP_003594494.1|  Peroxidase                                         385   5e-122   
gb|AAB41810.1|  peroxidase                                              370   6e-122   Medicago sativa [alfalfa]
ref|XP_004486564.1|  PREDICTED: uncharacterized protein LOC101505702    382   1e-121   
ref|XP_010102453.1|  Peroxidase 15                                      370   1e-121   
gb|AII99874.1|  peroxidase                                              369   2e-121   
gb|KHN22991.1|  Peroxidase 15                                           368   3e-121   
gb|KFK25059.1|  hypothetical protein AALP_AA8G061200                    364   4e-121   
emb|CCJ34830.1|  horseradish peroxidase isoenzyme HRP_22684.2           367   6e-121   
emb|CCJ34829.1|  horseradish peroxidase isoenzyme HRP_22684.1           367   6e-121   
gb|ACJ84393.1|  unknown                                                 367   1e-120   Medicago truncatula
gb|KFK26225.1|  hypothetical protein AALP_AA8G219000                    366   1e-120   
ref|XP_003594491.1|  Peroxidase                                         367   1e-120   
gb|AAB41811.1|  peroxidase                                              367   1e-120   Medicago sativa [alfalfa]
ref|XP_003594497.1|  Peroxidase                                         367   2e-120   
gb|AFK40933.1|  unknown                                                 367   2e-120   
ref|XP_003561851.1|  PREDICTED: peroxidase A2-like                      365   3e-120   
gb|EMT06857.1|  Peroxidase 53                                           365   3e-120   
ref|XP_006289358.1|  hypothetical protein CARUB_v10002844mg             365   4e-120   
gb|AII99877.1|  peroxidase                                              365   6e-120   
ref|XP_007147500.1|  hypothetical protein PHAVU_006G129800g             365   7e-120   
ref|XP_003594498.1|  Peroxidase                                         364   1e-119   
gb|AAM60837.1|  peroxidase                                              363   2e-119   
gb|KHN14342.1|  Peroxidase 15                                           364   2e-119   
emb|CDY35844.1|  BnaC09g37760D                                          362   4e-119   
emb|CAC38073.1|  peroxidase1A                                           362   6e-119   Medicago sativa [alfalfa]
ref|XP_007147494.1|  hypothetical protein PHAVU_006G129200g             362   9e-119   
ref|XP_006400552.1|  hypothetical protein EUTSA_v10014083mg             361   9e-119   
ref|XP_009120849.1|  PREDICTED: peroxidase 58                           361   1e-118   
gb|AFK47226.1|  unknown                                                 361   2e-118   
ref|XP_007147503.1|  hypothetical protein PHAVU_006G130100g             361   2e-118   
emb|CDX92493.1|  BnaA10g15320D                                          360   4e-118   
gb|AII99879.1|  peroxidase                                              360   5e-118   
ref|XP_004151584.1|  PREDICTED: peroxidase 2-like                       360   5e-118   
emb|CAA62225.1|  peroxidase1A                                           360   8e-118   Medicago sativa [alfalfa]
ref|XP_003594492.1|  Peroxidase                                         360   9e-118   
ref|XP_008467328.1|  PREDICTED: peroxidase 2-like                       359   1e-117   
ref|NP_197488.1|  peroxidase                                            358   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003594485.1|  Peroxidase                                         359   1e-117   
ref|XP_009759099.1|  PREDICTED: peroxidase N                            358   1e-117   
ref|XP_010454278.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    358   2e-117   
gb|ABK28706.1|  unknown                                                 358   2e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KHN14345.1|  Peroxidase 22                                           358   2e-117   
ref|XP_006828876.1|  hypothetical protein AMTR_s00001p00177360          357   3e-117   
gb|AII99876.1|  peroxidase                                              358   4e-117   
ref|XP_010509180.1|  PREDICTED: peroxidase 22-like                      358   4e-117   
ref|XP_006295915.1|  hypothetical protein CARUB_v10025052mg             357   6e-117   
ref|XP_009620838.1|  PREDICTED: peroxidase N                            357   6e-117   
ref|XP_004486565.1|  PREDICTED: uncharacterized protein LOC101506026    369   6e-117   
emb|CDY70137.1|  BnaAnng32690D                                          357   8e-117   
ref|NP_001237377.1|  peroxidase, pathogen-induced precursor             357   9e-117   
gb|KGN54099.1|  hypothetical protein Csa_4G285750                       357   9e-117   
ref|XP_008449779.1|  PREDICTED: peroxidase 2-like                       355   1e-116   
ref|XP_006586831.1|  PREDICTED: uncharacterized protein LOC100814455    368   2e-116   
ref|XP_009126398.1|  PREDICTED: peroxidase 58-like                      355   2e-116   
ref|NP_001284470.1|  peroxidase 2-like precursor                        356   2e-116   
ref|XP_004143733.1|  PREDICTED: lignin-forming anionic peroxidase...    355   2e-116   
ref|XP_002304020.2|  peroxidase family protein                          355   2e-116   Populus trichocarpa [western balsam poplar]
gb|AHL39128.1|  class III peroxidase                                    355   2e-116   
ref|XP_011025200.1|  PREDICTED: peroxidase N                            355   3e-116   
ref|XP_004162016.1|  PREDICTED: peroxidase 2-like                       355   3e-116   
ref|NP_001131290.1|  uncharacterized protein LOC100192603 precursor     356   3e-116   
ref|XP_010520602.1|  PREDICTED: peroxidase E5-like                      355   4e-116   
ref|NP_181372.1|  peroxidase 22                                         355   4e-116   
ref|XP_009133252.1|  PREDICTED: peroxidase 22-like                      355   4e-116   
dbj|BAC42706.1|  putative peroxidase                                    354   6e-116   
ref|XP_003594487.1|  Peroxidase                                         355   7e-116   
gb|KHN14341.1|  Peroxidase C3                                           355   8e-116   
ref|XP_010535901.1|  PREDICTED: peroxidase E5-like                      354   8e-116   
emb|CDY68097.1|  BnaA10g29690D                                          353   9e-116   
emb|CDY35845.1|  BnaC09g37770D                                          353   1e-115   
gb|ACU19085.1|  unknown                                                 354   1e-115   
ref|XP_004228346.1|  PREDICTED: peroxidase N-like                       353   1e-115   
ref|XP_003594502.1|  Peroxidase                                         354   1e-115   
ref|NP_001242517.1|  uncharacterized protein LOC100804765 precursor     354   1e-115   
gb|KHN22986.1|  Peroxidase 22                                           354   2e-115   
gb|KEH32489.1|  peroxidase family protein                               353   2e-115   
gb|KGN54100.1|  hypothetical protein Csa_4G285760                       354   2e-115   
ref|XP_009133251.1|  PREDICTED: peroxidase 22-like                      353   2e-115   
ref|XP_003594486.1|  Peroxidase                                         353   2e-115   
ref|XP_006400551.1|  hypothetical protein EUTSA_v10016025mg             352   2e-115   
ref|XP_004151583.1|  PREDICTED: peroxidase 2-like                       353   3e-115   
gb|AES64717.2|  peroxidase family protein                               353   3e-115   
gb|KHN14344.1|  Peroxidase 15                                           351   3e-115   
ref|XP_008449775.1|  PREDICTED: peroxidase 2-like                       353   4e-115   
gb|KHN14340.1|  Peroxidase 54                                           353   4e-115   
emb|CDY65894.1|  BnaCnng48990D                                          353   4e-115   
gb|KDP34262.1|  hypothetical protein JCGZ_12830                         351   6e-115   
ref|XP_010519956.1|  PREDICTED: peroxidase E5                           351   1e-114   
ref|XP_009120850.1|  PREDICTED: peroxidase 58-like                      350   1e-114   
emb|CDP17671.1|  unnamed protein product                                350   2e-114   
gb|KDO62912.1|  hypothetical protein CISIN_1g018796mg                   348   2e-114   
gb|AAA32842.1|  peroxidase                                              351   2e-114   
ref|XP_010517131.1|  PREDICTED: peroxidase 22                           350   3e-114   
sp|P17180.1|PER3_ARMRU  RecName: Full=Peroxidase C3; Flags: Precu...    350   3e-114   
ref|XP_010505461.1|  PREDICTED: peroxidase 22-like                      350   3e-114   
emb|CCJ34827.1|  horseradish peroxidase isoenzyme HRP_E5                350   4e-114   
ref|XP_003594466.1|  Peroxidase                                         354   4e-114   
ref|NP_001238315.1|  peroxidase precursor                               350   4e-114   
ref|XP_008344242.1|  PREDICTED: peroxidase A2-like                      350   4e-114   
ref|XP_004169999.1|  PREDICTED: peroxidase 2-like                       349   7e-114   
ref|XP_008449771.1|  PREDICTED: peroxidase 2-like                       350   8e-114   
gb|KFK36735.1|  hypothetical protein AALP_AA4G162800                    348   1e-113   
ref|XP_002534437.1|  Peroxidase C3 precursor, putative                  345   2e-113   
ref|NP_001239739.1|  uncharacterized protein LOC100812309 precursor     348   2e-113   
ref|XP_010535898.1|  PREDICTED: peroxidase 37-like                      348   2e-113   
ref|XP_002468211.1|  hypothetical protein SORBIDRAFT_01g041790          347   2e-113   
ref|XP_010519954.1|  PREDICTED: peroxidase C1C-like                     348   2e-113   
ref|XP_007147497.1|  hypothetical protein PHAVU_006G129500g             348   3e-113   
ref|XP_002879742.1|  hypothetical protein ARALYDRAFT_321537             348   3e-113   
ref|XP_010505460.1|  PREDICTED: peroxidase C3                           348   4e-113   
ref|XP_008660359.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase A...    347   4e-113   
gb|AAS00456.1|  acid isoperoxidase                                      344   4e-113   
ref|XP_010265936.1|  PREDICTED: peroxidase N                            347   4e-113   
ref|XP_009376683.1|  PREDICTED: peroxidase 59-like                      346   7e-113   
ref|NP_181373.1|  peroxidase 23                                         346   1e-112   
gb|AAM19121.1|AC103891_1  Putative peroxidase                           346   1e-112   
dbj|BAJ93823.1|  predicted protein                                      345   1e-112   
emb|CAG77503.1|  peroxidase precursor                                   346   2e-112   
ref|XP_007014796.1|  Peroxidase superfamily protein                     345   2e-112   
ref|XP_009141738.1|  PREDICTED: peroxidase C3-like                      346   2e-112   
ref|XP_010509181.1|  PREDICTED: peroxidase 23-like                      345   3e-112   
sp|P15232.1|PER1B_ARMRU  RecName: Full=Peroxidase C1B; Flags: Pre...    345   3e-112   
emb|CDY18388.1|  BnaA04g21990D                                          345   3e-112   
gb|EYU17993.1|  hypothetical protein MIMGU_mgv1a018276mg                343   3e-112   
ref|XP_010455290.1|  PREDICTED: peroxidase 37-like                      345   3e-112   
ref|XP_002464826.1|  hypothetical protein SORBIDRAFT_01g027330          345   4e-112   
gb|EAY89162.1|  hypothetical protein OsI_10658                          344   4e-112   
ref|XP_004983463.1|  PREDICTED: peroxidase 15-like                      345   4e-112   
ref|XP_008787878.1|  PREDICTED: peroxidase N                            344   5e-112   
ref|NP_001240914.1|  uncharacterized protein LOC100787073 precursor     344   5e-112   
sp|P59121.1|PERE5_ARMRU  RecName: Full=Peroxidase E5                    343   5e-112   
ref|XP_010043876.1|  PREDICTED: peroxidase N                            344   5e-112   
gb|AAQ67366.1|  POD9 precursor                                          343   6e-112   
ref|XP_004162078.1|  PREDICTED: peroxidase 2-like                       344   7e-112   
ref|XP_009141737.1|  PREDICTED: peroxidase C3                           344   8e-112   
ref|XP_007147496.1|  hypothetical protein PHAVU_006G129400g             344   9e-112   
ref|XP_004142149.1|  PREDICTED: peroxidase 2-like                       343   1e-111   
ref|XP_010939956.1|  PREDICTED: peroxidase N                            343   1e-111   
ref|XP_007154627.1|  hypothetical protein PHAVU_003G134600g             343   1e-111   
gb|KHG30456.1|  Peroxidase N                                            343   2e-111   
gb|KHN22992.1|  Peroxidase C3                                           343   2e-111   
dbj|BAA02840.1|  peroxidase                                             339   2e-111   
ref|XP_004983465.1|  PREDICTED: peroxidase 54-like                      343   2e-111   
emb|CCJ34822.1|  horseradish peroxidase isoenzyme HRP_25148.2(C1D)      343   2e-111   
ref|XP_010541735.1|  PREDICTED: peroxidase N                            342   3e-111   
pdb|1FHF|A  Chain A, The Structure Of Soybean Peroxidase                341   3e-111   
ref|XP_008351692.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    342   4e-111   
ref|XP_004142148.1|  PREDICTED: peroxidase 2-like                       342   4e-111   
ref|XP_004985088.1|  PREDICTED: peroxidase 15-like                      342   4e-111   
ref|XP_007147499.1|  hypothetical protein PHAVU_006G129700g             342   5e-111   
gb|ABY84191.1|  peroxidase precursor                                    341   5e-111   
ref|XP_010436317.1|  PREDICTED: peroxidase 37-like                      342   5e-111   
ref|NP_001267541.1|  peroxidase 2-like precursor                        341   6e-111   
ref|XP_010517132.1|  PREDICTED: peroxidase C3-like                      342   6e-111   
ref|XP_008449770.1|  PREDICTED: peroxidase 2-like                       342   6e-111   
emb|CDY54418.1|  BnaC04g56590D                                          342   6e-111   
emb|CDY54419.1|  BnaC04g56600D                                          341   7e-111   
ref|XP_006597050.1|  PREDICTED: uncharacterized protein LOC100804...    353   8e-111   
gb|KGN54104.1|  hypothetical protein Csa_4G285800                       341   9e-111   
ref|XP_004142144.1|  PREDICTED: peroxidase 2-like                       341   1e-110   
ref|XP_004507960.1|  PREDICTED: peroxidase N-like                       341   1e-110   
tpg|DAA46605.1|  TPA: peroxidase 54                                     341   1e-110   
emb|CCJ34821.1|  horseradish peroxidase isoenzyme HRP_25148.1(C1C)      342   1e-110   
gb|KFK39978.1|  hypothetical protein AALP_AA3G314000                    341   1e-110   
ref|XP_008228270.1|  PREDICTED: peroxidase 59                           340   1e-110   
emb|CDY05024.1|  BnaC03g28220D                                          341   1e-110   
ref|XP_010421788.1|  PREDICTED: peroxidase 37-like                      341   1e-110   
ref|XP_010515256.1|  PREDICTED: peroxidase 34                           341   2e-110   
ref|XP_002285642.1|  PREDICTED: peroxidase N isoform X2                 340   2e-110   
ref|NP_001148814.1|  LOC100282431 precursor                             340   2e-110   
ref|XP_003563126.1|  PREDICTED: peroxidase A2-like                      340   3e-110   
emb|CDX83066.1|  BnaA01g20660D                                          340   3e-110   
ref|XP_004295168.1|  PREDICTED: peroxidase N-like                       340   4e-110   
emb|CDX68508.1|  BnaC01g25860D                                          340   5e-110   
ref|XP_006404177.1|  hypothetical protein EUTSA_v10010494mg             340   6e-110   
ref|XP_002465590.1|  hypothetical protein SORBIDRAFT_01g041760          339   6e-110   
emb|CDY54347.1|  BnaA09g53760D                                          340   6e-110   
ref|XP_004162090.1|  PREDICTED: LOW QUALITY PROTEIN: lignin-formi...    339   7e-110   
gb|ABK22680.1|  unknown                                                 339   7e-110   
ref|XP_006411051.1|  hypothetical protein EUTSA_v10016868mg             339   7e-110   
ref|XP_008361464.1|  PREDICTED: peroxidase N-like                       338   9e-110   
ref|XP_002982182.1|  hypothetical protein SELMODRAFT_421525             338   9e-110   
gb|ABK21983.1|  unknown                                                 338   9e-110   
ref|XP_007206866.1|  hypothetical protein PRUPE_ppb006944mg             338   1e-109   
ref|XP_004142246.1|  PREDICTED: lignin-forming anionic peroxidase...    338   1e-109   
sp|P15233.1|PER1C_ARMRU  RecName: Full=Peroxidase C1C; Flags: Pre...    338   1e-109   
ref|XP_009151778.1|  PREDICTED: peroxidase 34                           338   1e-109   
sp|P00433.2|PER1A_ARMRU  RecName: Full=Peroxidase C1A; Flags: Pre...    339   1e-109   
ref|XP_008653195.1|  PREDICTED: peroxidase A2-like                      338   1e-109   
ref|XP_003549216.1|  PREDICTED: peroxidase N-like                       338   1e-109   
ref|XP_010087404.1|  Peroxidase 59                                      338   2e-109   
ref|XP_004228694.1|  PREDICTED: peroxidase N-like isoform X1            338   2e-109   
ref|XP_008449769.1|  PREDICTED: peroxidase N                            338   2e-109   
gb|AFW68953.1|  hypothetical protein ZEAMMB73_580252                    337   2e-109   
ref|NP_001064030.1|  Os10g0109300                                       338   2e-109   
ref|XP_009390336.1|  PREDICTED: peroxidase 59-like                      337   2e-109   
ref|XP_010535899.1|  PREDICTED: peroxidase E5-like                      338   2e-109   
emb|CDY54420.1|  BnaC04g56610D                                          338   2e-109   
ref|XP_008449774.1|  PREDICTED: peroxidase 2-like                       337   2e-109   
ref|XP_008449778.1|  PREDICTED: peroxidase 2                            337   3e-109   
ref|XP_004162079.1|  PREDICTED: peroxidase N-like                       337   3e-109   
ref|XP_004142143.1|  PREDICTED: peroxidase N-like                       337   4e-109   
emb|CAL25299.1|  properoxidase                                          337   4e-109   
ref|NP_001136844.1|  peroxidase 54 precursor                            337   4e-109   
ref|XP_010426416.1|  PREDICTED: peroxidase 34-like                      337   5e-109   
ref|XP_009113501.1|  PREDICTED: peroxidase C2                           337   5e-109   
ref|XP_006356455.1|  PREDICTED: peroxidase N-like                       338   7e-109   
ref|XP_010503561.1|  PREDICTED: peroxidase 34-like                      337   7e-109   
ref|XP_010515255.1|  PREDICTED: peroxidase 34-like                      337   8e-109   
ref|XP_006288094.1|  hypothetical protein CARUB_v10001325mg             336   9e-109   
emb|CCJ34828.1|  horseradish peroxidase isoenzyme HRP_1805              337   1e-108   
ref|NP_192617.1|  peroxidase 37                                         336   1e-108   
emb|CAL25298.1|  properoxidase                                          336   1e-108   
ref|XP_006492728.1|  PREDICTED: peroxidase 59-like                      335   2e-108   
ref|XP_011083137.1|  PREDICTED: peroxidase N                            335   2e-108   
gb|AAA33377.1|  HRPC1                                                   335   3e-108   
ref|XP_003549220.1|  PREDICTED: peroxidase N isoform X1                 334   3e-108   
ref|XP_009149762.1|  PREDICTED: peroxidase 34-like                      335   3e-108   
ref|XP_006397261.1|  hypothetical protein EUTSA_v10028769mg             335   3e-108   
ref|XP_006290443.1|  hypothetical protein CARUB_v10019421mg             335   3e-108   
ref|XP_009405166.1|  PREDICTED: peroxidase 59-like                      334   3e-108   
ref|XP_010503558.1|  PREDICTED: peroxidase 34-like isoform X1           335   4e-108   
gb|ACU24431.1|  unknown                                                 334   4e-108   
pdb|1GX2|A  Chain A, Recombinant Horseradish Peroxidase Phe209ser...    333   4e-108   
ref|XP_009364156.1|  PREDICTED: peroxidase N-like                       334   5e-108   
ref|XP_004142147.1|  PREDICTED: peroxidase 2-like                       334   5e-108   
sp|P17179.1|PER2_ARMRU  RecName: Full=Peroxidase C2; Flags: Precu...    334   5e-108   
pdb|3ATJ|A  Chain A, Heme Ligand Mutant Of Recombinant Horseradis...    333   5e-108   
ref|XP_002875944.1|  ATPCA/ATPRX33/PRX33                                334   5e-108   
ref|XP_002874387.1|  peroxidase C1C precursor                           335   6e-108   
gb|AAM97030.1|  peroxidase C2 precursor-like protein                    334   6e-108   
ref|XP_002874553.1|  hypothetical protein ARALYDRAFT_489772             334   6e-108   
gb|KDO56405.1|  hypothetical protein CISIN_1g020050mg                   333   7e-108   
pdb|1GWO|A  Chain A, Recombinant Horseradish Peroxidase C1a Ala17...    333   7e-108   
ref|XP_010316021.1|  PREDICTED: peroxidase N-like isoform X2            333   8e-108   
emb|CDX75140.1|  BnaC09g25420D                                          334   1e-107   
ref|NP_001146489.1|  uncharacterized protein LOC100280077 precursor     333   1e-107   
pdb|1W4W|A  Chain A, Ferric Horseradish Peroxidase C1a In Complex...    333   1e-107   
pdb|1GWU|A  Chain A, Recombinant Horseradish Peroxidase C1a Ala14...    332   1e-107   
emb|CAD92857.1|  peroxidase                                             333   1e-107   
pdb|2ATJ|A  Chain A, Recombinant Horseradish Peroxidase Complex W...    332   1e-107   
ref|XP_010455289.1|  PREDICTED: peroxidase 37                           333   1e-107   
pdb|1ATJ|A  Chain A, Recombinant Horseradish Peroxidase C1a             332   1e-107   
pdb|6ATJ|A  Chain A, Recombinant Horseradish Peroxidase C Complex...    332   1e-107   
gb|AAA72223.1|  synthetic horseradish peroxidase isoenzyme C (HRP...    332   1e-107   
ref|XP_006651197.1|  PREDICTED: peroxidase 54-like                      333   1e-107   
ref|XP_002872413.1|  hypothetical protein ARALYDRAFT_327109             333   2e-107   
ref|XP_010673530.1|  PREDICTED: peroxidase N-like                       332   2e-107   
emb|CAA66959.1|  peroxidase                                             333   2e-107   
ref|XP_004142145.1|  PREDICTED: peroxidase 53-like                      332   2e-107   
ref|XP_009408603.1|  PREDICTED: peroxidase N-like                       332   2e-107   
gb|AAM65571.1|  peroxidase ATP N                                        332   3e-107   
ref|XP_008449772.1|  PREDICTED: peroxidase 2-like                       333   3e-107   
sp|P19135.1|PER2_CUCSA  RecName: Full=Peroxidase 2; AltName: Full...    330   3e-107   
emb|CAA67092.1|  peroxidase                                             332   3e-107   
gb|KFK32116.1|  hypothetical protein AALP_AA6G200400                    333   3e-107   
ref|XP_006288095.1|  hypothetical protein CARUB_v10001326mg             332   3e-107   
ref|XP_006291411.1|  hypothetical protein CARUB_v10017550mg             332   4e-107   
pdb|1GW2|A  Chain A, Recombinant Horseradish Peroxidase C1a Thr17...    331   4e-107   
ref|NP_568385.1|  peroxidase 59                                         331   4e-107   
ref|XP_006409640.1|  hypothetical protein EUTSA_v10022759mg             332   5e-107   
pdb|2YLJ|A  Chain A, Horse Radish Peroxidase, Mutant S167y              330   6e-107   
ref|XP_004983464.1|  PREDICTED: peroxidase 15-like                      331   6e-107   
ref|NP_192618.1|  peroxidase 38                                         332   7e-107   
ref|XP_002872414.1|  hypothetical protein ARALYDRAFT_489775             332   7e-107   
gb|ABO93458.1|  peroxidase 32                                           332   7e-107   
ref|NP_850652.1|  Peroxidase family protein                             332   7e-107   
pdb|1QGJ|A  Chain A, Arabidopsis Thaliana Peroxidase N                  330   8e-107   
ref|XP_010503559.1|  PREDICTED: peroxidase 34-like isoform X2           332   8e-107   
ref|XP_009149763.1|  PREDICTED: peroxidase 34-like isoform X1           331   9e-107   
gb|EMT01499.1|  Peroxidase 54                                           331   1e-106   
gb|AAM64838.1|  peroxidase                                              331   1e-106   
emb|CDX81458.1|  BnaC09g08690D                                          332   1e-106   
gb|KGN54106.1|  hypothetical protein Csa_4G286310                       330   1e-106   
gb|EAY89165.1|  hypothetical protein OsI_10661                          330   1e-106   
gb|AAY81665.1|  peroxidase                                              331   1e-106   
ref|XP_006400553.1|  hypothetical protein EUTSA_v10014080mg             330   2e-106   
emb|CDY08110.1|  BnaA06g16160D                                          331   2e-106   
ref|XP_006409192.1|  hypothetical protein EUTSA_v10022774mg             330   2e-106   
pdb|4ATJ|A  Chain A, Distal Heme Pocket Mutant (H42e) Of Recombin...    329   2e-106   
ref|XP_010420808.1|  PREDICTED: peroxidase N                            330   2e-106   



>sp|Q9LEH3.1|PER15_IPOBA RecName: Full=Peroxidase 15; Short=Prx15; AltName: Full=Anionic 
peroxidase; Flags: Precursor [Ipomoea batatas]
 emb|CAB94692.1| peroxidase [Ipomoea batatas]
Length=327

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/327 (90%), Positives = 308/327 (94%), Gaps = 0/327 (0%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLI  226
             MASFS LLAMA+AIFIF S SNAQLSSTFYSTTCPNVS+IV TV+QQALQNDARIG SLI
Sbjct  1     MASFSPLLAMALAIFIFSSHSNAQLSSTFYSTTCPNVSAIVRTVVQQALQNDARIGGSLI  60

Query  227   RLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVS  406
             RLHFHDCFV+GCDGSLLLDNNGTTIVSEKDA  N NS RGFDVVDNIKTAVENACPGVVS
Sbjct  61    RLHFHDCFVDGCDGSLLLDNNGTTIVSEKDALPNTNSTRGFDVVDNIKTAVENACPGVVS  120

Query  407   CADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVG  586
             C DILALASES+VSLAGGPSWNVLLGRRD  TANQGGANTSLP+PF++L+NLT+KFTNVG
Sbjct  121   CVDILALASESSVSLAGGPSWNVLLGRRDRRTANQGGANTSLPSPFENLTNLTQKFTNVG  180

Query  587   LNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGST  766
             LNVNDLVALSGAHTFGRAQCRTF+ RLFNFSNTGNPDPTLNTTYLATLQQ+CPQGGSG T
Sbjct  181   LNVNDLVALSGAHTFGRAQCRTFSPRLFNFSNTGNPDPTLNTTYLATLQQICPQGGSGFT  240

Query  767   VTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFV  946
             VTNLDPTT DTFDNNYFSNLQ NRGLL+SDQELFSTSGA TIAIVNNFSANQTAFF+SFV
Sbjct  241   VTNLDPTTPDTFDNNYFSNLQTNRGLLQSDQELFSTSGAPTIAIVNNFSANQTAFFESFV  300

Query  947   QSMINMGNISPLTGSSGEIRLNCRRLN  1027
             QSMINMGNISPLTGS+GEIR NCRR N
Sbjct  301   QSMINMGNISPLTGSNGEIRSNCRRPN  327



>gb|AAP42504.1| anionic peroxidase swpa5 [Ipomoea batatas]
Length=327

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/327 (90%), Positives = 308/327 (94%), Gaps = 0/327 (0%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLI  226
             MASFS+LLAMA+AI IF S SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLI
Sbjct  1     MASFSSLLAMALAISIFLSHSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLI  60

Query  227   RLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVS  406
             RLHFHDCFVNGCDGS+LLDNNGTTIVSEKDAA NNNSARGFDVVDNIKTAVENACPGVVS
Sbjct  61    RLHFHDCFVNGCDGSILLDNNGTTIVSEKDAAPNNNSARGFDVVDNIKTAVENACPGVVS  120

Query  407   CADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVG  586
             CADILALASESAVSLA GPSWNVLLGRRD  TANQ GANTS+P PF+ LSN+T KF+NVG
Sbjct  121   CADILALASESAVSLASGPSWNVLLGRRDSRTANQAGANTSIPAPFESLSNITTKFSNVG  180

Query  587   LNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGST  766
             LNVNDLVALSGAHTFGRAQCRTF+NRLFNFSNTGNPD  L    L+TLQQVCPQGGSGST
Sbjct  181   LNVNDLVALSGAHTFGRAQCRTFSNRLFNFSNTGNPDSHLKHNLLSTLQQVCPQGGSGST  240

Query  767   VTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFV  946
             VTNLDPTT DTFD++YFSNLQNNRGLL+SDQELFSTSGAATIAIVN+FSANQTAFFQSFV
Sbjct  241   VTNLDPTTPDTFDSSYFSNLQNNRGLLQSDQELFSTSGAATIAIVNSFSANQTAFFQSFV  300

Query  947   QSMINMGNISPLTGSSGEIRLNCRRLN  1027
             QSMINMGNISPLTG+SGEIRLNCRR N
Sbjct  301   QSMINMGNISPLTGTSGEIRLNCRRPN  327



>gb|KDP24640.1| hypothetical protein JCGZ_25556 [Jatropha curcas]
Length=337

 Score =   501 bits (1290),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 257/324 (79%), Positives = 294/324 (91%), Gaps = 2/324 (1%)
 Frame = +2

Query  56    FSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLH  235
             + AL  + VAI I   QSNAQLS+TFY+TTCPNVS+IV+ VIQQALQ+D RIGASLIRLH
Sbjct  14    YLALKIILVAI-ILQHQSNAQLSATFYNTTCPNVSAIVTNVIQQALQSDPRIGASLIRLH  72

Query  236   FHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCAD  415
             FHDCFV+GCDGS+LLDN  ++I+SEK AA N NSARGFDVVDNIKTAVEN+CPGVVSCAD
Sbjct  73    FHDCFVDGCDGSILLDNT-SSILSEKFAAPNVNSARGFDVVDNIKTAVENSCPGVVSCAD  131

Query  416   IlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNV  595
             ILALA+E++VSLAGGPSW VL+GRRD  TANQGGANTS+P PFD L+N+T KF+ VGLN 
Sbjct  132   ILALAAEASVSLAGGPSWTVLVGRRDSQTANQGGANTSIPTPFDGLTNITSKFSAVGLNT  191

Query  596   NDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTN  775
             NDLVALSGAHTFGRAQCRTF+NRLFNFS TGNPDPTLNTTYLATLQQ+CPQGG+ S + N
Sbjct  192   NDLVALSGAHTFGRAQCRTFSNRLFNFSGTGNPDPTLNTTYLATLQQICPQGGNISALAN  251

Query  776   LDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSM  955
             LDPTT DTFD+NYF+NLQNN+GLL+SDQELFSTSGA+TI+IVN FS+NQTAFFQSFVQSM
Sbjct  252   LDPTTPDTFDSNYFTNLQNNQGLLQSDQELFSTSGASTISIVNTFSSNQTAFFQSFVQSM  311

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             INMGNISPLTGS+GEIR +C+++N
Sbjct  312   INMGNISPLTGSNGEIRADCKKVN  335



>ref|XP_009784679.1| PREDICTED: peroxidase 15-like [Nicotiana sylvestris]
Length=330

 Score =   493 bits (1268),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 251/327 (77%), Positives = 290/327 (89%), Gaps = 2/327 (1%)
 Frame = +2

Query  50    ASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIR  229
             +SF+ L  + +AIF F+ +SNAQLS+ FYSTTCPNVSSIV   IQQALQ+DARIGASLIR
Sbjct  5     SSFAVLCILLLAIFSFY-ESNAQLSANFYSTTCPNVSSIVQNAIQQALQSDARIGASLIR  63

Query  230   LHFHDCFVNGCDGSLLLDNNGTT-IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVS  406
             LHFHDCFVNGCD SLLLDNN T  IVSEKDAA N NSARGFDVVDNIK+AVE++CPGVVS
Sbjct  64    LHFHDCFVNGCDASLLLDNNATANIVSEKDAAPNANSARGFDVVDNIKSAVESSCPGVVS  123

Query  407   CADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVG  586
             CADILALA+E++VSLAGGPSWNV LGRRD  TANQGGANTS+P+PF+ LSN+T KF+ VG
Sbjct  124   CADILALAAEASVSLAGGPSWNVSLGRRDSRTANQGGANTSIPSPFEGLSNITAKFSAVG  183

Query  587   LNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGST  766
             LNV DLVALSGAHTFGRAQCR F+ RL NF+ TGNPDPTLNTTYLA L+Q+CPQ G+ + 
Sbjct  184   LNVTDLVALSGAHTFGRAQCRVFSARLNNFNGTGNPDPTLNTTYLANLRQICPQNGNATA  243

Query  767   VTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFV  946
             + NLDPTTSD+FDNNYF+NLQNN+GLL+SDQELFST+GAAT++IVN FS+NQ  FFQSFV
Sbjct  244   LANLDPTTSDSFDNNYFTNLQNNQGLLQSDQELFSTAGAATVSIVNTFSSNQNTFFQSFV  303

Query  947   QSMINMGNISPLTGSSGEIRLNCRRLN  1027
             QSMI MGNISPLTG++GEIR +C+R+N
Sbjct  304   QSMITMGNISPLTGTNGEIRSDCKRVN  330



>ref|XP_009610510.1| PREDICTED: peroxidase 15 {ECO:0000303|PubMed:17936696}-like [Nicotiana 
tomentosiformis]
Length=329

 Score =   488 bits (1256),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 249/323 (77%), Positives = 287/323 (89%), Gaps = 2/323 (1%)
 Frame = +2

Query  62    ALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFH  241
             A+L + +AIF F+ +SNAQLS+ FYSTTCPNVSSIV  VIQQALQ+D+RIGASLIRLHFH
Sbjct  8     AVLCILLAIFSFY-ESNAQLSANFYSTTCPNVSSIVQNVIQQALQSDSRIGASLIRLHFH  66

Query  242   DCFVNGCDGSLLLDNNGTT-IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADI  418
             DCFVNGCD SLLLDNN T  IVSEKDAA N NS RGFDVVDNIK+AVE++CPGVVSCADI
Sbjct  67    DCFVNGCDASLLLDNNSTANIVSEKDAAPNANSVRGFDVVDNIKSAVESSCPGVVSCADI  126

Query  419   lalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN  598
             LALA+E++VSLAGGPSWNV LGRRD  TANQGGANTS+P+P + LSN+T KF+ VGLNV 
Sbjct  127   LALAAEASVSLAGGPSWNVSLGRRDSRTANQGGANTSIPSPVEGLSNITAKFSAVGLNVT  186

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNL  778
             DLVALSGAHTFGRAQCR F+ RL NF+ TGNPDPTLNTTYLA L+Q+CPQ GS + + NL
Sbjct  187   DLVALSGAHTFGRAQCRVFSARLNNFNGTGNPDPTLNTTYLANLRQICPQNGSATALANL  246

Query  779   DPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMI  958
             DPTTSD+FDNNYF+NLQ+N+GLL+SDQELFST GAAT++IVN FS+NQ  FFQSFVQSMI
Sbjct  247   DPTTSDSFDNNYFANLQSNQGLLQSDQELFSTPGAATVSIVNTFSSNQNTFFQSFVQSMI  306

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
             NMGNISPLTG++GEIR +C+R+N
Sbjct  307   NMGNISPLTGTNGEIRSDCKRVN  329



>ref|XP_010257485.1| PREDICTED: peroxidase A2-like [Nelumbo nucifera]
Length=328

 Score =   484 bits (1247),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 243/308 (79%), Positives = 282/308 (92%), Gaps = 1/308 (0%)
 Frame = +2

Query  104   QSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLD  283
             +S+AQL++TFYS +CPNVSSIV  VIQQALQ+DAR GASLIRLHFHDCFVNGCDGS+LLD
Sbjct  20    RSSAQLNATFYSISCPNVSSIVRGVIQQALQSDARNGASLIRLHFHDCFVNGCDGSILLD  79

Query  284   NNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGP  463
             N+G+ I SEKDAA N NS RGFDVVD+IKTA+EN+CPGVVSCADILALA+E++VSLAGGP
Sbjct  80    NSGS-IQSEKDAAPNANSTRGFDVVDDIKTALENSCPGVVSCADILALAAEASVSLAGGP  138

Query  464   SWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQ  643
             SWNVLLGRRD TTANQ GANTS+P+PF++L+ +T KF+ VGL+  DLVALSGAHTFGRAQ
Sbjct  139   SWNVLLGRRDSTTANQAGANTSIPSPFENLTEITAKFSAVGLDTTDLVALSGAHTFGRAQ  198

Query  644   CRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSN  823
             CRTF++RL+NFS +GNPDPTLN++YLATLQQ CPQ GS +T+ NLDPTT DTFDNNYFSN
Sbjct  199   CRTFSSRLYNFSGSGNPDPTLNSSYLATLQQTCPQNGSSTTLANLDPTTPDTFDNNYFSN  258

Query  824   LQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEI  1003
             L+NN+GLL SDQEL STSGAATI+IVNNFSANQTAFFQSF QSMINMGNISPLTGSSG+I
Sbjct  259   LENNQGLLLSDQELLSTSGAATISIVNNFSANQTAFFQSFAQSMINMGNISPLTGSSGQI  318

Query  1004  RLNCRRLN  1027
             R +C+++N
Sbjct  319   RSDCKKVN  326



>ref|XP_002530724.1| Peroxidase 53 precursor, putative [Ricinus communis]
 gb|EEF31678.1| Peroxidase 53 precursor, putative [Ricinus communis]
Length=335

 Score =   484 bits (1247),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 239/329 (73%), Positives = 289/329 (88%), Gaps = 1/329 (0%)
 Frame = +2

Query  41    KKMASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGAS  220
             K  A+ ++LL   +   +  +QS AQLS+TFY++TCPN++SIV+  +QQA Q+D+RIGAS
Sbjct  6     KATATATSLLLSIIIAALVLNQSEAQLSTTFYASTCPNITSIVTNAVQQAFQSDSRIGAS  65

Query  221   LIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGV  400
             LIRLHFHDCFV+GCD S+LLD+  ++I SEK A  N NS RGF VVDNIKTA E++CPGV
Sbjct  66    LIRLHFHDCFVDGCDASILLDST-SSIQSEKLAGPNVNSTRGFGVVDNIKTAAESSCPGV  124

Query  401   VSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTN  580
             VSCADILAL++E++VSL+GGPSWNVLLGRRD  TANQ GANTS+P+PF+ L+N+T KFT 
Sbjct  125   VSCADILALSAEASVSLSGGPSWNVLLGRRDSLTANQAGANTSIPSPFEGLNNITSKFTA  184

Query  581   VGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSG  760
             VGLN NDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQ+CPQ G+ 
Sbjct  185   VGLNTNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQICPQNGNT  244

Query  761   STVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQS  940
             + + NLDPTT DTFDNNYF+NLQ+N+GLL+SDQELFST+GAAT++IVN+F+ NQTAFFQS
Sbjct  245   AALVNLDPTTPDTFDNNYFTNLQSNQGLLQSDQELFSTTGAATVSIVNSFAGNQTAFFQS  304

Query  941   FVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FVQSMINMGNISPLTGS+GEIR +C+++N
Sbjct  305   FVQSMINMGNISPLTGSNGEIRADCKKVN  333



>ref|XP_008240914.1| PREDICTED: peroxidase A2-like [Prunus mume]
Length=333

 Score =   482 bits (1241),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 234/314 (75%), Positives = 281/314 (89%), Gaps = 0/314 (0%)
 Frame = +2

Query  86    IFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCD  265
             + +    SNAQL++TFYS+TCPNV++IV +V+QQALQ+D+RIGASLIRLHFHDCFVNGCD
Sbjct  18    VLLMLYVSNAQLNTTFYSSTCPNVTTIVRSVVQQALQSDSRIGASLIRLHFHDCFVNGCD  77

Query  266   GSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesav  445
              S+LLD  G+  +SEKDAA N NS RGFDVVDNIKTAVEN+CP VVSCADILALA+E++V
Sbjct  78    ASILLDKGGSIQLSEKDAAPNTNSTRGFDVVDNIKTAVENSCPAVVSCADILALAAEASV  137

Query  446   slaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAH  625
             SL+GG SWNVLLGRRD  TANQ GANTS+P+P + L+N+T KF+ +GLN NDLVALSGAH
Sbjct  138   SLSGGISWNVLLGRRDSLTANQAGANTSIPSPVEGLANITSKFSALGLNTNDLVALSGAH  197

Query  626   TFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFD  805
             TFGRAQCRTF+NRL+NF+ TGNPDPTLN++YL TLQQ CPQ GSG+ + NLDPTT D+FD
Sbjct  198   TFGRAQCRTFSNRLYNFTGTGNPDPTLNSSYLTTLQQTCPQNGSGTALANLDPTTPDSFD  257

Query  806   NNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLT  985
             NNYFSNLQNN+GLL+SDQELFST+GAAT++IVN+FS+NQ+AFFQSF QSMINMGNISPL 
Sbjct  258   NNYFSNLQNNQGLLQSDQELFSTTGAATVSIVNSFSSNQSAFFQSFAQSMINMGNISPLV  317

Query  986   GSSGEIRLNCRRLN  1027
             GS+GEIRL+C+++N
Sbjct  318   GSNGEIRLDCKKVN  331



>ref|XP_011078985.1| PREDICTED: peroxidase 15-like [Sesamum indicum]
Length=332

 Score =   482 bits (1240),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 248/325 (76%), Positives = 281/325 (86%), Gaps = 1/325 (0%)
 Frame = +2

Query  56    FSALLAMAVAIFIFFSQ-SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             +S LL   +  F+   + S AQL+STFYS+TCPNVS+IV+TVIQQALQ+D RIGASLIRL
Sbjct  6     YSFLLIFTITSFLLLPRPSQAQLNSTFYSSTCPNVSNIVTTVIQQALQSDPRIGASLIRL  65

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFV GCDGS+LLD+N  +I SEKDAA N NS RGFDVVDNIKTAVEN+CPGVVSCA
Sbjct  66    HFHDCFVQGCDGSILLDDNNGSIQSEKDAAPNTNSTRGFDVVDNIKTAVENSCPGVVSCA  125

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALA++SAVSLAGGPSWNVLLGRRD  TANQ GANTS+P PF+ L+NLT KF+ VGLN
Sbjct  126   DILALAAQSAVSLAGGPSWNVLLGRRDSRTANQAGANTSIPAPFEPLTNLTAKFSAVGLN  185

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
             V DLVALSGAHTFGRAQCR F NRL+NFS +G PDPTLNTTYLATL+Q+CPQ GSG  V 
Sbjct  186   VTDLVALSGAHTFGRAQCRLFINRLYNFSGSGGPDPTLNTTYLATLRQICPQNGSGFVVA  245

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             NLD  T DTFDNNY+SNLQ+N GLL+SDQELFS+SGA TI IVN FS+NQ+AFF+SFVQS
Sbjct  246   NLDLRTPDTFDNNYYSNLQSNEGLLQSDQELFSSSGAPTIPIVNLFSSNQSAFFESFVQS  305

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MI MGNI+PLTGS+GEIR NCRR+N
Sbjct  306   MIKMGNITPLTGSNGEIRANCRRVN  330



>ref|XP_007029017.1| Peroxidase 2 [Theobroma cacao]
 gb|EOY09519.1| Peroxidase 2 [Theobroma cacao]
Length=331

 Score =   480 bits (1236),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 241/327 (74%), Positives = 286/327 (87%), Gaps = 2/327 (1%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLI  226
             +A+ S +L+  +  F+ + QS AQLS+TFY+TTCPN SSIV +VIQQALQ+D RIGASLI
Sbjct  5     IANSSFILSTILLTFLVY-QSKAQLSATFYATTCPNASSIVRSVIQQALQSDIRIGASLI  63

Query  227   RLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVS  406
             RLHFHDCFV+GCD S+LLDN+   I SEKDAA N NS RGF+VVDNIKTA+EN+CPG+VS
Sbjct  64    RLHFHDCFVDGCDASILLDNSAN-IQSEKDAAPNTNSTRGFNVVDNIKTALENSCPGIVS  122

Query  407   CADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVG  586
             CAD+LALA+ES+VSL GGPSW+VLLGRRD  TANQ GAN+S+P+PF+ LSN+T KF+ VG
Sbjct  123   CADVLALAAESSVSLQGGPSWSVLLGRRDSLTANQAGANSSIPSPFEGLSNITSKFSAVG  182

Query  587   LNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGST  766
             LN NDLVALSGAHTFGRAQCR F+NRL+NFS TGNPDPTL+++YL TL+Q+CPQ GSG  
Sbjct  183   LNTNDLVALSGAHTFGRAQCRLFSNRLYNFSGTGNPDPTLDSSYLTTLRQICPQSGSGFN  242

Query  767   VTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFV  946
             V NLDPTT DTFD+NYF+NLQNN+GLL+SDQELFST+GA TI+IVN FS NQTAFFQSF 
Sbjct  243   VANLDPTTPDTFDSNYFTNLQNNQGLLQSDQELFSTAGAPTISIVNTFSGNQTAFFQSFA  302

Query  947   QSMINMGNISPLTGSSGEIRLNCRRLN  1027
             QSMINMGNISPLTGSSGEIR +C+++N
Sbjct  303   QSMINMGNISPLTGSSGEIRADCKKVN  329



>ref|XP_003521220.1| PREDICTED: peroxidase 15-like [Glycine max]
Length=330

 Score =   479 bits (1234),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 243/328 (74%), Positives = 280/328 (85%), Gaps = 1/328 (0%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFF-SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASL  223
             M SF+ L      +  FF   SNAQLSSTFYS+TCPNVSSIV +V+QQALQ+D RI ASL
Sbjct  1     MFSFNYLFTTIFLVLTFFLYPSNAQLSSTFYSSTCPNVSSIVRSVVQQALQSDPRIAASL  60

Query  224   IRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVV  403
              RLHFHDCFVNGCDGS+LLD  G   +SEK A  NNNSARGFDVVDNIKT++EN+CPGVV
Sbjct  61    TRLHFHDCFVNGCDGSILLDVGGNITLSEKTAGPNNNSARGFDVVDNIKTSIENSCPGVV  120

Query  404   SCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNV  583
             SCADILALA+E +VSL GGPSWNVLLGRRDG  ANQ GANTS+PNP + L+N+T KF  V
Sbjct  121   SCADILALAAEVSVSLGGGPSWNVLLGRRDGLIANQSGANTSIPNPTESLANVTAKFAAV  180

Query  584   GLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGS  763
             GLN+ DLVALSGAH+FGRAQCR FN RLFNFS TG+PDPTLNTTYLATLQQ CPQ GSG+
Sbjct  181   GLNITDLVALSGAHSFGRAQCRFFNQRLFNFSGTGSPDPTLNTTYLATLQQNCPQNGSGN  240

Query  764   TVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSF  943
             T+ NLDP++ DTFDNNYF NL +N+GLL++DQELFST+GAAT+++VNNF+ANQTAFFQ+F
Sbjct  241   TLNNLDPSSPDTFDNNYFQNLLSNQGLLQTDQELFSTNGAATVSVVNNFAANQTAFFQAF  300

Query  944   VQSMINMGNISPLTGSSGEIRLNCRRLN  1027
              QSMINMGNISPLTGS GEIR +C+R+N
Sbjct  301   AQSMINMGNISPLTGSQGEIRSDCKRVN  328



>ref|XP_007202211.1| hypothetical protein PRUPE_ppa008390mg [Prunus persica]
 gb|EMJ03410.1| hypothetical protein PRUPE_ppa008390mg [Prunus persica]
Length=333

 Score =   479 bits (1233),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 235/321 (73%), Positives = 285/321 (89%), Gaps = 1/321 (0%)
 Frame = +2

Query  68    LAMAVA-IFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             L +A+  + +    SNAQL++TFYS+TCPNV++IV +V+QQALQ+D+RIGASLIRLHFHD
Sbjct  11    LPLAITFVLLMLYVSNAQLNTTFYSSTCPNVTTIVRSVVQQALQSDSRIGASLIRLHFHD  70

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCD S+LLD  G+  +SEKDAA N NS RGFDVVDNIKTAVEN+CP VVSCADILA
Sbjct  71    CFVNGCDASILLDKGGSIQLSEKDAAPNTNSTRGFDVVDNIKTAVENSCPAVVSCADILA  130

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LA+E++VSL+GG SWNVLLGRRD  TANQ GANTS+P+PF+ L+N+T KF+ VGLN NDL
Sbjct  131   LAAEASVSLSGGISWNVLLGRRDSLTANQAGANTSIPSPFEGLANITSKFSAVGLNTNDL  190

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             VALSGAHTFGRAQC+ F+NRL+NF+ TGNPDPTLN++YL TLQQ CPQ GSG+ + NLDP
Sbjct  191   VALSGAHTFGRAQCQRFSNRLYNFNGTGNPDPTLNSSYLTTLQQTCPQNGSGTALANLDP  250

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             TT D+FDN+YFSNLQNN+GLL+SDQELFST+GAAT++IVN+FS+NQ+AFFQSF QSMINM
Sbjct  251   TTPDSFDNSYFSNLQNNQGLLQSDQELFSTTGAATVSIVNSFSSNQSAFFQSFAQSMINM  310

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNISPL GS+GEIRL+C+++N
Sbjct  311   GNISPLVGSNGEIRLDCKKVN  331



>emb|CDP10156.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   479 bits (1234),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 246/335 (73%), Positives = 285/335 (85%), Gaps = 3/335 (1%)
 Frame = +2

Query  29    KLNPKKMASFSALLAMAVAIF--IFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQND  202
             K N  K  SF +L  +       I    SNAQL++TFYS TCPNVS+IV  VIQQALQ+D
Sbjct  22    KKNEMKTLSFPSLFVLTSFFLGAIQLHVSNAQLNATFYSNTCPNVSAIVQNVIQQALQSD  81

Query  203   ARIGASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVE  382
              RIGASLIRLHFHDCFV+GCD S+LLDNNGT + SEKDAA N NSARGFDVVD IKTAVE
Sbjct  82    PRIGASLIRLHFHDCFVDGCDASILLDNNGT-LRSEKDAAPNTNSARGFDVVDKIKTAVE  140

Query  383   NACPGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNL  562
             N+CPG+VSCAD+LALA+ES+VSL+GGPSWNVLLGRRD  TANQ GANTS+P PF+ LSN+
Sbjct  141   NSCPGIVSCADVLALAAESSVSLSGGPSWNVLLGRRDSKTANQAGANTSIPAPFESLSNI  200

Query  563   TRKFTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVC  742
             T KFT VGLN+NDLVALSGAHTFGRAQCR F++RL+NFS +GNPDP+LNTTYLATL+Q+C
Sbjct  201   TAKFTAVGLNINDLVALSGAHTFGRAQCRLFSSRLYNFSGSGNPDPSLNTTYLATLRQIC  260

Query  743   PQGGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQ  922
             PQ GS + + NLD TT +TFDNNYFSNLQ N+GLL+SDQELFST GAATI+IVN FS+NQ
Sbjct  261   PQNGSTTALANLDFTTPNTFDNNYFSNLQTNQGLLQSDQELFSTPGAATISIVNTFSSNQ  320

Query  923   TAFFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
              AFFQSF QSMINMGNISPLTG++GEIR +C+++N
Sbjct  321   NAFFQSFAQSMINMGNISPLTGTNGEIRSDCKKVN  355



>gb|KHN07440.1| Peroxidase 15 [Glycine soja]
Length=330

 Score =   478 bits (1230),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 242/328 (74%), Positives = 279/328 (85%), Gaps = 1/328 (0%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFF-SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASL  223
             M SF+ L      +  FF   SNAQLSSTFYS+TCPNVSSIV +V+QQALQ+D RI ASL
Sbjct  1     MFSFNYLFTTIFLVLTFFLYPSNAQLSSTFYSSTCPNVSSIVRSVVQQALQSDPRIAASL  60

Query  224   IRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVV  403
              RLHFHDCFVNGCDGS+LLD  G   +SEK A  NNNSARGFDVVDNIKT++EN+CPGVV
Sbjct  61    TRLHFHDCFVNGCDGSILLDVGGNITLSEKTAGPNNNSARGFDVVDNIKTSIENSCPGVV  120

Query  404   SCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNV  583
             SCADILALA+E +VSL GGPSWNVLLGRRDG  ANQ GANTS+PNP + L+N+T KF  V
Sbjct  121   SCADILALAAEVSVSLGGGPSWNVLLGRRDGLIANQSGANTSIPNPTESLANVTAKFAAV  180

Query  584   GLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGS  763
             GLN+ DLVALSGAH+FGRAQCR FN RLFNFS TG+PDPTLN TYLATLQQ CPQ GSG+
Sbjct  181   GLNITDLVALSGAHSFGRAQCRFFNQRLFNFSGTGSPDPTLNATYLATLQQNCPQNGSGN  240

Query  764   TVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSF  943
             T+ NLDP++ DTFDNNYF NL +N+GLL++DQELFST+GAAT+++VNNF+ANQTAFFQ+F
Sbjct  241   TLNNLDPSSPDTFDNNYFQNLLSNQGLLQTDQELFSTNGAATVSVVNNFAANQTAFFQAF  300

Query  944   VQSMINMGNISPLTGSSGEIRLNCRRLN  1027
              QSMINMGNISPLTGS GEIR +C+R+N
Sbjct  301   AQSMINMGNISPLTGSQGEIRSDCKRVN  328



>ref|XP_010058197.1| PREDICTED: peroxidase A2-like [Eucalyptus grandis]
Length=334

 Score =   474 bits (1219),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 235/325 (72%), Positives = 281/325 (86%), Gaps = 3/325 (1%)
 Frame = +2

Query  59    SALLAMAV--AIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             S+L+ +AV  A+      S+AQLSS FY+T+CPNVS+IV TVIQQALQ+D RI ASL+RL
Sbjct  9     SSLMGIAVFAALLFLLHPSSAQLSSNFYATSCPNVSNIVQTVIQQALQSDPRITASLLRL  68

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFV+GCDGSLLLDN+ T I SEKDAA N NS RGFDVVDNIK+A+E++CPG VSCA
Sbjct  69    HFHDCFVDGCDGSLLLDNSAT-ITSEKDAAPNTNSTRGFDVVDNIKSAIESSCPGTVSCA  127

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILAL ++++V L+GGPSW VL GRRD  TANQ GANTS+P+PFD L+NLT KF  VGL+
Sbjct  128   DILALGAQASVVLSGGPSWTVLSGRRDSLTANQAGANTSIPSPFDSLANLTSKFAAVGLD  187

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
              NDLV LSGAHTFGRAQCRTF+ RL+NF+ +G+PDPT++ +YL TLQQ+CPQ GSGS + 
Sbjct  188   TNDLVTLSGAHTFGRAQCRTFSPRLYNFNASGSPDPTISPSYLTTLQQLCPQNGSGSVLA  247

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             NLDPTT +TFDNNY++NLQNN+GLL+SDQELFSTSGAATI+IVN+FS NQ+AFFQSF QS
Sbjct  248   NLDPTTVNTFDNNYYANLQNNQGLLQSDQELFSTSGAATISIVNSFSGNQSAFFQSFAQS  307

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MINMGNISPLTGSSGEIR NC+++N
Sbjct  308   MINMGNISPLTGSSGEIRSNCKKVN  332



>ref|XP_004251296.1| PREDICTED: peroxidase 15-like [Solanum lycopersicum]
Length=327

 Score =   473 bits (1217),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 241/311 (77%), Positives = 277/311 (89%), Gaps = 3/311 (1%)
 Frame = +2

Query  98    FSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLL  277
             F ++NAQLS+ FYSTTCPNVSSIV  VIQQALQ+DARIGASLIRLHFHDCFVNGCD SLL
Sbjct  19    FYETNAQLSANFYSTTCPNVSSIVQNVIQQALQSDARIGASLIRLHFHDCFVNGCDASLL  78

Query  278   LDNNGTT-IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavsla  454
             LDNN TT IVSEKDAA N NS RGFDVVDNIKTA+E++CPGVVSCADILALA+ES+VSLA
Sbjct  79    LDNNATTNIVSEKDAAPNTNSTRGFDVVDNIKTALESSCPGVVSCADILALAAESSVSLA  138

Query  455   GGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFG  634
             GGPSWNVLLGRRD  TANQ GANTS+P+P + L+N+T KFT VGLN+ DLVALSGAHTFG
Sbjct  139   GGPSWNVLLGRRDSRTANQAGANTSIPSPTEGLTNITAKFTAVGLNLTDLVALSGAHTFG  198

Query  635   RAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNY  814
             RAQCR F+ RL+NF+ TGNPDP+LNTTYL+ L+Q+CPQ GS + + NLDPTTSD FDNNY
Sbjct  199   RAQCRVFSARLYNFNGTGNPDPSLNTTYLSNLRQICPQNGSATALANLDPTTSDGFDNNY  258

Query  815   FSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSS  994
             F+NLQNN+GLL+SDQELFS+  A T++IVN FS+NQ  FFQSFVQSMINMGNISPLTG++
Sbjct  259   FANLQNNQGLLQSDQELFSS--ATTLSIVNTFSSNQNTFFQSFVQSMINMGNISPLTGTN  316

Query  995   GEIRLNCRRLN  1027
             GEI L+C+R+N
Sbjct  317   GEIHLDCKRIN  327



>ref|XP_009369457.1| PREDICTED: peroxidase A2-like [Pyrus x bretschneideri]
Length=338

 Score =   473 bits (1216),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 235/306 (77%), Positives = 278/306 (91%), Gaps = 0/306 (0%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
             NAQL+STFYSTTCPNV+SIV T +QQALQ+D+RIGASLIRLHFHDCFVNGCD S+LLD N
Sbjct  31    NAQLNSTFYSTTCPNVTSIVRTTVQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDKN  90

Query  290   GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSW  469
             GT   SEKDAA N NS RGFDVVDNIKTA+EN+CPGVVSCAD+LALA+E++VSL+GGPSW
Sbjct  91    GTIQQSEKDAAPNTNSTRGFDVVDNIKTALENSCPGVVSCADLLALAAEASVSLSGGPSW  150

Query  470   NVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCR  649
             NVLLGRRD  TANQ GANTS+P+PF+ L+N+T KF+ VGLN NDLVALSGAHTFGRAQCR
Sbjct  151   NVLLGRRDSLTANQAGANTSIPSPFESLANITSKFSAVGLNTNDLVALSGAHTFGRAQCR  210

Query  650   TFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQ  829
             TF+NRL+NF++TGNPDPTLN++YL TLQQ CPQ GSG+ + NLD +T D FDNNYF+NLQ
Sbjct  211   TFSNRLYNFNSTGNPDPTLNSSYLTTLQQTCPQNGSGTALANLDLSTPDAFDNNYFTNLQ  270

Query  830   NNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
             NN+GLL+SDQELFST+GAAT++IVN+FS+NQ+AFF+SF +SMINMGNISPL G+SGEIRL
Sbjct  271   NNQGLLQSDQELFSTAGAATVSIVNSFSSNQSAFFESFARSMINMGNISPLVGTSGEIRL  330

Query  1010  NCRRLN  1027
             +C+ +N
Sbjct  331   DCKNVN  336



>gb|KDO70903.1| hypothetical protein CISIN_1g019976mg [Citrus sinensis]
Length=333

 Score =   472 bits (1214),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 237/324 (73%), Positives = 279/324 (86%), Gaps = 1/324 (0%)
 Frame = +2

Query  59    SALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHF  238
             S++ A  + I + FS S AQL+S+FY+TTCPNV++IV   +QQA+Q+D RIGASLIRLHF
Sbjct  8     SSIAAATIFITLLFSNSQAQLNSSFYATTCPNVTTIVRNALQQAMQSDIRIGASLIRLHF  67

Query  239   HDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADI  418
             HDCFVNGCDGS+LLD  G    SEKD   N NSARGF VVDNIKTAVEN+CPGVVSCADI
Sbjct  68    HDCFVNGCDGSVLLDRGGNITQSEKDGGPNTNSARGFGVVDNIKTAVENSCPGVVSCADI  127

Query  419   lalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN  598
             LALA+ES+VSLAGGPSWNVLLGRRDG  ANQ GAN+S+P P D LSNLT KF+ VGL+  
Sbjct  128   LALAAESSVSLAGGPSWNVLLGRRDGLRANQSGANSSIPAPIDSLSNLTSKFSAVGLDTT  187

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNL  778
             DLVALSGAHTFGRAQCR F+ RL+NF+ TGNPDPT+N TYL TL+Q+CPQ G+GS + NL
Sbjct  188   DLVALSGAHTFGRAQCRVFSGRLYNFNGTGNPDPTVNGTYLTTLRQICPQNGNGSALANL  247

Query  779   DPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSG-AATIAIVNNFSANQTAFFQSFVQSM  955
             DPTT+DTFDNNY++NLQNN+GLL+SDQELFST+G AA +AIVNNF++NQTAFFQ FVQSM
Sbjct  248   DPTTADTFDNNYYTNLQNNQGLLQSDQELFSTNGPAAIVAIVNNFASNQTAFFQQFVQSM  307

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             INMGNISPLTGS+GEIR +C+++N
Sbjct  308   INMGNISPLTGSNGEIRADCKKVN  331



>ref|XP_008387221.1| PREDICTED: peroxidase A2-like [Malus domestica]
Length=339

 Score =   472 bits (1215),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 236/307 (77%), Positives = 275/307 (90%), Gaps = 0/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             SNAQL+STFYSTTCPNV+SIV + +QQALQ+D+RIGASLIRLHFHDCFVNGCD S+LLD 
Sbjct  31    SNAQLNSTFYSTTCPNVTSIVRSAVQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDK  90

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             NGT   SEKDAA N NSARGFDVVDNIKTA+EN+CPGVVSCAD+LALA+E++VSL+GGPS
Sbjct  91    NGTIQQSEKDAAPNTNSARGFDVVDNIKTALENSCPGVVSCADLLALAAEASVSLSGGPS  150

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             WN LLGRRD  TANQ GANTS+P+PF+ L+N+T KF+ VGLN NDLVALSGAHTFGRAQC
Sbjct  151   WNALLGRRDSLTANQAGANTSIPSPFEGLANITSKFSAVGLNTNDLVALSGAHTFGRAQC  210

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
             RTF+NRL+NF+ TGNPDPTLN++YL TLQQ CPQ GSG+ + NLD  T D FDNNYF+NL
Sbjct  211   RTFSNRLYNFNGTGNPDPTLNSSYLTTLQQTCPQNGSGTALANLDLXTPDAFDNNYFTNL  270

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             QNN GLL+SDQELFST+GAAT++IVN+FS+NQ+AFF SF QSMINMGNISPL G+SGEIR
Sbjct  271   QNNEGLLQSDQELFSTAGAATVSIVNSFSSNQSAFFASFAQSMINMGNISPLVGTSGEIR  330

Query  1007  LNCRRLN  1027
             L+C+ +N
Sbjct  331   LDCKNVN  337



>ref|XP_007162335.1| hypothetical protein PHAVU_001G143300g [Phaseolus vulgaris]
 gb|ESW34329.1| hypothetical protein PHAVU_001G143300g [Phaseolus vulgaris]
Length=331

 Score =   471 bits (1213),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 238/329 (72%), Positives = 283/329 (86%), Gaps = 2/329 (1%)
 Frame = +2

Query  47    MASF--SALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGAS  220
             M SF  S L  +   + IF   SNAQLSSTFYS+TCPNVSSIV +VIQQALQ+D RI AS
Sbjct  1     MFSFNHSLLTTIFSVLTIFLHPSNAQLSSTFYSSTCPNVSSIVRSVIQQALQSDTRIAAS  60

Query  221   LIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGV  400
             LIRLHFHDCFVNGCDGSLLLD  G   +SEK+A  NNNSARGF+VVDNIKT++EN+CPGV
Sbjct  61    LIRLHFHDCFVNGCDGSLLLDQGGNITLSEKNAVPNNNSARGFNVVDNIKTSLENSCPGV  120

Query  401   VSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTN  580
             VSCADILALA+E++VSL GGPSW VLLGRRDG  ANQ GAN+S+P P + L+N+T KF+ 
Sbjct  121   VSCADILALAAEASVSLGGGPSWTVLLGRRDGLIANQSGANSSIPAPTESLANITAKFSA  180

Query  581   VGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSG  760
             VGLN+ DLVALSGAHTFGRAQCR FN RLFNFS TG+PDPTL+++YLATLQQ CPQ GSG
Sbjct  181   VGLNITDLVALSGAHTFGRAQCRFFNQRLFNFSGTGSPDPTLDSSYLATLQQNCPQNGSG  240

Query  761   STVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQS  940
             +T+ NLDP++ DTFDNNYF NL NNRGLL++DQELFST+G+AT++IV+NF++NQ+AFF++
Sbjct  241   NTLNNLDPSSPDTFDNNYFQNLLNNRGLLQTDQELFSTNGSATMSIVSNFASNQSAFFEA  300

Query  941   FVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             F QSMINMGNISPLTGS GEIR +C+++N
Sbjct  301   FAQSMINMGNISPLTGSQGEIRSDCKKVN  329



>ref|XP_006363346.1| PREDICTED: peroxidase 15-like [Solanum tuberosum]
Length=326

 Score =   470 bits (1210),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 242/333 (73%), Positives = 281/333 (84%), Gaps = 8/333 (2%)
 Frame = +2

Query  32    LNPKKMASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARI  211
             ++P  +A    LL+        F ++NAQLS+ FYSTTCPNVSSIV  VIQQALQ+DARI
Sbjct  1     MSPYILAVICILLSTCS-----FYETNAQLSANFYSTTCPNVSSIVQNVIQQALQSDARI  55

Query  212   GASLIRLHFHDCFVNGCDGSLLLDNNGTT-IVSEKDAAQNNNSARGFDVVDNIKTAVENA  388
             GASLIRLHFHDCFVNGCD SLLLDNN TT IVSEKDAA N NS RGFDVVDNIKTA+E +
Sbjct  56    GASLIRLHFHDCFVNGCDASLLLDNNATTNIVSEKDAAPNTNSTRGFDVVDNIKTALETS  115

Query  389   CPGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTR  568
             CPGVVSCADILALA+ES+VS AGGPSWNVLLGRRD  TANQ GANTS+P+P + L+N+T 
Sbjct  116   CPGVVSCADILALAAESSVSQAGGPSWNVLLGRRDSRTANQAGANTSIPSPTEGLTNITA  175

Query  569   KFTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQ  748
             KFT VGLN+ DLVALSGAHTFGRAQCR F+ RL+NF+ TGNPDP+LNTTYLA L+Q+CPQ
Sbjct  176   KFTAVGLNITDLVALSGAHTFGRAQCRVFSARLYNFNGTGNPDPSLNTTYLANLRQICPQ  235

Query  749   GGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTA  928
              GS + + NLDPTTSD FDNNY++NLQNN+GLL+SDQELFS+    T++IVN FS+NQ  
Sbjct  236   NGSATALANLDPTTSDGFDNNYYANLQNNQGLLQSDQELFSS--GTTLSIVNTFSSNQNT  293

Query  929   FFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FFQSFVQSMINMGNISPLTG++GEI  +C+R+N
Sbjct  294   FFQSFVQSMINMGNISPLTGTNGEIHSDCKRIN  326



>gb|AGF25268.1| peroxidase 1 [Pyrus communis]
Length=338

 Score =   470 bits (1209),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 235/306 (77%), Positives = 276/306 (90%), Gaps = 0/306 (0%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
             NAQL+STFYSTTCPNV+SIV +  QQALQ+D+RIGASLIRLHFHDCFVNGCD S+LLD N
Sbjct  31    NAQLNSTFYSTTCPNVTSIVRSADQQALQSDSRIGASLIRLHFHDCFVNGCDASILLDKN  90

Query  290   GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSW  469
             GT   SEKDAA N NS RGFDVVDNIKTA+EN+CPGVVSCAD+LALA+E++VSL+GGPSW
Sbjct  91    GTIQQSEKDAAPNTNSTRGFDVVDNIKTALENSCPGVVSCADLLALAAEASVSLSGGPSW  150

Query  470   NVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCR  649
             NVLLGRRD  TANQ GANTS+P+PF+ L+N+T KF+ VGLN NDLVALSGAHTFGRAQCR
Sbjct  151   NVLLGRRDSLTANQAGANTSIPSPFESLANITSKFSAVGLNTNDLVALSGAHTFGRAQCR  210

Query  650   TFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQ  829
             TF+NRL+NF+ TGNPDPTLN++YL TLQQ CPQ GSG+ + NLD +T D FDNNYF+NLQ
Sbjct  211   TFSNRLYNFNGTGNPDPTLNSSYLTTLQQTCPQNGSGTALANLDLSTPDAFDNNYFTNLQ  270

Query  830   NNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
             NN+GLL+SDQELFST+GAAT++IVN+FS+NQ+AFF+SF QSMINMGNISPL G+SGEIRL
Sbjct  271   NNQGLLQSDQELFSTAGAATVSIVNSFSSNQSAFFESFAQSMINMGNISPLVGTSGEIRL  330

Query  1010  NCRRLN  1027
             +C+ +N
Sbjct  331   DCKNVN  336



>ref|XP_006492847.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 53-like [Citrus sinensis]
Length=333

 Score =   469 bits (1208),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 238/327 (73%), Positives = 282/327 (86%), Gaps = 2/327 (1%)
 Frame = +2

Query  53    SFSALLAMA-VAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIR  229
             SF++ +A+A + I + FS S AQL+S+FY+TTCPNV++IV   +QQA+ +D RIGASLIR
Sbjct  5     SFTSSIAVATIFITLLFSNSQAQLNSSFYATTCPNVTTIVRNALQQAMXSDIRIGASLIR  64

Query  230   LHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSC  409
             LHFHDCFVNGCDGS+LLD  G    SEKD   N NSARGF VVDNIKTAVEN+CPGVVSC
Sbjct  65    LHFHDCFVNGCDGSVLLDRGGNITQSEKDGGPNTNSARGFGVVDNIKTAVENSCPGVVSC  124

Query  410   ADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGL  589
             ADILALA+ES+VSLAGGPSWNVLLGRRDG  ANQ GAN+S+P P D LSNLT KF+ VGL
Sbjct  125   ADILALAAESSVSLAGGPSWNVLLGRRDGLRANQSGANSSIPAPIDSLSNLTSKFSAVGL  184

Query  590   NVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTV  769
             +  DLVALSGAHTFGRAQCR F+ RL+NF+ TGNPDPT+N TYL TL+Q+CPQ G+GS +
Sbjct  185   DTTDLVALSGAHTFGRAQCRVFSGRLYNFNGTGNPDPTVNGTYLTTLRQICPQNGNGSAL  244

Query  770   TNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSG-AATIAIVNNFSANQTAFFQSFV  946
              NLDPTT+DTFDNNY++NLQNN+GLL+SDQELFST+G AA +AIVNNF++NQTAFFQ FV
Sbjct  245   ANLDPTTADTFDNNYYTNLQNNQGLLQSDQELFSTNGPAAIVAIVNNFASNQTAFFQQFV  304

Query  947   QSMINMGNISPLTGSSGEIRLNCRRLN  1027
             QSMINMGNISPLTGS+GEIR +C+++N
Sbjct  305   QSMINMGNISPLTGSNGEIRADCKKVN  331



>ref|XP_011039460.1| PREDICTED: peroxidase A2-like [Populus euphratica]
Length=331

 Score =   469 bits (1206),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 247/332 (74%), Positives = 292/332 (88%), Gaps = 3/332 (1%)
 Frame = +2

Query  32    LNPKKMASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARI  211
             ++P    SF ++  + + + +   QS AQL++TFY+ TCPNVSSIVS V+QQA Q+D+RI
Sbjct  1     MSPPPSTSFFSVTIVLLGMML--PQSKAQLNTTFYANTCPNVSSIVSNVVQQAFQSDSRI  58

Query  212   GASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENAC  391
             GASLIRLHFHDCFVNGCD S+LLDN+ ++I+SEK AA N NS RGF VVDNIKTAVEN+C
Sbjct  59    GASLIRLHFHDCFVNGCDASILLDNS-SSILSEKFAAPNVNSTRGFGVVDNIKTAVENSC  117

Query  392   PGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRK  571
             PGVVSCADILALA+ES+VS +GGPSW+VLLGRRD  TANQ GANTS+P+PF+ L+N+T K
Sbjct  118   PGVVSCADILALAAESSVSQSGGPSWSVLLGRRDSLTANQAGANTSIPSPFEGLNNITAK  177

Query  572   FTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQG  751
             F+ VGLN NDLVALSGAHTFGRAQCRTF+NRL+NFSNTGNPD TLNTTYL TLQQ+CPQ 
Sbjct  178   FSAVGLNTNDLVALSGAHTFGRAQCRTFSNRLYNFSNTGNPDSTLNTTYLTTLQQICPQN  237

Query  752   GSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAF  931
             GSG+ + NLDPTTSD FDNNYF+NLQNN+GLL+SDQELFSTSG+ATI +VNNFS+NQTAF
Sbjct  238   GSGTALANLDPTTSDAFDNNYFTNLQNNQGLLQSDQELFSTSGSATITLVNNFSSNQTAF  297

Query  932   FQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FQSFVQSMINMGNISPLTGSSGEIR +C+++N
Sbjct  298   FQSFVQSMINMGNISPLTGSSGEIRSDCKKVN  329



>ref|XP_006373791.1| hypothetical protein POPTR_0016s05860g [Populus trichocarpa]
 ref|XP_006388578.1| This sequence shows homology with Cucumber peroxidase family 
protein [Populus trichocarpa]
 gb|ERP47492.1| This sequence shows homology with Cucumber peroxidase family 
protein [Populus trichocarpa]
 gb|ERP51588.1| hypothetical protein POPTR_0016s05860g [Populus trichocarpa]
 gb|AHL39185.1| class III peroxidase [Populus trichocarpa]
Length=331

 Score =   468 bits (1203),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 247/333 (74%), Positives = 290/333 (87%), Gaps = 5/333 (2%)
 Frame = +2

Query  32    LNPKKMASFSALLAMAVAIF-IFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDAR  208
             ++P    SF    ++A+ +  +    S AQL++TFY+ TCPNVSSIVS V+QQA Q+D+R
Sbjct  1     MSPPPSTSF---FSVAIVLLGMMLPHSKAQLNATFYANTCPNVSSIVSNVVQQAFQSDSR  57

Query  209   IGASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENA  388
             IGASLIRLHFHDCFVNGCD S+LLDN+ ++I+SEK AA N NS RGF VVDNIKTAVEN+
Sbjct  58    IGASLIRLHFHDCFVNGCDASILLDNS-SSILSEKFAAPNVNSIRGFGVVDNIKTAVENS  116

Query  389   CPGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTR  568
             CPGVVSCADILALA+ES+VS +GGPSW+VLLGRRD  TANQ GANT++P+PF+ L+N+T 
Sbjct  117   CPGVVSCADILALAAESSVSQSGGPSWSVLLGRRDSLTANQAGANTAIPSPFEGLNNITA  176

Query  569   KFTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQ  748
             KF+ VGLN NDLVALSGAHTFGRAQCRTF+NRL+NFSNTGNPDPTLNTTYL TLQQ+CPQ
Sbjct  177   KFSAVGLNTNDLVALSGAHTFGRAQCRTFSNRLYNFSNTGNPDPTLNTTYLTTLQQICPQ  236

Query  749   GGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTA  928
              GSG+ + NLDPTTSD FDNNYF+NLQNN+GLL+SDQELFST GAATI  VNNFS+NQTA
Sbjct  237   NGSGTALANLDPTTSDAFDNNYFTNLQNNQGLLQSDQELFSTPGAATITFVNNFSSNQTA  296

Query  929   FFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FFQSFVQSMINMGNISPLTGSSGEIR +C+++N
Sbjct  297   FFQSFVQSMINMGNISPLTGSSGEIRSDCKKVN  329



>ref|XP_003625275.1| Peroxidase [Medicago truncatula]
 gb|AES81493.1| peroxidase family protein [Medicago truncatula]
Length=373

 Score =   469 bits (1207),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 239/336 (71%), Positives = 277/336 (82%), Gaps = 2/336 (1%)
 Frame = +2

Query  26    SKLNPKKMASFSALL--AMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQN  199
             SK   KK   FS        V IF+  + S+AQL+STFYS TCP+VSSIV  V+QQALQN
Sbjct  36    SKEETKKPTMFSPKFYSIFTVLIFLLLNPSHAQLTSTFYSNTCPSVSSIVRNVVQQALQN  95

Query  200   DARIGASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAV  379
             D RI ASL RLHFHDCFVNGCD SLLLD  G   +SEK+A  NNNSARGFDVVD IKT+V
Sbjct  96    DPRITASLTRLHFHDCFVNGCDASLLLDQGGNITLSEKNAVPNNNSARGFDVVDKIKTSV  155

Query  380   ENACPGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSN  559
             EN+CP VVSCADILALA+E++VSL+GGPSWNVLLGRRDG  ANQ GANTS+PNP + L+N
Sbjct  156   ENSCPSVVSCADILALAAEASVSLSGGPSWNVLLGRRDGLIANQSGANTSIPNPTESLAN  215

Query  560   LTRKFTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQV  739
             +T KF  VGLN +DLVALSGAHTFGR QCR FN RLFNFS TG PDPTLN+TYLATLQQ 
Sbjct  216   VTAKFAAVGLNTSDLVALSGAHTFGRGQCRFFNQRLFNFSGTGKPDPTLNSTYLATLQQN  275

Query  740   CPQGGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSAN  919
             CPQ GSG+T+ NLDP++ + FDNNYF NL  N+GLL++DQELFST+GAATI+IVNNF++N
Sbjct  276   CPQNGSGNTLNNLDPSSPNNFDNNYFKNLLKNQGLLQTDQELFSTNGAATISIVNNFASN  335

Query  920   QTAFFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             QTAFF++FVQSMINMGNISPL GS GEIR +C+++N
Sbjct  336   QTAFFEAFVQSMINMGNISPLIGSQGEIRSDCKKVN  371



>emb|CDX98949.1| BnaC09g48860D [Brassica napus]
Length=338

 Score =   464 bits (1195),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 235/324 (73%), Positives = 280/324 (86%), Gaps = 1/324 (0%)
 Frame = +2

Query  56    FSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLH  235
             F  +L   V     F  SNAQL++TFYS TCPN S+IV T IQQALQ+D+RIGASLIRLH
Sbjct  14    FIVILTTLVISSSLFGTSNAQLNATFYSGTCPNASAIVRTTIQQALQSDSRIGASLIRLH  73

Query  236   FHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCAD  415
             FHDCFVNGCD S+LLDN+G+ I SEK+A  N NSARGF+VVDNIKTA+ENACPG VSC+D
Sbjct  74    FHDCFVNGCDASILLDNSGS-IQSEKNAGPNANSARGFNVVDNIKTALENACPGAVSCSD  132

Query  416   IlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNV  595
             ILALASE++VSL+GGPSW VLLGRRD  TANQ GAN+S+P+PF+ LSN+T KF+ VGLN 
Sbjct  133   ILALASEASVSLSGGPSWTVLLGRRDSLTANQAGANSSIPSPFESLSNITSKFSAVGLNT  192

Query  596   NDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTN  775
             NDLVALSGAHTFGRA+C  F+NRLFNFS +GNPDPTLNTT L++LQQ+CPQ G+GS +TN
Sbjct  193   NDLVALSGAHTFGRARCGVFSNRLFNFSGSGNPDPTLNTTLLSSLQQICPQNGTGSGITN  252

Query  776   LDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSM  955
             LD +T D FDNNYF+NLQ+N GLL+SDQELFST+G+ATIAIV +F++NQ+ FFQ+F QSM
Sbjct  253   LDLSTPDAFDNNYFTNLQSNNGLLQSDQELFSTTGSATIAIVTSFASNQSLFFQAFAQSM  312

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             INMGNISPLTGSSGEIRL+C+++N
Sbjct  313   INMGNISPLTGSSGEIRLDCKKVN  336



>gb|EYU20688.1| hypothetical protein MIMGU_mgv1a009598mg [Erythranthe guttata]
Length=337

 Score =   463 bits (1192),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 243/335 (73%), Positives = 281/335 (84%), Gaps = 8/335 (2%)
 Frame = +2

Query  47    MASFSAL-LAM----AVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARI  211
             M SF +L LA+    A+ +      S AQL+S+FYS +CPNVS+IV+TVIQQALQ+D RI
Sbjct  1     MHSFPSLTLALITTAAILVLQLAPLSEAQLNSSFYSNSCPNVSNIVTTVIQQALQSDPRI  60

Query  212   GASLIRLHFHDCFVNGCDGSLLLDNN-GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENA  388
             GASL+RLHFHDCFV GCDGS+LLDNN   TI SEKDAA N NS RGFDVVDNIK+AVEN+
Sbjct  61    GASLLRLHFHDCFVQGCDGSILLDNNVNGTIQSEKDAAPNTNSTRGFDVVDNIKSAVENS  120

Query  389   CPGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTR  568
             CPGVVSCADILALAS+S+VSLAGGPSWNVLLGRRDGT+ANQ GANT++P PF++L+NLT 
Sbjct  121   CPGVVSCADILALASQSSVSLAGGPSWNVLLGRRDGTSANQAGANTAIPAPFENLTNLTA  180

Query  569   KFTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQ  748
             KF+ VGLN+ DLVALSGAHTFGRAQCR F NRL+NFS +G PDP LN TYLA+L+Q+CPQ
Sbjct  181   KFSAVGLNITDLVALSGAHTFGRAQCRLFRNRLYNFSGSGGPDPLLNATYLASLRQICPQ  240

Query  749   GGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAA--TIAIVNNFSANQ  922
              G G +V +LDPTT DTFD NYFSNLQ+N+GLL+SDQELFS S  A  T+ IVN FS NQ
Sbjct  241   NGGGFSVADLDPTTPDTFDANYFSNLQSNQGLLQSDQELFSASAGAQTTLPIVNMFSGNQ  300

Query  923   TAFFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             +AFFQSFV SMINMGNISPL G +GEIR NCRR+N
Sbjct  301   SAFFQSFVASMINMGNISPLIGVNGEIRSNCRRVN  335



>ref|XP_003553432.1| PREDICTED: peroxidase 15-like [Glycine max]
Length=331

 Score =   463 bits (1191),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 239/325 (74%), Positives = 279/325 (86%), Gaps = 0/325 (0%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             ++S    + + + IF   SNAQLSSTFYS+TCPNVSS+V +V+QQALQ+D RI ASL RL
Sbjct  5     TYSLFTTIFLVLTIFLHPSNAQLSSTFYSSTCPNVSSVVRSVVQQALQSDPRIAASLTRL  64

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFVNGCDGS+LLD  G   +SEK+A  NNNSARGFDVVDNIKT+VEN+CPGVVSCA
Sbjct  65    HFHDCFVNGCDGSILLDVGGNITLSEKNAGPNNNSARGFDVVDNIKTSVENSCPGVVSCA  124

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALA+E++VSL GGPSWNV LGRRDG  ANQ GANTS+PNP + L+N+T KF  VGLN
Sbjct  125   DILALAAEASVSLGGGPSWNVQLGRRDGLIANQSGANTSIPNPTESLANVTAKFAAVGLN  184

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
             V DLVALSGAHTFGRAQCR FN RLFN S TG+PDPTLN TYLATLQQ CPQ GSG+T+ 
Sbjct  185   VTDLVALSGAHTFGRAQCRFFNQRLFNLSGTGSPDPTLNATYLATLQQNCPQNGSGNTLN  244

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             NLDP++ DTFDNNYF NL +N+GLL++DQELFST+GAATI+++NNF+ANQTAFFQ+F QS
Sbjct  245   NLDPSSPDTFDNNYFQNLLSNQGLLQTDQELFSTNGAATISVINNFAANQTAFFQAFAQS  304

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MINMGNISPLTGS GEIR +C+R+N
Sbjct  305   MINMGNISPLTGSRGEIRSDCKRVN  329



>gb|KHN45426.1| Peroxidase 15 [Glycine soja]
Length=331

 Score =   463 bits (1191),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 239/325 (74%), Positives = 279/325 (86%), Gaps = 0/325 (0%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             ++S    + + + IF   SNAQLSSTFYS+TCPNVSS+V +V+QQALQ+D RI ASL RL
Sbjct  5     TYSLFTTIFLVLTIFLHPSNAQLSSTFYSSTCPNVSSVVRSVVQQALQSDPRIAASLTRL  64

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFVNGCDGS+LLD  G   +SEK+A  NNNSARGFDVVDNIKT+VEN+CPGVVSCA
Sbjct  65    HFHDCFVNGCDGSILLDVGGNITLSEKNAGPNNNSARGFDVVDNIKTSVENSCPGVVSCA  124

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALA+E++VSL GGPSWNV LGRRDG  ANQ GANTS+PNP + L+N+T KF  VGLN
Sbjct  125   DILALAAEASVSLGGGPSWNVQLGRRDGLIANQSGANTSIPNPTESLANVTAKFAAVGLN  184

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
             V DLVALSGAHTFGRAQCR FN RLFN S TG+PDPTLN TYLATLQQ CPQ GSG+T+ 
Sbjct  185   VTDLVALSGAHTFGRAQCRFFNQRLFNLSGTGSPDPTLNATYLATLQQNCPQNGSGNTLN  244

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             NLDP++ DTFDNNYF NL +N+GLL++DQELFST+GAAT+++VNNF+ANQTAFFQ+F QS
Sbjct  245   NLDPSSPDTFDNNYFQNLLSNQGLLQTDQELFSTNGAATVSVVNNFAANQTAFFQAFAQS  304

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MINMGNISPLTGS GEIR +C+R+N
Sbjct  305   MINMGNISPLTGSRGEIRSDCKRVN  329



>ref|XP_003535116.1| PREDICTED: peroxidase 53-like [Glycine max]
 gb|KHN35656.1| Peroxidase 53 [Glycine soja]
Length=331

 Score =   460 bits (1184),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 230/322 (71%), Positives = 277/322 (86%), Gaps = 0/322 (0%)
 Frame = +2

Query  62    ALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFH  241
             +LLA    +      S  QLSSTFYS+TC NVSSIV + +QQALQ+D+RIGASL RLHFH
Sbjct  8     SLLATIFLVLTLIFPSEGQLSSTFYSSTCSNVSSIVRSAVQQALQSDSRIGASLSRLHFH  67

Query  242   DCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIl  421
             DCFVNGCD S+LLD  G    SEK+AA N NS RGFDVVDNIK+++E++CPGVVSCADIL
Sbjct  68    DCFVNGCDASILLDQGGNITQSEKNAAPNVNSIRGFDVVDNIKSSLESSCPGVVSCADIL  127

Query  422   alasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVND  601
             ALA+ES+VSL+GGPSWNVLLGRRDG TANQ GAN+S+P+PF+ L+N+T KF+ VGL+  D
Sbjct  128   ALAAESSVSLSGGPSWNVLLGRRDGLTANQAGANSSIPSPFESLANVTSKFSAVGLDTTD  187

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRAQC+ F+ RLFNFS TG+PDPTLN+TYLATLQQ CPQ GSGST+ NLD
Sbjct  188   LVALSGAHTFGRAQCQFFSQRLFNFSGTGSPDPTLNSTYLATLQQNCPQSGSGSTLNNLD  247

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMIN  961
             P+T DTFDNNYF+NL  N+GLL++DQELFS++G++TI+IVNNF+ NQ+AFF++FVQSMIN
Sbjct  248   PSTPDTFDNNYFTNLLINQGLLQTDQELFSSNGSSTISIVNNFANNQSAFFEAFVQSMIN  307

Query  962   MGNISPLTGSSGEIRLNCRRLN  1027
             MGNISPLTGS GEIR +C++LN
Sbjct  308   MGNISPLTGSQGEIRTDCKKLN  329



>gb|AFN41087.1| peroxidase precursor [Corylus avellana]
Length=330

 Score =   459 bits (1181),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 225/322 (70%), Positives = 276/322 (86%), Gaps = 1/322 (0%)
 Frame = +2

Query  62    ALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFH  241
             A+  + VA+ + + +SNAQL++TFY  TC N S+IV   +QQALQ+D+RIGASLIRLHFH
Sbjct  8     AVATIFVAVIMLY-ESNAQLNATFYGDTCSNASTIVRNAVQQALQSDSRIGASLIRLHFH  66

Query  242   DCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIl  421
             DCFVNGCDGS+LLD  G+   SEKDAA N NS RGFDVVDNIK A+E++CP VVSCADIL
Sbjct  67    DCFVNGCDGSILLDRGGSITQSEKDAAPNTNSTRGFDVVDNIKAALESSCPSVVSCADIL  126

Query  422   alasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVND  601
             ALA+E++VSL+GGP+WNVLLGRRD  TANQ GANTS+P+P + LSN+T KF+ VGL+ ND
Sbjct  127   ALAAEASVSLSGGPTWNVLLGRRDSLTANQAGANTSIPSPVEGLSNITSKFSAVGLDTND  186

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRAQCR F  RL+NF+ TGNPDPT+N+TYL TLQQ CPQ G G+ + NLD
Sbjct  187   LVALSGAHTFGRAQCRLFIGRLYNFNGTGNPDPTINSTYLTTLQQTCPQNGDGTVLANLD  246

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMIN  961
             PTT D+FDN YF+NLQNN+GLL+SDQELFST+GA+T++IVN+FS+NQTAFF+ F QSMIN
Sbjct  247   PTTPDSFDNGYFTNLQNNQGLLQSDQELFSTAGASTVSIVNSFSSNQTAFFERFAQSMIN  306

Query  962   MGNISPLTGSSGEIRLNCRRLN  1027
             MGNISPLTG++GEIR +C+++N
Sbjct  307   MGNISPLTGTNGEIRSDCKKVN  328



>ref|XP_006399146.1| hypothetical protein EUTSA_v10014029mg [Eutrema salsugineum]
 gb|ESQ40599.1| hypothetical protein EUTSA_v10014029mg [Eutrema salsugineum]
Length=339

 Score =   459 bits (1182),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 231/311 (74%), Positives = 275/311 (88%), Gaps = 1/311 (0%)
 Frame = +2

Query  95    FFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSL  274
              F  S+AQL++TFYS TCPN S+IV + IQQALQ+D+RIGASLIRLHFHDCFVNGCD S+
Sbjct  28    LFWTSSAQLNATFYSRTCPNASAIVRSTIQQALQSDSRIGASLIRLHFHDCFVNGCDASI  87

Query  275   LLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavsla  454
             LLD++G+ I SEK+AA N NSARGF+VVDNIKTA+ENACPGVVSC+D+LALASE++VSLA
Sbjct  88    LLDDSGS-IQSEKNAAPNANSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLA  146

Query  455   GGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFG  634
             GGPSW VLLGRRD  TANQ GAN+S+P+P + L+N+T KF+ VGLN NDLVALSGAHTFG
Sbjct  147   GGPSWTVLLGRRDSLTANQAGANSSIPSPVESLANITSKFSAVGLNTNDLVALSGAHTFG  206

Query  635   RAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNY  814
             RA+C  F+NRL NFS +GNPDPTLNTT L +LQQ+CPQ GSGS +TNLD +T D FDNNY
Sbjct  207   RARCGVFSNRLINFSGSGNPDPTLNTTLLNSLQQICPQNGSGSGITNLDLSTPDAFDNNY  266

Query  815   FSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSS  994
             FSNLQ+N GLL+SDQELFST+G+ATIAIV +F++NQT FFQ+F QSMINMGNISPLTGSS
Sbjct  267   FSNLQSNNGLLQSDQELFSTTGSATIAIVTSFASNQTLFFQAFAQSMINMGNISPLTGSS  326

Query  995   GEIRLNCRRLN  1027
             GEIRL+C+++N
Sbjct  327   GEIRLDCKKVN  337



>ref|XP_008787874.1| PREDICTED: peroxidase 15 [Phoenix dactylifera]
Length=336

 Score =   459 bits (1180),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 235/335 (70%), Positives = 288/335 (86%), Gaps = 2/335 (1%)
 Frame = +2

Query  23    ISKLNPKKMASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQND  202
             +S +  ++M+S S L+A+A+ + +    S AQLSS+FY++TC NVS+IV +VIQQA  +D
Sbjct  2     LSSIAERRMSSSSLLVALAICLALLSPGSRAQLSSSFYNSTCSNVSAIVRSVIQQAQSSD  61

Query  203   ARIGASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVE  382
              RI ASL RL FHDCFV+GCDGS+LLD++ +TIVSEK A  NNNSARGFDVVDNIKTAVE
Sbjct  62    VRITASLTRLFFHDCFVDGCDGSVLLDSS-STIVSEKGAVPNNNSARGFDVVDNIKTAVE  120

Query  383   NACPGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNL  562
             NACPGVVSCADILALA+E++V+LAGGPSW+ LLGRRDGTTAN  GAN +LP+PFD L+ L
Sbjct  121   NACPGVVSCADILALAAEASVNLAGGPSWSALLGRRDGTTANITGAN-NLPSPFDSLTTL  179

Query  563   TRKFTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVC  742
               KF+ VGL   DLVALSGAHTFGRAQCR F+NRL+NFS TGNPDP+LN++YL TLQQ C
Sbjct  180   QSKFSAVGLGDTDLVALSGAHTFGRAQCRFFSNRLYNFSGTGNPDPSLNSSYLTTLQQNC  239

Query  743   PQGGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQ  922
             PQGG G+T+ NLDP+T +TFD+NYF+NLQNNRGLL+SDQEL STSGA+T +IVN+F+++Q
Sbjct  240   PQGGDGTTLNNLDPSTPNTFDSNYFTNLQNNRGLLQSDQELLSTSGASTASIVNSFASSQ  299

Query  923   TAFFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             + FFQ+FVQSMINMGNISPLTGSSG+IR NCR++N
Sbjct  300   STFFQNFVQSMINMGNISPLTGSSGQIRSNCRKVN  334



>dbj|BAF33316.1| peroxidase [Populus alba]
Length=329

 Score =   458 bits (1179),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 242/330 (73%), Positives = 288/330 (87%), Gaps = 4/330 (1%)
 Frame = +2

Query  38    PKKMASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGA  217
             P   + FS  +   V + +   QS AQLS+TFY+ TCPNVSSIVS V+QQA  +D+RIGA
Sbjct  2     PPSTSFFSVAI---VLLGMMLPQSKAQLSATFYANTCPNVSSIVSNVVQQAFLSDSRIGA  58

Query  218   SLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPG  397
             SLIRLHFHDCFV+GCD S+LLDN+ ++I+SEK AA N NS RGF VVD+IKTA+E++CPG
Sbjct  59    SLIRLHFHDCFVDGCDASILLDNS-SSILSEKLAAPNVNSIRGFGVVDSIKTALESSCPG  117

Query  398   VVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFT  577
             VV+CADILALA+ES+VS +GGPSW+VLLGR D  TANQ GANTS+P+PF+ LSN+T KF+
Sbjct  118   VVTCADILALAAESSVSQSGGPSWSVLLGRGDSLTANQAGANTSIPSPFEGLSNITAKFS  177

Query  578   NVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGS  757
              VGLN NDLVAL GAHTFGRAQCRTF+NRL+NFSNTG+PDPTLNTTYL TLQQ+CPQ GS
Sbjct  178   AVGLNTNDLVALLGAHTFGRAQCRTFSNRLYNFSNTGSPDPTLNTTYLTTLQQICPQNGS  237

Query  758   GSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQ  937
             G+ + NLDPTTSDTFDNNYF+NLQNN+GLL+SDQELFSTSGAAT+ +VNNFS+NQTAFFQ
Sbjct  238   GTALANLDPTTSDTFDNNYFTNLQNNQGLLQSDQELFSTSGAATVTLVNNFSSNQTAFFQ  297

Query  938   SFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             SFVQS+INMGNISPLTGSSGEIR +C+++N
Sbjct  298   SFVQSIINMGNISPLTGSSGEIRSDCKKVN  327



>ref|XP_006288143.1| hypothetical protein CARUB_v10001380mg [Capsella rubella]
 gb|EOA21041.1| hypothetical protein CARUB_v10001380mg [Capsella rubella]
Length=336

 Score =   458 bits (1178),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 230/321 (72%), Positives = 280/321 (87%), Gaps = 1/321 (0%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             ++++ V + + F  S+AQL++TFYS TCPN S+IV + IQQALQ+DARIGASLIRLHFHD
Sbjct  15    IISLLVIVSLLFGTSSAQLNATFYSATCPNASAIVRSTIQQALQSDARIGASLIRLHFHD  74

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLD+ G+ I SEK+AA N NS RGF+VVDNIKTA+ENACPG+VSC+D+LA
Sbjct  75    CFVNGCDGSLLLDDTGS-IQSEKNAAPNANSTRGFNVVDNIKTALENACPGIVSCSDVLA  133

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LASE++VSLAGGPSW VLLGRRD  TAN  GAN+++P+P + LSN+T KF+ VGLN NDL
Sbjct  134   LASEASVSLAGGPSWTVLLGRRDSLTANLAGANSAIPSPVESLSNITSKFSAVGLNTNDL  193

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             VALSGAHTFGRA+C  FNNRLFNFS TGNPDPTLN+T L++LQQ+CPQ GS ST+TNLD 
Sbjct  194   VALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQNGSASTITNLDL  253

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             +T D FDNNYF+NLQ+N GLL+SDQELFST+ ++TIAIV +F++NQT FFQ F QSMINM
Sbjct  254   STPDAFDNNYFNNLQSNNGLLQSDQELFSTTVSSTIAIVTSFASNQTLFFQVFAQSMINM  313

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNISPLTGS+GEIRL+C+++N
Sbjct  314   GNISPLTGSNGEIRLDCKKVN  334



>gb|AAM65211.1| peroxidase [Arabidopsis thaliana]
 gb|AAS17636.1| peroxidase ATPA2 [Arabidopsis thaliana]
Length=335

 Score =   458 bits (1178),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 231/321 (72%), Positives = 279/321 (87%), Gaps = 1/321 (0%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             ++++ V +   F  S+AQL++TFYS TCPN S+IV + IQQALQ+D RIGASLIRLHFHD
Sbjct  14    IISLIVILSSIFGTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHD  73

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCD S+LLD+ G+ I SEK+A  N NSARGF+VVDNIKTA+ENACPGVVSC+D+LA
Sbjct  74    CFVNGCDASILLDDTGS-IQSEKNAGPNVNSARGFNVVDNIKTALENACPGVVSCSDVLA  132

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LASE++VSLAGGPSW VLLGRRD  TAN  GAN+S+P+P + LSN+T KF+ VGLN NDL
Sbjct  133   LASEASVSLAGGPSWTVLLGRRDSLTANLAGANSSIPSPVESLSNITSKFSAVGLNTNDL  192

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             VALSGAHTFGRA+C  FNNRLFNFS TGNPDPTLN+T L+TLQQ+CPQ GS ST+TNLD 
Sbjct  193   VALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSTLQQLCPQNGSASTITNLDL  252

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             +T D FDNNYF+NLQ+N GLL+SDQELFST+G++TIAIV +F++NQT FFQ+F QSMINM
Sbjct  253   STPDAFDNNYFANLQSNNGLLQSDQELFSTTGSSTIAIVTSFASNQTLFFQAFAQSMINM  312

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNISPLTGS+GEIRL+C+++N
Sbjct  313   GNISPLTGSNGEIRLDCKKVN  333



>ref|NP_196290.1| peroxidase 53 [Arabidopsis thaliana]
 sp|Q42578.1|PER53_ARATH RecName: Full=Peroxidase 53; Short=Atperox P53; AltName: Full=ATPA2; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA68212.1| peroxidase [Arabidopsis thaliana]
 dbj|BAB09806.1| peroxidase [Arabidopsis thaliana]
 gb|AAL07035.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAM20347.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED91055.1| peroxidase 2 [Arabidopsis thaliana]
Length=335

 Score =   457 bits (1176),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 231/321 (72%), Positives = 279/321 (87%), Gaps = 1/321 (0%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             ++++ V +   F  S+AQL++TFYS TCPN S+IV + IQQALQ+D RIGASLIRLHFHD
Sbjct  14    IISLIVIVSSIFGTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHD  73

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCD S+LLD+ G+ I SEK+A  N NSARGF+VVDNIKTA+ENACPGVVSC+D+LA
Sbjct  74    CFVNGCDASILLDDTGS-IQSEKNAGPNVNSARGFNVVDNIKTALENACPGVVSCSDVLA  132

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LASE++VSLAGGPSW VLLGRRD  TAN  GAN+S+P+P + LSN+T KF+ VGLN NDL
Sbjct  133   LASEASVSLAGGPSWTVLLGRRDSLTANLAGANSSIPSPIESLSNITFKFSAVGLNTNDL  192

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             VALSGAHTFGRA+C  FNNRLFNFS TGNPDPTLN+T L+TLQQ+CPQ GS ST+TNLD 
Sbjct  193   VALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSTLQQLCPQNGSASTITNLDL  252

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             +T D FDNNYF+NLQ+N GLL+SDQELFST+G++TIAIV +F++NQT FFQ+F QSMINM
Sbjct  253   STPDAFDNNYFANLQSNDGLLQSDQELFSTTGSSTIAIVTSFASNQTLFFQAFAQSMINM  312

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNISPLTGS+GEIRL+C+++N
Sbjct  313   GNISPLTGSNGEIRLDCKKVN  333



>ref|XP_009122283.1| PREDICTED: peroxidase A2 [Brassica rapa]
 emb|CDX70075.1| BnaA10g24240D [Brassica napus]
Length=338

 Score =   457 bits (1175),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 229/324 (71%), Positives = 280/324 (86%), Gaps = 1/324 (0%)
 Frame = +2

Query  56    FSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLH  235
             F  +L   +     F  SNAQL++TFYS TCPN S+IV T IQQALQ+D+RIGASLIRLH
Sbjct  14    FIVILTTLIISSSLFGTSNAQLNATFYSGTCPNASAIVRTTIQQALQSDSRIGASLIRLH  73

Query  236   FHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCAD  415
             FHDCFVNGCD S+LLD++G+ I SEK+A  N NSARGF+VVDNIKTA+ENACPGVVSC+D
Sbjct  74    FHDCFVNGCDASILLDDSGS-IQSEKNAGPNANSARGFNVVDNIKTALENACPGVVSCSD  132

Query  416   IlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNV  595
             +LALASE++VSL+GGPSW VLLGRRD  TANQ GAN+S+P+P + L+N+T KF+ VGLN 
Sbjct  133   VLALASEASVSLSGGPSWTVLLGRRDSLTANQAGANSSIPSPVESLTNITSKFSAVGLNT  192

Query  596   NDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTN  775
             NDLVALSGAHTFGRA+C  F+NRLFNFS +GNPDPTLNTT L++LQQ+CPQ G+GS +TN
Sbjct  193   NDLVALSGAHTFGRARCGVFSNRLFNFSGSGNPDPTLNTTLLSSLQQICPQNGTGSGITN  252

Query  776   LDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSM  955
             LD +T D FDNNYF+NLQ+N GLL+SDQELFST+G+ATIAIV +F++NQ+ FFQ+F QSM
Sbjct  253   LDLSTPDAFDNNYFTNLQSNNGLLQSDQELFSTTGSATIAIVTSFASNQSLFFQAFAQSM  312

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             INMGNI+PLTG+SGEIRL+C+++N
Sbjct  313   INMGNITPLTGNSGEIRLDCKKVN  336



>emb|CCJ34825.1| horseradish peroxidase isoenzyme HRP_A2A [Armoracia rusticana]
Length=336

 Score =   456 bits (1174),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 228/321 (71%), Positives = 278/321 (87%), Gaps = 1/321 (0%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             ++++ V +   F  S+AQL++TFYS TCPN S+IV + IQQA Q+D RIGASLIRLHFHD
Sbjct  15    IISLLVIVSSLFGTSSAQLNATFYSGTCPNASAIVRSTIQQAFQSDTRIGASLIRLHFHD  74

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCD S+LLD++G+ I SEK+A  N NSARGF+VVDNIKTA+EN CPGVVSC+DILA
Sbjct  75    CFVNGCDASILLDDSGS-IQSEKNAGPNANSARGFNVVDNIKTALENTCPGVVSCSDILA  133

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LASE++VSL GGPSW VLLGRRD  TAN  GAN+++P+PF+ LSN+T KF+ VGLN NDL
Sbjct  134   LASEASVSLTGGPSWTVLLGRRDSLTANLAGANSAIPSPFEGLSNITSKFSAVGLNTNDL  193

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             VALSGAHTFGRA+C  FNNRLFNFS TGNPDPTLN+T L++LQQ+CPQ GS ST+TNLD 
Sbjct  194   VALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQNGSASTITNLDL  253

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             +T D FDNNYF+NLQ+N GLL+SDQELFST+G+ATIA+V +F++NQT FFQ+F QSMINM
Sbjct  254   STPDAFDNNYFANLQSNNGLLQSDQELFSTTGSATIAVVTSFASNQTLFFQAFAQSMINM  313

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNISPLTGS+GEIRL+C+++N
Sbjct  314   GNISPLTGSNGEIRLDCKKVN  334



>emb|CCJ34826.1| horseradish peroxidase isoenzyme HRP_A2B [Armoracia rusticana]
Length=336

 Score =   455 bits (1170),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 227/321 (71%), Positives = 277/321 (86%), Gaps = 1/321 (0%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             ++++ V +   F  S+AQL++TFYS TCPN S+IV + IQQA Q+D RIGASLIRLHFHD
Sbjct  15    IISLLVIVSSLFGTSSAQLNATFYSGTCPNASAIVRSTIQQAFQSDTRIGASLIRLHFHD  74

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCD S+LLD++G+ I SEK+A  N NSARGF+VVDNIKTA+EN CPGVVSC+DILA
Sbjct  75    CFVNGCDASILLDDSGS-IQSEKNAGPNANSARGFNVVDNIKTALENTCPGVVSCSDILA  133

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LASE++VSL GGPSW VLLGRRD  TAN  GAN+++P+PF+ LSN+T KF+ VGLN NDL
Sbjct  134   LASEASVSLTGGPSWTVLLGRRDSLTANLAGANSAIPSPFEGLSNITSKFSAVGLNTNDL  193

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             VALSGAHTFGRA+C  FNNRLFNFS TGNPDPTLN+T L++LQQ+CPQ GS ST+TNLD 
Sbjct  194   VALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQNGSASTITNLDL  253

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             +T D FDNNYF+NLQ+N GLL+SDQELFST+G+ATI +V +F++NQT FFQ+F QSMINM
Sbjct  254   STPDAFDNNYFANLQSNNGLLQSDQELFSTTGSATITVVTSFASNQTLFFQAFAQSMINM  313

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNISPLTGS+GEIRL+C+++N
Sbjct  314   GNISPLTGSNGEIRLDCKKVN  334



>gb|KHN41710.1| Peroxidase 53 [Glycine soja]
Length=331

 Score =   454 bits (1169),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 224/314 (71%), Positives = 275/314 (88%), Gaps = 0/314 (0%)
 Frame = +2

Query  86    IFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCD  265
             +  F   S AQL++TFYS+TCPNVSSIVS  +QQALQ+D+RIGASLIRLHFHDCFVNGCD
Sbjct  16    VLTFLFPSEAQLNATFYSSTCPNVSSIVSNAVQQALQSDSRIGASLIRLHFHDCFVNGCD  75

Query  266   GSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesav  445
              S+LLD  G    SEK+A  N NS RGFD+VDNIK+++E++CPGVVSCADILALA+ES+V
Sbjct  76    ASILLDQGGNITQSEKNAVPNFNSVRGFDIVDNIKSSLESSCPGVVSCADILALAAESSV  135

Query  446   slaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAH  625
             SL+GGPSWNVLLGRRDG TANQ GAN+SLP+PF+ L+N++ KF+ VGL+  DLVALSGAH
Sbjct  136   SLSGGPSWNVLLGRRDGLTANQAGANSSLPSPFESLANVSSKFSAVGLDTTDLVALSGAH  195

Query  626   TFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFD  805
             TFGR+QC+ F+ RLFNFS TG+PDPTLN+TYLATLQQ CPQ G+GST+ NLDP+T DTFD
Sbjct  196   TFGRSQCQFFSQRLFNFSGTGSPDPTLNSTYLATLQQNCPQNGNGSTLNNLDPSTPDTFD  255

Query  806   NNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLT  985
             NNYF+NL  N+GLL++DQELFST+G++TI+IVNNF+ NQ+AFF++F QSMINMGNISPLT
Sbjct  256   NNYFTNLLINQGLLQTDQELFSTNGSSTISIVNNFANNQSAFFEAFAQSMINMGNISPLT  315

Query  986   GSSGEIRLNCRRLN  1027
             G+ GEIR +C+++N
Sbjct  316   GTQGEIRTDCKKVN  329



>gb|AFK39887.1| unknown [Lotus japonicus]
Length=335

 Score =   454 bits (1169),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 230/314 (73%), Positives = 275/314 (88%), Gaps = 0/314 (0%)
 Frame = +2

Query  86    IFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCD  265
             + I    SNAQLSSTFYS+TCP+VSSIV +V+QQALQ+D+RIGASL RLHFHDCFVNGCD
Sbjct  20    LIILLYPSNAQLSSTFYSSTCPSVSSIVRSVVQQALQSDSRIGASLTRLHFHDCFVNGCD  79

Query  266   GSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesav  445
             GS+LLD      +SEK+A  NNNSARGFDVVDNIKT+VEN+CPGVVSCADILALA++++V
Sbjct  80    GSILLDQGVNITLSEKNATPNNNSARGFDVVDNIKTSVENSCPGVVSCADILALAAQASV  139

Query  446   slaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAH  625
             +LAGGPSWNVL+GRRDG  ANQ GAN S+P PF+ L+ ++ KF  VGLN+ DLVALSGAH
Sbjct  140   ALAGGPSWNVLVGRRDGVMANQSGANASIPTPFESLAIISAKFAAVGLNITDLVALSGAH  199

Query  626   TFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFD  805
             TFGRAQCR FN RLFNFS TG+PDPTL++TYLATLQQ CPQ GSG+T+ NLDP+++D FD
Sbjct  200   TFGRAQCRFFNQRLFNFSGTGSPDPTLSSTYLATLQQNCPQNGSGTTLNNLDPSSADAFD  259

Query  806   NNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLT  985
             +NYF NL NN+GLL+SDQELFST+G+ATI+IVNNF+ NQTAFF++F QSMINMGN+SPLT
Sbjct  260   SNYFKNLLNNKGLLQSDQELFSTNGSATISIVNNFATNQTAFFEAFAQSMINMGNVSPLT  319

Query  986   GSSGEIRLNCRRLN  1027
             G+ GEIR NCR++N
Sbjct  320   GNQGEIRSNCRKVN  333



>ref|XP_010491252.1| PREDICTED: peroxidase 53 [Camelina sativa]
Length=336

 Score =   454 bits (1169),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 226/321 (70%), Positives = 277/321 (86%), Gaps = 0/321 (0%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             ++++   +   F  S+AQL++TFYS TCPN S+IV + IQQALQ+D RIGASLIRLHFHD
Sbjct  14    IISLIAIVSSIFGTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHD  73

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCD S+LLD+   +I SEK+A  N NSARGF+VVDNIKTA+ENACPGVVSC+D+LA
Sbjct  74    CFVNGCDASILLDDVSGSIQSEKNAGPNANSARGFNVVDNIKTALENACPGVVSCSDVLA  133

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LASE++VSLAGGPSW VLLGRRD  TAN  GAN+++P+P + LSN+T KF+ VGLN NDL
Sbjct  134   LASEASVSLAGGPSWTVLLGRRDSLTANLAGANSTIPSPVESLSNITSKFSAVGLNTNDL  193

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             VALSGAHTFGRA+C  FNNRLFNFS TGNPDPTLN+T L++LQQ+CPQ GS +T+TNLD 
Sbjct  194   VALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQNGSATTITNLDL  253

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             +T D FDNNYF+NLQ+N GLL+SDQELFST+G++TIAIV +F++NQT FFQ+F QSMINM
Sbjct  254   STPDAFDNNYFTNLQSNNGLLQSDQELFSTTGSSTIAIVTSFASNQTLFFQTFAQSMINM  313

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNISPLTGS+GEIRL+C+++N
Sbjct  314   GNISPLTGSNGEIRLDCKKVN  334



>ref|XP_010423310.1| PREDICTED: peroxidase 53-like [Camelina sativa]
Length=336

 Score =   454 bits (1169),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 226/321 (70%), Positives = 277/321 (86%), Gaps = 0/321 (0%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             ++++   +   F  S+AQL++TFYS TCPN S+IV + IQQALQ+D RIGASLIRLHFHD
Sbjct  14    IISLIAIVSSMFGTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHD  73

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCD S+LLD+   +I SEK+A  N NSARGF+VVDNIKTA+ENACPGVVSC+D+LA
Sbjct  74    CFVNGCDASILLDDVSGSIQSEKNAGPNANSARGFNVVDNIKTALENACPGVVSCSDVLA  133

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LASE++VSLAGGPSW VLLGRRD  TAN  GAN+++P+P + LSN+T KF+ VGLN NDL
Sbjct  134   LASEASVSLAGGPSWTVLLGRRDSLTANLAGANSAIPSPVESLSNITSKFSAVGLNSNDL  193

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             VALSGAHTFGRA+C  FNNRLFNFS TGNPDPTLN+T L++LQQ+CPQ GS +T+TNLD 
Sbjct  194   VALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSSLQQLCPQNGSATTITNLDL  253

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             +T D FDNNYF+NLQ+N GLL+SDQELFST+G++TIAIV +F++NQT FFQ+F QSMINM
Sbjct  254   STPDAFDNNYFANLQSNNGLLQSDQELFSTTGSSTIAIVTSFASNQTLFFQTFAQSMINM  313

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNISPLTGS+GEIRL+C+++N
Sbjct  314   GNISPLTGSNGEIRLDCKKVN  334



>ref|XP_006399147.1| hypothetical protein EUTSA_v10013916mg [Eutrema salsugineum]
 gb|ESQ40600.1| hypothetical protein EUTSA_v10013916mg [Eutrema salsugineum]
Length=361

 Score =   455 bits (1170),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 229/318 (72%), Positives = 275/318 (86%), Gaps = 1/318 (0%)
 Frame = +2

Query  74    MAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFV  253
             + +   I F  S+AQL++TFYS TCPN S+IV + IQQALQ+D RIGASLIRLHFHDCFV
Sbjct  19    LVIVSSILFGTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDPRIGASLIRLHFHDCFV  78

Query  254   NGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalas  433
             NGCDGS+LLD++G+ I SEK+AA N NSARGF+VVDNIKTA+ENACPG+VSC+D+LALAS
Sbjct  79    NGCDGSILLDDSGS-IQSEKNAAPNANSARGFNVVDNIKTALENACPGIVSCSDVLALAS  137

Query  434   esavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVAL  613
             E++VSLAGGP+W VLLGRRDG TANQ GANTSLP+PF+ L+N+T KF+ VGLN  DLVAL
Sbjct  138   EASVSLAGGPTWTVLLGRRDGLTANQAGANTSLPSPFEGLNNITSKFSAVGLNTTDLVAL  197

Query  614   SGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTS  793
             SGAHTFGR  C TFNNRLFNF+ TGNPDPTLN+T L++LQQ+CPQ GSGS +TNLD +T 
Sbjct  198   SGAHTFGRGNCVTFNNRLFNFNGTGNPDPTLNSTLLSSLQQICPQNGSGSGITNLDLSTP  257

Query  794   DTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNI  973
             D FDNNYF+NLQ+N GLL+SDQELFS +G+ TIAIV +F++NQT FF++F QSMI MGNI
Sbjct  258   DAFDNNYFTNLQSNNGLLQSDQELFSDTGSPTIAIVTSFASNQTLFFEAFAQSMIKMGNI  317

Query  974   SPLTGSSGEIRLNCRRLN  1027
             SPLTGSSGEIR +C+ +N
Sbjct  318   SPLTGSSGEIRQDCKVIN  335



>ref|XP_006575205.1| PREDICTED: peroxidase 53-like [Glycine max]
Length=331

 Score =   453 bits (1166),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 224/314 (71%), Positives = 274/314 (87%), Gaps = 0/314 (0%)
 Frame = +2

Query  86    IFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCD  265
             +  F   S AQL++TFYS+TCPNVSSIVS  +QQALQ+D+RIGASLIRLHFHDCFVNGCD
Sbjct  16    VLTFLFPSEAQLNATFYSSTCPNVSSIVSNAVQQALQSDSRIGASLIRLHFHDCFVNGCD  75

Query  266   GSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesav  445
              S+LLD  G    SEK+A  N NS RGFD+VDNIK+++E++CPGVVSCADILALA+ES+V
Sbjct  76    ASILLDQGGNITQSEKNAVPNFNSVRGFDIVDNIKSSLESSCPGVVSCADILALAAESSV  135

Query  446   slaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAH  625
             SL+GGPSWNVLLGRRDG TANQ GAN+SLP+PF+ L+N++ KF+ VGL+  DLVALSGAH
Sbjct  136   SLSGGPSWNVLLGRRDGLTANQAGANSSLPSPFESLANVSSKFSAVGLDTTDLVALSGAH  195

Query  626   TFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFD  805
             TFGR+QC+ F+ RLFNFS TG+PDPTLN+TYLATLQQ CPQ G+GST+ NLDP+T DTFD
Sbjct  196   TFGRSQCQFFSQRLFNFSGTGSPDPTLNSTYLATLQQNCPQNGNGSTLNNLDPSTPDTFD  255

Query  806   NNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLT  985
             NNYF+NL  N+GLL++DQELFST+G++TI+IVNNF+ NQ+AFF +F QSMINMGNISPLT
Sbjct  256   NNYFTNLLINQGLLQTDQELFSTNGSSTISIVNNFANNQSAFFAAFAQSMINMGNISPLT  315

Query  986   GSSGEIRLNCRRLN  1027
             G+ GEIR +C+++N
Sbjct  316   GTQGEIRTDCKKVN  329



>ref|XP_010520028.1| PREDICTED: peroxidase A2-like [Tarenaya hassleriana]
Length=340

 Score =   453 bits (1166),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 229/324 (71%), Positives = 274/324 (85%), Gaps = 1/324 (0%)
 Frame = +2

Query  56    FSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLH  235
             F+  L +   +   F  S  QL++TFYS TCPN SSIV  ++QQALQ+D RIGASLIRLH
Sbjct  16    FAMTLIVLPLVSSMFGTSYGQLNATFYSGTCPNASSIVRNIVQQALQSDPRIGASLIRLH  75

Query  236   FHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCAD  415
             FHDCFVNGCD S+LLD +G+ + SEK+A  N NS RGF VVDNIKTA+ENACPGVVSCAD
Sbjct  76    FHDCFVNGCDASILLDGSGS-VQSEKNAGPNANSVRGFGVVDNIKTALENACPGVVSCAD  134

Query  416   IlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNV  595
             ILA ASES+VSL+GGPSW VLLGRRDG TANQ GANTS+P+PF+ LSN+T KF+ VGLN 
Sbjct  135   ILAFASESSVSLSGGPSWTVLLGRRDGLTANQAGANTSIPSPFEGLSNITAKFSAVGLNT  194

Query  596   NDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTN  775
             +DLVALSGAHTFGRAQCR F++RL+NFS TGNPDP+LNTT+L +LQQ+CP+ GSGS +TN
Sbjct  195   SDLVALSGAHTFGRAQCRLFSSRLYNFSGTGNPDPSLNTTFLNSLQQLCPRNGSGSVITN  254

Query  776   LDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSM  955
             LD  T D+FDN YF+NLQ N+GLL+SDQELFST GAAT+AIV +F++NQT FFQ+F QSM
Sbjct  255   LDLQTPDSFDNAYFANLQTNQGLLQSDQELFSTRGAATVAIVASFASNQTLFFQAFAQSM  314

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             INMGNISPLTG+SGEIR +C+++N
Sbjct  315   INMGNISPLTGNSGEIRQDCKKVN  338



>ref|XP_006362277.1| PREDICTED: peroxidase 15-like [Solanum tuberosum]
Length=335

 Score =   452 bits (1164),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 227/326 (70%), Positives = 272/326 (83%), Gaps = 2/326 (1%)
 Frame = +2

Query  56    FSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLH  235
             FS ++ + + +  FFS+SNAQL+S FY   CPNVS IV  VIQ+ALQ+DARIGASL+RLH
Sbjct  10    FSVIICILLVVLSFFSKSNAQLNSNFYQNNCPNVSDIVRCVIQEALQSDARIGASLLRLH  69

Query  236   FHDCFVNGCDGSLLLDNNGTT-IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             FHDCFVNGCD S+LLDNN  T IVSEKDAA N NS RGF+VVDNIK AVEN CPGVVSCA
Sbjct  70    FHDCFVNGCDASILLDNNAKTNIVSEKDAAPNANSVRGFNVVDNIKVAVENCCPGVVSCA  129

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALA+ES+VSLAGGPSWNVLLGRRD   ANQGGAN S+P+PF+ ++ +T KF+ VGL+
Sbjct  130   DILALAAESSVSLAGGPSWNVLLGRRDSRRANQGGANISIPSPFESINKITTKFSAVGLS  189

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
             + DLVALSGAHTFGRAQCR F  RL+NF+ TG PDPTLNT YLA L ++CP+ GS + + 
Sbjct  190   ITDLVALSGAHTFGRAQCRLFRQRLYNFNGTGKPDPTLNTNYLAKLMKICPKKGSNTPLA  249

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIA-IVNNFSANQTAFFQSFVQ  949
             NLD TT + FDNNYF+NLQNN+GLL+SDQ+LFS +GA+ I  I+N FS +Q  FFQSFV+
Sbjct  250   NLDLTTPNKFDNNYFANLQNNKGLLESDQKLFSKNGASEITNIINTFSRDQNVFFQSFVE  309

Query  950   SMINMGNISPLTGSSGEIRLNCRRLN  1027
             SMINMGNISPLTG++GEIRL+C+R+N
Sbjct  310   SMINMGNISPLTGTNGEIRLDCKRVN  335



>ref|XP_010452613.1| PREDICTED: peroxidase 54 [Camelina sativa]
Length=358

 Score =   453 bits (1165),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 227/321 (71%), Positives = 278/321 (87%), Gaps = 1/321 (0%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             ++++ + + + F  S+AQL++TFYS TCPN S+IV + IQQALQ+D RIGASLIRLHFHD
Sbjct  15    IISLLIIVSLLFGTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDPRIGASLIRLHFHD  74

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLD+ G+ I SEK+A  N NS RGF+VVDNIKTA+ENACPG+VSC+D+LA
Sbjct  75    CFVNGCDGSLLLDDTGS-IQSEKNAPPNANSTRGFNVVDNIKTALENACPGIVSCSDVLA  133

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LASE++VSLAGGPSW+VLLGRRDG  AN  GAN+SLP+PF+ L+N+T KF  VGLN  D+
Sbjct  134   LASEASVSLAGGPSWSVLLGRRDGLNANLTGANSSLPSPFEGLNNITSKFVAVGLNTTDV  193

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             VALSGAHTFGR +C TFNNRLFNFS TGNPDPTLN+T L++LQQ+CPQ  SGS +TNLD 
Sbjct  194   VALSGAHTFGRGKCVTFNNRLFNFSGTGNPDPTLNSTLLSSLQQICPQNSSGSGITNLDL  253

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             TT D FDN+YF+NLQ+N GLL+SDQELFS SG+AT+A+VN+F++NQT FF++FVQSMINM
Sbjct  254   TTPDAFDNSYFTNLQSNNGLLQSDQELFSNSGSATVAVVNSFASNQTLFFEAFVQSMINM  313

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNISPLTGSSGEIR +C+ +N
Sbjct  314   GNISPLTGSSGEIRQDCKVVN  334



>ref|XP_004497888.1| PREDICTED: peroxidase 53-like [Cicer arietinum]
Length=329

 Score =   451 bits (1161),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 225/327 (69%), Positives = 275/327 (84%), Gaps = 0/327 (0%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLI  226
             M S + L A+          SN QL++TFYS TCPNVSSIV  ++QQALQ+D+RIGASL 
Sbjct  1     MFSRTILPALIFLTLTLLYPSNGQLNATFYSNTCPNVSSIVKNIVQQALQSDSRIGASLT  60

Query  227   RLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVS  406
             RLHFHDCFVNGCD S+LLD  G    SEK+AA N NS RGF+V+DNIK+++E++C GVVS
Sbjct  61    RLHFHDCFVNGCDASILLDQGGNITQSEKNAAPNFNSIRGFNVIDNIKSSLESSCSGVVS  120

Query  407   CADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVG  586
             CADI+ALA+ES+VS++GGPSWNVLLGRRDG TANQGGANTS+P+PF+ L+N+T KF+ VG
Sbjct  121   CADIVALAAESSVSMSGGPSWNVLLGRRDGLTANQGGANTSIPSPFESLANITSKFSAVG  180

Query  587   LNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGST  766
             L+  DLVALSGAHTFGRAQC+ F+ RLFNFS +G+PDPTLN+TYLATLQQ CPQ G+GST
Sbjct  181   LDTTDLVALSGAHTFGRAQCKFFSQRLFNFSGSGSPDPTLNSTYLATLQQNCPQNGNGST  240

Query  767   VTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFV  946
             + NLDP+T DTFDNNYFSNL  N GLL++DQEL ST+G++TI+IVNNF+ NQTAFF  F 
Sbjct  241   LNNLDPSTQDTFDNNYFSNLLINMGLLQTDQELLSTNGSSTISIVNNFANNQTAFFNQFA  300

Query  947   QSMINMGNISPLTGSSGEIRLNCRRLN  1027
             QSMINMGNISPLTG+ GEIR++C+++N
Sbjct  301   QSMINMGNISPLTGNQGEIRVDCKKVN  327



>pdb|1PA2|A Chain A, Arabidopsis Thaliana Peroxidase A2
 pdb|1QO4|A Chain A, Arabidopsis Thaliana Peroxidase A2 At Room Temperature
Length=306

 Score =   449 bits (1155),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 227/304 (75%), Positives = 269/304 (88%), Gaps = 1/304 (0%)
 Frame = +2

Query  116   QLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNGT  295
             QL++TFYS TCPN S+IV + IQQALQ+D RIGASLIRLHFHDCFVNGCD S+LLD+ G+
Sbjct  2     QLNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHDCFVNGCDASILLDDTGS  61

Query  296   TIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNV  475
              I SEK+A  N NSARGF+VVDNIKTA+ENACPGVVSC+D+LALASE++VSLAGGPSW V
Sbjct  62    -IQSEKNAGPNVNSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSWTV  120

Query  476   LLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRTF  655
             LLGRRD  TAN  GAN+S+P+P + LSN+T KF+ VGLN NDLVALSGAHTFGRA+C  F
Sbjct  121   LLGRRDSLTANLAGANSSIPSPIESLSNITFKFSAVGLNTNDLVALSGAHTFGRARCGVF  180

Query  656   NNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQNN  835
             NNRLFNFS TGNPDPTLN+T L+TLQQ+CPQ GS ST+TNLD +T D FDNNYF+NLQ+N
Sbjct  181   NNRLFNFSGTGNPDPTLNSTLLSTLQQLCPQNGSASTITNLDLSTPDAFDNNYFANLQSN  240

Query  836   RGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLNC  1015
              GLL+SDQELFST+G++TIAIV +F++NQT FFQ+F QSMINMGNISPLTGS+GEIRL+C
Sbjct  241   DGLLQSDQELFSTTGSSTIAIVTSFASNQTLFFQAFAQSMINMGNISPLTGSNGEIRLDC  300

Query  1016  RRLN  1027
             +++N
Sbjct  301   KKVN  304



>ref|XP_010491253.1| PREDICTED: peroxidase 54-like [Camelina sativa]
Length=359

 Score =   451 bits (1160),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 227/320 (71%), Positives = 277/320 (87%), Gaps = 1/320 (0%)
 Frame = +2

Query  68    LAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDC  247
             +++ + + + F  S+AQL++TFYS TCPN S+IV + IQQALQ+D RIGASLIRLHFHDC
Sbjct  16    ISLLIIVSLLFGTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDPRIGASLIRLHFHDC  75

Query  248   FVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlal  427
             FVNGCDGSLLLD+ G+ I SEK+A  N NS RGF+VVDNIKTA+ENACPG+VSC+D+LAL
Sbjct  76    FVNGCDGSLLLDDAGS-IQSEKNAPPNANSTRGFNVVDNIKTALENACPGIVSCSDVLAL  134

Query  428   asesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLV  607
             ASE++VSLAGGPSW+VLLGRRDG  AN  GAN+SLP+PF+ L+N+T KF  VGLN  D+V
Sbjct  135   ASEASVSLAGGPSWSVLLGRRDGLNANLTGANSSLPSPFEGLNNITSKFVAVGLNTTDVV  194

Query  608   ALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPT  787
             ALSGAHTFGRA+C TFNNRLFNFS TGNPDPTLN+T L++LQQ+CP  GSGS +TNLD T
Sbjct  195   ALSGAHTFGRAKCVTFNNRLFNFSGTGNPDPTLNSTLLSSLQQICPHNGSGSGITNLDLT  254

Query  788   TSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMG  967
             T D FDN+YF+NLQ+N GLL+SDQELFS +G+ T+AIVN+F++NQT FF++FVQSMINMG
Sbjct  255   TPDAFDNSYFTNLQSNNGLLQSDQELFSNTGSDTVAIVNSFASNQTLFFEAFVQSMINMG  314

Query  968   NISPLTGSSGEIRLNCRRLN  1027
             NISPLTGSSGEIR +C+ +N
Sbjct  315   NISPLTGSSGEIRQDCKAVN  334



>ref|XP_002304885.1| peroxidase family protein [Populus trichocarpa]
 gb|EEE79864.1| peroxidase family protein [Populus trichocarpa]
 gb|ACN97184.1| peroxidase [Populus trichocarpa]
Length=349

 Score =   446 bits (1148),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 234/332 (70%), Positives = 265/332 (80%), Gaps = 4/332 (1%)
 Frame = +2

Query  41    KKMASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGAS  220
             K M    A L + +        + AQL+ TFY  TCPNVS+I+  V+ QALQ D RIGAS
Sbjct  5     KAMHPLLASLFLVIWFGGSLPYAYAQLTPTFYDGTCPNVSTIIRGVLVQALQTDPRIGAS  64

Query  221   LIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGV  400
             LIRLHFHDCFV+GCDGS+LLDN   TI SEK+AA NNNSARGFDVVD++K AVENACPG+
Sbjct  65    LIRLHFHDCFVDGCDGSILLDNT-DTIESEKEAAPNNNSARGFDVVDDMKAAVENACPGI  123

Query  401   VSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTN  580
             VSCADILA+A+E +V LAGGPSW V LGRRD   AN+ GAN++LP+PF  L  L  KF  
Sbjct  124   VSCADILAIAAEESVRLAGGPSWTVPLGRRDSLIANRSGANSALPSPFASLDVLKSKFAA  183

Query  581   VGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG-  754
             VGLN + DLVALSGAHTFGRAQC +FN RL+NFS +GNPDPTLNTTYLA LQQ+CPQ G 
Sbjct  184   VGLNTSSDLVALSGAHTFGRAQCSSFNLRLYNFSGSGNPDPTLNTTYLAELQQLCPQAGN  243

Query  755   -SGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAF  931
              S S VTNLDPTT DTFD NYFSNLQ N GLL+SDQELFST+GA TI IVNNFS+NQTAF
Sbjct  244   ESESVVTNLDPTTPDTFDGNYFSNLQTNEGLLRSDQELFSTTGADTIDIVNNFSSNQTAF  303

Query  932   FQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             F+SFV SMI MGNISPLTG+ GEIRLNCRR+N
Sbjct  304   FESFVVSMIRMGNISPLTGTDGEIRLNCRRVN  335



>emb|CCJ34833.1| horseradish peroxidase isoenzyme HRP_4663 [Armoracia rusticana]
Length=358

 Score =   446 bits (1147),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 224/321 (70%), Positives = 274/321 (85%), Gaps = 1/321 (0%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             ++++ V     F  S+AQL++TFYS TCPN S+IV + IQQALQ+D RIGASLIRLHFHD
Sbjct  15    IISLLVIASSLFGTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDPRIGASLIRLHFHD  74

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLD+ G+ I SEK+A  N NSARGF+VVD+IKTA+ENACPG+VSC+DILA
Sbjct  75    CFVNGCDGSLLLDDTGS-IQSEKNAPANANSARGFNVVDDIKTALENACPGIVSCSDILA  133

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LASE++VSLAGGPSW VL+GRRDG TAN  GAN+SLP+PF+ L+N+T KF  VGLN  D+
Sbjct  134   LASEASVSLAGGPSWTVLVGRRDGLTANLSGANSSLPSPFEGLNNITSKFLAVGLNTTDV  193

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             V LSGAHTFGR QC TFNNRLFNF+ TG+PDPTLN+T L++LQQ+CPQ GSGS +TNLD 
Sbjct  194   VVLSGAHTFGRGQCVTFNNRLFNFNGTGSPDPTLNSTLLSSLQQICPQNGSGSAITNLDL  253

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             TT D FD+NY++NLQ+N GLL+SDQELFS +G+ TIAIVN+F++NQT FF++F QSMI M
Sbjct  254   TTPDAFDSNYYTNLQSNNGLLQSDQELFSNTGSPTIAIVNSFASNQTLFFEAFAQSMIKM  313

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNISPLTG+SGEIR +C+ +N
Sbjct  314   GNISPLTGTSGEIRQDCKAVN  334



>gb|AHL39126.1| class III peroxidase [Populus trichocarpa]
Length=349

 Score =   445 bits (1145),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 233/332 (70%), Positives = 265/332 (80%), Gaps = 4/332 (1%)
 Frame = +2

Query  41    KKMASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGAS  220
             K M    A L + +        + AQL+ TFY  TCPNVS+I+  V+ QALQ D RIGAS
Sbjct  5     KAMHPLLASLFLVIWFGGSLPYAYAQLTPTFYDGTCPNVSTIIRGVLAQALQTDPRIGAS  64

Query  221   LIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGV  400
             LIRLHFHDCFV+GCDGS+LLDN   TI SEK+AA NNNSARGFDVVD++K AVENACPG+
Sbjct  65    LIRLHFHDCFVDGCDGSILLDNT-DTIESEKEAAPNNNSARGFDVVDDMKAAVENACPGI  123

Query  401   VSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTN  580
             VSCADILA+A+E +V LAGGPSW V LGRRD   AN+ GAN++LP+PF  L  L  KF  
Sbjct  124   VSCADILAIAAEESVCLAGGPSWTVPLGRRDSLIANRSGANSALPSPFASLDVLKSKFAA  183

Query  581   VGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG-  754
             VGLN + DLVALSGAHTFGRAQC +FN RL+NFS +GNPDPTLNTTYLA LQQ+CPQ G 
Sbjct  184   VGLNTSSDLVALSGAHTFGRAQCSSFNLRLYNFSGSGNPDPTLNTTYLAELQQLCPQAGN  243

Query  755   -SGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAF  931
              S S VTNLDPTT DTFD NYFSNLQ N GLL+SDQELFST+GA TI IVN+FS+NQTAF
Sbjct  244   ESESVVTNLDPTTPDTFDGNYFSNLQTNEGLLRSDQELFSTTGADTIDIVNHFSSNQTAF  303

Query  932   FQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             F+SFV SMI MGNISPLTG+ GEIRLNCRR+N
Sbjct  304   FESFVVSMIRMGNISPLTGTDGEIRLNCRRVN  335



>gb|KEH41719.1| peroxidase family protein [Medicago truncatula]
Length=328

 Score =   444 bits (1142),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 225/326 (69%), Positives = 272/326 (83%), Gaps = 5/326 (2%)
 Frame = +2

Query  65    LLAMAVAIFIFFS-----QSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIR  229
             +L+  +   IFFS      SN QL++TFYS TCPNVSSIV   +QQALQ+D+RIGASLIR
Sbjct  1     MLSSTIQAIIFFSLILLYPSNGQLNATFYSNTCPNVSSIVKNAVQQALQSDSRIGASLIR  60

Query  230   LHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSC  409
             LHFHDCFVNGCD S+LLD  G    SEK+AA N NS RGF VVD IK+++E++C GVVSC
Sbjct  61    LHFHDCFVNGCDASILLDQGGNITQSEKNAAPNFNSIRGFGVVDTIKSSLESSCSGVVSC  120

Query  410   ADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGL  589
             ADILALA+ES+VSLAGGPSWNVLLGRRDG TANQGGAN+S+P+PF+ L+N+T KF+ V L
Sbjct  121   ADILALAAESSVSLAGGPSWNVLLGRRDGLTANQGGANSSIPSPFESLANVTSKFSAVNL  180

Query  590   NVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTV  769
             +  D+VALSGAHTFGRAQC+ F+ RLFNF+ TGNPDPTLNTTYLATLQQ CPQ G+GST+
Sbjct  181   DTTDMVALSGAHTFGRAQCQFFSQRLFNFNGTGNPDPTLNTTYLATLQQNCPQNGNGSTL  240

Query  770   TNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQ  949
              NLDP+T DTFDNNYF+NL    GLL++DQ LFST+G++T++IVN F+ NQTAFF  F Q
Sbjct  241   NNLDPSTQDTFDNNYFTNLLTKMGLLQTDQHLFSTNGSSTVSIVNTFANNQTAFFNQFAQ  300

Query  950   SMINMGNISPLTGSSGEIRLNCRRLN  1027
             SMINMGNISPLTG+ GEIR++C+++N
Sbjct  301   SMINMGNISPLTGTQGEIRIDCKKVN  326



>gb|AAM66044.1| peroxidase [Arabidopsis thaliana]
 gb|AAS17637.1| peroxidase ATP29a [Arabidopsis thaliana]
Length=358

 Score =   445 bits (1144),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 224/321 (70%), Positives = 275/321 (86%), Gaps = 1/321 (0%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             ++++ V +   F  S+AQL++TFYS TCPN S+IV + IQQALQ+DARIG SLIRLHFHD
Sbjct  15    IISLIVVVSSLFGASSAQLNATFYSGTCPNASAIVRSTIQQALQSDARIGGSLIRLHFHD  74

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLD+  ++I SEK+A  N NS RGF+VVD+IKTA+ENACPG+VSC+DILA
Sbjct  75    CFVNGCDGSLLLDDT-SSIQSEKNAPANANSTRGFNVVDSIKTALENACPGIVSCSDILA  133

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LASE++VSLAGGPSW VLLGRRDG TAN  GAN+SLP+PF+ L+N+T KF  VGLN  D+
Sbjct  134   LASEASVSLAGGPSWTVLLGRRDGLTANLSGANSSLPSPFEGLNNITSKFVAVGLNTTDV  193

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             V+LSGAHTFGR QC TFNNRLFNF+ TGNPDPTLN+T L++LQQ+CPQ GS + +TNLD 
Sbjct  194   VSLSGAHTFGRGQCVTFNNRLFNFNGTGNPDPTLNSTLLSSLQQLCPQNGSNTGITNLDL  253

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             +T D FDNNYF+NLQ+N GLL+SDQELFS +G+AT+ IVN+F++NQT FF++FVQSMI M
Sbjct  254   STPDAFDNNYFTNLQSNNGLLQSDQELFSNTGSATVPIVNSFASNQTLFFEAFVQSMIKM  313

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNISPLTGSSGEIR +C+ +N
Sbjct  314   GNISPLTGSSGEIRQDCKVVN  334



>ref|XP_006386069.1| hypothetical protein POPTR_0003s21640g [Populus trichocarpa]
 gb|ABK94318.1| unknown [Populus trichocarpa]
 gb|ACN97185.1| peroxidase [Populus trichocarpa]
 gb|ERP63866.1| hypothetical protein POPTR_0003s21640g [Populus trichocarpa]
 gb|AHL39127.1| class III peroxidase [Populus trichocarpa]
Length=354

 Score =   444 bits (1143),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 235/335 (70%), Positives = 269/335 (80%), Gaps = 8/335 (2%)
 Frame = +2

Query  44    KMASFSALLAMAVAIF--IFFSQS----NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDA  205
             KM    AL  +  ++F  I+F  S     AQL+ TFY  TCPNVS+I+  V+ QALQ D 
Sbjct  8     KMMIDKALHPLVASLFFVIWFGGSLPYAYAQLTPTFYDGTCPNVSTIIRGVLAQALQTDP  67

Query  206   RIGASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVEN  385
             RIGASLIRLHFHDCFV+GCDGS+LLDN   TI SEK+AA NNNSARGFDVVDN+K AVEN
Sbjct  68    RIGASLIRLHFHDCFVDGCDGSILLDNT-DTIESEKEAAPNNNSARGFDVVDNMKAAVEN  126

Query  386   ACPGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLT  565
             ACPG+VSCADILA+A+E +V LAGGPSW V LGRRD   AN+ GAN+S+P P + L+ L 
Sbjct  127   ACPGIVSCADILAIAAEESVRLAGGPSWTVPLGRRDSLIANRSGANSSIPAPSESLAVLK  186

Query  566   RKFTNVGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVC  742
              KF  VGLN + DLVALSGAHTFGRAQC  F +RL+NFS +GNPDPTLNTTYLA LQQ+C
Sbjct  187   SKFAAVGLNTSSDLVALSGAHTFGRAQCLNFISRLYNFSGSGNPDPTLNTTYLAALQQLC  246

Query  743   PQGGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQ  922
             PQGG+ S +TNLD TT DTFD NYFSNLQ N GLL+SDQELFST+GA TIAIVNNFS+NQ
Sbjct  247   PQGGNRSVLTNLDRTTPDTFDGNYFSNLQTNEGLLQSDQELFSTTGADTIAIVNNFSSNQ  306

Query  923   TAFFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             TAFF+SFV SMI MGNISPLTG+ GEIRLNCR +N
Sbjct  307   TAFFESFVVSMIRMGNISPLTGTDGEIRLNCRIVN  341



>ref|NP_196291.1| peroxidase 54 [Arabidopsis thaliana]
 sp|Q9FG34.1|PER54_ARATH RecName: Full=Peroxidase 54; Short=Atperox P54; AltName: Full=ATP29a; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09807.1| peroxidase [Arabidopsis thaliana]
 dbj|BAC43417.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAP40411.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED91056.1| peroxidase [Arabidopsis thaliana]
Length=358

 Score =   442 bits (1138),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 223/321 (69%), Positives = 274/321 (85%), Gaps = 1/321 (0%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             ++++ V +   F  S+AQL++TFYS TCPN S+IV + IQQALQ+DARIG SLIRLHFHD
Sbjct  15    IISLIVIVSSLFGTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDARIGGSLIRLHFHD  74

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLD+  ++I SEK+A  N NS RGF+VVD+IKTA+ENACPG+VSC+DILA
Sbjct  75    CFVNGCDGSLLLDDT-SSIQSEKNAPANANSTRGFNVVDSIKTALENACPGIVSCSDILA  133

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LASE++VSLAGGPSW VLLGRRDG TAN  GAN+SLP+PF+ L+N+T KF  VGL   D+
Sbjct  134   LASEASVSLAGGPSWTVLLGRRDGLTANLSGANSSLPSPFEGLNNITSKFVAVGLKTTDV  193

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             V+LSGAHTFGR QC TFNNRLFNF+ TGNPDPTLN+T L++LQQ+CPQ GS + +TNLD 
Sbjct  194   VSLSGAHTFGRGQCVTFNNRLFNFNGTGNPDPTLNSTLLSSLQQLCPQNGSNTGITNLDL  253

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             +T D FDNNYF+NLQ+N GLL+SDQELFS +G+AT+ IVN+F++NQT FF++FVQSMI M
Sbjct  254   STPDAFDNNYFTNLQSNNGLLQSDQELFSNTGSATVPIVNSFASNQTLFFEAFVQSMIKM  313

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNISPLTGSSGEIR +C+ +N
Sbjct  314   GNISPLTGSSGEIRQDCKVVN  334



>ref|XP_004249178.1| PREDICTED: peroxidase A2 [Solanum lycopersicum]
Length=338

 Score =   442 bits (1136),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 220/326 (67%), Positives = 266/326 (82%), Gaps = 2/326 (1%)
 Frame = +2

Query  56    FSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLH  235
             FS ++ + + +   FS SNAQL+S FY   CPNVS IV  V+Q+ALQ+DARIGASL+R+H
Sbjct  13    FSVIICILLVVLSIFSHSNAQLNSNFYENNCPNVSDIVRCVLQEALQSDARIGASLLRIH  72

Query  236   FHDCFVNGCDGSLLLDNNGTT-IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             FHDCFVNGCD S+LLDNN  T IVSEK+AA N NS RGF+VVDNIK AVEN CPGVVSCA
Sbjct  73    FHDCFVNGCDASILLDNNAKTKIVSEKNAAPNANSLRGFNVVDNIKVAVENCCPGVVSCA  132

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALA+ES+VSLAGGPSWNVLLGRRD   ANQGGAN S+P+P +D++ +T KF+ VGL 
Sbjct  133   DILALAAESSVSLAGGPSWNVLLGRRDSRRANQGGANISIPSPLEDINKITTKFSAVGLT  192

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
             + DLVALSGAHTFGRAQCR F  RL+NF+ TG PDPTLNT YLA L ++CP+ GS + + 
Sbjct  193   ITDLVALSGAHTFGRAQCRLFRERLYNFNGTGKPDPTLNTNYLAKLMKICPKKGSNTALA  252

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIA-IVNNFSANQTAFFQSFVQ  949
             NLD TT + FDNNYF+NLQN +GLL+SDQ+LFS + A+ I  I+  FS +Q  FFQSFV+
Sbjct  253   NLDLTTPNKFDNNYFANLQNKKGLLESDQKLFSKNSASEITNIIKTFSRDQNVFFQSFVE  312

Query  950   SMINMGNISPLTGSSGEIRLNCRRLN  1027
             SMINMGNISPLTG++GEIRL+C+R+N
Sbjct  313   SMINMGNISPLTGTNGEIRLDCKRVN  338



>emb|CAA66037.1| peroxidase [Populus trichocarpa]
Length=345

 Score =   441 bits (1135),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 233/329 (71%), Positives = 267/329 (81%), Gaps = 8/329 (2%)
 Frame = +2

Query  62    ALLAMAVAIF--IFFSQS----NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASL  223
             AL  +  ++F  I+F  S     AQL+ TFY  TCPNVS+I+  V+ QALQ D RIGASL
Sbjct  5     ALHPLVASLFFVIWFGGSLPYAYAQLTPTFYDGTCPNVSTIIRGVLAQALQTDPRIGASL  64

Query  224   IRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVV  403
             IRLHFHDCFV+GCDGS+LLDN   TI SEK+AA NNNSARGFDVVDN+K AVENACPG+V
Sbjct  65    IRLHFHDCFVDGCDGSILLDNT-DTIESEKEAAPNNNSARGFDVVDNMKAAVENACPGIV  123

Query  404   SCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNV  583
             SCADILA+A+E +V LAGGPSW V LGRRD   AN+ GAN+S+P P + L+ L  KF  V
Sbjct  124   SCADILAIAAEESVRLAGGPSWTVPLGRRDSLIANRSGANSSIPAPSESLAVLKSKFAAV  183

Query  584   GLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSG  760
             GLN + DLVALSGAHTFGRAQC  F +RL+NFS +GNPDPTLNTTYLA LQQ+CPQGG+ 
Sbjct  184   GLNTSSDLVALSGAHTFGRAQCLNFISRLYNFSGSGNPDPTLNTTYLAALQQLCPQGGNR  243

Query  761   STVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQS  940
             S +TNLD TT DTFD NYFSNLQ N GLL+SDQELFST+GA TIAIVNNFS+NQTAFF+S
Sbjct  244   SVLTNLDRTTPDTFDGNYFSNLQTNEGLLQSDQELFSTTGADTIAIVNNFSSNQTAFFES  303

Query  941   FVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FV SMI MGNISPLTG+ GEIRLNCR +N
Sbjct  304   FVVSMIRMGNISPLTGTDGEIRLNCRIVN  332



>ref|XP_007145698.1| hypothetical protein PHAVU_007G260700g [Phaseolus vulgaris]
 gb|ESW17692.1| hypothetical protein PHAVU_007G260700g [Phaseolus vulgaris]
Length=334

 Score =   441 bits (1133),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 216/324 (67%), Positives = 272/324 (84%), Gaps = 0/324 (0%)
 Frame = +2

Query  56    FSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLH  235
             + +L+A  + +  F   S  QLS++FYS+TC NVSSIV   +QQAL +D+RI ASLIRLH
Sbjct  9     YHSLVATILLVLTFVFPSEGQLSASFYSSTCSNVSSIVRDSVQQALTSDSRIAASLIRLH  68

Query  236   FHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCAD  415
             FHDCFV+GCDGS+LLD +G    SEK+AA N NS RGFDVVD+IK+ +E +CP VVSCAD
Sbjct  69    FHDCFVDGCDGSILLDVDGNITESEKNAAPNENSVRGFDVVDSIKSTIEASCPAVVSCAD  128

Query  416   IlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNV  595
             ILALA+E++VSL+GGPSWNVLLGR+DG TANQ GANTS+P+PF  L+N+T KF++VGL+ 
Sbjct  129   ILALAAEASVSLSGGPSWNVLLGRKDGLTANQAGANTSIPSPFQSLANITSKFSDVGLDT  188

Query  596   NDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTN  775
              DLVALSGAHTFGRAQC+ F+ RL NF+ TG+PDPTLNTTYL TLQQ CPQ G+G+T+ N
Sbjct  189   TDLVALSGAHTFGRAQCQFFSQRLLNFNGTGSPDPTLNTTYLGTLQQNCPQNGNGATLNN  248

Query  776   LDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSM  955
             LDP+T DTFDN YF+NL  N+GLL++DQELFST G++TI+IVNNF+ NQ+AFF++F QSM
Sbjct  249   LDPSTPDTFDNKYFTNLLINQGLLQTDQELFSTDGSSTISIVNNFANNQSAFFEAFAQSM  308

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             INMGNISPLTG+ G+IR +C+++N
Sbjct  309   INMGNISPLTGTQGQIRTDCKKVN  332



>dbj|BAF33314.1| peroxidase [Populus alba]
Length=321

 Score =   439 bits (1130),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 226/306 (74%), Positives = 256/306 (84%), Gaps = 2/306 (1%)
 Frame = +2

Query  113   AQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNG  292
             AQL+ TFY  TCPNVS+I+  V+ QALQ D RIGASL RLHFHDCFV+GCDGS+LLDN  
Sbjct  4     AQLTPTFYDGTCPNVSTIIRGVLVQALQTDPRIGASLTRLHFHDCFVDGCDGSILLDNT-  62

Query  293   TTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWN  472
              TI SEK+AA NNNSARGFDVVDN+K AVENACPG+VSCADILA+A+E +V LAGGPSW 
Sbjct  63    DTIESEKEAAPNNNSARGFDVVDNMKAAVENACPGIVSCADILAIAAEESVRLAGGPSWT  122

Query  473   VLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-DLVALSGAHTFGRAQCR  649
             V LGRRD   AN+ GAN+S+P PF+ L+ L  KF  VGLN + DLVALSGAHTFGRAQC 
Sbjct  123   VPLGRRDSLIANRSGANSSIPAPFESLAVLKSKFAAVGLNTSSDLVALSGAHTFGRAQCL  182

Query  650   TFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQ  829
              F +RL+NFS +GNPDPTLNTTYLA LQQ+CPQ G+ S +TNLD TT+DTFD NYFSNLQ
Sbjct  183   NFISRLYNFSGSGNPDPTLNTTYLAALQQLCPQAGNRSVLTNLDRTTADTFDGNYFSNLQ  242

Query  830   NNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
              N GLL+SDQELFST+GA TIAIVNNFS NQTAFF+SFV SMI MGNISPLTG+ GEIRL
Sbjct  243   TNEGLLQSDQELFSTTGADTIAIVNNFSGNQTAFFESFVVSMIRMGNISPLTGTDGEIRL  302

Query  1010  NCRRLN  1027
             NCR +N
Sbjct  303   NCRIVN  308



>sp|P80679.1|PERA2_ARMRU RecName: Full=Peroxidase A2 [Armoracia rusticana]
Length=305

 Score =   438 bits (1127),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 220/304 (72%), Positives = 265/304 (87%), Gaps = 1/304 (0%)
 Frame = +2

Query  116   QLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNGT  295
             QL++TFYS TCPN S+IV + IQQA Q+D RIGASLIRLHFHDCFV+GCD S+LLD++G+
Sbjct  1     QLNATFYSGTCPNASAIVRSTIQQAFQSDTRIGASLIRLHFHDCFVDGCDASILLDDSGS  60

Query  296   TIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNV  475
              I SEK+A  N NSARGF+VVDNIKTA+EN CPGVVSC+DILALASE++VSL GGPSW V
Sbjct  61    -IQSEKNAGPNANSARGFNVVDNIKTALENTCPGVVSCSDILALASEASVSLTGGPSWTV  119

Query  476   LLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRTF  655
             LLGRRD  TAN  GAN+++P+PF+ LSN+T KF+ VGLN NDLVALSGAHTFGRA+C  F
Sbjct  120   LLGRRDSLTANLAGANSAIPSPFEGLSNITSKFSAVGLNTNDLVALSGAHTFGRARCGVF  179

Query  656   NNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQNN  835
             NNRLFNFS T  PDPTLN+T L++LQQ+CPQ GS ST+TNLD +T D FDNNYF+NLQ+N
Sbjct  180   NNRLFNFSGTNGPDPTLNSTLLSSLQQLCPQNGSASTITNLDLSTPDAFDNNYFANLQSN  239

Query  836   RGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLNC  1015
              GLL+SDQELFST G+ATIA+V +F++NQT FFQ+F QSMINMGNISPLTGS+GEIRL+C
Sbjct  240   NGLLQSDQELFSTLGSATIAVVTSFASNQTLFFQAFAQSMINMGNISPLTGSNGEIRLDC  299

Query  1016  RRLN  1027
             ++++
Sbjct  300   KKVD  303



>pir||S60054 peroxidase (EC 1.11.1.7) A3a precursor - Japanese aspen x large-toothed 
aspen
 dbj|BAA07240.1| peroidase precursor [Populus sieboldii x Populus grandidentata]
Length=347

 Score =   440 bits (1131),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 229/325 (70%), Positives = 262/325 (81%), Gaps = 6/325 (2%)
 Frame = +2

Query  68    LAMAVAIFIFFSQS----NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLH  235
             L  ++ I I+F  S     AQLS TFY   CPNV++I+  V+ QAL  D RIGASL RLH
Sbjct  10    LVASLFIVIWFGGSLPYAYAQLSPTFYDEACPNVNNIIRGVLVQALYTDPRIGASLTRLH  69

Query  236   FHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCAD  415
             FHDCFVNGCDGS+LLDN   TI SEK+AA NNNS RGFDVVD++K A+ENACPG+VSCAD
Sbjct  70    FHDCFVNGCDGSILLDNT-DTIESEKEAAPNNNSVRGFDVVDDMKAALENACPGIVSCAD  128

Query  416   IlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNV  595
             ILA+A+E +V LAGGPSW V LGRRD   AN+ GAN++LP+PF  L  L  KF  VGL+ 
Sbjct  129   ILAIAAEQSVCLAGGPSWTVPLGRRDSLIANRSGANSALPSPFASLDVLKSKFAAVGLDT  188

Query  596   N-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
             + DLVALSGAHTFGRAQC +FN RL+NFS +GNPDPTLNTTYLA LQQ+CPQ G+ S VT
Sbjct  189   SSDLVALSGAHTFGRAQCSSFNLRLYNFSGSGNPDPTLNTTYLAELQQLCPQAGNESVVT  248

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             NLDPTT DTFD NYFSNLQ N GLL+SDQELFST+GA TI IVNNFS+NQTAFF+SFV S
Sbjct  249   NLDPTTPDTFDGNYFSNLQTNEGLLRSDQELFSTTGADTIDIVNNFSSNQTAFFESFVVS  308

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MI MGNISPLTG+ GEIRLNCRR+N
Sbjct  309   MIRMGNISPLTGTDGEIRLNCRRVN  333



>ref|XP_004497889.1| PREDICTED: peroxidase 53-like [Cicer arietinum]
Length=329

 Score =   437 bits (1125),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 218/327 (67%), Positives = 268/327 (82%), Gaps = 0/327 (0%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLI  226
             M S + L A+          SN QL++TFYS TCPNV SIV   +QQALQ+D+R+GASL+
Sbjct  1     MFSTTVLPAIIFLTLTLLYPSNGQLNATFYSNTCPNVLSIVKNAVQQALQSDSRVGASLL  60

Query  227   RLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVS  406
             RLHFHDC VNGCD S+LLD  G    SEKDAA N+NS RG DV+DNIK+++E++C GVVS
Sbjct  61    RLHFHDCIVNGCDASILLDQGGNITQSEKDAAPNSNSIRGLDVIDNIKSSLESSCSGVVS  120

Query  407   CADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVG  586
             CADI+ALA+ES+VSL+GGPSWNVLLGRRD  TANQ GAN  +P+PF+ L+ +T KF+NVG
Sbjct  121   CADIVALAAESSVSLSGGPSWNVLLGRRDSLTANQAGANNLIPSPFESLAQITTKFSNVG  180

Query  587   LNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGST  766
             L+  DLVALSGAHTFGRA+C+ F+ RLFNFS +G+PDPTLN+TYLATLQQ CPQ G+GST
Sbjct  181   LDTTDLVALSGAHTFGRARCQLFSQRLFNFSGSGSPDPTLNSTYLATLQQNCPQNGNGST  240

Query  767   VTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFV  946
             + N DP+T DTFDNNYFSNL  N GLL++DQEL ST+G++TI+IVNNF+ NQTAFF  F 
Sbjct  241   LNNFDPSTPDTFDNNYFSNLLINMGLLQTDQELLSTNGSSTISIVNNFANNQTAFFNQFA  300

Query  947   QSMINMGNISPLTGSSGEIRLNCRRLN  1027
             QSMINMGNISPLTG+ GEIR++C+++N
Sbjct  301   QSMINMGNISPLTGNQGEIRIDCKKVN  327



>ref|XP_011025201.1| PREDICTED: peroxidase A2-like [Populus euphratica]
Length=368

 Score =   437 bits (1125),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 231/335 (69%), Positives = 268/335 (80%), Gaps = 8/335 (2%)
 Frame = +2

Query  44    KMASFSALLAMAVAIF--IFFSQS----NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDA  205
             KM    AL  +  ++F  I+F  S     AQL+ TFY  TCPNVS+I+  V+ QA+Q D 
Sbjct  22    KMMVDKALHPLVASLFFVIWFGGSLPCAYAQLTPTFYDGTCPNVSTIIRGVLVQAMQTDP  81

Query  206   RIGASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVEN  385
             RIGASL RLHFHDCFV+GCDGS+LLDN  + I SEK+AA NNNSARGFDVVDN+K AVEN
Sbjct  82    RIGASLTRLHFHDCFVDGCDGSILLDNTDS-IESEKEAAPNNNSARGFDVVDNMKAAVEN  140

Query  386   ACPGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLT  565
             AC G+VSCADILA+A+E +V LAGGPSW VLLGRRD  TAN+ GAN+S+P P + L+ L 
Sbjct  141   ACTGIVSCADILAIAAEESVRLAGGPSWTVLLGRRDSLTANRSGANSSIPAPSESLAVLK  200

Query  566   RKFTNVGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVC  742
              KF  VGLN + DLVALSGAHTFGRAQC  F +RL+NFS +GNPDPTLNTTYLA LQQ+C
Sbjct  201   SKFAAVGLNTSSDLVALSGAHTFGRAQCLNFISRLYNFSGSGNPDPTLNTTYLAALQQLC  260

Query  743   PQGGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQ  922
             PQGG+ S + NLD TT DTFD NYFSNLQ N GLL+SDQELFST+GA TI+IVNNFS+NQ
Sbjct  261   PQGGNQSVLANLDRTTPDTFDGNYFSNLQTNEGLLQSDQELFSTTGADTISIVNNFSSNQ  320

Query  923   TAFFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             TAFF+SFV SMI MGNISPLTG+ GEIRLNCR +N
Sbjct  321   TAFFESFVVSMIRMGNISPLTGTDGEIRLNCRIVN  355



>ref|XP_007145699.1| hypothetical protein PHAVU_007G260800g [Phaseolus vulgaris]
 gb|AAD37430.1|AF149280_1 peroxidase 5 precursor [Phaseolus vulgaris]
 gb|ESW17693.1| hypothetical protein PHAVU_007G260800g [Phaseolus vulgaris]
Length=334

 Score =   434 bits (1117),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 214/324 (66%), Positives = 270/324 (83%), Gaps = 0/324 (0%)
 Frame = +2

Query  56    FSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLH  235
             + +L+A  + +  F   S  QLS++FYS+TC NVSSIV   +QQAL +D+RI ASLIRLH
Sbjct  9     YYSLVATILLVLTFVFPSEGQLSASFYSSTCSNVSSIVRDSVQQALTSDSRIAASLIRLH  68

Query  236   FHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCAD  415
             FHDCFV+GCDGS+LLD  G    SEK+AA N NS RGFDVVD+IK+ +E +CP VVSCAD
Sbjct  69    FHDCFVDGCDGSILLDVGGNITESEKNAAPNENSVRGFDVVDSIKSTIEASCPAVVSCAD  128

Query  416   IlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNV  595
             ILALA+E++VSL+ GPSW VLLGRRD  TANQGGANTSLP+PF++L+N++ KF+ VGL+ 
Sbjct  129   ILALAAEASVSLSQGPSWTVLLGRRDSVTANQGGANTSLPSPFENLTNVSSKFSAVGLDT  188

Query  596   NDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTN  775
              DLVALSGAHTFGR+QC+ F+ RL NF+ TG+PDPTLNTTYL TLQQ CPQ G+G+T+ N
Sbjct  189   TDLVALSGAHTFGRSQCQFFSQRLLNFNGTGSPDPTLNTTYLGTLQQNCPQNGNGATLNN  248

Query  776   LDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSM  955
             LDP+T DTFDN YF+NL  N+GLL++DQELFST G++TI+IVNNF+ NQ+AFF++F QSM
Sbjct  249   LDPSTPDTFDNKYFTNLLINQGLLQTDQELFSTDGSSTISIVNNFANNQSAFFEAFAQSM  308

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             INMGNISPLTG+ G+IR +C+++N
Sbjct  309   INMGNISPLTGTQGQIRTDCKKVN  332



>gb|ABG46370.1| rubber peroxidase 1 [Hevea brasiliensis]
Length=346

 Score =   434 bits (1117),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 221/330 (67%), Positives = 267/330 (81%), Gaps = 7/330 (2%)
 Frame = +2

Query  56    FSALLAMAVAIFIFFSQSN-----AQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGAS  220
              S L+ +A+A++     S+     AQLS TFY  +CPNVS+I+  VIQ++LQ+D+RIGAS
Sbjct  3     ISPLMLVAIALYAILVGSSRPLAYAQLSPTFYDQSCPNVSNIIRGVIQESLQSDSRIGAS  62

Query  221   LIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGV  400
             LIRLHFHDCFVNGCD S+LLDN  T I SEK AA NNNSARGFDVVD +K  +E+ACPG+
Sbjct  63    LIRLHFHDCFVNGCDASILLDNTDT-IESEKQAAANNNSARGFDVVDTMKARLESACPGI  121

Query  401   VSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTN  580
             VSCADIL ++++ +V LAGGP+W  LLGRRD  TA++  AN S+P PF+ L  L  KFT 
Sbjct  122   VSCADILTVSAQQSVDLAGGPTWTNLLGRRDSLTASRSQANLSIPGPFETLDQLKSKFTA  181

Query  581   VGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGS  757
             VGLN N DLVALSGAHTFGRAQCRTF+ RL+NF+NT +PDPTLNTTYL TLQQ+CPQGG+
Sbjct  182   VGLNNNTDLVALSGAHTFGRAQCRTFSPRLYNFNNTNSPDPTLNTTYLQTLQQICPQGGN  241

Query  758   GSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQ  937
             GS +TNLD TTSDTFDN YFSNL    GLL+SDQELF+T+GA T+AIV NFSANQTAFF+
Sbjct  242   GSVITNLDLTTSDTFDNEYFSNLLVGEGLLQSDQELFNTTGADTVAIVQNFSANQTAFFE  301

Query  938   SFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             SFV+SM+ MGN+S LTG+ GEIRLNC ++N
Sbjct  302   SFVESMLRMGNLSVLTGTIGEIRLNCSKVN  331



>emb|CDX70074.1| BnaA10g24230D [Brassica napus]
Length=358

 Score =   435 bits (1118),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 220/321 (69%), Positives = 268/321 (83%), Gaps = 1/321 (0%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             +++  V +   F  S+AQL++TFYS TCPNVS+IV + I+QALQ+D RIGASLIRLHFHD
Sbjct  15    IISFLVIVSALFGTSSAQLNATFYSGTCPNVSAIVRSTIEQALQSDPRIGASLIRLHFHD  74

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLD++   I SEK+A  N NS RGF+VVD+IKTA+ENACPG+VSC+DILA
Sbjct  75    CFVNGCDGSLLLDDSAN-IQSEKNAVPNANSTRGFNVVDDIKTALENACPGIVSCSDILA  133

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LASE++VSLAGGP+W VLLGRRDG TAN  GANT LP+PF+ ++N+T KFT VGLN  D+
Sbjct  134   LASEASVSLAGGPTWAVLLGRRDGLTANLSGANTGLPSPFEGITNITAKFTAVGLNTTDV  193

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             V LSGAHTFGRA C TFNNRLFNF+ TG+PDPTLN+T L++LQQ+CPQ GS S VTNLD 
Sbjct  194   VVLSGAHTFGRAACATFNNRLFNFNGTGSPDPTLNSTLLSSLQQLCPQNGSASVVTNLDL  253

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             +T D FDNNYF+NLQ+N GLL+SDQEL S +G+ TI IV +F++NQT FF++F  SMI M
Sbjct  254   STPDAFDNNYFTNLQSNNGLLQSDQELLSDTGSPTIPIVTSFASNQTQFFEAFALSMIKM  313

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNISPLTGSSGEIR +C+ +N
Sbjct  314   GNISPLTGSSGEIRQDCKVVN  334



>emb|CDX98950.1| BnaC09g48850D [Brassica napus]
Length=358

 Score =   434 bits (1117),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 220/311 (71%), Positives = 264/311 (85%), Gaps = 1/311 (0%)
 Frame = +2

Query  95    FFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSL  274
              F  S+AQL++TFYS TCPNVS+IV + IQQALQ+D RIGASLIRLHFHDCFVNGCDGSL
Sbjct  25    LFGTSSAQLNATFYSGTCPNVSAIVRSTIQQALQSDPRIGASLIRLHFHDCFVNGCDGSL  84

Query  275   LLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavsla  454
             LLD++ T I SEK+A  N NS RGF+VVD+IKTA+ENACPG+VSC+DILALASE++VSLA
Sbjct  85    LLDDSAT-IQSEKNAVPNANSTRGFNVVDDIKTALENACPGIVSCSDILALASEASVSLA  143

Query  455   GGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFG  634
             GGP+W VLLGRRDG TAN  GANT LP+PF+ ++N+T KFT VGLN  D+V LSGAHTFG
Sbjct  144   GGPTWTVLLGRRDGLTANLSGANTGLPSPFEGITNITAKFTAVGLNTTDVVVLSGAHTFG  203

Query  635   RAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNY  814
             RA C TFNNRLFNF+ TG+PDPTLN+T L++LQQ+CPQ G+ S VTNLD +T D FDNNY
Sbjct  204   RAACATFNNRLFNFNGTGSPDPTLNSTLLSSLQQLCPQNGNASVVTNLDLSTPDAFDNNY  263

Query  815   FSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSS  994
             F+NLQ+N GLL+SDQEL S +G+ TI IV +F++NQT FF++F  SMI MGNISPLTGSS
Sbjct  264   FTNLQSNNGLLQSDQELLSDTGSPTIPIVTSFASNQTQFFEAFALSMIKMGNISPLTGSS  323

Query  995   GEIRLNCRRLN  1027
             GEIR +C+ +N
Sbjct  324   GEIRQDCKVVN  334



>ref|XP_009122284.1| PREDICTED: peroxidase A2 [Brassica rapa]
Length=358

 Score =   434 bits (1117),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 220/321 (69%), Positives = 268/321 (83%), Gaps = 1/321 (0%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             +++  V +   F  S+AQL++TFYS TCPNVS+IV + I+QALQ+D RIGASLIRLHFHD
Sbjct  15    IISFLVIVSALFGTSSAQLNATFYSGTCPNVSAIVRSTIEQALQSDPRIGASLIRLHFHD  74

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLD++   I SEK+A  N NS RGF+VVD+IKTA+ENACPG+VSC+DILA
Sbjct  75    CFVNGCDGSLLLDDSAN-IQSEKNAVPNANSTRGFNVVDDIKTALENACPGIVSCSDILA  133

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LASE++VSLAGGP+W VLLGRRDG TAN  GANT LP+PF+ ++N+T KFT VGLN  D+
Sbjct  134   LASEASVSLAGGPTWAVLLGRRDGLTANLSGANTGLPSPFEGITNITAKFTAVGLNTTDV  193

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             V LSGAHTFGRA C TFNNRLFNF+ TG+PDPTLN+T L++LQQ+CPQ GS S VTNLD 
Sbjct  194   VVLSGAHTFGRAACATFNNRLFNFNGTGSPDPTLNSTLLSSLQQLCPQNGSASVVTNLDL  253

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             +T D FDNNYF+NLQ+N GLL+SDQEL S +G+ TI IV +F++NQT FF++F  SMI M
Sbjct  254   STPDAFDNNYFTNLQSNNGLLQSDQELLSDTGSPTIPIVTSFASNQTQFFEAFALSMIKM  313

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNISPLTGSSGEIR +C+ +N
Sbjct  314   GNISPLTGSSGEIRQDCKVVN  334



>ref|XP_002873275.1| peroxidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49534.1| peroxidase [Arabidopsis lyrata subsp. lyrata]
Length=323

 Score =   432 bits (1112),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 223/321 (69%), Positives = 270/321 (84%), Gaps = 13/321 (4%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             ++ + V +   F  S+AQL++TFYS TCPN S+IV + IQQALQ+DARIGASLIRLHFHD
Sbjct  14    IIGLIVIVSSMFRTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDARIGASLIRLHFHD  73

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCD S+LLD++G+ I SEK+A  N NSARGF+VVDNIKTA+ENACPGVVSC+D+LA
Sbjct  74    CFVNGCDASILLDDSGS-IQSEKNAGPNANSARGFNVVDNIKTALENACPGVVSCSDVLA  132

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LASE++VSLAGGPSW VLLGRRDG TAN  GAN+S+P+P + LSN+T KF+ VGLN+NDL
Sbjct  133   LASEASVSLAGGPSWTVLLGRRDGLTANLAGANSSIPSPVESLSNITSKFSAVGLNMNDL  192

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             VALSGAHTFGRA+C  FNNRLFNFS TGNPDPTLN+T L+TLQQ+CPQ GS ST+TNLD 
Sbjct  193   VALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSTLQQLCPQNGSVSTITNLDL  252

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             +T D FDNNYF+NLQ+N GLL+SDQELFST+G++TIAIV +F++NQT FFQ+F QSMINM
Sbjct  253   STPDAFDNNYFTNLQSNNGLLQSDQELFSTTGSSTIAIVTSFASNQTLFFQAFAQSMINM  312

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNI            NC+++N
Sbjct  313   GNI------------NCKKVN  321



>ref|XP_009409636.1| PREDICTED: peroxidase A2-like [Musa acuminata subsp. malaccensis]
Length=333

 Score =   432 bits (1110),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 217/312 (70%), Positives = 266/312 (85%), Gaps = 2/312 (1%)
 Frame = +2

Query  92    IFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGS  271
             +    S AQLSSTFY ++C NVS++V  V+QQA  +D RI ASL+RLHFHDCFVNGCDGS
Sbjct  24    LLLHGSRAQLSSTFYDSSCSNVSAVVRNVVQQAQSSDVRIVASLLRLHFHDCFVNGCDGS  83

Query  272   LLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavsl  451
             +LLDN+  +I SEKDAA N NS RGFDVVD+IKTAVEN CPGVVSCADILALA+E++V L
Sbjct  84    ILLDNS-DSIQSEKDAAPNKNSVRGFDVVDDIKTAVENVCPGVVSCADILALAAEASVDL  142

Query  452   aGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTF  631
             AGGP+W VLLGRRDGTTAN   AN ++P+PFDDL  L +KF++VGL+  DLVALSGAHTF
Sbjct  143   AGGPTWGVLLGRRDGTTANPTAAN-NMPSPFDDLDTLKQKFSDVGLDDTDLVALSGAHTF  201

Query  632   GRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNN  811
             GRAQCR F++RL+NFS TG+PDP+L++TYLATLQQ CPQGG  +T+ NLD TT +TFDN 
Sbjct  202   GRAQCRFFSSRLYNFSGTGSPDPSLDSTYLATLQQNCPQGGDDTTLNNLDLTTPNTFDNK  261

Query  812   YFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGS  991
             YF+NLQ+N GLL+SDQELFSTSGA+TI+IVN+F+ +++ FFQSF  SMINMGNI+PLTGS
Sbjct  262   YFTNLQSNEGLLQSDQELFSTSGASTISIVNSFAGDESTFFQSFASSMINMGNINPLTGS  321

Query  992   SGEIRLNCRRLN  1027
             +GEIR +C+++N
Sbjct  322   NGEIRSDCKKVN  333



>ref|XP_010058152.1| PREDICTED: peroxidase A2-like [Eucalyptus grandis]
Length=333

 Score =   429 bits (1104),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 210/307 (68%), Positives = 258/307 (84%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             SNAQL++ FY+ TCP+VSSIV TVIQ+ALQ+D RI ASL+RLHFHDCFV+GCDGSLLLDN
Sbjct  26    SNAQLTANFYAKTCPSVSSIVQTVIQEALQSDPRITASLLRLHFHDCFVDGCDGSLLLDN  85

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             +  TI SEKDAA N  SARGFDVVD IK A+E+ACPG VSCADILALA++++VSL+ GP 
Sbjct  86    S-PTIKSEKDAAPNFKSARGFDVVDKIKAAIESACPGTVSCADILALAAQASVSLSEGPY  144

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W VLLGRRD  TANQ GANTS+P+PFD  +NL  KF+ VGL++ DL  LSGAHTFGRAQC
Sbjct  145   WTVLLGRRDSLTANQAGANTSIPSPFDSYNNLVSKFSAVGLDITDLATLSGAHTFGRAQC  204

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
             ++FN RL+NF+  G PDPT+N  YL  L+++CPQ G  S + +LDPTT + FDN+Y+SNL
Sbjct  205   KSFNPRLYNFTANGGPDPTINPWYLTNLRKLCPQNGDSSVLADLDPTTPNLFDNHYYSNL  264

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q N GLL SDQEL+ST+GAATI+IVN+FS +Q+AFF+SF +S++NMGNISPLTGS+GEIR
Sbjct  265   QKNEGLLLSDQELYSTTGAATISIVNSFSFDQSAFFESFARSIVNMGNISPLTGSNGEIR  324

Query  1007  LNCRRLN  1027
              NCR++N
Sbjct  325   FNCRKVN  331



>ref|XP_006849541.1| hypothetical protein AMTR_s00024p00166170 [Amborella trichopoda]
 gb|ERN11122.1| hypothetical protein AMTR_s00024p00166170 [Amborella trichopoda]
Length=328

 Score =   429 bits (1103),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 213/311 (68%), Positives = 265/311 (85%), Gaps = 2/311 (1%)
 Frame = +2

Query  95    FFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSL  274
             FF    AQLS+TFY TTCPNV SIV  V+QQA Q+DARIGASLIRLHFHDCFV+GCDGSL
Sbjct  18    FFGVGRAQLSATFYDTTCPNVISIVRNVVQQAAQSDARIGASLIRLHFHDCFVDGCDGSL  77

Query  275   LLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavsla  454
             LLDN+ ++IVSEKDA  N+ S RGF VVDNIK  +E+ CPG+VSCADILA+ASE +V LA
Sbjct  78    LLDNS-SSIVSEKDAVPNSGSVRGFPVVDNIKADLESQCPGIVSCADILAIASEVSVVLA  136

Query  455   GGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFG  634
             GGPSW+VLLGRRDGTTAN+  AN +LP+PF+ +SN++ KF+NVGL+  D+VALSGAHTFG
Sbjct  137   GGPSWSVLLGRRDGTTANKDAANNNLPSPFEGISNISTKFSNVGLDTTDVVALSGAHTFG  196

Query  635   RAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNY  814
             RAQC+ F +RL+NFS +G  DPT+N++Y+ TLQ  CPQ G  +T+++LDPTT D FDN Y
Sbjct  197   RAQCQFFRDRLYNFSGSGAADPTMNSSYVTTLQGSCPQSGGDTTLSDLDPTTPDGFDNAY  256

Query  815   FSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSS  994
             F+NL++NRGLL+SDQELFSTSG AT++IV N+++NQ+AFF+SFV+SMI MGNISPLTG++
Sbjct  257   FTNLESNRGLLQSDQELFSTSG-ATVSIVQNYASNQSAFFESFVKSMIKMGNISPLTGTN  315

Query  995   GEIRLNCRRLN  1027
             G+IR NC R+N
Sbjct  316   GQIRTNCSRVN  326



>ref|XP_006492671.1| PREDICTED: peroxidase 15-like [Citrus sinensis]
 gb|KDO62911.1| hypothetical protein CISIN_1g018796mg [Citrus sinensis]
Length=350

 Score =   429 bits (1104),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 225/331 (68%), Positives = 265/331 (80%), Gaps = 5/331 (2%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFF---SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGA  217
             MAS   LLA A+ +       S + AQLS +FY++TCPNV++I+  V+Q A  +D RIGA
Sbjct  1     MASLRFLLAAALVVAFVLEGSSPAQAQLSPSFYNSTCPNVANIIREVLQNAFLSDIRIGA  60

Query  218   SLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPG  397
             SLIRLHFHDCFVNGCD S+LLDN  TTIVSEK AA NNNSARGF+VVD++K AVE ACPG
Sbjct  61    SLIRLHFHDCFVNGCDASILLDNT-TTIVSEKFAAPNNNSARGFEVVDDMKAAVERACPG  119

Query  398   VVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFT  577
             VVSCADIL +A+E +V+L+GGPSW  LLGRRD  TAN+  AN +LP P + L  L  +F 
Sbjct  120   VVSCADILTIAAEQSVALSGGPSWTNLLGRRDSRTANRTLANENLPGPNNSLERLKDRFR  179

Query  578   NVGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG  754
             NVGLN N DLVALSGAHTFGRAQCRTF++RLFNF++TGNPDPTLNTT L  L+Q+CPQGG
Sbjct  180   NVGLNDNFDLVALSGAHTFGRAQCRTFSDRLFNFNSTGNPDPTLNTTLLQQLRQLCPQGG  239

Query  755   SGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFF  934
             +GS +TNLD TT D FDN YF NLQ ++GLL+SDQELFST GA T AIVNNF  NQTAFF
Sbjct  240   NGSVLTNLDVTTPDVFDNKYFFNLQIHKGLLQSDQELFSTPGADTAAIVNNFGRNQTAFF  299

Query  935   QSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             ++FV SMI MGN+ PLTG+ GEIRLNCRR+N
Sbjct  300   ENFVTSMIRMGNLKPLTGNQGEIRLNCRRVN  330



>ref|XP_009375132.1| PREDICTED: peroxidase A2-like [Pyrus x bretschneideri]
Length=350

 Score =   427 bits (1098),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 219/327 (67%), Positives = 256/327 (78%), Gaps = 3/327 (1%)
 Frame = +2

Query  56    FSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLH  235
             +  +LAM + +       +AQL+ TFY  +CPN +SIV  VIQ+ALQ D RI ASL RLH
Sbjct  10    YRYVLAMLLILCASAGCGDAQLTPTFYDESCPNATSIVRGVIQEALQTDPRITASLTRLH  69

Query  236   FHDCFVNGCDGSLLLDNN---GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVS  406
             FHDCFVNGCDGS+LLDN+    +TI SEK A  NNNSARGFDVVDNIKTA+ENACP VVS
Sbjct  70    FHDCFVNGCDGSILLDNSTNPNSTIDSEKTAIANNNSARGFDVVDNIKTALENACPAVVS  129

Query  407   CADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVG  586
             CADILA+A+E +V L+GG SW VLLGRRD  TAN+  AN +LP P   L  L   F  VG
Sbjct  130   CADILAIAAEESVVLSGGSSWTVLLGRRDSLTANRTAANEALPGPTFTLDELMANFLAVG  189

Query  587   LNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGST  766
             LN  DLVALSGAHTFGRA+C TF +RL+NF+ TG+PDPTLN+TYL  L ++CPQ G+GS 
Sbjct  190   LNTTDLVALSGAHTFGRARCLTFTDRLYNFTGTGSPDPTLNSTYLEILSEICPQNGNGSV  249

Query  767   VTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFV  946
             +TNLDP T DTFD+ YFSNLQ   GLL+SDQELFSTSGA TI IVNNFSANQ+AFF+SF 
Sbjct  250   LTNLDPVTPDTFDSKYFSNLQVEEGLLQSDQELFSTSGADTIDIVNNFSANQSAFFESFG  309

Query  947   QSMINMGNISPLTGSSGEIRLNCRRLN  1027
             +SMI MGNISPLTG+ GEIRL+CRR+N
Sbjct  310   ESMIKMGNISPLTGTEGEIRLSCRRVN  336



>ref|XP_002285649.1| PREDICTED: lignin-forming anionic peroxidase [Vitis vinifera]
 emb|CAN78501.1| hypothetical protein VITISV_002523 [Vitis vinifera]
Length=326

 Score =   426 bits (1095),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 209/307 (68%), Positives = 256/307 (83%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             SNAQLS+TFY T+CPN+SSIV  +I+QA  +D RI A LIRLHFHDCFV+GCDGS+LLDN
Sbjct  20    SNAQLSATFYDTSCPNISSIVQGIIEQAQNSDVRINAKLIRLHFHDCFVDGCDGSILLDN  79

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
                 I SEKDA+ N NS  GF VVD+IKTA+EN CPGVVSCADILA+AS+ +VSLAGGP+
Sbjct  80    -ADGIASEKDASPNINSVDGFSVVDDIKTALENVCPGVVSCADILAIASQISVSLAGGPT  138

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W VL GRRD TTA Q GAN+ +P P + L  +T+KFTN GL+  DLVALSGAHTFGRAQC
Sbjct  139   WQVLFGRRDSTTAYQAGANSDIPTPLETLEQITQKFTNKGLDSTDLVALSGAHTFGRAQC  198

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
             RTF++RL++F+N+ +PDPT++ TYL TLQ  CPQ G G+ V NLDP+T + FDN+YF+NL
Sbjct  199   RTFSHRLYDFNNSSSPDPTIDATYLQTLQGTCPQDGDGTVVANLDPSTPNGFDNDYFTNL  258

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             QNNRGLL++DQELFST+GA TIAIVN F+++Q+ FF +F QSMINMGNISPLTGS+GEIR
Sbjct  259   QNNRGLLQTDQELFSTTGADTIAIVNQFASSQSEFFDAFAQSMINMGNISPLTGSNGEIR  318

Query  1007  LNCRRLN  1027
              +C+R+N
Sbjct  319   ADCKRVN  325



>ref|XP_010058168.1| PREDICTED: peroxidase A2-like [Eucalyptus grandis]
 gb|KCW90315.1| hypothetical protein EUGRSUZ_A02458 [Eucalyptus grandis]
Length=333

 Score =   426 bits (1095),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 209/307 (68%), Positives = 257/307 (84%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             SNAQL++ FY+ TCP+VSSIV TVIQ+ALQ+D RI ASL+RLHFHDCFV+GCDGSLLLDN
Sbjct  26    SNAQLTANFYAKTCPSVSSIVQTVIQEALQSDPRITASLLRLHFHDCFVDGCDGSLLLDN  85

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             +  TI SEKDAA N  SARGFDVVD IK A+E+ACPG VSCADILALA++++VSL+ GP 
Sbjct  86    S-PTIKSEKDAAPNFKSARGFDVVDKIKAAIESACPGTVSCADILALAAQASVSLSEGPY  144

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W VLLGRRD  TANQ GANTS+P+P D  +NL  KF+ VGL++ DL  LSGAHTFGRAQC
Sbjct  145   WTVLLGRRDSLTANQAGANTSIPSPSDSYNNLVSKFSAVGLDITDLATLSGAHTFGRAQC  204

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
             ++FN RL+NF+  G PDPT+N  YL  L+++CPQ G  S + +LDPTT + FDN+Y+SNL
Sbjct  205   KSFNPRLYNFTANGGPDPTINPWYLTNLRKLCPQNGDSSVLADLDPTTPNLFDNHYYSNL  264

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q N GLL SDQEL+ST+GAATI+IVN+FS +Q+AFF+SF +S++NMGNISPLTGS+GEIR
Sbjct  265   QKNEGLLLSDQELYSTTGAATISIVNSFSFDQSAFFESFARSIVNMGNISPLTGSNGEIR  324

Query  1007  LNCRRLN  1027
              NCR++N
Sbjct  325   FNCRKVN  331



>gb|AFY97686.1| peroxidase 3 [Pyrus pyrifolia]
Length=350

 Score =   426 bits (1096),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 216/308 (70%), Positives = 251/308 (81%), Gaps = 3/308 (1%)
 Frame = +2

Query  113   AQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNG  292
             AQL+ TFY  +CPN +SIV  VIQ+ALQ D RI ASL RLHFHDCFVNGCDGS+LLDN+ 
Sbjct  29    AQLTPTFYDESCPNATSIVRGVIQEALQTDPRIAASLTRLHFHDCFVNGCDGSILLDNST  88

Query  293   TT---IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGP  463
             ++   I SEK A  NNNS RGFDVVD+IKTA+ENACP VVSCADILA+A+E +V+L+GGP
Sbjct  89    SSTSTIDSEKTAFPNNNSVRGFDVVDSIKTALENACPAVVSCADILAIAAEESVALSGGP  148

Query  464   SWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQ  643
             SW VLLGRRD TTAN+  AN ++P P   L  L   F  VGLN  DLVALSGAHTFGRA+
Sbjct  149   SWTVLLGRRDSTTANRTAANLAIPAPTLTLDGLKANFLAVGLNTTDLVALSGAHTFGRAR  208

Query  644   CRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSN  823
             C++F NRL+NFS TG+PDPTLN+TYL TL ++CPQ G+ S +TNLDP T DTFD  YFSN
Sbjct  209   CQSFTNRLYNFSGTGSPDPTLNSTYLETLSEICPQNGNSSVLTNLDPVTPDTFDAEYFSN  268

Query  824   LQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEI  1003
             LQ  +GLL+SDQELFSTSGA TI IVNNFS NQ+AFF+SFV+SMI MGNISPLTG+ GEI
Sbjct  269   LQVQQGLLQSDQELFSTSGADTIGIVNNFSTNQSAFFESFVESMIKMGNISPLTGTDGEI  328

Query  1004  RLNCRRLN  1027
             RLNCRR+N
Sbjct  329   RLNCRRVN  336



>ref|XP_009375169.1| PREDICTED: peroxidase A2-like [Pyrus x bretschneideri]
Length=350

 Score =   426 bits (1096),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 216/308 (70%), Positives = 251/308 (81%), Gaps = 3/308 (1%)
 Frame = +2

Query  113   AQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNG  292
             AQL+ TFY  +CPN +SIV  VIQ+ALQ D RI ASL RLHFHDCFVNGCDGS+LLDN+ 
Sbjct  29    AQLTPTFYDESCPNATSIVRGVIQEALQTDPRIAASLTRLHFHDCFVNGCDGSILLDNST  88

Query  293   TT---IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGP  463
             ++   I SEK A  NNNS RGFDVVD+IKTA+ENACP VVSCADILA+A+E +V+L+GGP
Sbjct  89    SSTSTIDSEKTAFPNNNSVRGFDVVDSIKTALENACPAVVSCADILAIAAEESVALSGGP  148

Query  464   SWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQ  643
             SW VLLGRRD TTAN+  AN ++P P   L  L   F  VGLN  DLVALSGAHTFGRA+
Sbjct  149   SWTVLLGRRDSTTANRTAANLAIPAPTLTLDGLKANFLAVGLNTTDLVALSGAHTFGRAR  208

Query  644   CRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSN  823
             C++F NRL+NFS TG+PDPTLN+TYL TL ++CPQ G+ S +TNLDP T DTFD  YFSN
Sbjct  209   CQSFTNRLYNFSGTGSPDPTLNSTYLETLSEICPQNGNSSVLTNLDPVTPDTFDAKYFSN  268

Query  824   LQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEI  1003
             LQ  +GLL+SDQELFSTSGA TI IVNNFS NQ+AFF+SFV+SMI MGNISPLTG+ GEI
Sbjct  269   LQVQQGLLQSDQELFSTSGADTIGIVNNFSTNQSAFFESFVESMIKMGNISPLTGTDGEI  328

Query  1004  RLNCRRLN  1027
             RLNCRR+N
Sbjct  329   RLNCRRVN  336



>dbj|BAA06335.1| peroxidase [Populus kitakamiensis]
Length=308

 Score =   423 bits (1088),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 217/295 (74%), Positives = 247/295 (84%), Gaps = 2/295 (1%)
 Frame = +2

Query  146   CPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQ  325
             CPNV++I+  V+ QAL  D RIGASL RLHFHDCFVNGCDGS+LLDN   TI SEK+AA 
Sbjct  1     CPNVNNIIRGVLVQALYTDPRIGASLTRLHFHDCFVNGCDGSILLDNT-DTIESEKEAAP  59

Query  326   NNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTA  505
             NNNS RGFDVVD++K A+ENACPG+VSCADILA+A+E +V LAGGPSW V LGRRD   A
Sbjct  60    NNNSVRGFDVVDDMKAALENACPGIVSCADILAIAAEQSVCLAGGPSWTVPLGRRDSLIA  119

Query  506   NQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSN  682
             N+ GAN++LP+PF  L  L  KF  VGL+ + DLVALSGAHTFGRAQC +FN RL+NFS 
Sbjct  120   NRSGANSALPSPFASLDVLKSKFAAVGLDTSSDLVALSGAHTFGRAQCSSFNLRLYNFSG  179

Query  683   TGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQE  862
             +GNPDPTLNTTYLA LQQ+CPQ G+ S VTNLDPTT DTFD NYFSNLQ N GLL+SDQE
Sbjct  180   SGNPDPTLNTTYLAELQQLCPQAGNESVVTNLDPTTPDTFDGNYFSNLQTNEGLLRSDQE  239

Query  863   LFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             LFST+GA TI IVNNFS+NQTAFF+SFV SMI MGNISPLTG+ GEIRLNCRR+N
Sbjct  240   LFSTTGADTIDIVNNFSSNQTAFFESFVVSMIRMGNISPLTGTDGEIRLNCRRVN  294



>gb|KDO62915.1| hypothetical protein CISIN_1g018873mg [Citrus sinensis]
Length=349

 Score =   424 bits (1091),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 225/331 (68%), Positives = 262/331 (79%), Gaps = 5/331 (2%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFF---SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGA  217
             MAS   LLA A+ +       S + AQLS  FYS+TCPNV++I+  V++ A  +D RIGA
Sbjct  1     MASLRYLLAAALVVAFVLEGSSPAQAQLSPFFYSSTCPNVTNIIREVLKNAFLSDIRIGA  60

Query  218   SLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPG  397
             SLIRLHFHDCFVNGCD S+LLDN  TTIVSEK A  N NSARGF+VVD++K AVE ACPG
Sbjct  61    SLIRLHFHDCFVNGCDASILLDNT-TTIVSEKFAGPNINSARGFEVVDDMKAAVERACPG  119

Query  398   VVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFT  577
             VVSCADIL +A+E +V+L+GGPSW  LLGRRD  TAN+  AN +LP P + L+ L  +F 
Sbjct  120   VVSCADILTIAAEESVALSGGPSWTNLLGRRDSRTANRTLANENLPGPNNTLTRLKDRFR  179

Query  578   NVGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG  754
             NVGLN N DLVALSGAHTFGRAQCRTF++RLFNF+NTGNPDPTLNTT L  L+Q+CPQGG
Sbjct  180   NVGLNDNFDLVALSGAHTFGRAQCRTFSDRLFNFNNTGNPDPTLNTTLLQQLRQLCPQGG  239

Query  755   SGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFF  934
             +GS +TNLD TT D FDN YF NLQ  +GLL+SDQELFST GA T AIVN FS+NQ AFF
Sbjct  240   NGSVLTNLDVTTPDLFDNKYFFNLQIRKGLLQSDQELFSTPGADTAAIVNVFSSNQAAFF  299

Query  935   QSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             QSFV SMI MGN+ PLTG+ GEIRLNCRR+N
Sbjct  300   QSFVISMIRMGNLRPLTGNQGEIRLNCRRVN  330



>ref|XP_006492677.1| PREDICTED: peroxidase 15-like [Citrus sinensis]
Length=349

 Score =   424 bits (1089),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 224/331 (68%), Positives = 262/331 (79%), Gaps = 5/331 (2%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFF---SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGA  217
             MAS   LLA A+ +       S + AQLS  FYS+TCPNV++I+  V++ A  +D RIGA
Sbjct  1     MASLRYLLAAALVVAFVLEGSSPAQAQLSPFFYSSTCPNVTNIIREVLKNAFLSDIRIGA  60

Query  218   SLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPG  397
             SLIRLHFHDCFVNGCD S+LLDN  TTIVSEK A  N NSARGF+VVD++K AVE ACPG
Sbjct  61    SLIRLHFHDCFVNGCDASILLDNT-TTIVSEKFAGPNINSARGFEVVDDMKAAVERACPG  119

Query  398   VVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFT  577
             VVSCADIL +A+E +V+L+GGP+W  LLGRRD  TAN+  AN +LP P + L+ L  +F 
Sbjct  120   VVSCADILTIAAEESVALSGGPAWTNLLGRRDSRTANRTLANENLPGPNNTLTRLKDRFR  179

Query  578   NVGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG  754
             NVGLN N DLVALSGAHTFGRAQCRTF++RLFNF+NTGNPDPTLNTT L  L+Q+CPQGG
Sbjct  180   NVGLNDNFDLVALSGAHTFGRAQCRTFSDRLFNFNNTGNPDPTLNTTLLQQLRQLCPQGG  239

Query  755   SGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFF  934
             +GS +TNLD TT D FDN YF NLQ  +GLL+SDQELFST GA T AIVN FS+NQ AFF
Sbjct  240   NGSVLTNLDVTTPDLFDNKYFFNLQIRKGLLQSDQELFSTPGADTAAIVNVFSSNQAAFF  299

Query  935   QSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             QSFV SMI MGN+ PLTG+ GEIRLNCRR+N
Sbjct  300   QSFVISMIRMGNLRPLTGNQGEIRLNCRRVN  330



>ref|XP_011025398.1| PREDICTED: uncharacterized protein LOC105126277 [Populus euphratica]
Length=715

 Score =   436 bits (1122),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 262/325 (81%), Gaps = 6/325 (2%)
 Frame = +2

Query  68    LAMAVAIFIFFSQS----NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLH  235
             L  ++ + I+F  S     AQLS TFY  TCPNV++I+  V+ QAL  D RIGASL RLH
Sbjct  10    LVASLFLVIWFGGSLPYAYAQLSPTFYDETCPNVNNIIRGVLVQALYTDPRIGASLTRLH  69

Query  236   FHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCAD  415
             FHDCFVNGCDGS+LLDN  T I SEK+AA NNN+ RGFDVVD++K AVENACPG+VSCAD
Sbjct  70    FHDCFVNGCDGSILLDNTDT-IESEKEAAPNNNTVRGFDVVDDMKAAVENACPGIVSCAD  128

Query  416   IlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNV  595
             ILA+A+E +V LAGGPSW V LGRRD   AN+ GAN++LP+PF  L  L  KF +VGLN 
Sbjct  129   ILAIAAEESVCLAGGPSWTVPLGRRDSLIANRSGANSALPSPFASLDVLKSKFADVGLNT  188

Query  596   N-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
             + DLVALSGAHTFGRAQC +FN RL+NFS +GNPDPTLNTTYLA LQQ+CPQ G+ S VT
Sbjct  189   SSDLVALSGAHTFGRAQCSSFNLRLYNFSGSGNPDPTLNTTYLAELQQLCPQSGNESVVT  248

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
              LD TT DTFD NYFSNLQ N GLL+SDQELFST+GA TI IVNNFS+NQTAFF+SFV S
Sbjct  249   YLDSTTPDTFDGNYFSNLQTNEGLLRSDQELFSTTGADTIDIVNNFSSNQTAFFESFVVS  308

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MI MGNISPLTG+ GEIRLNCRR+N
Sbjct  309   MIRMGNISPLTGTDGEIRLNCRRVN  333


 Score =   402 bits (1033),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 212/324 (65%), Positives = 250/324 (77%), Gaps = 7/324 (2%)
 Frame = +2

Query  74    MAVAIFIFF----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFH  241
             M VA+F  F      +  QL+ TFY  TCP+V SI+  VI + L  D RIGASLIRLHFH
Sbjct  379   MVVALFYAFLVGGPLAYGQLTPTFYDETCPSVISIIRGVIAETLIFDPRIGASLIRLHFH  438

Query  242   DCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIl  421
             DCFV+GCDGS+LLD   T I +EK+A  NNNSARGFDVVD +K  +E  CPG VSCADIL
Sbjct  439   DCFVHGCDGSILLDKTAT-IDTEKEAFANNNSARGFDVVDIMKERLEGVCPGTVSCADIL  497

Query  422   alasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-  598
             A+A+E +V LAGGP W + LGRRD  TAN+  AN  +P P D L  L  +FT VGLN N 
Sbjct  498   AIAAEESVVLAGGPWWPIPLGRRDSLTANRTAANAFIPGPRDTLERLRSRFTVVGLNNNT  557

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNL  778
             DLVALSGAHTFGRAQCRTF +RL+NF+NTG PDPTL+TT LATLQQ+CPQGG+G+ + +L
Sbjct  558   DLVALSGAHTFGRAQCRTFIDRLYNFNNTGLPDPTLDTTSLATLQQLCPQGGNGTVLADL  617

Query  779   DPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSM  955
             DPTT D FDNNYFSNLQ N+GLL+SDQELFST GA   I +VN FS ++TAFF+SFV+SM
Sbjct  618   DPTTPDCFDNNYFSNLQANKGLLQSDQELFSTPGADDIIELVNIFSTDETAFFESFVESM  677

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             I MGN+SPLTG+ GEIRLNCR +N
Sbjct  678   IRMGNLSPLTGTEGEIRLNCRVVN  701



>ref|XP_006492672.1| PREDICTED: peroxidase 15-like [Citrus sinensis]
 gb|KDO40102.1| hypothetical protein CISIN_1g018847mg [Citrus sinensis]
Length=349

 Score =   422 bits (1086),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 223/331 (67%), Positives = 262/331 (79%), Gaps = 5/331 (2%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFF---SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGA  217
             MAS   L+A A+ +       S + AQLS  FYS+TCPNV++I+  V+Q A  +D RIGA
Sbjct  1     MASLRYLIAAALVVAFVLEGSSPAQAQLSPFFYSSTCPNVTNIIREVLQNAFLSDIRIGA  60

Query  218   SLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPG  397
             SLIRLHFHDCFVNGCD S+LLDN  TTI SEK AA NNNSARGF+VVD++K AVE ACPG
Sbjct  61    SLIRLHFHDCFVNGCDASILLDNT-TTIDSEKFAAPNNNSARGFEVVDDMKAAVERACPG  119

Query  398   VVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFT  577
             VVSCADIL +A+E +V+L+GGP+W  LLGRRD  TAN+  AN +LP P + L  L  +F 
Sbjct  120   VVSCADILTIAAEESVALSGGPAWTNLLGRRDSRTANRTLANENLPGPNNSLERLKDRFR  179

Query  578   NVGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG  754
             NVGLN N DLVALSGAHTFGRAQCRTF++RLFNF+NTGNPDPTLNTT L  L+Q+CPQGG
Sbjct  180   NVGLNDNFDLVALSGAHTFGRAQCRTFSDRLFNFNNTGNPDPTLNTTLLQQLRQLCPQGG  239

Query  755   SGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFF  934
             +GS +TNLD TT D FDN YF NLQ ++GLL+SDQELFST GA T AIVN FS+NQ AFF
Sbjct  240   NGSVLTNLDVTTPDLFDNKYFFNLQISKGLLQSDQELFSTPGADTTAIVNVFSSNQAAFF  299

Query  935   QSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             +SFV SMI MGN+ PLTG+ GEIR NCRR+N
Sbjct  300   KSFVISMIRMGNLKPLTGNQGEIRSNCRRVN  330



>ref|XP_006494804.1| PREDICTED: peroxidase 15-like [Citrus sinensis]
Length=350

 Score =   422 bits (1085),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 222/331 (67%), Positives = 260/331 (79%), Gaps = 5/331 (2%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFF---SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGA  217
             MAS   LLA A+ +       S   AQLS +FYS+TCPNV++I+  V+Q A  +D RIGA
Sbjct  1     MASLRFLLAAALVVAFVLEGSSPDQAQLSPSFYSSTCPNVTNIIREVLQNAFLSDIRIGA  60

Query  218   SLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPG  397
             SL+RLHFHDCFVNGCD S+LLDN  TTI SEK A  NNNSARGF+VVD++K AVE ACPG
Sbjct  61    SLVRLHFHDCFVNGCDASILLDNT-TTIESEKFAGPNNNSARGFEVVDDMKAAVERACPG  119

Query  398   VVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFT  577
             VVSCADIL +A+E +V+L+GGPSW  LLGRRD  TAN+  AN +LP P + +  L  +F 
Sbjct  120   VVSCADILTIAAEQSVALSGGPSWTNLLGRRDSRTANRTLANENLPVPNNSVERLKDRFR  179

Query  578   NVGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG  754
             NVGLN N DLVALSGAHTFGRAQCRTF++RLFNF+NTGNPDPTLNTT L  L+Q+CPQGG
Sbjct  180   NVGLNDNFDLVALSGAHTFGRAQCRTFSDRLFNFNNTGNPDPTLNTTLLQQLRQLCPQGG  239

Query  755   SGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFF  934
             +GS +TNLD TT D FDN YF NLQ ++GLL+SDQELFST GA T AIVNNF  NQT FF
Sbjct  240   NGSVLTNLDVTTPDVFDNKYFFNLQIHKGLLQSDQELFSTPGADTAAIVNNFGRNQTVFF  299

Query  935   QSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
              +FV SMI MGN+ PLTG+ GEIRLNCRR+N
Sbjct  300   VNFVTSMIRMGNLKPLTGNQGEIRLNCRRVN  330



>ref|XP_002285652.2| PREDICTED: peroxidase A2 [Vitis vinifera]
Length=343

 Score =   422 bits (1084),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 214/329 (65%), Positives = 260/329 (79%), Gaps = 2/329 (1%)
 Frame = +2

Query  44    KMASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASL  223
             KM S    L +     +  S S  QLS T+Y  TCPN SSIV  VIQ+A  +D RIGASL
Sbjct  2     KMCSQVVGLLILGVFLLGGSPSYGQLSPTYYDDTCPNASSIVRGVIQEAFISDVRIGASL  61

Query  224   IRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVV  403
             IRLHFHDCFVNGCDGSLLLDN   TIVSEKDA  N NS RGF+VVD+IKTA+E++C G+V
Sbjct  62    IRLHFHDCFVNGCDGSLLLDNT-ETIVSEKDAIPNANSTRGFEVVDSIKTALESSCQGIV  120

Query  404   SCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNV  583
             SCADILA+A+E++V+++GGPSW VLLGRRD   ANQ GANT+LPNP  +++ L   F  V
Sbjct  121   SCADILAIAAEASVNMSGGPSWTVLLGRRDSRIANQSGANTALPNPRQNITTLKAVFEAV  180

Query  584   GLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSG  760
             GLN   DLVALSGAHTFGRA CR F++R++NFS T +PDP+LN++YL TL  +CPQ G G
Sbjct  181   GLNTTTDLVALSGAHTFGRAACRFFSDRIYNFSGTESPDPSLNSSYLETLSALCPQDGDG  240

Query  761   STVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQS  940
             + + +LDPTT D FD NYFSNLQ NRGLL+SDQELFST+G+ TI IVN F++N+TAFF+S
Sbjct  241   TVLADLDPTTPDGFDKNYFSNLQENRGLLQSDQELFSTTGSDTIDIVNLFASNETAFFES  300

Query  941   FVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FV+SMI MGNISPLTG+ GEIRL+CR++N
Sbjct  301   FVESMIRMGNISPLTGTEGEIRLDCRKVN  329



>gb|AAR15704.3| peroxidase [Brassica napus]
Length=306

 Score =   420 bits (1079),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 214/304 (70%), Positives = 256/304 (84%), Gaps = 1/304 (0%)
 Frame = +2

Query  116   QLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNGT  295
             QL+ TFYS TCPNVS+IV + I+QA Q+D RIGASLIRLHFHDCFV GCDGSLLLD++  
Sbjct  1     QLNPTFYSGTCPNVSAIVRSTIEQAPQSDPRIGASLIRLHFHDCFVKGCDGSLLLDDSAN  60

Query  296   TIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNV  475
              I SEK+A  N NS RGF+VVD+IKTA+ENACPG+VSC+DILALASE++VSLAGGP+W V
Sbjct  61    -IQSEKNAVPNANSTRGFNVVDDIKTALENACPGIVSCSDILALASEASVSLAGGPTWAV  119

Query  476   LLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRTF  655
             LLGRRDG TAN  GANT LP+PF+ ++N+T KFT VGLN  D+V LSGAHTFGRA C TF
Sbjct  120   LLGRRDGLTANLSGANTGLPSPFEGITNITAKFTAVGLNTTDVVVLSGAHTFGRAACATF  179

Query  656   NNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQNN  835
             NNRLFNF+ TG+PDPTLN+T L++LQQ+CPQ GS S VTNLD +T D FDNNYF+NLQ+N
Sbjct  180   NNRLFNFNGTGSPDPTLNSTLLSSLQQLCPQNGSASVVTNLDLSTPDAFDNNYFTNLQSN  239

Query  836   RGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLNC  1015
              GLL+SDQEL S +G+ TI IV +F++NQT FF++F  SMI MGNISPLTGSSGEIR +C
Sbjct  240   NGLLQSDQELLSDTGSPTIPIVTSFASNQTQFFEAFALSMIKMGNISPLTGSSGEIRQDC  299

Query  1016  RRLN  1027
             + +N
Sbjct  300   KVVN  303



>pdb|4A5G|A Chain A, Raphanus Sativus Anionic Peroxidase.
 pdb|4A5G|B Chain B, Raphanus Sativus Anionic Peroxidase.
Length=308

 Score =   420 bits (1079),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 220/303 (73%), Positives = 263/303 (87%), Gaps = 1/303 (0%)
 Frame = +2

Query  119   LSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNGTT  298
             L++TFY+ TCPN S++V T++QQA Q+D+RIGASLIRLHFHDCFV GCD S+LLDN+G+ 
Sbjct  4     LNATFYAGTCPNASAMVRTIVQQAFQSDSRIGASLIRLHFHDCFVLGCDASILLDNSGS-  62

Query  299   IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNVL  478
             I+SEK+A  N NSARGF+VVDNIKTA+ENACPGVVSC D+LALAS+++VSL+GGPSW V 
Sbjct  63    IISEKNAGPNANSARGFNVVDNIKTALENACPGVVSCTDVLALASQASVSLSGGPSWTVD  122

Query  479   LGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRTFN  658
             LGRRD  TANQ GAN+S+P+P   LSN+T KF+ VGLN NDLVALSGAHTFGRA C  F+
Sbjct  123   LGRRDTLTANQAGANSSIPSPTQGLSNITSKFSAVGLNTNDLVALSGAHTFGRATCGVFS  182

Query  659   NRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQNNR  838
             NRLFNFS  GNPDPTLNTT L+TLQ++CPQ G GS  TNLD +T D FDNNYF+NLQ+N 
Sbjct  183   NRLFNFSGKGNPDPTLNTTLLSTLQELCPQKGRGSGSTNLDLSTPDAFDNNYFTNLQSNN  242

Query  839   GLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLNCR  1018
             GLL+SDQELFST+G+ATIAIV +F++NQT FFQ+F QSMINMGNISPLTGSSGEIRL+C+
Sbjct  243   GLLQSDQELFSTTGSATIAIVTSFASNQTLFFQAFAQSMINMGNISPLTGSSGEIRLDCK  302

Query  1019  RLN  1027
             + N
Sbjct  303   KTN  305



>ref|XP_002279920.1| PREDICTED: peroxidase A2 [Vitis vinifera]
 emb|CBI30006.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   421 bits (1081),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 219/332 (66%), Positives = 264/332 (80%), Gaps = 7/332 (2%)
 Frame = +2

Query  50    ASFSALLAMAVAIFI--FFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASL  223
             +S S    +   IFI   F  S AQL+S+FYS TCPN  +IV +++ QA+ +D RIGASL
Sbjct  3     SSPSHFFVLIATIFISSLFHPSTAQLNSSFYSCTCPNAYTIVRSIVHQAMASDTRIGASL  62

Query  224   IRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVV  403
             +RLHFHDCF NGCD S+LLD++  +I SEK AA N  SARGF+VVD IK A+E +C GVV
Sbjct  63    VRLHFHDCFANGCDASILLDDS-PSIQSEKHAAPNFKSARGFEVVDRIKAALECSCRGVV  121

Query  404   SCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNV  583
             SCADILALASE++VSL+GGPSW VLLGRRD TTANQ GANTS+P+P + L+N++ KF+ V
Sbjct  122   SCADILALASEASVSLSGGPSWTVLLGRRDSTTANQAGANTSIPSPSEGLANISNKFSAV  181

Query  584   GLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGS  763
             GL + DLVALSGAHTFG+AQCRTF+ RL+NF  TG PDPTLN TYLA LQQ+CP+ G+G 
Sbjct  182   GLEITDLVALSGAHTFGKAQCRTFSERLYNFKGTGGPDPTLNATYLAVLQQICPEDGNGG  241

Query  764   -TVTNLDPT-TSD--TFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAF  931
               + NLDPT TSD   FDNNYFSNLQ+ +GLL+SDQELFST  A  IAIVN+FS +Q+AF
Sbjct  242   FGLANLDPTNTSDGHDFDNNYFSNLQSLQGLLQSDQELFSTPNAKIIAIVNSFSGDQSAF  301

Query  932   FQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FQSF QSM+ MGNISPLTG  GEIRLNCR++N
Sbjct  302   FQSFAQSMVKMGNISPLTGKDGEIRLNCRKVN  333



>ref|XP_007206842.1| hypothetical protein PRUPE_ppa027053mg [Prunus persica]
 gb|EMJ08041.1| hypothetical protein PRUPE_ppa027053mg [Prunus persica]
Length=324

 Score =   420 bits (1079),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 213/326 (65%), Positives = 261/326 (80%), Gaps = 4/326 (1%)
 Frame = +2

Query  50    ASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIR  229
             +SFS + A+ +        SNAQLSSTFYS+TCPNV+S+V  V++QA QND RIGA LIR
Sbjct  3     SSFSIVSAIILLTICVLGNSNAQLSSTFYSSTCPNVTSVVRGVVEQAQQNDIRIGAKLIR  62

Query  230   LHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSC  409
             +HFHDCFVNGCDGS++LDN    I SEKDA  N  S  G+DVVD+IKTA+EN CPGVVSC
Sbjct  63    VHFHDCFVNGCDGSIMLDN-ADGIESEKDAVPNQ-STDGYDVVDDIKTALENVCPGVVSC  120

Query  410   ADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGL  589
             ADILA+AS+  VS  GGP+W V LGRRD  TAN+ G  T+LP+PF++L  +T+KF +VGL
Sbjct  121   ADILAIASQILVSANGGPTWEVQLGRRDSRTANRAGT-TALPSPFENLEQITKKFNDVGL  179

Query  590   NVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTV  769
             +  DLVALSGAHTFGRA+C TF +RL+NFS TGNPDPT++TTYL TL+Q+CP GG+G T+
Sbjct  180   DSTDLVALSGAHTFGRARCLTFVHRLYNFSGTGNPDPTIDTTYLETLRQICPNGGNGGTL  239

Query  770   TNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQ  949
              +LD +T D FD+NYF+NLQN RGLL++DQELFSTSG  T+AIVN F+ +Q+ FF SF Q
Sbjct  240   ADLDQSTRDEFDHNYFTNLQNKRGLLQTDQELFSTSG-DTVAIVNRFANSQSDFFDSFGQ  298

Query  950   SMINMGNISPLTGSSGEIRLNCRRLN  1027
             SMINMGNI PLTGS GEIR +CRR+N
Sbjct  299   SMINMGNIRPLTGSDGEIRSDCRRVN  324



>ref|XP_008228052.1| PREDICTED: peroxidase A2-like [Prunus mume]
Length=365

 Score =   421 bits (1082),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 216/328 (66%), Positives = 258/328 (79%), Gaps = 3/328 (1%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             S S L A+ + +        AQLS TFY   CPN +S V  VI++ALQ D RI ASL RL
Sbjct  24    SVSILFAILLILCAGAGYGEAQLSPTFYDEDCPNATSTVRAVIEEALQTDPRIAASLTRL  83

Query  233   HFHDCFVNGCDGSLLLDNNGTT---IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVV  403
             HFHDCFVNGCDGS+LLDN+ +T   I SEK A  NNNSARGFDVVDNIKTA+E ACPGVV
Sbjct  84    HFHDCFVNGCDGSILLDNSSSTSSTIDSEKAAFANNNSARGFDVVDNIKTALETACPGVV  143

Query  404   SCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNV  583
             SCADILA+A+E +VSL+GGPSW VLLGRRD TTAN+  AN +LP P   L  L   F  V
Sbjct  144   SCADILAIAAEESVSLSGGPSWTVLLGRRDSTTANRTAANEALPPPTFTLDQLKASFAAV  203

Query  584   GLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGS  763
             GL+  DLVALSGAHTFGRA+C++F+NRL++F++TG PDPTLN+TYL TL+++CPQ G+ S
Sbjct  204   GLDTTDLVALSGAHTFGRAKCQSFSNRLYDFNSTGLPDPTLNSTYLETLRELCPQNGNAS  263

Query  764   TVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSF  943
              + N DP+T +TFD  YFSNLQ  +GLL+SDQELFST+GA TI IVNNFS NQ+AFF+SF
Sbjct  264   VLANFDPSTPNTFDGKYFSNLQVRKGLLQSDQELFSTTGADTINIVNNFSVNQSAFFESF  323

Query  944   VQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             V+SMI MGNISPLTG+ GEIRLNCR++N
Sbjct  324   VKSMIKMGNISPLTGTDGEIRLNCRKVN  351



>ref|XP_010257484.1| PREDICTED: peroxidase 15-like [Nelumbo nucifera]
Length=321

 Score =   419 bits (1078),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 212/307 (69%), Positives = 259/307 (84%), Gaps = 7/307 (2%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             ++AQLS+TFYS+TCPNVS+IV  VIQQ L++D RI ASLIRLHFHDCFV+GCDGS+LLD+
Sbjct  22    TDAQLSATFYSSTCPNVSTIVRNVIQQELRSDVRIAASLIRLHFHDCFVDGCDGSILLDD  81

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             + T I SEK A  N++S RGF VVD+IKTAVEN CPGVVSCADILA+A+E++VSL+GGPS
Sbjct  82    SDT-IQSEKTARPNDDSVRGFPVVDDIKTAVENVCPGVVSCADILAIAAEASVSLSGGPS  140

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W+VLLGRRD  TAN+ GAN SLP+PF+ L  +T KF+NVGL+  DLVALSGAHTFGRAQC
Sbjct  141   WDVLLGRRDSRTANRQGANDSLPSPFESLDRITTKFSNVGLDTTDLVALSGAHTFGRAQC  200

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
             RTF  RL    NT NPDP L+  YL TL+Q C  GG+ +T+T++DP++ D FDNNYF+NL
Sbjct  201   RTFRQRL----NTSNPDPNLDADYLETLRQTC--GGADNTLTDMDPSSPDDFDNNYFTNL  254

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             QNNRGLL++DQ+LFST GA T+AIVN F+++Q+ FF SFVQSMI MGNISPLTGSSGEIR
Sbjct  255   QNNRGLLQTDQDLFSTPGANTVAIVNRFASSQSDFFDSFVQSMIKMGNISPLTGSSGEIR  314

Query  1007  LNCRRLN  1027
              +C+R+N
Sbjct  315   SDCKRVN  321



>ref|XP_007207695.1| hypothetical protein PRUPE_ppa023946mg [Prunus persica]
 gb|EMJ08894.1| hypothetical protein PRUPE_ppa023946mg [Prunus persica]
Length=324

 Score =   419 bits (1078),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 211/326 (65%), Positives = 263/326 (81%), Gaps = 4/326 (1%)
 Frame = +2

Query  50    ASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIR  229
             +SFS + A+ +        SNAQLSSTFY+TTCPNV+S+V  V++QA QND RIGA LI+
Sbjct  3     SSFSIVAAIILLTICVLGNSNAQLSSTFYTTTCPNVTSVVRGVVEQAQQNDIRIGAKLIQ  62

Query  230   LHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSC  409
             +HFHDCFVNGCDGS++LDN    I SEKDA + N S  G+DVVD+IKTA+EN CPGVVSC
Sbjct  63    VHFHDCFVNGCDGSIMLDN-ADGIESEKDA-RPNQSTDGYDVVDDIKTALENVCPGVVSC  120

Query  410   ADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGL  589
             ADILA+AS+  VS  GGP+W V LGRRD  TANQ G  T++P+PF++L  +T+KF++VGL
Sbjct  121   ADILAIASQILVSANGGPTWEVQLGRRDSRTANQSGT-TAIPSPFENLEQITKKFSDVGL  179

Query  590   NVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTV  769
             +  DLVALSGAHTFGRA+C TF +RL+NFS TGNPDPT++TTYL TL+Q+CP GG+G T+
Sbjct  180   DSTDLVALSGAHTFGRARCLTFVHRLYNFSGTGNPDPTIDTTYLETLRQICPNGGNGGTL  239

Query  770   TNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQ  949
              +LD +T D FD+NYF+NLQN RGLL++DQELFSTSG  T+AIVN F+ +Q+ FF SF Q
Sbjct  240   ADLDQSTRDEFDHNYFTNLQNKRGLLQTDQELFSTSG-DTVAIVNRFANSQSDFFDSFGQ  298

Query  950   SMINMGNISPLTGSSGEIRLNCRRLN  1027
             SMINMGNI PLTGS GEIR +C+R+N
Sbjct  299   SMINMGNIRPLTGSDGEIRSDCKRVN  324



>gb|KDP44301.1| hypothetical protein JCGZ_19168 [Jatropha curcas]
Length=357

 Score =   420 bits (1079),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 216/319 (68%), Positives = 256/319 (80%), Gaps = 3/319 (1%)
 Frame = +2

Query  65    LLAMAVAIFIF-FSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFH  241
             ++A+   I +   S +  QLS TFY  +CPNVSSI+  VI+Q LQ+D RIGASLIRLHFH
Sbjct  19    VVALVCGILVGGVSMAYGQLSPTFYDESCPNVSSIIRGVIEQTLQSDPRIGASLIRLHFH  78

Query  242   DCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIl  421
             DCFVNGCDGS+LLDN  T I SEK+A  NNNSARGFDVVD +K+ +E  CP  VSCADIL
Sbjct  79    DCFVNGCDGSILLDNTAT-IESEKEALANNNSARGFDVVDTMKSNLETVCPATVSCADIL  137

Query  422   alasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-  598
              +A++ +V+LAGGP+W+ LLGRRD TTA++  AN ++P PFD L  L +KFTNVGLN N 
Sbjct  138   TIAAQESVALAGGPTWSNLLGRRDSTTASRALANITIPGPFDSLDLLKQKFTNVGLNNNT  197

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNL  778
             DLVALSGAHTFGRAQCRTF  RL+NF+ T  PDPTLNTTYL TLQQ+CP GG+GS +TNL
Sbjct  198   DLVALSGAHTFGRAQCRTFVTRLYNFNGTNLPDPTLNTTYLQTLQQICPNGGNGSVLTNL  257

Query  779   DPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMI  958
             DPTT D FD NYFSNL  N GLL+SDQELFST+GA T AIV+NFS+N+TAFF+SFV SM+
Sbjct  258   DPTTPDAFDKNYFSNLLTNEGLLQSDQELFSTTGADTAAIVSNFSSNETAFFESFVLSML  317

Query  959   NMGNISPLTGSSGEIRLNC  1015
              MGN+S LTG+ GEIRLNC
Sbjct  318   RMGNLSVLTGTQGEIRLNC  336



>ref|XP_006492673.1| PREDICTED: peroxidase 15-like [Citrus sinensis]
Length=350

 Score =   418 bits (1074),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 216/310 (70%), Positives = 251/310 (81%), Gaps = 2/310 (1%)
 Frame = +2

Query  101   SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLL  280
             S S AQLS  FYS+TCPNV++I+  V+Q+A  +D RIGASLIRLHFHDCFVNGCD S+LL
Sbjct  22    SPSQAQLSPFFYSSTCPNVTNIIRGVLQKAFLSDIRIGASLIRLHFHDCFVNGCDASVLL  81

Query  281   DNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGG  460
             DN  TTI SEK AA NNNSARGF+V+D +K AVE ACP VVSCADIL +A+E +V+L+GG
Sbjct  82    DNT-TTIDSEKFAAPNNNSARGFEVIDQMKAAVEKACPRVVSCADILTIAAEQSVALSGG  140

Query  461   PSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-DLVALSGAHTFGR  637
             PSW  LLGRRD  TAN+  AN +LP+PFD L  L   F NVGLN N DLVALSGAHTFGR
Sbjct  141   PSWTNLLGRRDSRTANRTLANQNLPSPFDTLDRLKASFRNVGLNDNFDLVALSGAHTFGR  200

Query  638   AQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYF  817
             AQCR F+ RLFNF+NTGNPDPTL+ T+L  L+Q+CPQGG+GS +TNLD TT + FDN YF
Sbjct  201   AQCRFFSVRLFNFNNTGNPDPTLDATFLQQLRQLCPQGGNGSVLTNLDVTTPNVFDNKYF  260

Query  818   SNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSG  997
             SNL+N +GLL+SDQELFST GA TI IVN F  NQ AFF+SFV SMI MGN+ PLTG+ G
Sbjct  261   SNLRNRKGLLQSDQELFSTPGADTIDIVNVFRKNQAAFFKSFVTSMIRMGNLKPLTGNEG  320

Query  998   EIRLNCRRLN  1027
             EIRLNCRR+N
Sbjct  321   EIRLNCRRVN  330



>ref|XP_010937006.1| PREDICTED: peroxidase 15-like [Elaeis guineensis]
Length=333

 Score =   417 bits (1071),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 218/310 (70%), Positives = 256/310 (83%), Gaps = 3/310 (1%)
 Frame = +2

Query  98    FSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLL  277
             F  S AQL  +FY+TTCP+VS+IV +V+Q+A ++D RI ASL RL FHDCFV GCDGS+L
Sbjct  25    FQGSRAQLRPSFYNTTCPDVSAIVLSVVQEAQRSDVRITASLTRLFFHDCFVQGCDGSIL  84

Query  278   LDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaG  457
             LD++ T IVSEK A  NNNS RGF+VVDNIK A+E ACPGVVSCADILALA+ES+V  +G
Sbjct  85    LDDSAT-IVSEKGAIPNNNSLRGFNVVDNIKAAIERACPGVVSCADILALAAESSVRSSG  143

Query  458   GPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGR  637
             GPSW+VLLGRRDGTTAN+  AN +LP+PFD LS L  KF+ VGL   DLVALSGAHTFGR
Sbjct  144   GPSWSVLLGRRDGTTANRNAAN-NLPSPFDPLSTLQSKFSAVGLGNTDLVALSGAHTFGR  202

Query  638   AQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYF  817
             AQC++F+NRL+NFS  G PD TLN +Y +TLQQ CPQGG GST+ NLDPTT +TFD NYF
Sbjct  203   AQCKSFSNRLYNFSG-GRPDSTLNPSYRSTLQQNCPQGGPGSTLNNLDPTTPNTFDKNYF  261

Query  818   SNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSG  997
             +NLQ NRGLL+SDQEL STSGA T +IVN+F+ +Q  FFQSFVQSMINMGNISPLT S G
Sbjct  262   NNLQGNRGLLQSDQELLSTSGAPTASIVNSFANSQGTFFQSFVQSMINMGNISPLTASRG  321

Query  998   EIRLNCRRLN  1027
             +IR NCRR+N
Sbjct  322   QIRSNCRRVN  331



>gb|ABG49115.1| peroxidase [Citrus maxima]
Length=350

 Score =   416 bits (1070),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 226/333 (68%), Positives = 265/333 (80%), Gaps = 7/333 (2%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFF---SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGA  217
             M+    LLA AV +F F    S S AQL+  FY+TTCPN S+I+  V+Q A  +D RI A
Sbjct  1     MSPLRYLLAAAV-LFAFVLDESSSQAQLTPDFYNTTCPNASNIILGVLQNAFNSDIRITA  59

Query  218   SLIRLHFHDCFVNGCDGSLLLDN--NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENAC  391
             SLIRLHFHDCFVNGCDGS+LLDN  N T+I SEK +  NNNSARGF+VVD +KTA+E+AC
Sbjct  60    SLIRLHFHDCFVNGCDGSILLDNVANDTSIDSEKFSMANNNSARGFEVVDAMKTALESAC  119

Query  392   PGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRK  571
             PG+VSCADILA+ASE +V+L+GGPSW V LGRRDG TAN+  A+ +LP PF  L  L  +
Sbjct  120   PGIVSCADILAIASEQSVNLSGGPSWTVPLGRRDGRTANRSLADQNLPTPFQTLDLLKGR  179

Query  572   FTNVGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQ  748
             F NVGLN N DLVALSGAHTFGRAQC+ F+ RLFNF+ TGNPDPTLN T LA LQQ+CPQ
Sbjct  180   FRNVGLNDNTDLVALSGAHTFGRAQCQFFSQRLFNFNGTGNPDPTLNATLLAQLQQLCPQ  239

Query  749   GGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTA  928
             GG+GS +TNLD +T D FDN+YFSNLQ N GLL+SDQELFSTSGA TI IVNNFS+N+TA
Sbjct  240   GGNGSVLTNLDLSTPDGFDNDYFSNLQANNGLLQSDQELFSTSGADTIPIVNNFSSNETA  299

Query  929   FFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FF+SF  SMI MGN+S LTG+ GEIR NCRR+N
Sbjct  300   FFESFAVSMIRMGNLSLLTGTQGEIRSNCRRVN  332



>ref|XP_010058176.1| PREDICTED: peroxidase A2-like [Eucalyptus grandis]
 gb|KCW90314.1| hypothetical protein EUGRSUZ_A02457 [Eucalyptus grandis]
Length=334

 Score =   416 bits (1068),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 201/306 (66%), Positives = 251/306 (82%), Gaps = 1/306 (0%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
             NA+L++ FY+ TCP+VSSIV TVI +AL++D RI ASL+RLHFHDCFV GCDGS+LLDN+
Sbjct  28    NAELTADFYAKTCPDVSSIVQTVIHEALESDPRITASLLRLHFHDCFVQGCDGSILLDNS  87

Query  290   GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSW  469
               TI SEKD+A +  SARGF VVD IK A+E+ CPG VSCADILALA+ ++V L+GGP W
Sbjct  88    -PTIKSEKDSAPSFKSARGFGVVDKIKAAIESTCPGTVSCADILALAANASVYLSGGPYW  146

Query  470   NVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCR  649
              VLLGRRDG TANQG ANTS+P+PFD  +NLT KF  VGL++ DLV LSGAHTFGRA C+
Sbjct  147   TVLLGRRDGLTANQGLANTSIPSPFDSYANLTSKFFAVGLDITDLVTLSGAHTFGRAHCK  206

Query  650   TFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQ  829
             +F  RL+NF+  G PDPTL+  YL  LQ++CP   S S + +LDPTT + FDN+Y+SNLQ
Sbjct  207   SFTPRLYNFTADGGPDPTLSPWYLTALQKLCPPNFSSSVLADLDPTTPNLFDNHYYSNLQ  266

Query  830   NNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
              N GL +SDQEL+ST+GAAT+ IVN+FSA+Q+AFF+SF +S++NMGNISPLTGS+GEIR 
Sbjct  267   KNDGLFQSDQELYSTAGAATVPIVNSFSADQSAFFKSFTRSIVNMGNISPLTGSNGEIRC  326

Query  1010  NCRRLN  1027
             NCR++N
Sbjct  327   NCRKVN  332



>ref|XP_009381003.1| PREDICTED: peroxidase A2-like [Musa acuminata subsp. malaccensis]
Length=351

 Score =   415 bits (1067),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 214/325 (66%), Positives = 265/325 (82%), Gaps = 4/325 (1%)
 Frame = +2

Query  56    FSALLAMAVAI-FIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
              +A LA  + +  +   +S AQLSSTFY ++CPNVSSIV   +QQA ++D RI ASL RL
Sbjct  10    LTASLAFILTLQLLVLRESQAQLSSTFYDSSCPNVSSIVLDQVQQAQKSDTRILASLTRL  69

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
              FHDCFVNGCDGS+LLDN+ +TIV+EKDA  NNNSARGFDVVDNIK AVEN+C G+VSCA
Sbjct  70    FFHDCFVNGCDGSILLDNS-STIVTEKDAVPNNNSARGFDVVDNIKAAVENSCSGIVSCA  128

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALA+E +V+L+GGP W+VLLGRRDGTTAN   AN +LP P D+L+ L +KF +VGLN
Sbjct  129   DILALAAEVSVNLSGGPKWSVLLGRRDGTTANITAAN-NLPGPRDNLTTLQQKFNDVGLN  187

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
               DLVALSG HTFGRAQCR+F+NRL+NFS+    DP+LN+TYL TLQ  CPQGG+GST+ 
Sbjct  188   DTDLVALSGGHTFGRAQCRSFSNRLYNFSDNSTADPSLNSTYLTTLQNNCPQGGNGSTLN  247

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             NLD TT DTFDN Y++NLQ   GLL+SDQEL+ T GA+T +IV+ F+ANQT FF++F+ +
Sbjct  248   NLDLTTPDTFDNKYYTNLQTKEGLLQSDQELYGT-GASTASIVDQFAANQTVFFENFIAA  306

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MINMGNISPLTGS+GEIR +C+++N
Sbjct  307   MINMGNISPLTGSNGEIRSDCKKVN  331



>ref|XP_002299142.2| hypothetical protein POPTR_0001s04840g [Populus trichocarpa]
 gb|EEE83947.2| hypothetical protein POPTR_0001s04840g [Populus trichocarpa]
 gb|AHL39107.1| class III peroxidase [Populus trichocarpa]
Length=343

 Score =   414 bits (1065),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 216/323 (67%), Positives = 253/323 (78%), Gaps = 8/323 (2%)
 Frame = +2

Query  80    VAIFIFF-----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             VA F F      + +  QL+ TFY  TCPNVSSI+  VI + L +D RI ASLIRLHFHD
Sbjct  8     VAAFFFVVLLGGTLAYGQLTPTFYDQTCPNVSSIIRNVITETLVSDPRIAASLIRLHFHD  67

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLDN  T I SEK+AA NNNSARGF+VVD +K  +E+ CP  VSCADIL 
Sbjct  68    CFVNGCDGSLLLDNTDT-IESEKEAAGNNNSARGFEVVDRMKALLESTCPATVSCADILT  126

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-D  601
             +A+E +V LAGGP W V LGRRD TTA++  AN SLP PF  L  L   FTNVGLN N D
Sbjct  127   IAAEESVVLAGGPCWTVPLGRRDSTTASRAAANASLPAPFLPLDQLRESFTNVGLNNNSD  186

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRA+C TF+ RL+NFS+TG PDP+L+TT LA LQ++CPQGG+ S +T+LD
Sbjct  187   LVALSGAHTFGRARCSTFDFRLYNFSSTGAPDPSLDTTLLAALQELCPQGGNESVITDLD  246

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMI  958
             PTT D FD+NY+SNLQ NRGLL++DQELFST GA   IA+VN FSANQTAFF+SFV+SMI
Sbjct  247   PTTPDVFDSNYYSNLQGNRGLLQTDQELFSTPGADDLIALVNAFSANQTAFFESFVESMI  306

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
              MGN+SPLTG+ GEIRLNCR +N
Sbjct  307   RMGNLSPLTGTEGEIRLNCRVVN  329



>ref|XP_006492678.1| PREDICTED: peroxidase 15-like [Citrus sinensis]
 gb|KDO62918.1| hypothetical protein CISIN_1g018811mg [Citrus sinensis]
Length=350

 Score =   415 bits (1066),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 225/333 (68%), Positives = 264/333 (79%), Gaps = 7/333 (2%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFF---SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGA  217
             M+    LLA AV +F F    S S AQL+  FY+TTCPN S+I+  V+Q A  +D RI A
Sbjct  1     MSPLRYLLAAAV-LFAFVLDESSSQAQLTPDFYNTTCPNASNIILGVLQNAFNSDIRITA  59

Query  218   SLIRLHFHDCFVNGCDGSLLLDN--NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENAC  391
             SLIRLHFHDCFVNGCDGS+LLDN  N T+I SEK +  NNNSARGF+VVD +K A+E+AC
Sbjct  60    SLIRLHFHDCFVNGCDGSILLDNVANDTSIDSEKFSMANNNSARGFEVVDAMKAALESAC  119

Query  392   PGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRK  571
             PG+VSCADILA+ASE +V+L+GGPSW V LGRRDG TAN+  A+ +LP PF  L  L  +
Sbjct  120   PGIVSCADILAIASEQSVNLSGGPSWTVPLGRRDGRTANRSLADQNLPTPFQTLDLLKGR  179

Query  572   FTNVGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQ  748
             FTNVGLN N DLVALSGAHTFGRAQC+ F+ RLFNF+ TGNPDPTLN T LA LQQ+CPQ
Sbjct  180   FTNVGLNDNTDLVALSGAHTFGRAQCQFFSQRLFNFNGTGNPDPTLNATLLAQLQQLCPQ  239

Query  749   GGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTA  928
             GG+GS +TNLD +T D FDN+YFSNLQ N GLL+SDQELFST GA TI IVNNFS+N+TA
Sbjct  240   GGNGSVLTNLDLSTPDGFDNDYFSNLQANNGLLQSDQELFSTPGADTIPIVNNFSSNETA  299

Query  929   FFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FF+SF  SMI MGN+S LTG+ GEIR NCRR+N
Sbjct  300   FFESFAVSMIRMGNLSLLTGTQGEIRSNCRRVN  332



>ref|XP_008228153.1| PREDICTED: peroxidase 15-like [Prunus mume]
Length=324

 Score =   413 bits (1062),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 208/326 (64%), Positives = 258/326 (79%), Gaps = 4/326 (1%)
 Frame = +2

Query  50    ASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIR  229
             +SFS + A  +        SNAQLSSTFY+TTCPNV+S+V  V+++A QND RIGA LIR
Sbjct  3     SSFSIVAATILVTICVLGNSNAQLSSTFYTTTCPNVTSVVRGVVEKAQQNDIRIGAKLIR  62

Query  230   LHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSC  409
             +HFHDCFVNGCDGS++LDN    I SEKDA  N  S  G+DVVD+IKTA+EN CPGVVSC
Sbjct  63    VHFHDCFVNGCDGSIMLDN-ADGIESEKDAVPNQ-STDGYDVVDDIKTALENVCPGVVSC  120

Query  410   ADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGL  589
             ADILA+AS+  VS  GGP+W V LGRRD  TAN+ G  T++P+PF++L  +T+KF++VGL
Sbjct  121   ADILAIASQILVSANGGPTWEVQLGRRDSRTANRAGT-TAIPSPFENLEQITKKFSDVGL  179

Query  590   NVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTV  769
             +  DLVALSGAHTFGRA+C TF +RL+NFS TG PDPT++ TYL TL+Q+CP GG+G T+
Sbjct  180   DSTDLVALSGAHTFGRARCVTFVHRLYNFSGTGKPDPTIDATYLETLRQICPNGGNGGTL  239

Query  770   TNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQ  949
              +LD +T D FDNNYF+NLQN RGLL++DQELFSTSG  T+AIVN F+ +Q+ F  SF Q
Sbjct  240   ADLDQSTRDEFDNNYFTNLQNKRGLLQTDQELFSTSG-DTVAIVNRFANSQSDFSDSFGQ  298

Query  950   SMINMGNISPLTGSSGEIRLNCRRLN  1027
             SMINMGNI PLTGS GEIR +C+R+N
Sbjct  299   SMINMGNIRPLTGSDGEIRSDCKRVN  324



>ref|XP_008798950.1| PREDICTED: peroxidase 15-like [Phoenix dactylifera]
Length=313

 Score =   412 bits (1059),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 208/309 (67%), Positives = 258/309 (83%), Gaps = 3/309 (1%)
 Frame = +2

Query  104   QSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLD  283
             + +AQ +  FY+T+CPNV  ++   + +AL  + R+G S++RLHFH CF+NGCDGS+LLD
Sbjct  5     EVSAQSTIGFYATSCPNVFDVIRHEVTKALMKEMRMGKSMLRLHFHVCFINGCDGSVLLD  64

Query  284   NNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGP  463
             ++ +TIVSEK AA N NS RGF+VVDNIK AVE ACPGVVSCADILALA+E++V  +GGP
Sbjct  65    SS-STIVSEKGAAPNANSLRGFNVVDNIKAAVERACPGVVSCADILALAAEASVRSSGGP  123

Query  464   SWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQ  643
             SW+VLLGRRD TTAN   AN +LP+PFD L+ L  KF+ VGL+  DLVALSGAHTFGRAQ
Sbjct  124   SWSVLLGRRDSTTANMNAAN-NLPSPFDSLTGLQSKFSAVGLSNTDLVALSGAHTFGRAQ  182

Query  644   CRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGST-VTNLDPTTSDTFDNNYFS  820
             CRTF++RL+NFS+TG PDPTLN +Y ATLQQ CPQGG+GS+ + NLDPTT +TFD NYF+
Sbjct  183   CRTFSSRLYNFSSTGKPDPTLNPSYRATLQQNCPQGGAGSSNLNNLDPTTPNTFDRNYFT  242

Query  821   NLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGE  1000
             NLQ NRGLL+SDQEL STSGA T +IVN+F+++QT FFQ+FV+SMINMGNISPLTGS G+
Sbjct  243   NLQGNRGLLQSDQELLSTSGAPTASIVNSFASSQTVFFQNFVRSMINMGNISPLTGSRGQ  302

Query  1001  IRLNCRRLN  1027
             IR NCR++N
Sbjct  303   IRSNCRKVN  311



>ref|XP_010111368.1| Peroxidase 53 [Morus notabilis]
 gb|EXC30846.1| Peroxidase 53 [Morus notabilis]
Length=320

 Score =   412 bits (1059),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 209/326 (64%), Positives = 264/326 (81%), Gaps = 14/326 (4%)
 Frame = +2

Query  50    ASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIR  229
             +++  L A+ +A    +  SNAQLS+TFY++TCPNVSSIV TV+QQ + +D+RIGASLI 
Sbjct  7     STYLVLKAITIAALTLY-PSNAQLSTTFYASTCPNVSSIVRTVVQQVMNSDSRIGASLIH  65

Query  230   LHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSC  409
             LHF            ++  +  +I SEKDA  N NSARG+DVVDNIKTAVEN+C GVVSC
Sbjct  66    LHF------------MIALSSDSIQSEKDAGPNANSARGYDVVDNIKTAVENSCSGVVSC  113

Query  410   ADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGL  589
             ADILALA+ES+VSL+GGPSW+V LGRRD  TAN+  ANT+LP+P + L+N+  KF+ VGL
Sbjct  114   ADILALAAESSVSLSGGPSWDVPLGRRDSLTANRAKANTALPSPSEGLANIMAKFSAVGL  173

Query  590   NVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTV  769
             +  DLVALSGAHTFGRAQCRTF+NRL+NFS  GNPDPTL+++YLA LQQ CPQ G G+ +
Sbjct  174   DTTDLVALSGAHTFGRAQCRTFSNRLYNFSG-GNPDPTLDSSYLAALQQTCPQNGDGTKL  232

Query  770   TNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQ  949
             TNLDP+++DTFDN YF+NL NNRGLL+SDQELFST+G+ T++IVN+ S++Q+AFF SF Q
Sbjct  233   TNLDPSSADTFDNKYFTNLHNNRGLLQSDQELFSTTGSVTVSIVNSLSSDQSAFFDSFAQ  292

Query  950   SMINMGNISPLTGSSGEIRLNCRRLN  1027
             SMINMGNISPLTGS GEIR +C+++N
Sbjct  293   SMINMGNISPLTGSKGEIRADCKKVN  318



>ref|XP_008390167.1| PREDICTED: peroxidase A2-like, partial [Malus domestica]
Length=315

 Score =   411 bits (1057),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 210/301 (70%), Positives = 242/301 (80%), Gaps = 3/301 (1%)
 Frame = +2

Query  134   YSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN---GTTIV  304
             Y  +CPN +SIV  VI++ALQ D RI ASL RLHFHDCFVNGCDGS+LLDN+    +TI 
Sbjct  1     YDESCPNATSIVRGVIEEALQTDPRITASLTRLHFHDCFVNGCDGSILLDNSTNPNSTID  60

Query  305   SEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNVLLG  484
             SEK A  NNNSARGFDVVDNIKTA+ENACP VVSCADILA+A+E +V+L+GGPSW VLLG
Sbjct  61    SEKTAVPNNNSARGFDVVDNIKTALENACPAVVSCADILAIAAEESVALSGGPSWTVLLG  120

Query  485   RRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRTFNNR  664
             RRD  TAN+  AN +LP P   L  L   F  VGLN  DLVALSGAHTFGRA+C TF +R
Sbjct  121   RRDSLTANRTAANEALPAPTFTLDZLEANFLAVGLNTTDLVALSGAHTFGRARCLTFTDR  180

Query  665   LFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGL  844
             L+NFS TG+PDPTLN+TYL TL ++CP  G+GS +TNLD  T DTFD  YFSNLQ   GL
Sbjct  181   LYNFSGTGSPDPTLNSTYLETLSEICPLNGNGSVLTNLDXVTPDTFDAKYFSNLQVEEGL  240

Query  845   LKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLNCRRL  1024
             L+SDQELFSTSGA TI IVNNFSANQ+AFF++F +SMI MGNISPLTG+ GEIRL+CRR+
Sbjct  241   LQSDQELFSTSGADTIDIVNNFSANQSAFFENFGESMIKMGNISPLTGTEGEIRLSCRRV  300

Query  1025  N  1027
             N
Sbjct  301   N  301



>ref|XP_007205419.1| hypothetical protein PRUPE_ppa007654mg [Prunus persica]
 gb|EMJ06618.1| hypothetical protein PRUPE_ppa007654mg [Prunus persica]
Length=360

 Score =   412 bits (1060),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 215/328 (66%), Positives = 255/328 (78%), Gaps = 3/328 (1%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             S S L A+ + +        AQL++TFY   CP   + V  VI  ALQ D RI ASL RL
Sbjct  19    SVSILFAILLILCAGAGYGEAQLTTTFYDEVCPCAITTVRGVILDALQTDPRIAASLTRL  78

Query  233   HFHDCFVNGCDGSLLLDNNGTT---IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVV  403
             HFHDCFVNGCDGS+LLDN+ +T   I SEK A  NNNSARGFDVVDNIKTA+E ACPGVV
Sbjct  79    HFHDCFVNGCDGSILLDNSSSTSSTIDSEKAAFANNNSARGFDVVDNIKTALETACPGVV  138

Query  404   SCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNV  583
             SCADILA+A+E +VSL+GGPSW VLLGRRD TTAN+  AN +LP P   L  L   F  V
Sbjct  139   SCADILAIAAEESVSLSGGPSWTVLLGRRDSTTANRTAANEALPAPSFTLDELKASFAAV  198

Query  584   GLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGS  763
             GL+  DLVALSGAHTFGRA+C++F+NRL++F++TG PDPTLN+TYL TL+++CPQ G+ S
Sbjct  199   GLDTTDLVALSGAHTFGRAKCQSFSNRLYDFNSTGLPDPTLNSTYLETLRELCPQNGNAS  258

Query  764   TVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSF  943
              + N DP+T +TFD  YFSNLQ  +GLL+SDQELFSTSGA TI IVNNFS NQ+AFF+SF
Sbjct  259   VLANFDPSTPNTFDGKYFSNLQVRKGLLQSDQELFSTSGADTINIVNNFSVNQSAFFESF  318

Query  944   VQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             V+SMI MGNISPLTG+ GEIRLNCRR+N
Sbjct  319   VKSMIKMGNISPLTGTDGEIRLNCRRVN  346



>ref|XP_009620837.1| PREDICTED: lignin-forming anionic peroxidase [Nicotiana tomentosiformis]
Length=324

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 210/326 (64%), Positives = 263/326 (81%), Gaps = 4/326 (1%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             SF   +   + +   F+ SNAQLS+TFY +TCPNV+SIV  V+ Q  + DAR GA +IRL
Sbjct  2     SFLRFVGTILFLVAIFAASNAQLSATFYDSTCPNVTSIVRGVMDQRQRTDARAGAKIIRL  61

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFVNGCDGS+LLD +GT   +EKDAA N   A GFD+VD+IKTA+EN CPGVVSCA
Sbjct  62    HFHDCFVNGCDGSILLDTDGTQ--TEKDAAPNV-GAGGFDIVDDIKTALENVCPGVVSCA  118

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALASE  V+LAGGPSW VL GRRD  TAN+ GAN+ +P+PF+ L+ +T +FTN G++
Sbjct  119   DILALASEIGVALAGGPSWQVLFGRRDSLTANRSGANSDIPSPFETLAVMTPQFTNKGMD  178

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG-SGSTV  769
             + DLVALSGAHTFGRA+C TF  RLFNFS +GNPDPT++ T+L TLQ +CPQGG +G+T 
Sbjct  179   LTDLVALSGAHTFGRARCGTFEQRLFNFSGSGNPDPTVDATFLQTLQGICPQGGNNGNTF  238

Query  770   TNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQ  949
             TNLD +T + FDN+YF+NLQNN+GLL++DQELFSTSG+ATIAIVN ++ +QT FF  FV 
Sbjct  239   TNLDISTPNDFDNDYFTNLQNNQGLLQTDQELFSTSGSATIAIVNRYAGSQTQFFDDFVS  298

Query  950   SMINMGNISPLTGSSGEIRLNCRRLN  1027
             SMI +GNISPLTG++GEIR +C+R+N
Sbjct  299   SMIKLGNISPLTGTNGEIRTDCKRVN  324



>ref|XP_010058158.1| PREDICTED: peroxidase A2-like [Eucalyptus grandis]
 gb|KCW90316.1| hypothetical protein EUGRSUZ_A02459 [Eucalyptus grandis]
Length=334

 Score =   411 bits (1057),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 249/306 (81%), Gaps = 1/306 (0%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
             NA+L++ FY+ TCP+VSSIV TVI +ALQ D RI ASL+RLHFHDCFV GCDGS+LLDN+
Sbjct  28    NAELTADFYAKTCPDVSSIVQTVIHEALQYDPRITASLLRLHFHDCFVQGCDGSVLLDNS  87

Query  290   GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSW  469
               TI SEKDAA N NSARGF VVD IK A+E+ CP  VSCADILALA+ ++V L+GGP W
Sbjct  88    -PTIKSEKDAAPNFNSARGFGVVDKIKAAIESTCPETVSCADILALAANASVYLSGGPYW  146

Query  470   NVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCR  649
              VLLGRRD  TANQG ANTS+P+PF+  +NLT KF  +GL++ DLV LSGAHTFGRA C+
Sbjct  147   TVLLGRRDSLTANQGLANTSIPSPFESYANLTSKFYVLGLDITDLVTLSGAHTFGRAHCK  206

Query  650   TFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQ  829
             +F  RL+NF+  G PDPTL+  YL  LQ++CP   +   +T+LDPTT + FDN+Y+SNLQ
Sbjct  207   SFTPRLYNFTKNGGPDPTLSPWYLTALQKLCPPNFNPKVITDLDPTTPNLFDNHYYSNLQ  266

Query  830   NNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
              N GL ++DQEL+ST+GAAT+ IVN+FSA+Q+AFF+SF +S++NMGNISPLTGS+GEIR 
Sbjct  267   KNDGLFETDQELYSTAGAATVPIVNSFSADQSAFFKSFTRSIVNMGNISPLTGSNGEIRC  326

Query  1010  NCRRLN  1027
             NCR++N
Sbjct  327   NCRKVN  332



>ref|XP_010265937.1| PREDICTED: peroxidase A2-like [Nelumbo nucifera]
Length=339

 Score =   411 bits (1057),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 213/325 (66%), Positives = 255/325 (78%), Gaps = 2/325 (1%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             S S  +  A+ +   F +SN+QL   FY +TCPNV +IV  VI QALQ D RIGASLIRL
Sbjct  2     SSSCFIITALFLVSMFMKSNSQLDPRFYDSTCPNVFNIVQQVISQALQTDPRIGASLIRL  61

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFVNGCDGS+LLDN  T I SEK+A  NNNSARG+DVVD+IK+++ENACPGVVSCA
Sbjct  62    HFHDCFVNGCDGSILLDNTDT-IQSEKEALPNNNSARGYDVVDSIKSSLENACPGVVSCA  120

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALA+E +V LAGGPSW V LGR D  TAN+ GAN +LP P ++L+ L  KF+   L+
Sbjct  121   DILALAAEISVKLAGGPSWCVPLGRNDSRTANRTGANNNLPGPSENLTTLKSKFSAFNLS  180

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
               DLVALSGAHTFGR+QCR F +RL+NFS TG PDPTLN +YL TL+Q+CPQ G+ S +T
Sbjct  181   TTDLVALSGAHTFGRSQCRNFIDRLYNFSGTGIPDPTLNQSYLETLRQICPQNGNQSVLT  240

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             NLDPTT D FD NYFSNLQ NRGLL+SDQELFS++    I +VN FS+NQTAFF+ F+QS
Sbjct  241   NLDPTTPDVFDRNYFSNLQVNRGLLQSDQELFSSNDTEIIDLVNKFSSNQTAFFEIFIQS  300

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MI MGNI P TGS  EIRL+C+++N
Sbjct  301   MIKMGNI-PATGSDLEIRLDCKKVN  324



>dbj|BAA11853.1| peroxidase [Populus nigra]
Length=343

 Score =   410 bits (1054),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 215/323 (67%), Positives = 253/323 (78%), Gaps = 8/323 (2%)
 Frame = +2

Query  80    VAIFIFF-----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             VA F F      + ++ QL+ TFY  TCPNVSSI+  VI + L +D RI ASLIRLHFHD
Sbjct  8     VAAFFFVVLLGGTLAHGQLTPTFYDQTCPNVSSIIRNVITETLVSDPRIAASLIRLHFHD  67

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLDN  T I SEK+AA NNNSARGF+VVD +K  +E+ACP  VSCADIL 
Sbjct  68    CFVNGCDGSLLLDNTDT-IESEKEAAGNNNSARGFEVVDRMKALLESACPATVSCADILT  126

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-D  601
             +A+E +V LAGGP+W V LGRRD TTA++  AN SLP PF  L  L   FTNVGLN N D
Sbjct  127   IAAEESVVLAGGPNWTVPLGRRDSTTASRAAANASLPAPFLPLDQLRESFTNVGLNNNTD  186

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRAQC TF+ RLF+F++TG PDP+L+ T LA LQ++CPQGG+ S +T+LD
Sbjct  187   LVALSGAHTFGRAQCSTFDFRLFDFNSTGAPDPSLDPTLLAALQELCPQGGNRSVITDLD  246

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMI  958
              TT D FD+NY+SNLQ NRGLL++DQELFST GA   IAIVN FSANQTAFF+SF +SMI
Sbjct  247   LTTPDAFDSNYYSNLQGNRGLLQTDQELFSTPGADDVIAIVNAFSANQTAFFESFAESMI  306

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
              MGN+SPLTG+ GEIRLNCR +N
Sbjct  307   RMGNLSPLTGTEGEIRLNCRVVN  329



>gb|AHL39106.1| class III peroxidase [Populus trichocarpa]
Length=343

 Score =   409 bits (1052),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 213/323 (66%), Positives = 254/323 (79%), Gaps = 8/323 (2%)
 Frame = +2

Query  80    VAIFIFF-----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             VA F F      + ++ QL+ TFY  TCPNVSSI+  VI + L +D RI ASLIRLHFHD
Sbjct  8     VATFFFVVLLGGTLAHGQLTPTFYDQTCPNVSSIIRNVITETLVSDPRIAASLIRLHFHD  67

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLDN  T I SEK+AA NNNSARGF+VVD +K  +E+ACP  VSCADIL 
Sbjct  68    CFVNGCDGSLLLDNTDT-IESEKEAAGNNNSARGFEVVDRMKALLESACPATVSCADILT  126

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-D  601
             +A+E +V LAGGP+W V LGRRD TTA++  AN SLP PF  L  L   FTNVGLN N D
Sbjct  127   IAAEESVVLAGGPNWTVPLGRRDSTTASRAAANASLPAPFLTLDQLRESFTNVGLNNNTD  186

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRA+C TF+ RLF+F+ TG PDP+++TT LA LQ++CP+ G+GS +T+LD
Sbjct  187   LVALSGAHTFGRAKCSTFDFRLFDFNRTGAPDPSMDTTLLAALQKLCPENGNGSVITDLD  246

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMI  958
              TT+D FD+ Y+SNLQ NRGLL++DQELFST GA   IA+VN FSANQTAFF+SFV+SMI
Sbjct  247   VTTADAFDSKYYSNLQCNRGLLQTDQELFSTPGADDVIALVNAFSANQTAFFESFVESMI  306

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
              MGNISPLTG+ GEIRLNCR +N
Sbjct  307   RMGNISPLTGTEGEIRLNCRVVN  329



>gb|KHG02293.1| Peroxidase 15 [Gossypium arboreum]
Length=345

 Score =   409 bits (1052),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/304 (68%), Positives = 247/304 (81%), Gaps = 2/304 (1%)
 Frame = +2

Query  119   LSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNGTT  298
             LS +FY  TCP V SI+  +I+QAL +D RIGASL+RLHFHDCFVNGCD S+LLDN+ T 
Sbjct  31    LSPSFYDETCPAVFSIIRGIIEQALLSDPRIGASLLRLHFHDCFVNGCDASILLDNSAT-  89

Query  299   IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNVL  478
             I SEK+AA NNNSARGF+VVD +K A+E  CPG+VSCADILA+A++ AV+LAGGPSW VL
Sbjct  90    IESEKEAAPNNNSARGFEVVDAMKIALEFECPGIVSCADILAIAAQEAVNLAGGPSWLVL  149

Query  479   LGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-DLVALSGAHTFGRAQCRTF  655
             LGRRD T AN+  AN ++P PFD L+ L  KF  VGLN + DLVALSGAHTFGRAQC   
Sbjct  150   LGRRDSTAANRTLANLAIPAPFDTLNVLKSKFAAVGLNTSTDLVALSGAHTFGRAQCTIL  209

Query  656   NNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQNN  835
               RL+NF+ TG  DPTLNTTYL TL++VCP+GG+GS + NLDPTT +TFD+NY++NLQ  
Sbjct  210   IERLYNFNGTGKADPTLNTTYLETLRKVCPEGGNGSVLVNLDPTTPNTFDSNYYTNLQAQ  269

Query  836   RGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLNC  1015
              GLL+SDQELFSTSGA TI IV  FS+NQ AFF+SFV SM+ MGNISP+TG+ GEIRL+C
Sbjct  270   EGLLQSDQELFSTSGADTIEIVERFSSNQIAFFESFVVSMLKMGNISPVTGTEGEIRLSC  329

Query  1016  RRLN  1027
             RR+N
Sbjct  330   RRVN  333



>ref|XP_010058186.1| PREDICTED: peroxidase A2-like [Eucalyptus grandis]
 gb|KCW90317.1| hypothetical protein EUGRSUZ_A02460 [Eucalyptus grandis]
Length=334

 Score =   409 bits (1050),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 247/306 (81%), Gaps = 1/306 (0%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
             NA+L++ FY+ TCP+VSSIV TVI +ALQ D RI ASL+RLHFHDCFV GCDGS+LLDN+
Sbjct  28    NAELTADFYAKTCPDVSSIVQTVIHEALQYDPRITASLLRLHFHDCFVQGCDGSVLLDNS  87

Query  290   GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSW  469
               TI SEKDAA N NSARGF VVD IK A+E+ CP  VSCADILALA+ ++V L+GGP W
Sbjct  88    -PTIKSEKDAAPNFNSARGFGVVDKIKAAIESTCPETVSCADILALAANASVYLSGGPYW  146

Query  470   NVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCR  649
              VLLGRRD  TANQG AN S+P+PFD  +NLT KF  +GL++ DLV LSGAHTFGRA C+
Sbjct  147   TVLLGRRDSLTANQGLANVSIPSPFDSYANLTSKFYVLGLDITDLVTLSGAHTFGRAHCK  206

Query  650   TFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQ  829
             +F  RL+NF+  G PDPTL+  YL  LQ++CP   +   +T+LDPTT + FDN+Y+SNLQ
Sbjct  207   SFTPRLYNFTKNGGPDPTLSPWYLTALQKLCPPNFNPKVITDLDPTTPNLFDNHYYSNLQ  266

Query  830   NNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
              N GL ++DQEL+ST+ AAT+ IVN+FSA+Q+AFF+SF +S++NMGNISPLTGS+GEIR 
Sbjct  267   KNDGLFETDQELYSTADAATVPIVNSFSADQSAFFKSFTRSIVNMGNISPLTGSNGEIRC  326

Query  1010  NCRRLN  1027
             NCR++N
Sbjct  327   NCRKVN  332



>ref|XP_008227949.1| PREDICTED: peroxidase A2-like isoform X2 [Prunus mume]
Length=405

 Score =   410 bits (1053),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 214/331 (65%), Positives = 258/331 (78%), Gaps = 3/331 (1%)
 Frame = +2

Query  35    NPKKMASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIG  214
             N K +AS   L AM + +        AQLS TFY   CPN +SIV  VI +ALQ D RI 
Sbjct  64    NIKILASI--LFAMLLILCAGAGYGEAQLSPTFYEEDCPNATSIVRAVIGEALQTDLRIA  121

Query  215   ASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACP  394
             ASL RL FHDCFVNGCDGS+LLDN+ +TI SEK A  NNNSARGFDVVDNIKTA+E ACP
Sbjct  122   ASLTRLFFHDCFVNGCDGSVLLDNS-STIDSEKGAFPNNNSARGFDVVDNIKTALETACP  180

Query  395   GVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKF  574
             G+VSCADILA+++E++VSL+GGPSW VLLGRRD TTAN+  AN +LP P   L  L   F
Sbjct  181   GIVSCADILAISAEASVSLSGGPSWTVLLGRRDSTTANRTAANEALPAPSFTLDELKASF  240

Query  575   TNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG  754
               VGL+  DLVALSGAHTFGRAQC+ F++RL++F++TG+PDPTLN+TYL TL  +CP+ G
Sbjct  241   AAVGLDTTDLVALSGAHTFGRAQCQFFSDRLYDFNSTGSPDPTLNSTYLETLSALCPESG  300

Query  755   SGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFF  934
             +GS + +LDP+T D FD +YFSNLQ + GLL+SDQELFSTSGA T+ IVN+FSANQ+AFF
Sbjct  301   NGSVLADLDPSTPDGFDADYFSNLQVHYGLLQSDQELFSTSGADTVDIVNSFSANQSAFF  360

Query  935   QSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             +SFV SM  MGNIS LTG+ GEIRLNC ++N
Sbjct  361   ESFVISMNKMGNISLLTGTDGEIRLNCSKVN  391



>gb|ACI03400.1| peroxidase 2 [Litchi chinensis]
Length=353

 Score =   408 bits (1048),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 219/310 (71%), Positives = 258/310 (83%), Gaps = 6/310 (2%)
 Frame = +2

Query  113   AQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNG  292
             AQLS TFY  TCPNVS I+S+V+QQA  +D RIGASL+RLHFHDCFVNGCDGS+LLDN+ 
Sbjct  27    AQLSPTFYDQTCPNVSGIISSVLQQAFVSDIRIGASLLRLHFHDCFVNGCDGSILLDNSA  86

Query  293   TTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWN  472
             T I SEK+AA NNNSARGF VVD++K A+E+ACPG+VSCADILA+A+E +V L+GGPSW+
Sbjct  87    T-IESEKEAAANNNSARGFSVVDSMKAALESACPGLVSCADILAVAAERSVFLSGGPSWS  145

Query  473   VLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-DLVALSGAHTFGRAQCR  649
             V LGRRD  TA++  AN ++P PFD L  L RKFTNVGLN N DLV+LSG HTFGRAQCR
Sbjct  146   VPLGRRDSLTASRALANLTIPGPFDSLEELKRKFTNVGLNNNTDLVSLSGGHTFGRAQCR  205

Query  650   TFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQ  829
             TF  RLFNF+NT +PDPTLNTTYLATLQQ+CPQGG+ S +T+LD TT+DTFD NYFSNL+
Sbjct  206   TFRPRLFNFNNTNSPDPTLNTTYLATLQQICPQGGNDSVLTDLDLTTTDTFDKNYFSNLE  265

Query  830   NNRGLLKSDQELFSTSG----AATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSG  997
             +  GLL+SDQELFST G      T  IV+NFS+NQTAFF+SFV SMI MGN+SPLTG+ G
Sbjct  266   SLNGLLQSDQELFSTPGNDTAPDTAPIVSNFSSNQTAFFESFVVSMIRMGNLSPLTGTDG  325

Query  998   EIRLNCRRLN  1027
             EIRLNC  +N
Sbjct  326   EIRLNCSVVN  335



>ref|XP_007205439.1| hypothetical protein PRUPE_ppa007826mg [Prunus persica]
 gb|EMJ06638.1| hypothetical protein PRUPE_ppa007826mg [Prunus persica]
Length=354

 Score =   408 bits (1048),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 206/306 (67%), Positives = 247/306 (81%), Gaps = 1/306 (0%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
              AQLS TFY   CPN +SIV  VI++ALQ D RI ASL RL FHDCFVNGCDGS+LLDN+
Sbjct  36    EAQLSPTFYDKDCPNATSIVRAVIEEALQTDLRIAASLTRLFFHDCFVNGCDGSILLDNS  95

Query  290   GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSW  469
              +TI SEK A  NNNSARGFDVVDNIKTA+E ACPG+VSCADILA+++E +VSL+GGPSW
Sbjct  96    -STIDSEKGALPNNNSARGFDVVDNIKTALETACPGIVSCADILAISAEESVSLSGGPSW  154

Query  470   NVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCR  649
              VLLGRRD TTAN+  AN +LP P   L  L   F  VGL+  DLVALSGAHTFGRAQC+
Sbjct  155   TVLLGRRDSTTANRTAANEALPAPSFTLDELKASFAAVGLDTTDLVALSGAHTFGRAQCQ  214

Query  650   TFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQ  829
              F++RL+ F++TG+PDPTLN+TYL TL  +CPQ G+GS + +LDP+T D FD +YFSNLQ
Sbjct  215   FFSDRLYAFNSTGSPDPTLNSTYLETLSALCPQSGNGSVLADLDPSTPDGFDADYFSNLQ  274

Query  830   NNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
              + GLL+SDQELFSTSGA T+ I+N++SANQ+AFF+SFV SM  MGNIS LTG+ GEIRL
Sbjct  275   VHYGLLQSDQELFSTSGADTVDIINSYSANQSAFFESFVISMNKMGNISLLTGTDGEIRL  334

Query  1010  NCRRLN  1027
             NC ++N
Sbjct  335   NCSKVN  340



>ref|XP_008229447.1| PREDICTED: peroxidase A2-like [Prunus mume]
Length=345

 Score =   407 bits (1045),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 209/327 (64%), Positives = 258/327 (79%), Gaps = 7/327 (2%)
 Frame = +2

Query  56    FSAL---LAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLI  226
             FS L   L + +        SNAQLSSTFY+TTCPNV+S+V  V++QA QND RIGA LI
Sbjct  23    FSCLNKTLPIILVTICVLGNSNAQLSSTFYTTTCPNVTSVVRGVVEQAQQNDIRIGAKLI  82

Query  227   RLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVS  406
             ++HFHDCFVNGCDGS++LDN    I SEKDA + N S  G+DVVD+IKTA+EN CPGVV+
Sbjct  83    QVHFHDCFVNGCDGSIMLDN-ADGIESEKDA-RPNQSTDGYDVVDDIKTALENVCPGVVT  140

Query  407   CADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVG  586
             CADILA+AS+  VS  GGP+W V LGRRD  TAN+ G  T++P+PF++L  +T+KF++VG
Sbjct  141   CADILAIASQILVSANGGPTWEVQLGRRDSRTANRAGT-TAIPSPFENLEQITKKFSDVG  199

Query  587   LNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGST  766
             L+  DLVALSGAHTFGRA+C TF +RL+NFS TG PDPT++ TYL TL+Q+CP GG+G T
Sbjct  200   LDSTDLVALSGAHTFGRARCVTFVHRLYNFSGTGKPDPTIDATYLETLRQICPNGGNGGT  259

Query  767   VTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFV  946
             + +LD +T D FDNNYF+NLQN RGLL++DQELFSTSG  T+AIVN FS +Q+ FF SF 
Sbjct  260   LADLDQSTRDEFDNNYFTNLQNKRGLLQTDQELFSTSG-DTVAIVNRFSNSQSDFFDSFG  318

Query  947   QSMINMGNISPLTGSSGEIRLNCRRLN  1027
             QSMINMGNI PLTGS GEIR +C R+N
Sbjct  319   QSMINMGNIRPLTGSDGEIRSDCTRVN  345



>ref|XP_011037955.1| PREDICTED: peroxidase A2-like [Populus euphratica]
Length=343

 Score =   406 bits (1043),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 211/306 (69%), Positives = 245/306 (80%), Gaps = 3/306 (1%)
 Frame = +2

Query  116   QLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNGT  295
             QL+ TFY  TCPNVSSI+  VI + L +D RIGASLIRLHFHDCFVNGCDGSLLLDN  T
Sbjct  25    QLTPTFYDQTCPNVSSIIRDVITETLVSDPRIGASLIRLHFHDCFVNGCDGSLLLDNTDT  84

Query  296   TIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNV  475
              IVSEK A  NN SARGF+VVD +K  +E+ACP  VSCADIL +A+E +V LAGGP+W V
Sbjct  85    -IVSEKQANGNNESARGFEVVDRMKALLESACPATVSCADILTIAAEESVVLAGGPNWTV  143

Query  476   LLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-DLVALSGAHTFGRAQCRT  652
              LGRRD TTA++  AN  LP PF  L  L   FTNV LN N DLVALSGAHTFGRA+C T
Sbjct  144   PLGRRDSTTASRDAANAFLPAPFFTLDQLRESFTNVSLNNNTDLVALSGAHTFGRAKCST  203

Query  653   FNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQN  832
             F+ RLF+F+ TG PDP+L+TT LA LQ++CPQGG+GS +T+LD TT D FD+NY+SNLQ 
Sbjct  204   FDFRLFDFNGTGAPDPSLDTTLLAALQELCPQGGNGSVITDLDLTTPDAFDSNYYSNLQG  263

Query  833   NRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
             NRGLL++DQELFST GA   IA+VN FSANQTAFF+SFV+SMI MGN+SPLTGS GEIRL
Sbjct  264   NRGLLQTDQELFSTPGADDVIALVNAFSANQTAFFESFVESMIRMGNLSPLTGSEGEIRL  323

Query  1010  NCRRLN  1027
             NCR +N
Sbjct  324   NCRVVN  329



>dbj|BAF33315.1| peroxidase [Populus alba]
Length=337

 Score =   405 bits (1040),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 211/324 (65%), Positives = 249/324 (77%), Gaps = 7/324 (2%)
 Frame = +2

Query  74    MAVAIFIFF----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFH  241
             M VA+F  F      +  QL+ TFY  TCP V SI+  VI + L  D RIGASLIRLHFH
Sbjct  1     MVVALFYAFLVGGPLAYGQLTPTFYDETCPYVISIIRGVIAETLILDPRIGASLIRLHFH  60

Query  242   DCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIl  421
             DCFVNGCDGS+LLD   T I +EK+A  NNNSARGFDVVD +K  +E  CPG VSCADIL
Sbjct  61    DCFVNGCDGSILLDKTAT-IDTEKEAFANNNSARGFDVVDIMKERLEGVCPGTVSCADIL  119

Query  422   alasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-  598
              +A+E +V LAGGP W + LGRRD  TAN+  AN  +P P D L  L  +FT VGLN N 
Sbjct  120   VIAAEESVVLAGGPWWPIPLGRRDSLTANRTAANAFIPGPRDTLERLRSRFTVVGLNNNT  179

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNL  778
             DLVALSGAHTFGRAQCRTF +RL+NF++TG PDPTL+TTYLATLQQ+CPQGG+G+ + +L
Sbjct  180   DLVALSGAHTFGRAQCRTFIDRLYNFNSTGLPDPTLDTTYLATLQQLCPQGGNGTVLADL  239

Query  779   DPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSM  955
             DPTT D FDNNYFSNLQ N+GLL+SDQELFST GA   I +V+ FS ++TAFF+SFV+SM
Sbjct  240   DPTTPDGFDNNYFSNLQANKGLLQSDQELFSTPGADDIIELVDIFSTDETAFFESFVESM  299

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             I MGN+SPLTG+ GEIRLNCR +N
Sbjct  300   IRMGNLSPLTGTEGEIRLNCRAVN  323



>ref|XP_008352115.1| PREDICTED: peroxidase A2-like [Malus domestica]
Length=354

 Score =   405 bits (1041),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 210/309 (68%), Positives = 247/309 (80%), Gaps = 3/309 (1%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
             +AQL+ TFY  +CPN +SIV  VIQ+ALQ D RI ASLIRLHFHDCFVNGCDGS+LLDN+
Sbjct  32    DAQLTPTFYDESCPNATSIVRGVIQEALQTDPRIAASLIRLHFHDCFVNGCDGSILLDNS  91

Query  290   GTT---IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGG  460
              ++   I SEK A  NNNSARGFDVVD+ KTA+ENACP +VSCADIL +A+E +V+L+GG
Sbjct  92    TSSTSTIDSEKTAFANNNSARGFDVVDSXKTALENACPAIVSCADILXIAAEESVALSGG  151

Query  461   PSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRA  640
             PSW VLLGRRD  TAN+  AN ++P P   L  L   F  VGLN  DLVALSGAHTFGRA
Sbjct  152   PSWTVLLGRRDSXTANRTAANAAIPAPTLTLDGLKANFLAVGLNTTDLVALSGAHTFGRA  211

Query  641   QCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFS  820
             +C++F NRL+NFS TG+PDPTLN+TYL TL ++CPQ G+ S + N DP T DTFD  YFS
Sbjct  212   RCQSFTNRLYNFSGTGSPDPTLNSTYLZTLSEICPQNGNSSVLXNXDPVTPDTFDAXYFS  271

Query  821   NLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGE  1000
             NLQ  +GLL+SDQELFSTSGA T   VNNFS NQ+AFF+SFV+SMI MGNISPLTG+ GE
Sbjct  272   NLQVQKGLLQSDQELFSTSGADTXDXVNNFSTNQSAFFESFVESMIKMGNISPLTGTDGE  331

Query  1001  IRLNCRRLN  1027
             IRLNCRR+N
Sbjct  332   IRLNCRRVN  340



>ref|XP_002299141.2| hypothetical protein POPTR_0001s04820g [Populus trichocarpa]
 gb|EEE83946.2| hypothetical protein POPTR_0001s04820g [Populus trichocarpa]
Length=343

 Score =   405 bits (1040),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 212/323 (66%), Positives = 252/323 (78%), Gaps = 8/323 (2%)
 Frame = +2

Query  80    VAIFIFF-----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             VA F F      + ++ QL+ TFY  TCPNVSSI+  VI + L +D RI ASLIRLHFHD
Sbjct  8     VATFFFVVLLGGTLAHGQLTPTFYDQTCPNVSSIIRNVITETLVSDPRIAASLIRLHFHD  67

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLDN  T IVSEK+A  NNNSARGF+VVD +K  +E+ACP  VSCADIL 
Sbjct  68    CFVNGCDGSLLLDNTDT-IVSEKEAGGNNNSARGFEVVDTMKALLESACPATVSCADILT  126

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-D  601
             +A+E +V LAGGP+W V LGRRD TTA++  AN  LP P   L  L   FTNV LN N D
Sbjct  127   IAAEESVVLAGGPNWTVPLGRRDSTTASRDAANAFLPAPSLTLDQLRESFTNVSLNNNSD  186

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRA+C TF+ RLF+F+ TG PDP+++TT LA LQ++CPQGG+GS +T+LD
Sbjct  187   LVALSGAHTFGRAKCSTFDFRLFDFNRTGAPDPSMDTTLLAALQELCPQGGNGSVITDLD  246

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMI  958
              TT D FD+NY+SNLQ NRGLL++DQELFST GA   IA+VN FSANQTAFF+SFV+SMI
Sbjct  247   LTTPDAFDSNYYSNLQGNRGLLQTDQELFSTPGADDVIALVNAFSANQTAFFESFVESMI  306

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
              MGN+SPLTG+ GEIRLNCR +N
Sbjct  307   RMGNLSPLTGTEGEIRLNCRVVN  329



>emb|CAA66034.1| peroxidase [Populus trichocarpa]
Length=343

 Score =   404 bits (1038),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 213/323 (66%), Positives = 251/323 (78%), Gaps = 8/323 (2%)
 Frame = +2

Query  80    VAIFIFF-----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             VA F F      + ++ QL+ TFY  TCPNVSSI+  VI + L  D RIG SLIRLHFHD
Sbjct  8     VAAFFFVVLLGGTLAHGQLTPTFYDQTCPNVSSIIRNVITETLVCDRRIGGSLIRLHFHD  67

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLDN  T I SEK+AA NNNSARGF+VVD +K  +E+ACP  VSCADIL 
Sbjct  68    CFVNGCDGSLLLDNTDT-IESEKEAAGNNNSARGFEVVDRMKALLESACPATVSCADILT  126

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-D  601
             +A+E +V LAGGP+W V LGRRD TTA++  AN SLP PF  L  L   FTNVGLN N D
Sbjct  127   IAAEESVVLAGGPNWTVPLGRRDSTTASRAAANASLPAPFLTLDQLRESFTNVGLNNNTD  186

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRA+C TFN RL++F+ TG PDPTL+  +LA LQ++CPQGG+ S +T+LD
Sbjct  187   LVALSGAHTFGRAKCSTFNFRLYDFNGTGAPDPTLDPPFLAALQELCPQGGNDSVITDLD  246

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMI  958
              TT D FD+NY+SNLQ NRGLL++DQELFST GA   IA+VN FSANQTAFF+SFV+SMI
Sbjct  247   LTTPDAFDSNYYSNLQCNRGLLQTDQELFSTPGADDVIALVNAFSANQTAFFESFVESMI  306

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
              MGN+SPLTG+ GEIRLNC  +N
Sbjct  307   RMGNLSPLTGTEGEIRLNCSVVN  329



>ref|XP_008227874.1| PREDICTED: peroxidase A2-like isoform X1 [Prunus mume]
Length=446

 Score =   406 bits (1044),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 207/306 (68%), Positives = 248/306 (81%), Gaps = 1/306 (0%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
              AQLS TFY   CPN +SIV  VI +ALQ D RI ASL RL FHDCFVNGCDGS+LLDN+
Sbjct  128   EAQLSPTFYEEDCPNATSIVRAVIGEALQTDLRIAASLTRLFFHDCFVNGCDGSVLLDNS  187

Query  290   GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSW  469
              +TI SEK A  NNNSARGFDVVDNIKTA+E ACPG+VSCADILA+++E++VSL+GGPSW
Sbjct  188   -STIDSEKGAFPNNNSARGFDVVDNIKTALETACPGIVSCADILAISAEASVSLSGGPSW  246

Query  470   NVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCR  649
              VLLGRRD TTAN+  AN +LP P   L  L   F  VGL+  DLVALSGAHTFGRAQC+
Sbjct  247   TVLLGRRDSTTANRTAANEALPAPSFTLDELKASFAAVGLDTTDLVALSGAHTFGRAQCQ  306

Query  650   TFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQ  829
              F++RL++F++TG+PDPTLN+TYL TL  +CP+ G+GS + +LDP+T D FD +YFSNLQ
Sbjct  307   FFSDRLYDFNSTGSPDPTLNSTYLETLSALCPESGNGSVLADLDPSTPDGFDADYFSNLQ  366

Query  830   NNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
              + GLL+SDQELFSTSGA T+ IVN+FSANQ+AFF+SFV SM  MGNIS LTG+ GEIRL
Sbjct  367   VHYGLLQSDQELFSTSGADTVDIVNSFSANQSAFFESFVISMNKMGNISLLTGTDGEIRL  426

Query  1010  NCRRLN  1027
             NC ++N
Sbjct  427   NCSKVN  432



>ref|XP_002299144.2| hypothetical protein POPTR_0001s04850g [Populus trichocarpa]
 gb|EEE83949.2| hypothetical protein POPTR_0001s04850g [Populus trichocarpa]
Length=343

 Score =   402 bits (1034),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 206/306 (67%), Positives = 247/306 (81%), Gaps = 3/306 (1%)
 Frame = +2

Query  116   QLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNGT  295
             QL+ TFY  TCPNVSSI+  VI + L +D RIGASLIRLHFHDCFVNGCDGSLLLDN  T
Sbjct  25    QLTPTFYDQTCPNVSSIIRDVITETLVSDPRIGASLIRLHFHDCFVNGCDGSLLLDNTDT  84

Query  296   TIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNV  475
              IVSEK+A  NNNSARGF+VVD +K  +E+ACP  VSCADIL +A+E +V LAGGP+W V
Sbjct  85    -IVSEKEAGGNNNSARGFEVVDTMKALLESACPATVSCADILTIAAEESVVLAGGPNWTV  143

Query  476   LLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-DLVALSGAHTFGRAQCRT  652
              LGRRD TTA++  AN  LP PF  L  L   FTNV LN N DLVALSGAHTFGRA+C T
Sbjct  144   PLGRRDSTTASRDAANAFLPAPFFTLDQLRESFTNVSLNNNSDLVALSGAHTFGRAKCST  203

Query  653   FNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQN  832
             F+ RL++F++TG PDP+L+TT LA LQ++CP+GG+GS +T+LD +T D FD++Y+SNLQ 
Sbjct  204   FDFRLYDFNSTGAPDPSLDTTLLAALQELCPEGGNGSVITDLDLSTPDAFDSDYYSNLQG  263

Query  833   NRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
             NRGLL++DQELFST GA   IA+VN FSANQTAFF+SFV+SMI MGN+SPLTG+ GEIRL
Sbjct  264   NRGLLQTDQELFSTPGADDVIALVNAFSANQTAFFESFVESMIRMGNLSPLTGTEGEIRL  323

Query  1010  NCRRLN  1027
             NC  +N
Sbjct  324   NCSVVN  329



>ref|XP_009766291.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
sylvestris]
Length=324

 Score =   402 bits (1032),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 205/326 (63%), Positives = 259/326 (79%), Gaps = 4/326 (1%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             SF   +   + +   F  SNA LS+TFY  TCPNV+SIV  V++Q  + DAR GA +IRL
Sbjct  2     SFFRFVGAILFLVAIFGASNAHLSATFYDCTCPNVTSIVRGVMEQRQRTDARAGAKIIRL  61

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFVNGCDGS+LLD +GT   +EKDA  N   A GFD+VD+IKTA+EN CPGVVSCA
Sbjct  62    HFHDCFVNGCDGSILLDTDGTQ--TEKDAIPNV-GAGGFDIVDDIKTALENVCPGVVSCA  118

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALASE  V+LAGGP W VL GRRD  TAN+ GAN+ +P+PF+ L+ +T +FTN G++
Sbjct  119   DILALASEIGVALAGGPCWQVLFGRRDSLTANRSGANSDIPSPFETLAVMTPQFTNKGMD  178

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG-SGSTV  769
             + DLVALSGAHTFGRA+C TF  RLFNFS +GNPDPT++ T+L TLQ +CPQGG +G+T 
Sbjct  179   LTDLVALSGAHTFGRARCGTFEQRLFNFSGSGNPDPTVDATFLQTLQGICPQGGNNGNTF  238

Query  770   TNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQ  949
             TNLD +T + FDN+YF+NLQNN+GLL++DQELFSTSG+ATIAIVN ++ +Q+ FF  F+ 
Sbjct  239   TNLDISTPNDFDNDYFTNLQNNQGLLQTDQELFSTSGSATIAIVNRYAGSQSQFFDDFIC  298

Query  950   SMINMGNISPLTGSSGEIRLNCRRLN  1027
             SMI +GNISPLTG++GEIR +C+R+N
Sbjct  299   SMIKLGNISPLTGTNGEIRKDCKRVN  324



>emb|CAA66035.1| peroxidase [Populus trichocarpa]
 gb|AHL39108.1| class III peroxidase [Populus trichocarpa]
Length=343

 Score =   402 bits (1033),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 206/306 (67%), Positives = 247/306 (81%), Gaps = 3/306 (1%)
 Frame = +2

Query  116   QLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNGT  295
             QL+ TFY  TCPNVSSI+  VI + L +D RIGASLIRLHFHDCFVNGCDGSLLLDN  T
Sbjct  25    QLTPTFYDQTCPNVSSIIRDVITETLVSDPRIGASLIRLHFHDCFVNGCDGSLLLDNTDT  84

Query  296   TIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNV  475
              IVSEK+A  NNNSARGF+VVD +K  +E+ACP  VSCADIL +A+E +V LAGGP+W V
Sbjct  85    -IVSEKEAGGNNNSARGFEVVDTMKALLESACPATVSCADILTIAAEESVVLAGGPNWTV  143

Query  476   LLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-DLVALSGAHTFGRAQCRT  652
              LGRRD TTA++  AN  LP PF  L  L   FTNV LN N DLVALSGAHTFGRA+C T
Sbjct  144   PLGRRDSTTASRDAANAFLPAPFFTLDQLRESFTNVSLNNNSDLVALSGAHTFGRAKCST  203

Query  653   FNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQN  832
             F+ RL++F++TG PDP+L+TT LA LQ++CP+GG+GS +T+LD +T D FD++Y+SNLQ 
Sbjct  204   FDFRLYDFNSTGAPDPSLDTTLLAALQELCPEGGNGSVITDLDLSTPDAFDSDYYSNLQG  263

Query  833   NRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
             NRGLL++DQELFST GA   IA+VN FSANQTAFF+SFV+SMI MGN+SPLTG+ GEIRL
Sbjct  264   NRGLLQTDQELFSTPGADDVIALVNAFSANQTAFFESFVESMIRMGNLSPLTGTEGEIRL  323

Query  1010  NCRRLN  1027
             NC  +N
Sbjct  324   NCSVVN  329



>ref|XP_008363339.1| PREDICTED: peroxidase A2-like [Malus domestica]
Length=351

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 209/309 (68%), Positives = 246/309 (80%), Gaps = 3/309 (1%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
             +AQL+ TFY  +CPN +SIV  VIQ+ALQ D RI ASLIRLHFHDCFVNGCDGS+LLDN+
Sbjct  29    DAQLTPTFYDASCPNATSIVRGVIQEALQTDPRIAASLIRLHFHDCFVNGCDGSILLDNS  88

Query  290   GTT---IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGG  460
              ++   I SEK A  NNNSARGFDVVD+ KTA+ENACP +VSCADIL +A+E +V+L+GG
Sbjct  89    TSSTSTIDSEKTAFANNNSARGFDVVDSXKTALENACPAIVSCADILXIAAEESVALSGG  148

Query  461   PSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRA  640
             PSW VLLGRRD  TAN+  AN ++P P   L  L   F  VGLN  DLVALSGAHTFGRA
Sbjct  149   PSWTVLLGRRDSXTANRTAANAAIPAPTLTLDGLKANFLAVGLNTTDLVALSGAHTFGRA  208

Query  641   QCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFS  820
             +C++F NRL+NFS TG+PDPTLN+TYL TL ++CPQ G+   + N DP T DTFD  YFS
Sbjct  209   RCQSFTNRLYNFSGTGSPDPTLNSTYLZTLSEICPQNGNSXVLXNXDPVTPDTFDAXYFS  268

Query  821   NLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGE  1000
             NLQ  +GLL+SDQELFSTSGA T   VNNFS NQ+AFF+SFV+SMI MGNISPLTG+ GE
Sbjct  269   NLQVQKGLLQSDQELFSTSGADTXDXVNNFSTNQSAFFESFVESMIKMGNISPLTGTDGE  328

Query  1001  IRLNCRRLN  1027
             IRLNCRR+N
Sbjct  329   IRLNCRRVN  337



>ref|XP_011037954.1| PREDICTED: peroxidase E5-like [Populus euphratica]
Length=341

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 210/323 (65%), Positives = 249/323 (77%), Gaps = 5/323 (2%)
 Frame = +2

Query  71    AMAVAIF--IFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             A+  A F  +    +  QL+ TFY  TCPNVSSI+  VI + L +D RIGASLIRLHFHD
Sbjct  6     AIVAAFFFVVLLRGTYGQLTPTFYDQTCPNVSSIIRDVITETLVSDPRIGASLIRLHFHD  65

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLDN  T IVSEK+A  NNNSARGF+VVD +K  +E+ACP  VSCADIL 
Sbjct  66    CFVNGCDGSLLLDNTDT-IVSEKEAGGNNNSARGFEVVDRMKALLESACPATVSCADILT  124

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-D  601
             +A+E +V LAGGP W V LGRRD TTA++  AN  LP PF  L  L   FTNV LN N D
Sbjct  125   IAAEESVVLAGGPYWTVPLGRRDSTTASRDAANAFLPAPFFTLDQLRESFTNVSLNNNTD  184

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRA+C TF+ RLF+F+ TG PDP+L+ T LA LQ++CPQGG+GS +T+LD
Sbjct  185   LVALSGAHTFGRAKCSTFDFRLFDFNGTGAPDPSLDPTLLADLQELCPQGGNGSVITDLD  244

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMI  958
              TT D FD+ Y+SNLQ N+GLL++DQELFST GA   I +VN FSAN+TAFF+SFV+SMI
Sbjct  245   LTTPDDFDSKYYSNLQGNQGLLQTDQELFSTPGADDVIELVNAFSANETAFFESFVESMI  304

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
              MGN+SPLTGS GEIRLNCR +N
Sbjct  305   RMGNLSPLTGSEGEIRLNCRVVN  327



>gb|AAL92037.1|AF488305_1 apoplastic anionic gaiacol peroxidase [Gossypium hirsutum]
Length=347

 Score =   402 bits (1032),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 213/337 (63%), Positives = 260/337 (77%), Gaps = 6/337 (2%)
 Frame = +2

Query  38    PKKMASFSALLA-MAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIG  214
             P+KMA F  ++A +  A+ +  S S AQL+ TFY  TCPNV++I+  V+  A  +D RIG
Sbjct  2     PEKMACFQYIVAALCFAVLLEGSLSKAQLTPTFYDETCPNVTAIIRHVLVNASFSDPRIG  61

Query  215   ASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACP  394
             ASLIRLHFHDCFV GCD S+LLD+    +  EK+A  NNNSARG++V+D +K A+E+ACP
Sbjct  62    ASLIRLHFHDCFVQGCDASILLDD---PVNGEKEAIPNNNSARGYEVIDAMKAALESACP  118

Query  395   GVVSCADIlalasesavsl-aGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRK  571
               VSCADILA+ASE +VS  AGGPSW V LGRRDG TAN+  AN++LP   + L  L  +
Sbjct  119   NTVSCADILAIASEQSVSTLAGGPSWAVPLGRRDGFTANRTLANSNLPGFNNTLDRLKNR  178

Query  572   FTNVGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQ  748
             F+NVGLN + DLVALSGAHTFGRAQC TF +RL+NF+  G+ DPTLN TYL  L+Q+CPQ
Sbjct  179   FSNVGLNTSIDLVALSGAHTFGRAQCLTFTSRLYNFTGVGDTDPTLNATYLEELRQICPQ  238

Query  749   GGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTA  928
             GG+ S +TNLDPTT D FDNNYF+NLQ NRGLL+SDQ LFST GA TI IVN FS+NQTA
Sbjct  239   GGNSSVLTNLDPTTPDGFDNNYFTNLQVNRGLLRSDQNLFSTEGADTIEIVNRFSSNQTA  298

Query  929   FFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN*AKL  1039
             FF+SFV+SMI MGNISPLTG+ GEIR NCR +N A +
Sbjct  299   FFESFVESMIRMGNISPLTGTEGEIRSNCRAVNSATI  335



>pdb|4CUO|A Chain A, Banyan Peroxidase With Glycosylation
Length=306

 Score =   400 bits (1027),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 217/304 (71%), Positives = 243/304 (80%), Gaps = 1/304 (0%)
 Frame = +2

Query  116   QLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNGT  295
             QL+ TFY +TCPNV+SIV  VIQ ALQ D RI ASLIRLHFHDCFVNGCDGSLLLDN+ T
Sbjct  1     QLTPTFYRSTCPNVTSIVRGVIQDALQTDLRIPASLIRLHFHDCFVNGCDGSLLLDNSDT  60

Query  296   TIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNV  475
              I SEK AA NNNSARGFDVVDNIKTAVENACPGVVSCADIL +A+E +V L+GGPSW V
Sbjct  61    -IESEKQAAPNNNSARGFDVVDNIKTAVENACPGVVSCADILTIAAEQSVWLSGGPSWPV  119

Query  476   LLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRTF  655
              LGRRD  TAN+  AN +LP+PF  L  L   F++ GLN  DLVALSGAHTFGRAQC+ F
Sbjct  120   PLGRRDSLTANRTLANQTLPSPFLTLDQLKTDFSDQGLNTTDLVALSGAHTFGRAQCQFF  179

Query  656   NNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQNN  835
             + RL+NFS TG+PDPTLNTT L TL+ +CPQGG+GST+TNLD TT D FDN YFSNLQ  
Sbjct  180   SQRLYNFSATGSPDPTLNTTLLETLRNICPQGGNGSTITNLDQTTPDAFDNKYFSNLQTQ  239

Query  836   RGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLNC  1015
              G+L++DQELFST GA T AIV  FSANQ+AFF SFV SMI MGNI  LT   GEIR NC
Sbjct  240   YGILQTDQELFSTKGANTTAIVTKFSANQSAFFNSFVASMIKMGNIGVLTXDEGEIRSNC  299

Query  1016  RRLN  1027
             R +N
Sbjct  300   RSVN  303



>ref|XP_002299152.2| hypothetical protein POPTR_0001s05050g [Populus trichocarpa]
 gb|EEE83957.2| hypothetical protein POPTR_0001s05050g [Populus trichocarpa]
Length=343

 Score =   401 bits (1031),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 211/323 (65%), Positives = 251/323 (78%), Gaps = 8/323 (2%)
 Frame = +2

Query  80    VAIFIFF-----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             VA F F      + ++ QL+ TFY  TCPNVSSI+  VI + + +D RIG SLIRLHFHD
Sbjct  8     VAAFFFVVLLGGTLAHGQLTPTFYDETCPNVSSIIRNVITETVVSDRRIGGSLIRLHFHD  67

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLDN  T I SEK+A  NNNSARGF+VVD +K  +E+ACP  VSCADILA
Sbjct  68    CFVNGCDGSLLLDNTDT-IESEKEANGNNNSARGFEVVDRMKALLESACPTTVSCADILA  126

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-D  601
             +A+E +V LAGGP+W V LGRRD TTA++  AN SLP PF  L  L   FTNVGLN N D
Sbjct  127   IAAEESVFLAGGPNWTVPLGRRDSTTASRDAANASLPAPFLTLDQLRESFTNVGLNNNTD  186

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRA+C TFN RL++F+ TG PDPTL+  +L  LQ++CP+ G+GS +T+LD
Sbjct  187   LVALSGAHTFGRAKCSTFNFRLYDFNGTGAPDPTLDPPFLEALQKLCPENGNGSVITDLD  246

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMI  958
              TT+D FDN Y+SNLQ  RGLL++DQELFST GA   IA+VN FSANQTAFF+SFV+SMI
Sbjct  247   VTTADAFDNKYYSNLQGKRGLLQTDQELFSTPGADDVIALVNAFSANQTAFFESFVESMI  306

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
              MGNISPLTG+ GEIRLNCR +N
Sbjct  307   RMGNISPLTGTEGEIRLNCRVVN  329



>ref|XP_006354190.1| PREDICTED: lignin-forming anionic peroxidase-like [Solanum tuberosum]
Length=324

 Score =   400 bits (1028),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 202/325 (62%), Positives = 250/325 (77%), Gaps = 5/325 (2%)
 Frame = +2

Query  62    ALLAMAVAIFIF---FSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             + L   V IF     F  SNAQLSSTFY+TTCPNV+ +V  V++Q  + D R GA +IRL
Sbjct  2     SFLRFIVPIFFLISIFVASNAQLSSTFYATTCPNVTEVVRGVMEQTQRTDVRAGAKIIRL  61

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFVNGCDGS+LLDN  T I+SEKDAA N   A GF++VD+IKTA+EN CPGVVSCA
Sbjct  62    HFHDCFVNGCDGSILLDN-ATGIISEKDAAANV-GAGGFEIVDDIKTALENVCPGVVSCA  119

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALASE  V+L GGP+W VLLGRRD  TAN+ G ++ +P+P + L  +  +FTN G++
Sbjct  120   DILALASEIGVALVGGPTWQVLLGRRDSLTANRTGVDSDIPSPVESLDVMRPQFTNKGMD  179

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
             + DLVALSGAHTFGRA+CRTF  RLFNF+ +G+PDPT+N+TYL TLQ  CPQG  G+T  
Sbjct  180   ITDLVALSGAHTFGRARCRTFQQRLFNFNGSGSPDPTINSTYLPTLQGTCPQGNDGNTFE  239

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             NLD TT D FDN+Y+ NLQN  GLL++DQELFSTSG+ TIAIVN ++ +QT FF  F  S
Sbjct  240   NLDKTTPDNFDNDYYINLQNQEGLLQTDQELFSTSGSDTIAIVNRYAGSQTQFFDDFASS  299

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MI +GNI  LTG++GEIR +C+R+N
Sbjct  300   MIKLGNIGALTGTNGEIRTDCKRVN  324



>dbj|BAA11852.1| peroxidase [Populus nigra]
Length=343

 Score =   400 bits (1028),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 208/306 (68%), Positives = 245/306 (80%), Gaps = 3/306 (1%)
 Frame = +2

Query  116   QLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNGT  295
             QL+ TFY  TCPNVSSI+  VI + L +D RIGASLIRLHFHDC VNGCDGSLLLDN  T
Sbjct  25    QLTPTFYDQTCPNVSSIIRDVITETLVSDPRIGASLIRLHFHDCLVNGCDGSLLLDNTDT  84

Query  296   TIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNV  475
              IVSEK+A  NNNSARGF+VVD +K  +E+ACP  VSCADIL +A+E +V LAGGP+W V
Sbjct  85    -IVSEKEAGGNNNSARGFEVVDRMKALLESACPATVSCADILTIAAEESVVLAGGPNWTV  143

Query  476   LLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-DLVALSGAHTFGRAQCRT  652
              LGRRD TTA++  AN  LP PF  L  L   FTNV LN N DLVALSGAHTFGRA+C T
Sbjct  144   PLGRRDSTTASRDAANAFLPAPFFTLDQLRESFTNVSLNNNTDLVALSGAHTFGRAKCST  203

Query  653   FNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQN  832
             F+ RLF+F++TG PD +LNTT LA LQ++CPQGG+GS +T+LD TT D FD+NY+SNLQ 
Sbjct  204   FDFRLFDFNSTGAPDQSLNTTLLADLQELCPQGGNGSVITDLDLTTPDAFDSNYYSNLQG  263

Query  833   NRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
             N+GLL++DQELFST GA   IA+VN FSANQTAFF+SF +SMI MGN+SPLTG+ GEIRL
Sbjct  264   NQGLLQTDQELFSTPGADDVIALVNAFSANQTAFFESFAESMIRMGNLSPLTGTEGEIRL  323

Query  1010  NCRRLN  1027
             NCR +N
Sbjct  324   NCRVVN  329



>ref|XP_002304884.1| hypothetical protein POPTR_0003s21610g [Populus trichocarpa]
 gb|EEE79863.1| hypothetical protein POPTR_0003s21610g [Populus trichocarpa]
Length=343

 Score =   400 bits (1028),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 213/324 (66%), Positives = 249/324 (77%), Gaps = 7/324 (2%)
 Frame = +2

Query  74    MAVAIFIFF----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFH  241
             M VA+F  F      +  QL+ TFY  TCP+V SI+  VI + L  D RIGASLIRLHFH
Sbjct  7     MVVALFYAFLVGGPLAYGQLTPTFYDDTCPSVVSIIRGVIAETLIFDRRIGASLIRLHFH  66

Query  242   DCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIl  421
             DCFVNGCDGS+LLD   T I +EK+A  NNNSARGFDVVD +K  +E  CP  VSCADIL
Sbjct  67    DCFVNGCDGSILLDKTAT-IDTEKEAFANNNSARGFDVVDIMKERLEGVCPDTVSCADIL  125

Query  422   alasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-  598
             A+A+E +V LAGGP W V LGRRD  TAN+  AN  +P P D L  L  +FT VGLN N 
Sbjct  126   AIAAEESVVLAGGPWWPVPLGRRDSLTANRTAANAFIPGPRDTLERLRSRFTVVGLNNNT  185

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNL  778
             DLVALSGAHTFGRAQCRTF +RL+NF+NTG PDPTL+TT LATLQQ+CPQGG+G+ + +L
Sbjct  186   DLVALSGAHTFGRAQCRTFIDRLYNFNNTGLPDPTLDTTSLATLQQLCPQGGNGTVLADL  245

Query  779   DPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSM  955
             DPTT D FDNNYFSNLQ N+GLL+SDQELFST GA   I +VN FS ++TAFF+SFV+SM
Sbjct  246   DPTTPDGFDNNYFSNLQANKGLLQSDQELFSTPGADDIIELVNIFSNDETAFFESFVESM  305

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             I MGN+SPLTG+ GEIRLNCR +N
Sbjct  306   IRMGNLSPLTGTEGEIRLNCRVVN  329



>gb|AHL39125.1| class III peroxidase [Populus trichocarpa]
Length=343

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 213/324 (66%), Positives = 249/324 (77%), Gaps = 7/324 (2%)
 Frame = +2

Query  74    MAVAIFIFF----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFH  241
             M VA+F  F      +  QL+ TFY  TCP+V SI+  VI + L  D RIGASLIRLHFH
Sbjct  7     MVVALFYAFLVGGPLAYGQLTPTFYDDTCPSVVSIIRGVIAETLIFDRRIGASLIRLHFH  66

Query  242   DCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIl  421
             DCFVNGCDGS+LLD   T I +EK+A  NNNSARGFDVVD +K  +E  CP  VSCADIL
Sbjct  67    DCFVNGCDGSILLDKTAT-IDTEKEAFANNNSARGFDVVDIMKERLEGVCPDTVSCADIL  125

Query  422   alasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-  598
             A+A+E +V LAGGP W V LGRRD  TAN+  AN  +P P D L  L  +FT VGLN N 
Sbjct  126   AIAAEESVVLAGGPWWPVPLGRRDSLTANRTAANAFIPGPRDTLERLRSRFTVVGLNNNT  185

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNL  778
             DLVALSGAHTFGRAQCRTF +RL+NF+NTG PDPTL+TT LATLQQ+CPQGG+G+ + +L
Sbjct  186   DLVALSGAHTFGRAQCRTFIDRLYNFNNTGLPDPTLDTTSLATLQQLCPQGGNGTVLADL  245

Query  779   DPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIA-IVNNFSANQTAFFQSFVQSM  955
             DPTT D FDNNYFSNLQ N+GLL+SDQELFST GA  I  +VN FS ++TAFF+SFV+SM
Sbjct  246   DPTTPDGFDNNYFSNLQANKGLLQSDQELFSTPGADDIVELVNIFSNDETAFFESFVESM  305

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             I MGN+SPLTG+ GEIRLNCR +N
Sbjct  306   IRMGNLSPLTGTEGEIRLNCRVVN  329



>ref|XP_008352125.1| PREDICTED: peroxidase A2-like [Malus domestica]
Length=351

 Score =   400 bits (1028),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 208/309 (67%), Positives = 245/309 (79%), Gaps = 3/309 (1%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
             +AQL+ TFY  +CPN +SIV  VIQ+ALQ D RI ASL RLHFHDCFVNGCDGS+LLDN+
Sbjct  29    DAQLTPTFYDXSCPNATSIVRGVIQEALQTDPRIAASLXRLHFHDCFVNGCDGSILLDNS  88

Query  290   GTT---IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGG  460
              ++   I SEK A  NNNSARGFDVVD+ KTA+ENACP +VSCADIL +A+E +V+L+GG
Sbjct  89    TSSTSTIDSEKTAFANNNSARGFDVVDSXKTALENACPAIVSCADILXIAAEESVALSGG  148

Query  461   PSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRA  640
             PSW VLLGRRD  TAN+  AN ++P P   L  L   F  VGLN  DLVALSGAHTFGRA
Sbjct  149   PSWTVLLGRRDSXTANRTAANAAIPAPTLTLDGLKANFLAVGLNTTDLVALSGAHTFGRA  208

Query  641   QCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFS  820
             +C++F NRL+NFS TG+PDPTLN+TYL TL ++CPQ G+   + N DP T DTFD  YFS
Sbjct  209   RCQSFTNRLYNFSGTGSPDPTLNSTYLZTLSEICPQNGNSXVLXNXDPVTPDTFDAXYFS  268

Query  821   NLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGE  1000
             NLQ  +GLL+SDQELFSTSGA T   VNNFS NQ+AFF+SFV+SMI MGNISPLTG+ GE
Sbjct  269   NLQVQKGLLQSDQELFSTSGADTXDXVNNFSTNQSAFFESFVESMIKMGNISPLTGTDGE  328

Query  1001  IRLNCRRLN  1027
             IRLNCRR+N
Sbjct  329   IRLNCRRVN  337



>ref|XP_007014789.1| Peroxidase superfamily protein, putative [Theobroma cacao]
 gb|EOY32408.1| Peroxidase superfamily protein, putative [Theobroma cacao]
Length=346

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 210/336 (63%), Positives = 256/336 (76%), Gaps = 5/336 (1%)
 Frame = +2

Query  38    PKKMASFSALLAMA-VAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIG  214
             P+KM  F  ++A+   A+ +  S SN QLS +FY  TCPN +SIV  V++ A  +D RIG
Sbjct  2     PEKMHCFQYIVALLFCAVLLEGSSSNGQLSPSFYDETCPNATSIVRQVLENAALSDPRIG  61

Query  215   ASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACP  394
             ASLIRLHFHDCFV GCD S+LLD+    +  EK+A  NNNSARGF+VVD +K A+E+ACP
Sbjct  62    ASLIRLHFHDCFVQGCDASILLDD---PVNGEKEARPNNNSARGFEVVDAMKAALESACP  118

Query  395   GVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKF  574
               VSCADILA+ASE +V LAGGPSW V LGRRDG TAN+  AN +LP  F+ L  +  KF
Sbjct  119   NTVSCADILAIASEESVCLAGGPSWAVPLGRRDGLTANRTLANANLPAFFEPLDIIKSKF  178

Query  575   TNVGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQG  751
               VGL+ + D+VALSG HTFGRAQC TF +RL+NF+  G+ DP LNTTYL  L+Q+CPQG
Sbjct  179   RVVGLDTSTDVVALSGGHTFGRAQCSTFTDRLYNFTGVGDTDPNLNTTYLEKLRQICPQG  238

Query  752   GSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAF  931
             G+GS + +LDPTT D FDNNYF+NLQ ++GLL+SDQELFST GA TI IVN FSANQTAF
Sbjct  239   GNGSVLADLDPTTPDGFDNNYFTNLQVHKGLLQSDQELFSTEGADTIEIVNRFSANQTAF  298

Query  932   FQSFVQSMINMGNISPLTGSSGEIRLNCRRLN*AKL  1039
             F+SFV+SMI MGNIS LTG+ GEIR NCR +N A +
Sbjct  299   FESFVESMIRMGNISLLTGTDGEIRSNCRVVNAATI  334



>ref|XP_006492676.1| PREDICTED: peroxidase C3-like isoform X3 [Citrus sinensis]
Length=349

 Score =   399 bits (1024),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 208/330 (63%), Positives = 251/330 (76%), Gaps = 4/330 (1%)
 Frame = +2

Query  47    MASFSALLAMA--VAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGAS  220
             MAS   LLA A  VA  +  S S AQLS +FYS+TCPNV +I+  V+++A  +D RIGAS
Sbjct  1     MASLRYLLAAALVVAFVLEGSPSQAQLSPSFYSSTCPNVLNIIEDVLKKAFSSDIRIGAS  60

Query  221   LIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGV  400
             LIRLHFHDCFV+GCD S+LLD+   TI SEK AA NNNSARGF+V+DN+K AVE AC  V
Sbjct  61    LIRLHFHDCFVDGCDASILLDST-NTIDSEKFAAPNNNSARGFEVIDNMKAAVEKACRRV  119

Query  401   VSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTN  580
             VSCADIL +A+E +V+L+GGPSW V LGRRD  TAN+  AN +LP P + L  L   F N
Sbjct  120   VSCADILTIAAERSVALSGGPSWAVPLGRRDSRTANRALANQNLPGPSNSLDELKSSFRN  179

Query  581   VGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGS  757
             VGLN   DLVALSGAHTFGRAQC+ F  RL++F+NTG PDPTL+ T+L  L+++CPQGG+
Sbjct  180   VGLNDKFDLVALSGAHTFGRAQCQFFRGRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGN  239

Query  758   GSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQ  937
             G  + N D TT D FDN YFSNL+  +GLL+SDQELFST GA T AIV +F  NQ AFF+
Sbjct  240   GGVLANFDVTTPDVFDNKYFSNLRGRKGLLQSDQELFSTPGADTAAIVEDFGRNQNAFFK  299

Query  938   SFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             +FV SMI MGN+ PLTG+ GEIRLNCRR+N
Sbjct  300   NFVTSMIRMGNLKPLTGNQGEIRLNCRRVN  329



>ref|XP_008344683.1| PREDICTED: peroxidase A2-like [Malus domestica]
Length=354

 Score =   399 bits (1024),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 209/309 (68%), Positives = 245/309 (79%), Gaps = 3/309 (1%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
             +AQL+ TFY  +CPN +SIV          D RI ASL RLHFHDCFVNGCDGS+LLDN+
Sbjct  32    DAQLTPTFYDESCPNATSIVRXXXXXXXXTDPRIAASLTRLHFHDCFVNGCDGSILLDNS  91

Query  290   GTT---IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGG  460
              ++   I SEK A  NNNSARGFDVVD+IKTA+ENACP +VSCADILA+A+E +V+L+GG
Sbjct  92    TSSTSTIDSEKTAFANNNSARGFDVVDSIKTALENACPAIVSCADILAIAAEESVALSGG  151

Query  461   PSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRA  640
             PSW VLLGRRD TTAN+  AN ++P P   L  L   F  VGLN  DLVALSGAHTFGRA
Sbjct  152   PSWTVLLGRRDSTTANRTAANAAIPAPTLTLDGLKANFLAVGLNTTDLVALSGAHTFGRA  211

Query  641   QCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFS  820
             +C++F NRL+NFS TG+PDPTLN+TYL TL ++CPQ G+ S +TN DP T DTFD NYFS
Sbjct  212   RCQSFTNRLYNFSGTGSPDPTLNSTYLETLSEICPQNGNSSVLTNFDPVTPDTFDANYFS  271

Query  821   NLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGE  1000
             NLQ  +GLL+SDQELFSTSGA T  IVNNFS NQ+AFF+SFV+SMI MGNISPLTG+ GE
Sbjct  272   NLQVQKGLLQSDQELFSTSGADTTDIVNNFSTNQSAFFESFVESMIKMGNISPLTGTDGE  331

Query  1001  IRLNCRRLN  1027
             IRLNCRR+N
Sbjct  332   IRLNCRRVN  340



>ref|XP_009404154.1| PREDICTED: peroxidase A2-like [Musa acuminata subsp. malaccensis]
Length=330

 Score =   397 bits (1021),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 207/323 (64%), Positives = 249/323 (77%), Gaps = 1/323 (0%)
 Frame = +2

Query  59    SALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHF  238
             S +LA+A  +      S+AQLS  FY +TCPNVS IV T++Q    +D R+ ASL+RLHF
Sbjct  7     SGVLAVATFMAFLLHGSHAQLSPAFYDSTCPNVSDIVQTIVQLVQSSDPRMPASLLRLHF  66

Query  239   HDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADI  418
             HDCFV+GCDGS+LLDN+ T IVSEKDA  N+NS RGFDV+D IK  VE  CPGVVSCADI
Sbjct  67    HDCFVDGCDGSVLLDNS-TAIVSEKDAPPNSNSLRGFDVIDAIKMTVEYVCPGVVSCADI  125

Query  419   lalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN  598
             LALA+E++VSL+GGPSW V LGRRDGTTAN  GANT+LP+PF+ L  L  KF  VGLN  
Sbjct  126   LALAAEASVSLSGGPSWTVQLGRRDGTTANLTGANTNLPSPFEPLDILKAKFAAVGLNDT  185

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNL  778
             DLV LSGAHTFGRA+C  F++RL+NF+ TG  DPTLNT+YL TLQ  CP GG+ +T+ NL
Sbjct  186   DLVTLSGAHTFGRARCGAFSDRLYNFNGTGIADPTLNTSYLTTLQANCPDGGNETTLNNL  245

Query  779   DPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMI  958
             D +T D FDN+Y+ NLQ+N GLL SDQ+L+STS     +IV  ++ NQTAFF+SF  SMI
Sbjct  246   DLSTPDAFDNSYYLNLQSNEGLLASDQQLYSTSNDPIASIVGIYAGNQTAFFESFALSMI  305

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
             NMGNISPLTGS GEIR NCR +N
Sbjct  306   NMGNISPLTGSDGEIRSNCRLVN  328



>ref|XP_009763841.1| PREDICTED: lignin-forming anionic peroxidase [Nicotiana sylvestris]
Length=324

 Score =   397 bits (1019),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 204/326 (63%), Positives = 257/326 (79%), Gaps = 4/326 (1%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             SF   +   + +   F  SNAQLS+TFY TTCPNV+SIV  V+ Q  + DAR GA +IRL
Sbjct  2     SFLRFVGAILFLVAIFGASNAQLSATFYDTTCPNVTSIVRGVMDQRQRTDARAGAKIIRL  61

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFVNGCDGS+LLD +GT   +EKDA  N   A GFD+VD+IKTA+EN CPGVVSCA
Sbjct  62    HFHDCFVNGCDGSILLDTDGTQ--TEKDAPANV-GAGGFDIVDDIKTALENVCPGVVSCA  118

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALASE  V LA GPSW VL GR+D  TAN+ GAN+ +P+PF+ L+ +  +FTN G++
Sbjct  119   DILALASEIGVVLAKGPSWQVLFGRKDSLTANRSGANSDIPSPFETLAVMIPQFTNKGMD  178

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG-SGSTV  769
             + DLVALSGAHTFGRA+C TF  RLFNF+ +GNPD T++ T+L TLQ +CPQGG +G+T 
Sbjct  179   LTDLVALSGAHTFGRARCGTFEQRLFNFNGSGNPDLTVDATFLQTLQGICPQGGNNGNTF  238

Query  770   TNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQ  949
             TNLD +T + FDN+YF+NLQ+N+GLL++DQELFSTSG+ATIAIVN ++ NQT FF  FV 
Sbjct  239   TNLDISTPNDFDNDYFTNLQSNQGLLQTDQELFSTSGSATIAIVNRYAGNQTQFFDDFVS  298

Query  950   SMINMGNISPLTGSSGEIRLNCRRLN  1027
             SMI +GNISPLTG++G+IR +C+R+N
Sbjct  299   SMIKLGNISPLTGTNGQIRTDCKRVN  324



>ref|XP_004295156.1| PREDICTED: peroxidase 15-like [Fragaria vesca subsp. vesca]
Length=324

 Score =   397 bits (1019),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 203/330 (62%), Positives = 256/330 (78%), Gaps = 9/330 (3%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIF---FSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGA  217
             M+ FS     AVAIF+F      SNAQLSSTFY TTCPN+SS+V  V++QA +ND RI A
Sbjct  1     MSPFSY---HAVAIFLFAIVLGNSNAQLSSTFYDTTCPNISSVVRNVVEQAQENDIRIAA  57

Query  218   SLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPG  397
              LIR+HFHDCFVNGCD SLLLD+    I SEK+ A N  S  G+ V+D+IKTA+EN CPG
Sbjct  58    KLIRVHFHDCFVNGCDASLLLDD-ADGIDSEKNGAPNL-STDGYAVIDDIKTALENVCPG  115

Query  398   VVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFT  577
             VVSCADI+ALAS+  VS  GGP+W V LGRRD  TAN+ G  T++P+PF+ L  + +KFT
Sbjct  116   VVSCADIVALASQILVSENGGPTWEVQLGRRDSRTANRAGT-TAIPSPFETLEQIAQKFT  174

Query  578   NVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGS  757
             + GL+  DLVALSGAHTFGRA+C TF +RL++F+ TG+PDP+++TTYL TLQQ CP GG 
Sbjct  175   DAGLDSTDLVALSGAHTFGRARCSTFVHRLYDFNGTGSPDPSIDTTYLGTLQQTCPNGGD  234

Query  758   GSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQ  937
             G T+ NLDPTT + FD NYF+NLQN +GLL++DQELFSTSGA T++IV+ F+ +++ FF 
Sbjct  235   GGTLANLDPTTPNGFDKNYFTNLQNKQGLLQTDQELFSTSGADTVSIVDRFANSESDFFD  294

Query  938   SFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             SF +SMI+MGNI  LTGS GEIR +C+R+N
Sbjct  295   SFAKSMISMGNIKVLTGSDGEIRTDCKRVN  324



>ref|XP_006492674.1| PREDICTED: peroxidase C3-like isoform X1 [Citrus sinensis]
Length=349

 Score =   397 bits (1021),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 201/310 (65%), Positives = 242/310 (78%), Gaps = 2/310 (1%)
 Frame = +2

Query  101   SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLL  280
             S S AQLS +FYS+TCPNV + +  V+++A  +D RIGASLIRLHFHDCFV+GCD S+LL
Sbjct  21    SPSQAQLSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASILL  80

Query  281   DNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGG  460
             D+   TI SEK AA NNNSARGF+V+DN+K AVE ACP VVSCADIL +A+E +V+L+GG
Sbjct  81    DST-NTIDSEKFAAPNNNSARGFEVIDNMKAAVEKACPRVVSCADILTIAAERSVALSGG  139

Query  461   PSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-DLVALSGAHTFGR  637
             PSW V LGRRD  TAN+  AN +LP PFD L  L   F NVGLN   DLVALSGAHTFGR
Sbjct  140   PSWAVPLGRRDSRTANRALANQNLPGPFDTLDELKSSFRNVGLNDKLDLVALSGAHTFGR  199

Query  638   AQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYF  817
             AQC+ F  RL++F+NTG PDPTL+ T+L  L+++CPQGG+G  + N D TT D FDN YF
Sbjct  200   AQCQFFRGRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGNGGVLANFDVTTPDVFDNKYF  259

Query  818   SNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSG  997
             SNL+  +GLL+SDQELFST GA T AIV +F  NQ AFF++FV SMI MGN+ PLTG+ G
Sbjct  260   SNLRGRKGLLQSDQELFSTPGADTAAIVEDFGRNQNAFFKNFVTSMIRMGNLKPLTGNQG  319

Query  998   EIRLNCRRLN  1027
             EIRLNCRR+N
Sbjct  320   EIRLNCRRVN  329



>gb|KDO62916.1| hypothetical protein CISIN_1g018871mg [Citrus sinensis]
Length=349

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 201/310 (65%), Positives = 242/310 (78%), Gaps = 2/310 (1%)
 Frame = +2

Query  101   SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLL  280
             S S AQLS +FYS+TCPNV + +  V+++A  +D RIGASLIRLHFHDCFV+GCD S+LL
Sbjct  21    SPSQAQLSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASILL  80

Query  281   DNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGG  460
             D+   TI SEK AA NNNSARGF+V+DN+K AVE ACP VVSCADIL +A+E +V+L+GG
Sbjct  81    DST-NTIDSEKFAAPNNNSARGFEVIDNMKAAVERACPRVVSCADILTIAAERSVALSGG  139

Query  461   PSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-DLVALSGAHTFGR  637
             PSW V LGRRD  TAN+  AN +LP PFD L  L   F NVGLN   DLVALSGAHTFGR
Sbjct  140   PSWAVPLGRRDSRTANRALANQNLPGPFDTLDELKSSFRNVGLNDKLDLVALSGAHTFGR  199

Query  638   AQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYF  817
             AQC+ F  RL++F+NTG PDPTL+ T+L  L+++CPQGG+G  + N D TT D FDN YF
Sbjct  200   AQCQFFRGRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGNGGVLANFDVTTPDVFDNKYF  259

Query  818   SNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSG  997
             SNL+  +GLL+SDQELFST GA T AIV +F  NQ AFF++FV SMI MGN+ PLTG+ G
Sbjct  260   SNLRGRKGLLQSDQELFSTPGADTAAIVEDFGRNQNAFFKNFVTSMIRMGNLKPLTGNQG  319

Query  998   EIRLNCRRLN  1027
             EIRLNCRR+N
Sbjct  320   EIRLNCRRVN  329



>pir||S60055 peroxidase (EC 1.11.1.7) A4a precursor - Japanese aspen x large-toothed 
aspen
 dbj|BAA07241.1| peroxidase [Populus sieboldii x Populus grandidentata]
Length=343

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 208/324 (64%), Positives = 247/324 (76%), Gaps = 7/324 (2%)
 Frame = +2

Query  74    MAVAIFIFF----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFH  241
             M VA+F  F      +  QL+ TFY  TCP V SI+  VI + L  D RIGASLIRLHFH
Sbjct  7     MVVALFYAFLVGGPLAYGQLTPTFYDETCPYVISIIRGVIAETLIFDPRIGASLIRLHFH  66

Query  242   DCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIl  421
             DCFVNGCDGS+LLD   T I +EK+A  NNNSARGFDVVD +K  +E  CP  VSCADIL
Sbjct  67    DCFVNGCDGSILLDKTAT-IDTEKEALANNNSARGFDVVDIMKERLEGVCPATVSCADIL  125

Query  422   alasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-  598
             A+A+E +V LAGGP W + LGRRD  TAN+  AN  +P P D L  L  +FT VGLN N 
Sbjct  126   AIAAEESVVLAGGPWWPIPLGRRDSLTANRTAANAFIPGPQDTLERLRSRFTVVGLNNNT  185

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNL  778
             DLVALSGAHTFGRAQCR F +RL+NF+NTG PDPTL+TTYLATLQ++CPQGG+G+ + +L
Sbjct  186   DLVALSGAHTFGRAQCRNFIDRLYNFNNTGLPDPTLDTTYLATLQRLCPQGGNGTVLADL  245

Query  779   DPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSM  955
             DPTT D FDNNYFSNLQ ++GLL+SDQELFST  A   I +V+ FS ++TAFF+SFV+SM
Sbjct  246   DPTTPDGFDNNYFSNLQASKGLLQSDQELFSTPEADDIIELVDIFSTDETAFFESFVESM  305

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             I MGN+SPLTG+ GEIRLNCR +N
Sbjct  306   IRMGNLSPLTGTEGEIRLNCRAVN  329



>ref|XP_009375114.1| PREDICTED: peroxidase A2-like [Pyrus x bretschneideri]
Length=324

 Score =   396 bits (1017),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 208/332 (63%), Positives = 257/332 (77%), Gaps = 13/332 (4%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQS-----NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARI  211
             M+SFS    +A AIF+  + S     NAQLSSTFYSTTCPNV+SIV  V++QA QND RI
Sbjct  1     MSSFS----IAAAIFVLVTASILGNSNAQLSSTFYSTTCPNVTSIVRGVVEQAQQNDIRI  56

Query  212   GASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENAC  391
             GA LIR+HFHDCFVNGCDGS++LDN    I SEKDA  N  S  G+DVVD+IKTAVEN C
Sbjct  57    GAKLIRVHFHDCFVNGCDGSIMLDN-ADGIESEKDAPPNQ-STDGYDVVDDIKTAVENVC  114

Query  392   PGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRK  571
             PGVVSC+DILA+AS+  VS  GGP+W   LGRRD  TANQ G  +++P+  ++L  +++K
Sbjct  115   PGVVSCSDILAIASQILVSANGGPTWEAQLGRRDSRTANQAGT-SAIPSFLENLEQISQK  173

Query  572   FTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQG  751
             F + GL+  DLVALSGAHTFGRA+C TF +RL+NF+ TGNPDPT+   YL TL+Q CPQ 
Sbjct  174   FGDAGLDSTDLVALSGAHTFGRARCSTFVHRLYNFNGTGNPDPTIEAGYLETLRQACPQN  233

Query  752   GSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAF  931
             GSG T+ +LD +T D FDN+YF+NLQNNRGLL++DQ LFSTSG  T+AIV+ F+ +Q+ F
Sbjct  234   GSGDTLNDLDQSTRDAFDNHYFTNLQNNRGLLQTDQVLFSTSG-DTVAIVDRFANSQSDF  292

Query  932   FQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             F SF QSMINMGNI  LTG++GEIR +CRR+N
Sbjct  293   FDSFGQSMINMGNIGVLTGTNGEIRTDCRRVN  324



>ref|XP_009364089.1| PREDICTED: peroxidase A2-like [Pyrus x bretschneideri]
Length=324

 Score =   396 bits (1017),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 210/328 (64%), Positives = 254/328 (77%), Gaps = 5/328 (2%)
 Frame = +2

Query  47    MASFSALLAMAVAIFI-FFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASL  223
             M+SFS   A+ V +F       NAQLSSTFYSTTCPNV+SIV  V++QA QND R+GA L
Sbjct  1     MSSFSIAGAIFVLVFTSVLGNVNAQLSSTFYSTTCPNVTSIVRGVVEQAQQNDIRLGAKL  60

Query  224   IRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVV  403
             IR+HFHDCFVNGCDGS++LDN    I SEKDA  N  S  G+DVVD+IKTA+EN CPGVV
Sbjct  61    IRVHFHDCFVNGCDGSIMLDN-ADGIDSEKDAGPNL-STDGYDVVDDIKTALENVCPGVV  118

Query  404   SCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNV  583
             SC+DILA+ASE  VS  GGP+W V LGRRD  TAN+ G  T++P   ++L  L++KF + 
Sbjct  119   SCSDILAIASEILVSANGGPTWEVQLGRRDSRTANRAGT-TAIPGFRENLDQLSQKFGDA  177

Query  584   GLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGS  763
             GL+  DLVALSGAHTFGRA+C TF +RL+NFS TGNPDPT+   YL TL+Q CPQ G+G 
Sbjct  178   GLDSTDLVALSGAHTFGRARCSTFGHRLYNFSGTGNPDPTMEAGYLETLRQTCPQNGNGD  237

Query  764   TVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSF  943
             T+ +LD +T D FDNNYF+NLQNNRGLL++DQ LFSTSG  T+AIVN F+ +Q+ FF SF
Sbjct  238   TLNDLDQSTRDAFDNNYFTNLQNNRGLLQTDQVLFSTSG-DTVAIVNRFANSQSDFFDSF  296

Query  944   VQSMINMGNISPLTGSSGEIRLNCRRLN  1027
              QSMINMGNI  LTG++GEIR NCRR+N
Sbjct  297   GQSMINMGNIGVLTGTNGEIRTNCRRVN  324



>sp|P11965.1|PERX_TOBAC RecName: Full=Lignin-forming anionic peroxidase; AltName: Full=TOPA; 
Flags: Precursor [Nicotiana tabacum]
 gb|AAA34108.1| lignin-forming peroxidase precursor (EC 1.11.1.7) [Nicotiana 
tabacum]
 prf||1313381A lignin-forming peroxidase
Length=324

 Score =   395 bits (1016),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 203/326 (62%), Positives = 257/326 (79%), Gaps = 4/326 (1%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             SF   +   + +   F  SNAQLS+TFY TTCPNV+SIV  V+ Q  + DAR GA +IRL
Sbjct  2     SFLRFVGAILFLVAIFGASNAQLSATFYDTTCPNVTSIVRGVMDQRQRTDARAGAKIIRL  61

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFVNGCDGS+LLD +GT   +EKDA  N   A GFD+VD+IKTA+EN CPGVVSCA
Sbjct  62    HFHDCFVNGCDGSILLDTDGTQ--TEKDAPANV-GAGGFDIVDDIKTALENVCPGVVSCA  118

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALASE  V LA GPSW VL GR+D  TAN+ GAN+ +P+PF+ L+ +  +FTN G++
Sbjct  119   DILALASEIGVVLAKGPSWQVLFGRKDSLTANRSGANSDIPSPFETLAVMIPQFTNKGMD  178

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG-SGSTV  769
             + DLVALSGAHTFGRA+C TF  RLFNF+ +GNPD T++ T+L TLQ +CPQGG +G+T 
Sbjct  179   LTDLVALSGAHTFGRARCGTFEQRLFNFNGSGNPDLTVDATFLQTLQGICPQGGNNGNTF  238

Query  770   TNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQ  949
             TNLD +T + FDN+YF+NLQ+N+GLL++DQELFSTSG+ATIAIVN ++ +QT FF  FV 
Sbjct  239   TNLDISTPNDFDNDYFTNLQSNQGLLQTDQELFSTSGSATIAIVNRYAGSQTQFFDDFVS  298

Query  950   SMINMGNISPLTGSSGEIRLNCRRLN  1027
             SMI +GNISPLTG++G+IR +C+R+N
Sbjct  299   SMIKLGNISPLTGTNGQIRTDCKRVN  324



>ref|XP_006492675.1| PREDICTED: peroxidase C3-like isoform X2 [Citrus sinensis]
 gb|KDO62913.1| hypothetical protein CISIN_1g018796mg [Citrus sinensis]
Length=349

 Score =   396 bits (1018),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 206/330 (62%), Positives = 252/330 (76%), Gaps = 4/330 (1%)
 Frame = +2

Query  47    MASFSALLAMA--VAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGAS  220
             MAS   LLA A  VA  +  S S AQLS +FYS+TCPNV +I+  V+++A  +D RIGAS
Sbjct  1     MASLRYLLAAALVVAFVLEGSPSQAQLSPSFYSSTCPNVLNIIEDVLKKAFSSDIRIGAS  60

Query  221   LIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGV  400
             LIRLHFHDCFV+GCD S+LLD+   TI SEK AA NNNSARGF+V+DN+K AVE AC  V
Sbjct  61    LIRLHFHDCFVDGCDASILLDST-NTIDSEKFAAPNNNSARGFEVIDNMKAAVEKACRRV  119

Query  401   VSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTN  580
             VSCADIL +A+E +V+L+GGPSW V LGRRD  TAN+  AN +LP P + L  L   F N
Sbjct  120   VSCADILTIAAERSVALSGGPSWAVPLGRRDSRTANRALANQNLPGPSNSLDELKSSFRN  179

Query  581   VGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGS  757
             VGLN   DLVALSGAHTFGRAQC+ F++RL++F+ TG PDPT++ T L  L+++CPQGG+
Sbjct  180   VGLNDKFDLVALSGAHTFGRAQCKFFSDRLYDFNKTGKPDPTVDRTLLKQLRELCPQGGN  239

Query  758   GSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQ  937
             G+ + N D  T D FDN YFSNL+  +GLL+SDQELFST GA T AIV +F  NQTAFF+
Sbjct  240   GAVLANFDVKTPDAFDNKYFSNLRLRKGLLQSDQELFSTPGADTAAIVEDFGRNQTAFFK  299

Query  938   SFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             +FV SMI MGN+ PLTG+ GEIRLNCRR+N
Sbjct  300   NFVISMIRMGNLKPLTGNQGEIRLNCRRVN  329



>gb|AFU51540.1| anionic peroxidase [Capsicum annuum]
Length=324

 Score =   395 bits (1015),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 200/325 (62%), Positives = 247/325 (76%), Gaps = 5/325 (2%)
 Frame = +2

Query  62    ALLAMAVAIFIF---FSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             ++L   V +F F   F  SNAQLS+TFY++TCPNV+ IV  V++Q  +ND R GA +IRL
Sbjct  2     SILKFIVVLFFFVSIFESSNAQLSATFYASTCPNVTEIVRGVMEQTQRNDVRAGAKIIRL  61

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFVNGCDGS+LLDN    I SEKDA  N     G D+VD+IKTA+EN CPGVVSCA
Sbjct  62    HFHDCFVNGCDGSVLLDN-AAGIESEKDAPANVGIG-GTDIVDDIKTALENVCPGVVSCA  119

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALASE  V+L GGPSW VLLGRRD   AN+ G    +P+PF+ L  +  +FT  GL 
Sbjct  120   DILALASEIGVALVGGPSWQVLLGRRDSLNANRSGVTPDIPSPFESLDVMIPQFTRKGLG  179

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
             + DLVALSGAHTFGRA+CRTFN RLFNF+ TG PDPTL+  YL TL+++CPQGG+G T  
Sbjct  180   LTDLVALSGAHTFGRARCRTFNQRLFNFNGTGRPDPTLDPNYLQTLRRLCPQGGNGGTFA  239

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
              LD +T D FDN+YF+NL+N++GLL++DQELFSTSG++TI IVNN++ NQ  FF  FV S
Sbjct  240   KLDKSTPDQFDNHYFTNLKNHQGLLQTDQELFSTSGSSTIGIVNNYANNQYKFFDDFVCS  299

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MI MGN+  LTG+ GEIR +C+R+N
Sbjct  300   MIKMGNVGVLTGTKGEIRKDCKRVN  324



>pir||JQ2217 peroxidase (EC 1.11.1.7) precursor, anionic - Japanese aspen 
x large-toothed aspen
 dbj|BAA01877.1| peroxidase [Populus kitakamiensis]
 prf||1908234A anionic peroxidase
Length=318

 Score =   395 bits (1014),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 207/323 (64%), Positives = 250/323 (77%), Gaps = 7/323 (2%)
 Frame = +2

Query  59    SALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHF  238
             S L  +   + +F+  S+AQLS TFY++TCPNVSSIV  V++QA QND R+GA LIR+HF
Sbjct  3     SVLATVICVVMLFWGISDAQLSPTFYASTCPNVSSIVRGVVEQAAQNDVRLGAKLIRMHF  62

Query  239   HDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADI  418
             HDCFV+GCDGS+LL  + T I SE+D A N  S  G+ VVD+IKTAVEN CPG+VSCADI
Sbjct  63    HDCFVDGCDGSILL-VDATGINSEQDEAPNT-SVEGYGVVDDIKTAVENVCPGIVSCADI  120

Query  419   lalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN  598
             LALASE  V+LAGGP+W V LGRRD TTAN     + +P+PF+   NL+ KF+N  L+  
Sbjct  121   LALASEILVTLAGGPTWQVPLGRRDSTTAN-AARTSDIPSPFETFENLSLKFSNKELDST  179

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNL  778
             DLVALSGAHTFGR+QC+ F+ RL    N  NPDPTLN TYL TL+Q CPQGG+ S + NL
Sbjct  180   DLVALSGAHTFGRSQCQFFSQRL----NDTNPDPTLNPTYLQTLRQACPQGGNPSRLNNL  235

Query  779   DPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMI  958
             DPTT D FDNNYF+NLQNN GLL +DQ LFSTSGA T+AIVN F+ +QTAFF SF QSMI
Sbjct  236   DPTTPDDFDNNYFTNLQNNSGLLATDQMLFSTSGADTVAIVNRFANSQTAFFDSFAQSMI  295

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
              MGN+SPLTGS+GEIR +C+R+N
Sbjct  296   KMGNLSPLTGSNGEIRADCKRVN  318



>gb|AAL58444.1|AF455807_1 anionic peroxidase [Nicotiana tomentosiformis]
Length=324

 Score =   395 bits (1015),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 203/326 (62%), Positives = 258/326 (79%), Gaps = 4/326 (1%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             SF   +   + +   F+ SNAQLS+TFY +TCPNV+SIV  V+ Q  + DAR GA +IRL
Sbjct  2     SFLRFVGTILFLVAIFAASNAQLSATFYDSTCPNVTSIVRGVMDQRQRTDARAGAKIIRL  61

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFVNGCDGS+LLD +GT   +EKDAA N   A GFD+VD+IKTA+EN CPGVVSCA
Sbjct  62    HFHDCFVNGCDGSILLDTDGTQ--TEKDAAPNV-GAGGFDIVDDIKTALENVCPGVVSCA  118

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DIL+LASE  V+LA GPSW VL GR++  TAN+  AN+ +P+PF+  + +T  FTN G++
Sbjct  119   DILSLASEIGVALAEGPSWQVLFGRKNSLTANRSEANSDIPSPFETPAVMTPLFTNKGMD  178

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG-SGSTV  769
             + DLVA SGAHTFGRA+C TF  RLFNFS +GNPDPT++ T+L TLQ +CPQGG +G+T 
Sbjct  179   LTDLVAQSGAHTFGRARCGTFEQRLFNFSGSGNPDPTVDATFLQTLQGICPQGGNNGNTF  238

Query  770   TNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQ  949
             TNLD +T + FDN+YF+NLQNN+GLL++DQELFSTSG+ATIAIVN ++ +QT FF  FV 
Sbjct  239   TNLDISTPNDFDNDYFTNLQNNQGLLQTDQELFSTSGSATIAIVNRYAGSQTQFFDDFVS  298

Query  950   SMINMGNISPLTGSSGEIRLNCRRLN  1027
             SMI +GNISPLTG++GEIR +C+R+N
Sbjct  299   SMIKLGNISPLTGTNGEIRTDCKRVN  324



>dbj|BAA01992.1| peroxidase [Nicotiana tabacum]
Length=322

 Score =   394 bits (1013),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 204/326 (63%), Positives = 258/326 (79%), Gaps = 6/326 (2%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             SF   +   + +   F  SNAQLS+TFY  TCPNV+SIV  V++Q  + DAR GA +IRL
Sbjct  2     SFFRFVGAILFLVAIFGASNAQLSATFYDCTCPNVTSIVRGVMEQRQRTDARAGAKIIRL  61

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCF  GCDGS+LLD +G  I +EKDA  N   A GFD+VD+IKTA+EN CPGVVSCA
Sbjct  62    HFHDCF--GCDGSILLDTDG--IQTEKDAIPNV-GAGGFDIVDDIKTALENVCPGVVSCA  116

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALASE  V+LAGGP W VL GRRD  TAN+ GAN+ +P+PF+ L+ +T +FTN G++
Sbjct  117   DILALASEIGVALAGGPCWQVLFGRRDSLTANRSGANSDIPSPFETLAVMTPQFTNKGMD  176

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG-SGSTV  769
             + DLVALSGAHTFGRA+C TF  RLFNFS +GNPDPT++ T+L TLQ +CPQGG +G+T 
Sbjct  177   LTDLVALSGAHTFGRARCGTFEQRLFNFSGSGNPDPTVDATFLQTLQGICPQGGNNGNTF  236

Query  770   TNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQ  949
             TNLD +T + FDN+YF+NLQNN+GLL++DQELFSTSG+ATIAIVN ++ +Q+ FF  F+ 
Sbjct  237   TNLDISTPNDFDNDYFTNLQNNQGLLQTDQELFSTSGSATIAIVNRYAGSQSQFFDDFIC  296

Query  950   SMINMGNISPLTGSSGEIRLNCRRLN  1027
             SMI +GNISPLTG++GEIR +C+R+N
Sbjct  297   SMIKLGNISPLTGTNGEIRKDCKRVN  322



>dbj|BAD97836.2| peroxidase [Populus alba]
Length=337

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 208/323 (64%), Positives = 251/323 (78%), Gaps = 8/323 (2%)
 Frame = +2

Query  80    VAIFIFF-----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             VA F F      + +  QL+ TFY  TCPNVS+I+  VI + L +D RIGASLIRLHFHD
Sbjct  2     VAAFFFVVLLGGTLAYGQLTPTFYDQTCPNVSTIIRDVITETLVSDPRIGASLIRLHFHD  61

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLDN+ T IVSEK+A  NNNSARGF+VVD +K  +E+ACP  VSCADIL 
Sbjct  62    CFVNGCDGSLLLDNSDT-IVSEKEAGGNNNSARGFEVVDRMKALLESACPATVSCADILT  120

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-D  601
             +A+E +V LAGGP+W V LGRRD TTA++  AN  LP P   L  L   FTNV LN N D
Sbjct  121   IAAEESVVLAGGPNWTVPLGRRDSTTASRDAANAFLPPPTLTLDQLRESFTNVSLNNNSD  180

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRA+C TF+ RL++F++TG PDP+L+ T LA LQ++CPQGG+GS +T+LD
Sbjct  181   LVALSGAHTFGRAKCSTFDFRLYDFNSTGAPDPSLDPTLLAALQELCPQGGNGSVITDLD  240

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMI  958
              TT D FD+NY+SNLQ N+GLL++DQ LFST GA   IA+VN FSANQTAFF+SFV+SMI
Sbjct  241   LTTPDAFDSNYYSNLQGNQGLLQTDQVLFSTPGADDVIALVNAFSANQTAFFESFVESMI  300

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
              MGN+SPLTG+ GEIRLNC  +N
Sbjct  301   RMGNLSPLTGTEGEIRLNCSVVN  323



>emb|CAA66036.1| peroxidase [Populus trichocarpa]
Length=343

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 210/323 (65%), Positives = 250/323 (77%), Gaps = 8/323 (2%)
 Frame = +2

Query  80    VAIFIFF-----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             VA F F      + ++ QL+ TFY  TCPNVSSI+S VI + L +D RIGASLIRLHFHD
Sbjct  8     VAAFFFVVLLGGTLAHGQLTPTFYDRTCPNVSSIISNVITETLVSDTRIGASLIRLHFHD  67

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLDN  T I SEK+A  NNNSARGF+VVD +K  +E+ACP  VSCADILA
Sbjct  68    CFVNGCDGSLLLDNTDT-IESEKEANGNNNSARGFEVVDRMKALLESACPTTVSCADILA  126

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-D  601
             +A+E +V LAGGP+W V LGRRD TTA++  AN  LP PF  L  L   FTNV LN N D
Sbjct  127   IAAEESVVLAGGPNWTVPLGRRDSTTASRDAANAFLPAPFFTLDQLRESFTNVSLNNNSD  186

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRAQC TF  RL++F+ TG PD T++  +L  LQ++CP+ G+GS +T+LD
Sbjct  187   LVALSGAHTFGRAQCSTFVFRLYDFNGTGAPDSTIDPPFLEALQKLCPENGNGSVITDLD  246

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMI  958
              TT+D FD+ Y+SNLQ NRGLL++DQELFST GA   IA+VN FSANQTAFF+SFV+SMI
Sbjct  247   VTTADAFDSKYYSNLQCNRGLLQTDQELFSTPGADDVIALVNAFSANQTAFFESFVESMI  306

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
              MGNISPLTG+ GEIRLNCR +N
Sbjct  307   RMGNISPLTGTEGEIRLNCRVVN  329



>ref|XP_002299145.1| peroxidase family protein [Populus trichocarpa]
 gb|EEE83950.1| peroxidase family protein [Populus trichocarpa]
 gb|AHL39110.1| class III peroxidase [Populus trichocarpa]
Length=318

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 206/324 (64%), Positives = 253/324 (78%), Gaps = 9/324 (3%)
 Frame = +2

Query  59    SALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHF  238
             S L  +   + +F+  S+AQLS TFY++TCPNVSSIV  V++QA +ND R+GA LIR+HF
Sbjct  3     SVLATVICVVMLFWGISDAQLSPTFYASTCPNVSSIVRGVVEQAARNDVRLGAKLIRMHF  62

Query  239   HDCFVNGCDGSLLL-DNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCAD  415
             HDCFV+GCDGS+LL D NG  I SE+D   N  S  G+ VVD+IKTAVEN CPG+VSCAD
Sbjct  63    HDCFVDGCDGSILLVDANG--INSEQDELPNQ-SVEGYGVVDDIKTAVENVCPGIVSCAD  119

Query  416   IlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNV  595
             ILALASE  V+LAGGP+W V LGRRD TTAN     + +P+PF+   NL+ KF+N  L+ 
Sbjct  120   ILALASEILVTLAGGPTWQVPLGRRDSTTAN-AARTSDIPSPFETFENLSLKFSNKELDS  178

Query  596   NDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTN  775
              DLVALSGAHTFGR+QC+ F+ RL    N  NPDPTL+TTYL TL+Q CPQGG+ S + N
Sbjct  179   TDLVALSGAHTFGRSQCQFFSQRL----NDTNPDPTLDTTYLQTLRQACPQGGNPSRLNN  234

Query  776   LDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSM  955
             LDPTT D FDNNYF+NLQNNRGLL++DQ LFSTSGA T+A+VN F+ +QTAFF SF QSM
Sbjct  235   LDPTTPDDFDNNYFTNLQNNRGLLQTDQILFSTSGADTVAVVNRFANSQTAFFDSFAQSM  294

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             I +GN+SPLTGS+GEIR +C+R+N
Sbjct  295   IKLGNLSPLTGSNGEIRADCKRVN  318



>gb|KDO62910.1| hypothetical protein CISIN_1g018796mg [Citrus sinensis]
Length=350

 Score =   394 bits (1012),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 204/331 (62%), Positives = 251/331 (76%), Gaps = 5/331 (2%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFF---SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGA  217
             MAS   LLA A+ +       S + AQLS +FY++TCPNV++I+  V+Q A  +D RIGA
Sbjct  1     MASLRFLLAAALVVAFVLEGSSPAQAQLSPSFYNSTCPNVANIIREVLQNAFLSDIRIGA  60

Query  218   SLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPG  397
             SLIRLHFHDCFVNGCD S+LLD+   TI SEK AA NNNSARGF+V+DN+K AVE AC  
Sbjct  61    SLIRLHFHDCFVNGCDASILLDST-NTIDSEKFAAPNNNSARGFEVIDNMKAAVEKACRR  119

Query  398   VVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFT  577
             VVSCADIL +A+E +V+L+GGPSW V LGRRD  TAN+  AN +LP P + L  L   F 
Sbjct  120   VVSCADILTIAAERSVALSGGPSWAVPLGRRDSRTANRALANQNLPGPSNSLDELKSSFR  179

Query  578   NVGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG  754
             NVGLN   DLVALSGAHTFGRAQC+ F++RL++F+ TG PDPT++ T L  L+++CPQGG
Sbjct  180   NVGLNDKFDLVALSGAHTFGRAQCKFFSDRLYDFNKTGKPDPTVDRTLLKQLRELCPQGG  239

Query  755   SGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFF  934
             +G+ + N D  T D FDN YFSNL+  +GLL+SDQELFST GA T AIV +F  NQTAFF
Sbjct  240   NGAVLANFDVKTPDAFDNKYFSNLRLRKGLLQSDQELFSTPGADTAAIVEDFGRNQTAFF  299

Query  935   QSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             ++FV SMI MGN+ PLTG+ GEIRLNCRR+N
Sbjct  300   KNFVISMIRMGNLKPLTGNQGEIRLNCRRVN  330



>ref|XP_006354189.1| PREDICTED: lignin-forming anionic peroxidase-like [Solanum tuberosum]
Length=326

 Score =   393 bits (1009),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 206/327 (63%), Positives = 249/327 (76%), Gaps = 7/327 (2%)
 Frame = +2

Query  62    ALLAMAVAIFIF---FSQSNA--QLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLI  226
             + L   VAIF     F  SNA  +LS TFY  TCPNV  IV  V++Q  + D R GA +I
Sbjct  2     SFLRFIVAIFFLVSIFGVSNAHYKLSPTFYDCTCPNVIDIVRDVMEQIQRRDVRAGAKII  61

Query  227   RLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVS  406
             RLHFHDCFVNGCDGS+LLDN  T IVSEK  A  N  A GF++VD IKTA+EN CPGVVS
Sbjct  62    RLHFHDCFVNGCDGSILLDN-ATGIVSEK-GANPNVGAGGFEIVDEIKTALENECPGVVS  119

Query  407   CADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVG  586
             CADILALASE  V LAGGPSW V LGRRD  TAN+ GAN+ +P+P + L+ +  +FT  G
Sbjct  120   CADILALASEIGVVLAGGPSWQVPLGRRDSLTANRSGANSDIPSPTETLAVMIPQFTRKG  179

Query  587   LNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGST  766
             L++ DLVALSGAHTFGRA+CRTFN RLFNFS +G PDPT++  YL TLQ++CPQGG+G T
Sbjct  180   LDLTDLVALSGAHTFGRARCRTFNQRLFNFSGSGRPDPTIDPNYLKTLQRLCPQGGNGGT  239

Query  767   VTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFV  946
               NLD +T D FDN YF+NL+N++GLL++DQELFSTSG+ TIAIV N++ NQ  FF  FV
Sbjct  240   FANLDKSTPDEFDNYYFTNLKNHQGLLQTDQELFSTSGSGTIAIVANYANNQHKFFDDFV  299

Query  947   QSMINMGNISPLTGSSGEIRLNCRRLN  1027
              SMI +GNISPLTG++GEIR +C+R+N
Sbjct  300   CSMIKLGNISPLTGTNGEIRKDCKRIN  326



>gb|KHG23473.1| Peroxidase 15 [Gossypium arboreum]
Length=343

 Score =   394 bits (1011),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 211/334 (63%), Positives = 257/334 (77%), Gaps = 6/334 (2%)
 Frame = +2

Query  47    MASFSALLA-MAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASL  223
             MA F  ++A +  A+ +  S S AQL+ TFY  TCPNV++I+  V+  A  +D RIGASL
Sbjct  1     MACFQYIVAALCFAVVLEGSLSKAQLTPTFYDETCPNVTAIIRQVLVNASFSDPRIGASL  60

Query  224   IRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVV  403
             IRLHFHDCFV GCD S+LLD+    +  EK+A  NNNSARG++V+D +K A+E+ACP  V
Sbjct  61    IRLHFHDCFVQGCDASILLDD---PVNGEKEAIPNNNSARGYEVIDAMKAALESACPNTV  117

Query  404   SCADIlalasesavsl-aGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTN  580
             SCADILA+ASE +VS  AGGPSW V +GRRDG TAN+  AN++LP   + L  L  +F+N
Sbjct  118   SCADILAIASEQSVSTLAGGPSWAVPVGRRDGFTANRTLANSNLPGFNNTLDRLKDRFSN  177

Query  581   VGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGS  757
             VGLN + DLVALSGAHTFGRAQC TF +RL+NF+  G+ DPTLNTTYL  L+Q+CPQGG+
Sbjct  178   VGLNTSIDLVALSGAHTFGRAQCLTFTSRLYNFTGVGDTDPTLNTTYLEELRQICPQGGN  237

Query  758   GSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQ  937
              S +TNLDPTT D FDNNYF+NLQ NRGLL+SDQ LFST GA TI IVN FS+NQTAFF+
Sbjct  238   SSVLTNLDPTTPDGFDNNYFTNLQVNRGLLRSDQNLFSTEGADTIEIVNRFSSNQTAFFE  297

Query  938   SFVQSMINMGNISPLTGSSGEIRLNCRRLN*AKL  1039
             SFV+SMI MGNISPLTG+ GEIR NCR  N A +
Sbjct  298   SFVESMIRMGNISPLTGTEGEIRSNCRAGNSATI  331



>ref|NP_001234132.1| peroxidase precursor [Solanum lycopersicum]
 emb|CAA50597.1| peroxidase [Solanum lycopersicum]
Length=325

 Score =   393 bits (1009),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 245/311 (79%), Gaps = 3/311 (1%)
 Frame = +2

Query  98    FSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLL  277
             F  SNAQLS+TFY++TCPNV+ IV  V+QQA     R GA +IRLHFHDCFVNGCDGSLL
Sbjct  17    FVASNAQLSATFYASTCPNVTEIVRGVMQQAQSTVVRAGAKIIRLHFHDCFVNGCDGSLL  76

Query  278   LDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaG  457
             LDN    I SEKDAA +N  A GFD+VD+IKTA+EN CPGVVSCADILALASE  V+L G
Sbjct  77    LDN-AAGIESEKDAA-SNVGAGGFDIVDDIKTALENVCPGVVSCADILALASEIGVALVG  134

Query  458   GPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGR  637
             GP+W VLLGRRD  TAN+ G ++ +P PF+ L  +  +FTN G+++ DLVALSGAHTFGR
Sbjct  135   GPTWQVLLGRRDSLTANRSGVDSDIPTPFESLDVMRPQFTNKGMDITDLVALSGAHTFGR  194

Query  638   AQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG-SGSTVTNLDPTTSDTFDNNY  814
             A+C TF  RLFNFS +G+PDPT+N+TYL TLQ  CPQGG +G+T  NLD TT D FDN+Y
Sbjct  195   ARCGTFQQRLFNFSGSGSPDPTINSTYLPTLQATCPQGGNNGNTFENLDKTTPDNFDNDY  254

Query  815   FSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSS  994
             + NLQN  GLL++DQELFSTSG+ TIAIVN ++++Q+ FF  F  SMI +GNI  LTG++
Sbjct  255   YINLQNQEGLLQTDQELFSTSGSDTIAIVNRYASSQSQFFDDFASSMIKLGNIGVLTGTN  314

Query  995   GEIRLNCRRLN  1027
             GEIR +C+R+N
Sbjct  315   GEIRTDCKRVN  325



>emb|CAB67121.1| peroxidase [Solanum lycopersicum]
Length=325

 Score =   391 bits (1005),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 201/321 (63%), Positives = 250/321 (78%), Gaps = 6/321 (2%)
 Frame = +2

Query  68    LAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDC  247
             L   ++IF+    SNAQLS+TFY++TCPNV+ IV  V+QQ+     R GA +IRLHFHDC
Sbjct  10    LFFLISIFV---ASNAQLSATFYASTCPNVTEIVRGVMQQSQSTVVRAGAKIIRLHFHDC  66

Query  248   FVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlal  427
             FVNGCDGSLLLDN    I SEKDAA +N  A GFD+VD+IKTA+EN CPGVVSCADILAL
Sbjct  67    FVNGCDGSLLLDN-AAGIESEKDAA-SNVGAGGFDIVDDIKTALENVCPGVVSCADILAL  124

Query  428   asesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLV  607
             ASE  V+L GGP+W VLLGRRD  TAN+ G ++ +P PF+ L  +  +FTN G+++ DLV
Sbjct  125   ASEIGVALVGGPTWQVLLGRRDSLTANRSGVDSDIPTPFESLDVMRPQFTNKGMDITDLV  184

Query  608   ALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG-SGSTVTNLDP  784
             ALSGAHTFGRA+C TF  RLFNFS +G+PDPT+N+TYL TLQ  CPQGG +G+T  NLD 
Sbjct  185   ALSGAHTFGRARCGTFQQRLFNFSGSGSPDPTINSTYLPTLQATCPQGGNNGNTFENLDK  244

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             TT D FDN+Y+ NLQN  GLL++DQELFSTSG+ TIAIVN ++++Q+ FF  F  SMI +
Sbjct  245   TTPDNFDNDYYINLQNQEGLLQTDQELFSTSGSDTIAIVNRYASSQSQFFDDFASSMIKL  304

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNI  LTG++GEIR +C+R+N
Sbjct  305   GNIGVLTGTNGEIRTDCKRVN  325



>ref|XP_011037953.1| PREDICTED: peroxidase 15-like [Populus euphratica]
Length=318

 Score =   390 bits (1002),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 205/324 (63%), Positives = 252/324 (78%), Gaps = 9/324 (3%)
 Frame = +2

Query  59    SALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHF  238
             S L  +   + +F+  S+AQLS TFY++TCPNVSSIV  V++QA +ND R+GA LIR+HF
Sbjct  3     SVLATVICVVMLFWGISDAQLSPTFYASTCPNVSSIVRGVVEQAARNDVRLGAKLIRMHF  62

Query  239   HDCFVNGCDGSLLL-DNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCAD  415
             HDCFV+GCDGS+LL D NG  I SE+D A N  S  G+ VVD+IKTAVEN CPG+VSCAD
Sbjct  63    HDCFVDGCDGSILLVDANG--INSEQDEAPNQ-SVEGYGVVDDIKTAVENVCPGIVSCAD  119

Query  416   IlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNV  595
             ILALASE  V+LAGGP+W V LGRRD TTAN     + +P+PF+   NL+ KF+N  L+ 
Sbjct  120   ILALASEILVTLAGGPTWQVPLGRRDSTTAN-AARTSDIPSPFETFGNLSLKFSNKELDS  178

Query  596   NDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTN  775
              DLVALSGAHTFGR+QC+ F+ RL    +  NPDPTL+TTYL TL+Q CPQGG+ S + N
Sbjct  179   TDLVALSGAHTFGRSQCQFFSQRL----DDTNPDPTLDTTYLQTLRQACPQGGNPSRLNN  234

Query  776   LDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSM  955
             LDPTT D FDNNYF+NLQNNRGLL++DQ LFSTSGA T+AIV  F+ +Q AFF SF QSM
Sbjct  235   LDPTTPDDFDNNYFTNLQNNRGLLQTDQILFSTSGADTVAIVTRFANSQAAFFDSFAQSM  294

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             I +GN+SPLTGS+GEIR +C+R+N
Sbjct  295   IKLGNLSPLTGSNGEIRADCKRVN  318



>gb|AAB47602.1| peroxidase [Linum usitatissimum]
Length=359

 Score =   391 bits (1005),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 210/322 (65%), Positives = 243/322 (75%), Gaps = 3/322 (1%)
 Frame = +2

Query  80    VAIFIFFSQSNAQ-LSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVN  256
             VA+ +F   S AQ L+ TFY +TCPNV  IV TV+Q A   D RIGASL RLHFHDCFVN
Sbjct  15    VAMLLFAGASYAQQLTPTFYDSTCPNVIGIVRTVLQNAAMADPRIGASLNRLHFHDCFVN  74

Query  257   GCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalase  436
             GCDGSLLLDN+ T I+SEK A  NNNS RGFDVVD +KT VE ACPGVVSCADILA+ASE
Sbjct  75    GCDGSLLLDNSAT-ILSEKQALGNNNSVRGFDVVDQMKTQVEAACPGVVSCADILAIASE  133

Query  437   savslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNV-NDLVAL  613
              +V LAGGPSW V LGRRD  TAN+  A+  LP PF  +  L   F  VGLN   DLVAL
Sbjct  134   ESVVLAGGPSWAVPLGRRDSLTANRSLADDQLPPPFFTVDELKANFATVGLNTTEDLVAL  193

Query  614   SGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTS  793
             SGAHTFGRA+C  F  RL+NF++TG PDPT+N T+L TL+Q+CPQ G+GS +TNLD TT+
Sbjct  194   SGAHTFGRARCVGFVGRLYNFNSTGGPDPTINATFLETLRQICPQNGNGSVLTNLDRTTA  253

Query  794   DTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNI  973
             D FD+NYF+NLQ   GLL++DQEL ST G+ TI +VN F+ANQTAFFQSFV SMI MGNI
Sbjct  254   DAFDSNYFTNLQTREGLLQTDQELISTPGSDTIELVNRFAANQTAFFQSFVNSMIRMGNI  313

Query  974   SPLTGSSGEIRLNCRRLN*AKL  1039
              P  GS  EIR NCR +N A +
Sbjct  314   PPPPGSPSEIRRNCRVVNSASV  335



>ref|XP_008354993.1| PREDICTED: peroxidase 15-like [Malus domestica]
Length=324

 Score =   390 bits (1001),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 253/332 (76%), Gaps = 13/332 (4%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQS-----NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARI  211
             M+ FS    +A AIF+  + S     NAQLSSTFYSTTCPNV+SIV  V++QA QND RI
Sbjct  1     MSXFS----IAAAIFVLVTASILGNSNAQLSSTFYSTTCPNVTSIVRGVVEQAQQNDIRI  56

Query  212   GASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENAC  391
             GA LIR+HFHDCFVNGCDGS++LDN    I SEKDA  N  S  G+DVVD+IKTAVEN C
Sbjct  57    GAKLIRVHFHDCFVNGCDGSIMLDNX-DGIESEKDAPPNX-STXGYDVVDDIKTAVENVC  114

Query  392   PGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRK  571
             PGVVSC+DILA+AS+  VS  GGP+W   LGRRD  TAN  G   ++P+  ++L  +++K
Sbjct  115   PGVVSCSDILAIASQILVSANGGPTWEAQLGRRDSRTANXAGX-XAIPSFLENLEQISQK  173

Query  572   FTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQG  751
             F + GL+  DLVALSGAHTFGRA+C TF +RL+NF  TGNPDPT+   YL TL+Q CPQ 
Sbjct  174   FRDAGLDSTDLVALSGAHTFGRARCSTFVHRLYNFXXTGNPDPTIEAGYLETLRQACPQN  233

Query  752   GSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAF  931
             GSG T+ +LD +T D FDN+YF+NLQNNRGLL++DQ LFSTSG  T+AIV+ F+ +Q+ F
Sbjct  234   GSGDTLNDLDQSTRDAFDNHYFTNLQNNRGLLQTDQVLFSTSG-DTVAIVDRFANSQSDF  292

Query  932   FQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             F SF QSMINMGNI  LTG++GEIR +CRR+N
Sbjct  293   FDSFGQSMINMGNIGVLTGTNGEIRTDCRRVN  324



>dbj|BAF33313.1| peroxidase [Populus alba]
Length=337

 Score =   390 bits (1003),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 208/323 (64%), Positives = 250/323 (77%), Gaps = 8/323 (2%)
 Frame = +2

Query  80    VAIFIFF-----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             VA F F      + + AQL+ TFY  TCPNVS+I+  VI + L +D RIGASLIRLHFHD
Sbjct  2     VAAFFFVVLLGGTLAYAQLTPTFYDQTCPNVSTIIRDVITETLVSDPRIGASLIRLHFHD  61

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLDN+ T IVSEK+A  NNNSARGF+VVD +K  +E+ACP  VSCADIL 
Sbjct  62    CFVNGCDGSLLLDNSDT-IVSEKEAGGNNNSARGFEVVDRMKALLESACPATVSCADILT  120

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-D  601
             +A+E +V LAGGP+W V LGRRD TTA++  AN  L  P   L  L   FTNV LN N D
Sbjct  121   IAAEESVVLAGGPNWTVPLGRRDSTTASRDAANAFLLPPTLTLDQLREGFTNVSLNNNSD  180

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRA+C TF+ RL++F++TG PDP+L+ T LA LQ++CPQGG+GS +TNLD
Sbjct  181   LVALSGAHTFGRAKCSTFDFRLYDFNSTGAPDPSLDPTLLAALQELCPQGGNGSVLTNLD  240

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMI  958
              TT D FD+NY+SNLQ N+GLL++DQ LFST GA   IA+VN FSANQTAFF+SF +SMI
Sbjct  241   LTTPDAFDSNYYSNLQGNQGLLQTDQVLFSTPGADDIIALVNAFSANQTAFFESFAESMI  300

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
              MGN+SPLTG+ GEIRLNC  +N
Sbjct  301   RMGNLSPLTGTEGEIRLNCSVVN  323



>ref|XP_006492732.1| PREDICTED: peroxidase 15-like [Citrus sinensis]
 gb|KDO62942.1| hypothetical protein CISIN_1g039981mg [Citrus sinensis]
Length=313

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 202/312 (65%), Positives = 242/312 (78%), Gaps = 2/312 (1%)
 Frame = +2

Query  95    FFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSL  274
              F  SNAQLSSTFY+TTCPNVSSIV  V++QA  NDARIGA LIR+HFHDCFVNGCDGSL
Sbjct  1     MFGASNAQLSSTFYATTCPNVSSIVRGVVEQARNNDARIGARLIRVHFHDCFVNGCDGSL  60

Query  275   LLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavsla  454
             LLD++    +  +     N S  G++VVD+IKTA+EN CPGVVSCADILA+AS+  VSL 
Sbjct  61    LLDDSAPGGIQSEKNGNPNLSTGGYEVVDDIKTALENVCPGVVSCADILAIASQILVSLD  120

Query  455   GGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN-VNDLVALSGAHTF  631
             GGP+W V LGRRD  TAN  G  + +P   + L  ++ KF  VGL+   DLVALSGAHTF
Sbjct  121   GGPTWQVQLGRRDSRTANLAGT-SGIPLGNETLDRISEKFRAVGLDDPTDLVALSGAHTF  179

Query  632   GRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNN  811
             GRA+C  F NRLFNF   GNPDPT++ TYL TL+Q CPQGG+G+ + +LDPTT+D FDNN
Sbjct  180   GRARCVAFRNRLFNFDGAGNPDPTIDPTYLQTLRQNCPQGGNGNALVDLDPTTADGFDNN  239

Query  812   YFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGS  991
             YF+NLQNNRGLL SDQ LFST+GA T+AIVN F+ +QT FF +F Q+MI MGNI PLTG+
Sbjct  240   YFTNLQNNRGLLTSDQVLFSTTGAKTVAIVNRFANSQTDFFDTFGQAMIKMGNIRPLTGN  299

Query  992   SGEIRLNCRRLN  1027
             +GEIR NCRR+N
Sbjct  300   NGEIRSNCRRIN  311



>ref|XP_010109818.1| Peroxidase 54 [Morus notabilis]
 gb|EXC24761.1| Peroxidase 54 [Morus notabilis]
Length=339

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 201/305 (66%), Positives = 238/305 (78%), Gaps = 1/305 (0%)
 Frame = +2

Query  113   AQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNG  292
             AQL+ TFY+ TCPNV+SIV  VI+ ALQ D RI ASL+RLHFHDCFV GCDGSLLLDN  
Sbjct  21    AQLTPTFYNETCPNVTSIVRGVIEGALQTDPRITASLLRLHFHDCFVIGCDGSLLLDNTA  80

Query  293   TTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWN  472
             T I SEK+A  NNNS RGF+VVD+IKTA+ENACPG VSCADILA+A+E +V+L+ GPSW 
Sbjct  81    T-IESEKEAGGNNNSVRGFEVVDDIKTALENACPGTVSCADILAIAAEESVNLSSGPSWT  139

Query  473   VLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRT  652
             V LGRRD   AN+  AN +LP+PF  L  L   F   GLN  DLVALSG HTFGRAQCR 
Sbjct  140   VRLGRRDSLIANRTLANENLPSPFLTLDQLKANFLKQGLNTTDLVALSGGHTFGRAQCRF  199

Query  653   FNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQN  832
             F+ RL++F++TG+PDP+LNTT L TL+Q+CPQGG+ S VTNLD +T D FD  YFSNL  
Sbjct  200   FSTRLYDFNSTGSPDPSLNTTLLQTLRQICPQGGNDSAVTNLDQSTPDVFDKKYFSNLLL  259

Query  833   NRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLN  1012
               G+L++DQEL+STSGA T  IV+ +SANQTAFF SFV SMI MGNI  LT + GEIR N
Sbjct  260   ENGVLQTDQELYSTSGADTAPIVDAYSANQTAFFNSFVVSMIKMGNIGVLTATQGEIRSN  319

Query  1013  CRRLN  1027
             CR++N
Sbjct  320   CRKVN  324



>gb|AHL39111.1| class III peroxidase [Populus trichocarpa]
Length=343

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 207/323 (64%), Positives = 248/323 (77%), Gaps = 8/323 (2%)
 Frame = +2

Query  80    VAIFIFF-----SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             VA F F      + ++ QL+ TFY  TCPNVSSI+  VI + + +D RIG SLIRLHFHD
Sbjct  8     VAAFFFVVLLGGTLAHGQLTPTFYDETCPNVSSIIRNVITETVVSDRRIGGSLIRLHFHD  67

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFVNGCDGSLLLDN  T I SEK+A  NNNSARGF+VVD +K  +E+ACP  VSCADILA
Sbjct  68    CFVNGCDGSLLLDNTDT-IESEKEANGNNNSARGFEVVDRMKALLESACPTTVSCADILA  126

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-D  601
             +A+E +V LAGGP+W V LGRRD TTA++  AN  LP PF  L  L   FTNV LN N D
Sbjct  127   IAAEESVFLAGGPNWTVPLGRRDSTTASRDAANAFLPAPFFTLDQLRESFTNVSLNNNSD  186

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRAQC TF  RL++F+ TG PD T++  +L  LQ++CP+ G+GS +T+LD
Sbjct  187   LVALSGAHTFGRAQCSTFVFRLYDFNGTGAPDSTIDPPFLEALQKLCPENGNGSVITDLD  246

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMI  958
              TT+D FD+ Y+SNLQ NRGLL++DQELFST GA   IA+VN FSANQTAFF+SFV+SMI
Sbjct  247   VTTADAFDSKYYSNLQCNRGLLQTDQELFSTPGADDVIALVNAFSANQTAFFESFVESMI  306

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
              MGNISPLTG+ GEIRLNCR +N
Sbjct  307   RMGNISPLTGTEGEIRLNCRVVN  329



>dbj|BAF33317.1| peroxidase [Populus alba]
Length=310

 Score =   387 bits (995),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 203/314 (65%), Positives = 245/314 (78%), Gaps = 7/314 (2%)
 Frame = +2

Query  86    IFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCD  265
             + +F+  S+AQLS TFY++TCPNVSSIV  V++QA +ND R+GA LIR+HFHDCFVNGCD
Sbjct  4     VMLFWGISDAQLSPTFYASTCPNVSSIVRGVVEQAARNDVRLGAKLIRMHFHDCFVNGCD  63

Query  266   GSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesav  445
             GS+LL  + + I SE+D A N  S  G+ VVDNIKTAVEN CPG+VSCADILALASE  V
Sbjct  64    GSILL-VDASGIDSEQDEAPNQ-SVEGYGVVDNIKTAVENVCPGIVSCADILALASEILV  121

Query  446   slaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAH  625
             +LAGGP+W V LGRRD TTAN     + +P+PF+   NL+ KF+N  L+  DLVALSGAH
Sbjct  122   TLAGGPTWQVPLGRRDSTTAN-AARTSDIPSPFETFENLSLKFSNKELDSTDLVALSGAH  180

Query  626   TFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFD  805
             TFGR+QC+ F+ RL    N  NPDPTLN TYL TL+Q CP GG+ S + NLDPTT D FD
Sbjct  181   TFGRSQCQFFSQRL----NDTNPDPTLNPTYLQTLRQACPPGGNPSRLNNLDPTTPDDFD  236

Query  806   NNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLT  985
             NNYF+NLQNN GLL +DQ LFSTSGA T+AIVN F+ +Q AFF SF QSMI MGN+SPLT
Sbjct  237   NNYFTNLQNNSGLLATDQMLFSTSGADTVAIVNRFANSQAAFFDSFAQSMIKMGNLSPLT  296

Query  986   GSSGEIRLNCRRLN  1027
             GS+GEIR +C+R+N
Sbjct  297   GSNGEIRADCKRVN  310



>ref|XP_008352139.1| PREDICTED: peroxidase 15-like [Malus domestica]
Length=324

 Score =   388 bits (996),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 205/332 (62%), Positives = 252/332 (76%), Gaps = 13/332 (4%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQS-----NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARI  211
             M+ FS    +A AIF+  + S     NAQLSSTFYSTTCPNV+SIV  V++QA QND RI
Sbjct  1     MSXFS----IAAAIFVLVTASILGNSNAQLSSTFYSTTCPNVTSIVRGVVEQAQQNDIRI  56

Query  212   GASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENAC  391
             GA LIR+HFHDCFVNGCDGS++LDN    I SEKDA  N  S  G+DVVD+IKTAVEN C
Sbjct  57    GAKLIRVHFHDCFVNGCDGSIMLDNX-DGIESEKDAPPNX-STXGYDVVDDIKTAVENVC  114

Query  392   PGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRK  571
             PGVVSC+DILA+AS+  VS  GGP+W   LGRRD  TAN  G   ++P+  ++   +++K
Sbjct  115   PGVVSCSDILAIASQILVSANGGPTWEAQLGRRDSRTANXAGX-XAIPSFLENXEQISQK  173

Query  572   FTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQG  751
             F + GL+  DLVALSGAHTFGRA+C TF +RL+NF  TGNPDPT+   YL TL+Q CPQ 
Sbjct  174   FRDAGLDSTDLVALSGAHTFGRARCSTFVHRLYNFXXTGNPDPTIEAGYLETLRQACPQN  233

Query  752   GSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAF  931
             GSG T+ +LD +T D FDN+YF+NLQNNRGLL++DQ LFSTSG  T+AIV+ F+ +Q+ F
Sbjct  234   GSGDTLNDLDQSTRDAFDNHYFTNLQNNRGLLQTDQVLFSTSG-DTVAIVDRFANSQSDF  292

Query  932   FQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             F SF QSMINMGNI  LTG++GEIR +CRR+N
Sbjct  293   FDSFGQSMINMGNIXVLTGTNGEIRTDCRRVN  324



>gb|EYU17994.1| hypothetical protein MIMGU_mgv1a025866mg, partial [Erythranthe 
guttata]
Length=306

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 244/306 (80%), Gaps = 1/306 (0%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
             NAQLS+TFY+TTCPN+SS+V  VIQQA + D R    LIRLHFHDCFV+GCDGSLLLDN 
Sbjct  2     NAQLSTTFYATTCPNISSVVLNVIQQAQRADVRAAPKLIRLHFHDCFVDGCDGSLLLDN-  60

Query  290   GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSW  469
                I+SEKDA  N  S  GF +VDN+KTA+E+ CPGVVSCADILALAS+ +V+L GGPS+
Sbjct  61    ADGILSEKDAFPNAGSVDGFGIVDNMKTALESVCPGVVSCADILALASQISVNLVGGPSY  120

Query  470   NVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCR  649
             +V LGRRDG TAN+ GANT LP+PF +L  L   F+  GL+  DLVALSGAHTFGRA+C 
Sbjct  121   SVPLGRRDGRTANRAGANTELPSPFANLDELRSNFSAKGLDSTDLVALSGAHTFGRAKCN  180

Query  650   TFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQ  829
             TF++RL+NF+N+G PD T+  TYL TL+Q CPQ G+G+T+ NLD +T D FDN YF NLQ
Sbjct  181   TFSHRLYNFANSGGPDQTIEPTYLETLRQTCPQNGAGTTLENLDQSTPDEFDNEYFENLQ  240

Query  830   NNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
             + +GLL++DQ LFS++G+ T+AIV+ F  ++T FF +FV+S+I MGNI+PLTG+ GEIR 
Sbjct  241   SGKGLLQTDQLLFSSTGSDTVAIVDRFGDSETEFFDAFVRSIIKMGNIAPLTGTQGEIRA  300

Query  1010  NCRRLN  1027
             +C+R+N
Sbjct  301   DCKRVN  306



>ref|XP_008344212.1| PREDICTED: lignin-forming anionic peroxidase-like [Malus domestica]
Length=326

 Score =   388 bits (996),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 199/328 (61%), Positives = 244/328 (74%), Gaps = 3/328 (1%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLI  226
             M SFS +  + V +      ++ QLSSTFY TTCPNV+SI+  V++QA +ND R+GA LI
Sbjct  1     MHSFSIVATIFVLVTTSVLGNSTQLSSTFYDTTCPNVTSIIRGVVEQAQRNDTRVGAKLI  60

Query  227   RLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVS  406
             RLHFHDCFVNGCDGS+LLDN    I SEKDA +N   A G+D+V  IKTA+EN  PGVVS
Sbjct  61    RLHFHDCFVNGCDGSILLDN-ADGIESEKDAIRNK-GAEGYDIVAGIKTALENFFPGVVS  118

Query  407   CADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVG  586
             CADILAL S+  VS  GG +W V LGRRD  TAN+ GA+  +P P D+L  +T KF N G
Sbjct  119   CADILALVSQILVSENGGLTWEVQLGRRDSRTANRTGADRDIPTPQDNLKLITEKFRNKG  178

Query  587   LNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGST  766
             L+  DLVALSGAHTFGRA+CR F +RL+NFS T  PDPT++  Y+ TL+Q C QGG  ST
Sbjct  179   LDSTDLVALSGAHTFGRAKCRFFVDRLYNFSGTSKPDPTIDVEYMKTLRQTCSQGGKPST  238

Query  767   VTNLDP-TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSF  943
             +TNLD  TT D FDN Y+ NLQNNRGLL++DQELFSTS   T++IVN F+ NQ+ FF +F
Sbjct  239   LTNLDQLTTIDVFDNYYYKNLQNNRGLLQTDQELFSTSSIDTVSIVNRFANNQSDFFDTF  298

Query  944   VQSMINMGNISPLTGSSGEIRLNCRRLN  1027
              QSMI +GNI PLTGS+GEIR +C+R+N
Sbjct  299   AQSMIKLGNIRPLTGSAGEIRADCKRVN  326



>ref|XP_002304018.2| hypothetical protein POPTR_0003s21600g [Populus trichocarpa]
 gb|EEE78997.2| hypothetical protein POPTR_0003s21600g [Populus trichocarpa]
 gb|AHL39124.1| class III peroxidase [Populus trichocarpa]
Length=348

 Score =   388 bits (996),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 210/329 (64%), Positives = 252/329 (77%), Gaps = 12/329 (4%)
 Frame = +2

Query  74    MAVAIFIFFSQSNA-----QLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHF  238
             M VA+F  F    A     QL+ TFY  TCPNV+SI+  +I+  L +DARIGASLIRLHF
Sbjct  7     MFVALFYAFFAGVAPLAYGQLTPTFYDETCPNVTSIIREIIEDTLLSDARIGASLIRLHF  66

Query  239   HDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENA--CPGVVSCA  412
             HDCFV+GCD S+LLDN  T I SEK+A  NNNSARGFDV+D +K  +E++  CPG+VSCA
Sbjct  67    HDCFVDGCDASILLDNTDT-IESEKEALPNNNSARGFDVIDRMKARLESSENCPGIVSCA  125

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILA+A+E +V LAGGPSW V LGRRDGTTAN+  AN SLP+PF+ L  +  KFT VGLN
Sbjct  126   DILAIAAEESVVLAGGPSWAVPLGRRDGTTANRALANLSLPSPFETLDEIKAKFTAVGLN  185

Query  593   VN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGN---PDPTLNTTYLATLQQVCPQGGSG  760
              N DLVALSGAHTFGR++C+ F NRL+N S+      PD TLN+TYLATL+ +CP  G+G
Sbjct  186   NNTDLVALSGAHTFGRSRCQFFTNRLYNLSDCSTNPPPDDTLNSTYLATLRDLCPCNGNG  245

Query  761   STVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQS  940
             S + +LDPTT D FD+NYFSNL   +GLL+SDQ LFST GA T+ IVNNFSANQTAFF+S
Sbjct  246   SVLADLDPTTPDGFDSNYFSNLLVGQGLLRSDQLLFSTPGADTVDIVNNFSANQTAFFES  305

Query  941   FVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FV SM  MGN+S LTG+ GEIRLNCR +N
Sbjct  306   FVVSMTRMGNLSLLTGTQGEIRLNCRVVN  334



>ref|XP_006649693.1| PREDICTED: peroxidase 15-like [Oryza brachyantha]
Length=328

 Score =   387 bits (993),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 237/307 (77%), Gaps = 2/307 (1%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
             +AQL   +Y  TCP+V  IV  V+++A Q+D RI ASL RLHFHDCFV GCD S+LLDN+
Sbjct  21    SAQLFDEYYDGTCPDVHRIVRRVLKRAHQDDPRIFASLTRLHFHDCFVQGCDASILLDNS  80

Query  290   GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSW  469
              T+IVSEK AA NNNSARG+ VVD IK A+E ACPGVVSCADILA+A++ +V L+GGP W
Sbjct  81    -TSIVSEKFAAPNNNSARGYPVVDAIKAALEEACPGVVSCADILAIAAKISVELSGGPRW  139

Query  470   NVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCR  649
              V LGRRDGTTAN  GA   LP+P D+L+ L +KF +VGL+V DLVALSGAHTFGR QC+
Sbjct  140   RVPLGRRDGTTANLTGAEDKLPSPRDNLTTLRQKFADVGLDVTDLVALSGAHTFGRVQCQ  199

Query  650   TFNNRLFNFSNTGNPDPTLNTTYLATLQQVCP-QGGSGSTVTNLDPTTSDTFDNNYFSNL  826
                +RL+NFS TG PDPTL+  Y A L + CP +GG+ S + +LDPTT DTFD NYF+N+
Sbjct  200   FVTDRLYNFSGTGRPDPTLDAGYRALLAKSCPRRGGNSSALNDLDPTTPDTFDKNYFANI  259

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             + NRG L+SDQEL ST  A T AIVN F+ +Q AFF+SF +SM+NMGNI PLTGS GE+R
Sbjct  260   EVNRGFLQSDQELLSTPAAPTAAIVNRFAISQKAFFKSFARSMVNMGNIQPLTGSQGEVR  319

Query  1007  LNCRRLN  1027
              +CR +N
Sbjct  320   KSCRTVN  326



>ref|XP_011025199.1| PREDICTED: peroxidase A2-like [Populus euphratica]
Length=351

 Score =   387 bits (994),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 209/333 (63%), Positives = 252/333 (76%), Gaps = 12/333 (4%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLI  226
             +A F A LA    +  +      QL+ TFY  TCPNV+SI+  +I+  L +DARIGASLI
Sbjct  11    VALFYAFLAGVAPLLAY-----GQLAPTFYDETCPNVTSIIREIIEDTLLSDARIGASLI  65

Query  227   RLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENA--CPGV  400
             RLHFHDCFV+GCD S+LLDN  T I SEK+A  NNNSARGFDV+D +K  +E++  CPG+
Sbjct  66    RLHFHDCFVDGCDASILLDNTDT-IESEKEALPNNNSARGFDVIDRMKARLESSENCPGI  124

Query  401   VSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTN  580
             VSCADILA+A+E +V LAGGPSW V LGRRDGTTAN+  AN SLP+PF+ L  +  KFT 
Sbjct  125   VSCADILAIAAEESVVLAGGPSWAVPLGRRDGTTANRALANLSLPSPFETLDEIKAKFTA  184

Query  581   VGLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGN---PDPTLNTTYLATLQQVCPQ  748
             VGLN N DLVALSGAHTFGR+QC+ F NRL+N S+      PD TLNTTYLATL+ +CP 
Sbjct  185   VGLNNNTDLVALSGAHTFGRSQCQFFTNRLYNLSDCSTNPPPDNTLNTTYLATLRDLCPC  244

Query  749   GGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTA  928
              G+GS + +LDP T D FD+NYFSNL   +GLL SDQ LFST GA T+ IVNNFSAN+TA
Sbjct  245   NGNGSVLADLDPKTPDGFDSNYFSNLLVGQGLLGSDQLLFSTPGADTVDIVNNFSANETA  304

Query  929   FFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FF+SFV SMI MGN+S LTG+ GEIRL+CR +N
Sbjct  305   FFESFVVSMIRMGNLSLLTGTQGEIRLDCRVVN  337



>ref|XP_007147501.1| hypothetical protein PHAVU_006G129900g [Phaseolus vulgaris]
 gb|ESW19495.1| hypothetical protein PHAVU_006G129900g [Phaseolus vulgaris]
Length=351

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 205/317 (65%), Positives = 235/317 (74%), Gaps = 1/317 (0%)
 Frame = +2

Query  77    AVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVN  256
             A A+   FS +NAQLS TFY  TCPN+ +IV  VI QA   D RIGASL+RLHFHDCFV 
Sbjct  14    AFALHAGFSVTNAQLSPTFYRETCPNLFNIVFQVIFQASLTDPRIGASLVRLHFHDCFVQ  73

Query  257   GCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalase  436
             GCD S+LL NN   I SE+DA  NNNS RG DVV+NIKTAVEN+CPG VSCADIL +A+E
Sbjct  74    GCDASVLL-NNTAIIESEQDAIPNNNSIRGLDVVNNIKTAVENSCPGTVSCADILTIAAE  132

Query  437   savslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALS  616
                 L GGP W V LGR+D  TAN+  AN +LP PF +L+ L   F   GLN  DLVALS
Sbjct  133   IGSILGGGPGWLVPLGRKDSLTANRTLANQNLPPPFFNLTQLKASFAVQGLNTTDLVALS  192

Query  617   GAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSD  796
             GAHTFGRA C TFNNRL+NF+NTGNPDPTLNT YLATL+Q+CPQ  +G+ +TNLD TT D
Sbjct  193   GAHTFGRAHCSTFNNRLYNFNNTGNPDPTLNTVYLATLRQICPQNATGNNLTNLDLTTPD  252

Query  797   TFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNIS  976
              FDN Y+SNLQ   GLL+SDQELFST  A TI IVN+FS+NQ  FF +F  SMI MGNI 
Sbjct  253   QFDNKYYSNLQQLNGLLQSDQELFSTPAADTIPIVNSFSSNQNTFFDNFRASMIKMGNIG  312

Query  977   PLTGSSGEIRLNCRRLN  1027
              LTG+ GEIRL C  +N
Sbjct  313   VLTGAEGEIRLQCNFVN  329



>ref|XP_007147498.1| hypothetical protein PHAVU_006G129600g [Phaseolus vulgaris]
 gb|ESW19492.1| hypothetical protein PHAVU_006G129600g [Phaseolus vulgaris]
Length=353

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 233/307 (76%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             S+AQL  +FY  TCP+V SIV  VI+   ++D R+ ASLIRLHFHDCFV GCD S+LL N
Sbjct  25    SDAQLDPSFYRNTCPSVHSIVREVIRNVSKSDPRMLASLIRLHFHDCFVQGCDASILL-N  83

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             N  TIVSE++A  N NS RG DVV+ IKTAVENACPGVVSCADIL LA+E +  LA GP 
Sbjct  84    NTDTIVSEQEALPNINSIRGLDVVNQIKTAVENACPGVVSCADILTLAAEISSVLAQGPD  143

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W V LGR+D  TAN+  AN +LP PF +L+ L   F   GLN  DLVALSGAHTFGRAQC
Sbjct  144   WKVPLGRKDSLTANRTLANQNLPAPFFNLTLLKAAFAVQGLNTTDLVALSGAHTFGRAQC  203

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
              TF NRL+NFSNTGNPDPTLNTTYL TL+ VCP GG G+ +TN DPTT D FD NY+SNL
Sbjct  204   STFVNRLYNFSNTGNPDPTLNTTYLQTLRAVCPNGGGGTNLTNFDPTTPDKFDKNYYSNL  263

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q ++GLL+SDQELFST GA TI IVN FS+NQT FF+SF  +MI MGNI  LTGS GEIR
Sbjct  264   QVHKGLLQSDQELFSTIGADTIDIVNRFSSNQTLFFESFKAAMIKMGNIGVLTGSQGEIR  323

Query  1007  LNCRRLN  1027
               C  +N
Sbjct  324   KQCNFVN  330



>gb|AAD37427.1|AF149277_1 peroxidase 1 precursor [Phaseolus vulgaris]
Length=341

 Score =   386 bits (991),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 233/307 (76%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             S+AQL  +FY  TCP+V SIV  VI+   ++D R+ ASLIRLHFHDCFV GCD S+LL N
Sbjct  13    SDAQLDPSFYRNTCPSVHSIVREVIRNVSKSDPRMLASLIRLHFHDCFVQGCDASILL-N  71

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             N  TIVSE++A  N NS RG DVV+ IKTAVENACPGVVSCADIL LA+E +  LA GP 
Sbjct  72    NTDTIVSEQEALPNINSIRGLDVVNQIKTAVENACPGVVSCADILTLAAEISSVLAQGPD  131

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W V LGR+D  TAN+  AN +LP PF +L+ L   F   GLN  DLVALSGAHTFGRAQC
Sbjct  132   WKVPLGRKDSLTANRTLANQNLPAPFFNLTLLKAAFAVQGLNTTDLVALSGAHTFGRAQC  191

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
              TF NRL+NFSNTGNPDPTLNTTYL TL+ VCP GG G+ +TN DPTT D FD NY+SNL
Sbjct  192   STFVNRLYNFSNTGNPDPTLNTTYLQTLRAVCPNGGGGTNLTNFDPTTPDKFDKNYYSNL  251

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q ++GLL+SDQELFST GA TI IVN FS+NQT FF+SF  +MI MGNI  LTGS GEIR
Sbjct  252   QVHKGLLQSDQELFSTIGADTIDIVNRFSSNQTLFFESFKAAMIKMGNIGVLTGSQGEIR  311

Query  1007  LNCRRLN  1027
               C  +N
Sbjct  312   KQCNFVN  318



>dbj|BAA06334.1| peroxidase [Populus kitakamiensis]
Length=314

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 199/301 (66%), Positives = 239/301 (79%), Gaps = 3/301 (1%)
 Frame = +2

Query  131   FYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSE  310
             FY  TCPNVS+I+  VI + L +D RIGASLIRLHFHDCFVNGCDGSLLLDN+  TIVSE
Sbjct  1     FYDQTCPNVSTIIRDVITETLASDPRIGASLIRLHFHDCFVNGCDGSLLLDNS-DTIVSE  59

Query  311   KDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNVLLGRR  490
             K+A  NNNSARGF+VVD +K  +E+ACP  VSCADIL +A+E +  LAGGP+W V LGRR
Sbjct  60    KEAGGNNNSARGFEVVDRMKALLESACPATVSCADILTIAAEESEVLAGGPNWTVPLGRR  119

Query  491   DGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN-DLVALSGAHTFGRAQCRTFNNRL  667
             D TTA++  AN  LP P   L  L   FTNVGLN N DLVALSGAHTFGRA+C TF+ RL
Sbjct  120   DSTTASRDAANAFLPAPNITLDQLRESFTNVGLNNNSDLVALSGAHTFGRAKCSTFDFRL  179

Query  668   FNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLL  847
             ++F++TG PD +L+ T LA LQ++CPQGG+GS +T+LD TT D FD+NY+SNLQ N+GLL
Sbjct  180   YDFNSTGAPDQSLDPTLLAALQELCPQGGNGSVLTDLDLTTPDAFDSNYYSNLQGNQGLL  239

Query  848   KSDQELFSTSGA-ATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLNCRRL  1024
             ++DQ LFST GA   IA+VN FSANQTAFF+SF +SMI MGN+ PLTG+ GEIRLNCR +
Sbjct  240   QTDQVLFSTPGADDVIALVNAFSANQTAFFESFAESMIRMGNLRPLTGTEGEIRLNCRVV  299

Query  1025  N  1027
             N
Sbjct  300   N  300



>ref|XP_007147502.1| hypothetical protein PHAVU_006G130000g [Phaseolus vulgaris]
 gb|ESW19496.1| hypothetical protein PHAVU_006G130000g [Phaseolus vulgaris]
Length=332

 Score =   385 bits (989),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 204/329 (62%), Positives = 242/329 (74%), Gaps = 5/329 (2%)
 Frame = +2

Query  53    SFSALLAMAV----AIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGAS  220
             SF  ++A+AV    A+   FS +NA+LS TFY  TCPN+  IV  VI +A   D RIGAS
Sbjct  2     SFMRVVAVAVLCAFALHAGFSVTNAKLSPTFYIKTCPNLFYIVFPVILKASLTDPRIGAS  61

Query  221   LIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGV  400
             L+RLHFHDCFV GCD S+LL NN  TI SE++A  NNNS RG DV++NIKTAVE +CPG 
Sbjct  62    LVRLHFHDCFVQGCDASVLL-NNTATIESEQEALPNNNSIRGLDVINNIKTAVEKSCPGK  120

Query  401   VSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTN  580
             VSCADILA+A++    L GGP+W VLLGR+D  TAN+  AN +LP PF  L  L   F N
Sbjct  121   VSCADILAIAAQMGTVLGGGPAWAVLLGRKDSLTANRTLANQNLPPPFFTLPQLKASFAN  180

Query  581   VGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSG  760
              GLN  DLVALSGAHTFGRA C TF NRL+NF+NTGNPDPTL+T YLATL+Q+CPQ  +G
Sbjct  181   QGLNTTDLVALSGAHTFGRAHCITFVNRLYNFNNTGNPDPTLDTNYLATLRQICPQNATG  240

Query  761   STVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQS  940
             + +TNLD TT D FDN Y+SNLQ  +GLL++DQELFST GA TI IVN+FS+NQ  FF +
Sbjct  241   NNLTNLDLTTPDQFDNKYYSNLQQRKGLLQTDQELFSTPGADTIPIVNSFSSNQNTFFAN  300

Query  941   FVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             F  SMI MGNI  LTG  GEIR  C  +N
Sbjct  301   FRASMIKMGNIGVLTGDEGEIRSQCNFVN  329



>dbj|BAD97438.1| peroxidase [Pisum sativum]
Length=353

 Score =   385 bits (988),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 229/307 (75%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             SNAQL  +FY  TCPNVSSIV  VI+   + D R+ ASL+RLHFHDCFV GCD S+LL N
Sbjct  23    SNAQLDPSFYKNTCPNVSSIVREVIRNVSKTDTRMLASLVRLHFHDCFVQGCDASVLL-N  81

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
                TIV+E+DA  N NS RG DVV+ IKTAVE+ CP  VSCADILALA+E + +L+ GP 
Sbjct  82    TTDTIVTEQDAFPNINSLRGLDVVNKIKTAVESVCPNTVSCADILALAAELSSTLSQGPD  141

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W V LGRRDG TANQ  AN +LP PF+ L  L   F   GLN  DLVALSGAHTFGRA C
Sbjct  142   WKVPLGRRDGLTANQSLANQNLPAPFNSLDQLKAAFAKQGLNTTDLVALSGAHTFGRAHC  201

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
               F +RL+NFSNTGNPDPT+NTTYL  L+ +CP GGSG+ + N DPTT+D FD NY+SNL
Sbjct  202   SLFVSRLYNFSNTGNPDPTVNTTYLQELRNICPNGGSGTNLANFDPTTADKFDKNYYSNL  261

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q  +GLL+SDQELFSTSGA TI+IVN FSA+Q AFF+SF  +MI MGNI  LTG  GEIR
Sbjct  262   QVKKGLLQSDQELFSTSGADTISIVNKFSADQNAFFESFKAAMIKMGNIGVLTGKQGEIR  321

Query  1007  LNCRRLN  1027
               C  +N
Sbjct  322   KQCNFVN  328



>gb|KEH37050.1| peroxidase family protein [Medicago truncatula]
Length=352

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/321 (62%), Positives = 237/321 (74%), Gaps = 2/321 (1%)
 Frame = +2

Query  68    LAMAVAIF-IFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             L   VA+F +    SNAQL+ +FYS TCPNVSSIV  VI+   + D R+ ASL+RLHFHD
Sbjct  11    LCFIVALFGVLPFPSNAQLNPSFYSKTCPNVSSIVREVIRNVSKTDTRMLASLVRLHFHD  70

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFV GCD S+LL NN  TIVSE+DA  N NS RG DVV+ IKTAVE ACP  VSCADILA
Sbjct  71    CFVQGCDASVLL-NNTATIVSEQDAFPNRNSLRGLDVVNQIKTAVEKACPNTVSCADILA  129

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LA+E + +L+ GP W V LGRRDG TANQ  AN +LP PF+ L  L   F + GL+  DL
Sbjct  130   LAAELSSTLSQGPDWKVPLGRRDGLTANQSLANQNLPAPFNSLDQLKAAFASQGLSTTDL  189

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             VALSGAHTFGRA C  F +RL+NFSNTG+PDPTLN TYL  L+ +CP GG G+ + + DP
Sbjct  190   VALSGAHTFGRAHCSLFVSRLYNFSNTGSPDPTLNATYLQQLRNICPNGGPGTPLASFDP  249

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             TT D FD NY+SNLQ  +GLL+SDQELFSTSGA TI+IVNNF+ +Q AFF+SF  +MI M
Sbjct  250   TTPDKFDKNYYSNLQVKKGLLQSDQELFSTSGADTISIVNNFATDQKAFFESFKAAMIKM  309

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNI  LTG+ GEIR  C  +N
Sbjct  310   GNIGVLTGNQGEIRKQCNFVN  330



>gb|KDP44300.1| hypothetical protein JCGZ_19167 [Jatropha curcas]
Length=340

 Score =   384 bits (985),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 196/329 (60%), Positives = 249/329 (76%), Gaps = 4/329 (1%)
 Frame = +2

Query  44    KMASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASL  223
             ++ S + +LA+  A+ +  +  + +LS+TFY  +CPNVS+I+  V+++ALQ+D R+GASL
Sbjct  2     EVPSLTVVLALFYAVIVGGALGDGELSTTFYEESCPNVSTIIGGVLKEALQSDPRMGASL  61

Query  224   IRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVV  403
             +RL+FHDCFVNGCD S+LLDN+ +TI SEKDA  N NS RG+++VD +K  +E ACPGVV
Sbjct  62    LRLYFHDCFVNGCDASILLDNS-STIQSEKDALPNRNSIRGYELVDKMKAELETACPGVV  120

Query  404   SCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNV  583
             SCADIL +A++ +V LAGGPSW+ LLGRRDGTTAN   AN  +P P + L+ +  KF  V
Sbjct  121   SCADILTIAAQKSVHLAGGPSWSSLLGRRDGTTANLTLANLIMPGPTESLNAIKSKFVAV  180

Query  584   GLNVN-DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSG  760
             GLN N DLV+LSGAHTFGRA C  F +RL+NF+ TG PDPTLN+TYL  L Q CP+G  G
Sbjct  181   GLNNNTDLVSLSGAHTFGRASCENFASRLYNFNGTGEPDPTLNSTYLKMLIQKCPRGRDG  240

Query  761   STVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQS  940
              T  +LD TT   FD  Y+SNL  N GLL+SDQELFST GA T+ IV NFSANQT+FF S
Sbjct  241   GT--SLDLTTPTVFDGKYYSNLLVNEGLLQSDQELFSTPGADTVHIVTNFSANQTSFFAS  298

Query  941   FVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FV SMI MGN++ LTG+ GEIRLNCR +N
Sbjct  299   FVVSMIRMGNLNVLTGTEGEIRLNCRVVN  327



>gb|AFK35177.1| unknown [Medicago truncatula]
Length=352

 Score =   383 bits (984),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 199/321 (62%), Positives = 237/321 (74%), Gaps = 2/321 (1%)
 Frame = +2

Query  68    LAMAVAIF-IFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             L   VA+F +    SNAQL+ +FYS TCPNVSSIV  VI+   + D R+ ASL+RLHFHD
Sbjct  11    LCFIVALFGVLPFPSNAQLNPSFYSKTCPNVSSIVREVIRNVSKTDTRMLASLVRLHFHD  70

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFV GCD S+LL NN  TIVSE+DA  N NS RG DVV+ IKTAVE ACP  VSCADILA
Sbjct  71    CFVQGCDASVLL-NNTATIVSEQDAFPNRNSLRGLDVVNQIKTAVEKACPNTVSCADILA  129

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             LA+E + +L+ GP W V LGRRDG TANQ  AN +LP PF+ L  L   F + GL+  DL
Sbjct  130   LAAELSSTLSQGPDWKVPLGRRDGLTANQSLANQNLPAPFNSLDQLKAAFASQGLSTTDL  189

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             VALSGAHTFGRA C  F +RL+NFSNTG+PDPTLN TYL  L+ +CP GG G+ + + DP
Sbjct  190   VALSGAHTFGRAHCSLFVSRLYNFSNTGSPDPTLNATYLQQLRNICPNGGPGTPLASFDP  249

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             TT D FD NY+SNLQ  +GLL+SDQELFSTSGA TI+IV+NF+ +Q AFF+SF  +MI M
Sbjct  250   TTPDKFDKNYYSNLQVKKGLLQSDQELFSTSGADTISIVDNFATDQKAFFESFKAAMIKM  309

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNI  LTG+ GEIR  C  +N
Sbjct  310   GNIGVLTGNQGEIRKQCNFVN  330



>gb|KHN22987.1| Peroxidase 15 [Glycine soja]
Length=347

 Score =   383 bits (983),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 201/307 (65%), Positives = 234/307 (76%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             S+AQL  +FY  TCP V SIV  V++   ++D R+ ASLIRLHFHDCFV GCD S+LL N
Sbjct  20    SDAQLDPSFYRDTCPKVHSIVREVVRNVSKSDPRMLASLIRLHFHDCFVQGCDASILL-N  78

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             N  TI SE+ A  NNNS RG DVV+ IKTAVENACPGVVSCADILALA+E +  LA GP 
Sbjct  79    NTATIESEQQAFPNNNSIRGLDVVNQIKTAVENACPGVVSCADILALAAEISSVLAHGPD  138

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W V LGRRD  TAN+  AN +LP PF +L+ L   F   GLN  DLVALSGAHT GRAQC
Sbjct  139   WKVPLGRRDSLTANRTLANQNLPAPFFNLTQLKDAFAVQGLNTTDLVALSGAHTIGRAQC  198

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
             + F +RL+NFS+TGNPDPTLNTTYL TL  +CP GG G+ +TN DPTT DT D+NY+SNL
Sbjct  199   KFFVDRLYNFSSTGNPDPTLNTTYLQTLSALCPNGGPGTNLTNFDPTTPDTVDSNYYSNL  258

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q N+GLL+SDQELFST+GA TIAIVN+FS+NQT FF++F  SMI MGNI  LTGS GEIR
Sbjct  259   QVNKGLLQSDQELFSTTGADTIAIVNSFSSNQTLFFENFKASMIKMGNIGVLTGSQGEIR  318

Query  1007  LNCRRLN  1027
               C  +N
Sbjct  319   QQCNFIN  325



>ref|NP_001242766.1| uncharacterized protein LOC100804829 precursor [Glycine max]
 gb|ACU23027.1| unknown [Glycine max]
Length=347

 Score =   382 bits (982),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 200/307 (65%), Positives = 233/307 (76%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             S+AQL  +FY  TCP V SIV  V++   ++D ++ ASLIRLHFHDCFV GCD S+LL N
Sbjct  20    SDAQLDPSFYRDTCPKVHSIVREVVRNVSKSDPQMLASLIRLHFHDCFVQGCDASILL-N  78

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             N  TI SE+ A  NNNS RG DVV+ IKTAVENACPGVVSCADILALA+E +  L  GP 
Sbjct  79    NTATIESEQQAFPNNNSIRGLDVVNQIKTAVENACPGVVSCADILALAAEISSVLGHGPD  138

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W V LGRRD  TAN+  AN +LP PF +L+ L   F   GLN  DLVALSGAHT GRAQC
Sbjct  139   WKVPLGRRDSLTANRTLANQNLPAPFFNLTQLKDAFAVQGLNTTDLVALSGAHTIGRAQC  198

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
             R F +RL+NFS+TGNPDPTLNTTYL TL  +CP GG G+ +TN DPTT DT D+NY+SNL
Sbjct  199   RFFVDRLYNFSSTGNPDPTLNTTYLQTLSAICPNGGPGTNLTNFDPTTPDTVDSNYYSNL  258

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q N+GLL+SDQELFST+GA TIAIVN+FS+NQT FF++F  SMI MGNI  LTGS GEIR
Sbjct  259   QVNKGLLQSDQELFSTTGADTIAIVNSFSSNQTLFFENFKASMIKMGNIGVLTGSQGEIR  318

Query  1007  LNCRRLN  1027
               C  +N
Sbjct  319   QQCNFIN  325



>gb|AES64746.2| peroxidase family protein [Medicago truncatula]
Length=355

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 199/307 (65%), Positives = 232/307 (76%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             S+AQLS TFYS TCP VSSIVS V+    + D R+ ASL+RLHFHDCFV GCD S+LL N
Sbjct  24    SDAQLSPTFYSKTCPTVSSIVSNVLTNVSKTDQRMLASLVRLHFHDCFVLGCDASVLL-N  82

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             N  TIVSE+ A  NNNS RG DVV+ IKTA+E+ACP  VSCADILALA++++  LA GPS
Sbjct  83    NTATIVSEQQAFPNNNSLRGLDVVNQIKTAIESACPNTVSCADILALAAQASSVLAQGPS  142

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W V LGRRDG TAN+  AN +LP PF+ L  L   FT  GLN  DLVALSGAHTFGRA C
Sbjct  143   WTVPLGRRDGLTANRTLANQNLPAPFNTLVQLKAAFTAQGLNTTDLVALSGAHTFGRAHC  202

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
               F  RL+NFS+TG+PDPTLNTTYL  L+ +CP GG G+ +TN DPTT D FD NY+SNL
Sbjct  203   AQFVGRLYNFSSTGSPDPTLNTTYLQQLRTICPNGGPGTNLTNFDPTTPDKFDKNYYSNL  262

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q  +GLL+SDQELFSTSGA TI+IVN FS +Q AFF+SF  +MI MGNI  LTG+ GEIR
Sbjct  263   QVKKGLLQSDQELFSTSGADTISIVNKFSTDQNAFFESFKAAMIKMGNIGVLTGTKGEIR  322

Query  1007  LNCRRLN  1027
               C  +N
Sbjct  323   KQCNFVN  329



>ref|XP_009386276.1| PREDICTED: peroxidase A2-like [Musa acuminata subsp. malaccensis]
Length=332

 Score =   381 bits (979),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 196/307 (64%), Positives = 238/307 (78%), Gaps = 4/307 (1%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             S AQLS +FY  TCP +S IV  V+ QA  +D R+ ASLIRLHFHDCFV+GCD S+LLDN
Sbjct  28    SRAQLSPSFYDMTCPGLSDIVLDVVLQAQISDPRMPASLIRLHFHDCFVDGCDASVLLDN  87

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             +  TIVSEKDA  N NSARGFDV+D IK+AVE  C GVVSCADILALA+E+AVSL+GGPS
Sbjct  88    S-DTIVSEKDAVPNANSARGFDVIDAIKSAVEETCLGVVSCADILALAAEAAVSLSGGPS  146

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W V LGRRDGTTAN  GAN +LP P D L+ L  KF  VGL+  DLV LSGAHTFGRAQC
Sbjct  147   WEVQLGRRDGTTANISGAN-NLPGPVDTLAVLLSKFAAVGLDDTDLVTLSGAHTFGRAQC  205

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
             ++F  RL+N+S T  PDP+L++ YLA LQ  CP G  G+++ +LDPTT D FD NY+ NL
Sbjct  206   KSFAARLYNYSGTERPDPSLDSAYLALLQDQCPDGEDGTSLNDLDPTTPDAFDGNYYFNL  265

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             QN +GLL SDQE++  +GA T AIV+ ++ +++ FF+SF  SMINMGNISPL GS GE+R
Sbjct  266   QNGQGLLLSDQEIY--AGAGTAAIVDGYAGDESGFFESFAASMINMGNISPLAGSEGEVR  323

Query  1007  LNCRRLN  1027
             LNCR++N
Sbjct  324   LNCRQVN  330



>dbj|BAK05179.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   381 bits (979),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 193/324 (60%), Positives = 239/324 (74%), Gaps = 2/324 (1%)
 Frame = +2

Query  59    SALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHF  238
             + LLA+AVA+ +      AQL   FY  +CP V  +V  V+++A + D RI ASL RLHF
Sbjct  12    AVLLAIAVALGLGVRGGAAQLHDKFYDGSCPGVHGVVRRVLREAHKADKRIYASLTRLHF  71

Query  239   HDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADI  418
             HDCFV GCDGS+LLDN+ T+IVSEK A  NNNS RGF VVD++K A+E ACPGVVSCADI
Sbjct  72    HDCFVQGCDGSILLDNS-TSIVSEKYAKPNNNSVRGFTVVDDVKAALEKACPGVVSCADI  130

Query  419   lalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN  598
             LA+A++ +V L+GGP W V LGRRDGTTAN   AN+ LP+P ++L+ L RKF  VGL+  
Sbjct  131   LAIAAKVSVELSGGPRWRVPLGRRDGTTANITAANSLLPSPRNNLTMLQRKFAAVGLDDT  190

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCP-QGGSGSTVTN  775
             DLVALSGAHTFGRA+C+   +RL+NFS TG PDPTL+  Y A L   CP + G+ S + +
Sbjct  191   DLVALSGAHTFGRARCQFVTDRLYNFSKTGMPDPTLDVGYRAQLAGRCPRRHGNRSALND  250

Query  776   LDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSM  955
             LDPTT DTFD NYF+NLQ NRG L+SDQEL +  GA T  IV  F++++ AFF SF  +M
Sbjct  251   LDPTTPDTFDKNYFTNLQGNRGFLQSDQELLAAPGAPTAEIVGRFASDEKAFFTSFAAAM  310

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             INMGNI PLTG  GE+R NCRR+N
Sbjct  311   INMGNIKPLTGGHGEVRRNCRRVN  334



>ref|NP_001049482.1| Os03g0234900 [Oryza sativa Japonica Group]
 tpe|CAH69281.1| TPA: class III peroxidase 39 precursor [Oryza sativa Japonica 
Group]
 gb|ABF94829.1| Peroxidase 53 precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11396.1| Os03g0234900 [Oryza sativa Japonica Group]
 gb|EAY89164.1| hypothetical protein OsI_10660 [Oryza sativa Indica Group]
 gb|EAZ26186.1| hypothetical protein OsJ_10055 [Oryza sativa Japonica Group]
 dbj|BAG90874.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97031.1| unnamed protein product [Oryza sativa Japonica Group]
Length=333

 Score =   381 bits (978),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 190/305 (62%), Positives = 236/305 (77%), Gaps = 2/305 (1%)
 Frame = +2

Query  116   QLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNGT  295
             QL   +Y  TCP+V  IV  V+++A Q+D RI ASL RLHFHDCFV GCD S+LLDN+ T
Sbjct  28    QLCDKYYDGTCPDVHRIVRRVLKRARQDDPRIFASLTRLHFHDCFVQGCDASILLDNS-T  86

Query  296   TIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNV  475
             +IVSEK A  NNNSARG+ VVD+IK A+E ACPGVVSCADILA+A++ +V L+GGP W V
Sbjct  87    SIVSEKFATPNNNSARGYPVVDDIKAALEEACPGVVSCADILAIAAKISVELSGGPRWRV  146

Query  476   LLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRTF  655
              LGRRDGTTAN  GA+ +LP+P D+L+ L +KF  VGL+V DLVALSGAHTFGR QC+  
Sbjct  147   PLGRRDGTTANLTGADNNLPSPRDNLTTLQQKFAAVGLDVTDLVALSGAHTFGRVQCQFV  206

Query  656   NNRLFNFSNTGNPDPTLNTTYLATLQQVCP-QGGSGSTVTNLDPTTSDTFDNNYFSNLQN  832
              +RL+NFS TG PDPTL+  Y   L + CP +GG+ S + +LDPTT D FD NYF+N++ 
Sbjct  207   TDRLYNFSGTGKPDPTLDAGYRRALAKSCPRRGGNSSALNDLDPTTPDAFDKNYFANIEV  266

Query  833   NRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLN  1012
             NRG L+SDQEL ST GA T AIVN+F+ +Q AFF+SF +SM+NMGNI PLTGS GE+R +
Sbjct  267   NRGFLQSDQELLSTPGAPTAAIVNSFAISQKAFFKSFARSMVNMGNIQPLTGSQGEVRKS  326

Query  1013  CRRLN  1027
             CR +N
Sbjct  327   CRFVN  331



>gb|KHG17888.1| Peroxidase 15 [Gossypium arboreum]
Length=245

 Score =   376 bits (966),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 187/243 (77%), Positives = 216/243 (89%), Gaps = 0/243 (0%)
 Frame = +2

Query  299   IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNVL  478
             + SEKDAA N NS RGF+VVDNIKTA+EN+CPG+VSCADILALA+E++VS  GGPSW VL
Sbjct  1     MQSEKDAAPNTNSTRGFNVVDNIKTALENSCPGIVSCADILALAAEASVSSQGGPSWTVL  60

Query  479   LGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRTFN  658
             LGRRD  TANQ GAN+S+P+PF+ L+N+T KFT VGLN NDLVALSGAHTFGRAQCR F+
Sbjct  61    LGRRDSLTANQAGANSSIPSPFESLTNITAKFTAVGLNTNDLVALSGAHTFGRAQCRLFS  120

Query  659   NRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQNNR  838
             +RL+NFS TGNPDPTLN++YL TLQQ+CPQ GSG  V NLDPTT D+FDNNYF NLQNNR
Sbjct  121   SRLYNFSGTGNPDPTLNSSYLTTLQQICPQSGSGFNVANLDPTTPDSFDNNYFVNLQNNR  180

Query  839   GLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLNCR  1018
             GLL+SDQELFSTSGA TI+IVN FS+NQTAFFQSF QSMINMGNISPLTGS+GEIR +C+
Sbjct  181   GLLQSDQELFSTSGAPTISIVNTFSSNQTAFFQSFAQSMINMGNISPLTGSNGEIRSDCK  240

Query  1019  RLN  1027
             ++N
Sbjct  241   KVN  243



>emb|CBI16466.3| unnamed protein product [Vitis vinifera]
Length=332

 Score =   379 bits (973),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/288 (66%), Positives = 234/288 (81%), Gaps = 2/288 (1%)
 Frame = +2

Query  107  SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
            SNAQLS+TFY T+CPN+SSIV  +I+QA  +D RI A LIRLHFHDCFV+GCDGS+LLDN
Sbjct  20   SNAQLSATFYDTSCPNISSIVQGIIEQAQNSDVRINAKLIRLHFHDCFVDGCDGSILLDN  79

Query  287  NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
                I SEKDA+ N NS  GF VVD+IKTA+EN CPGVVSCADILA+AS+ +VSLAGGP+
Sbjct  80   -ADGIASEKDASPNINSVDGFSVVDDIKTALENVCPGVVSCADILAIASQISVSLAGGPT  138

Query  467  WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
            W VL GRRD TTA Q GAN+ +P P + L  +T+KFTN GL+  DLVALSGAHTFGRAQC
Sbjct  139  WQVLFGRRDSTTAYQAGANSDIPTPLETLEQITQKFTNKGLDSTDLVALSGAHTFGRAQC  198

Query  647  RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
            RTF++RL++F+N+ +PDPT++ TYL TLQ  CPQ G G+ V NLDP+T + FDN+YF+NL
Sbjct  199  RTFSHRLYDFNNSSSPDPTIDATYLQTLQGTCPQDGDGTVVANLDPSTPNGFDNDYFTNL  258

Query  827  QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGN  970
            QNNRGLL++DQELFST+GA TIAIVN F+++Q+ FF +F   +IN  N
Sbjct  259  QNNRGLLQTDQELFSTTGADTIAIVNQFASSQSEFFDAFAH-IINNAN  305



>gb|AII99873.1| peroxidase [Cicer arietinum]
Length=355

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 197/331 (60%), Positives = 236/331 (71%), Gaps = 5/331 (2%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFS----QSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIG  214
             M SF   L +   + +        S+AQL  +FY  TCPNV SIV  VI+   + D R+ 
Sbjct  1     MKSFDLTLTVLWCVVVVLGGLPFSSDAQLDPSFYRNTCPNVHSIVREVIRNVSKTDPRML  60

Query  215   ASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACP  394
             ASL+RLHFHDCFV GCD S+LL+N+GT IVSE+ A  NNNS RG DVV+ IKTAVEN CP
Sbjct  61    ASLVRLHFHDCFVQGCDASVLLNNSGT-IVSEQQAFPNNNSLRGLDVVNKIKTAVENVCP  119

Query  395   GVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKF  574
               VSCADILALA++ +  LA GP+W V LGRRDG TANQ  AN +LP PF  L  L   F
Sbjct  120   NTVSCADILALAAQISSILADGPNWKVPLGRRDGLTANQSLANINLPAPFHSLDQLKSAF  179

Query  575   TNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGG  754
                GLN  DLVALSGAHTFGR+ C  F NRL+NFSNTGNPDPTLNTTYL  L+++CP  G
Sbjct  180   AAQGLNTTDLVALSGAHTFGRSHCSLFVNRLYNFSNTGNPDPTLNTTYLQELRKLCPNSG  239

Query  755   SGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFF  934
              G+ + N DPTT DTFD NY+SNL+  +GLL+SDQELFSTSGA TI+IVN FS +Q AFF
Sbjct  240   PGTNLANFDPTTPDTFDKNYYSNLKVKKGLLQSDQELFSTSGADTISIVNKFSTDQDAFF  299

Query  935   QSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             +SF  +MI M +I  +TG+ GEIR +C  +N
Sbjct  300   ESFKAAMIKMSSIGVITGNKGEIRKHCNFVN  330



>ref|XP_004228671.1| PREDICTED: lignin-forming anionic peroxidase-like [Solanum lycopersicum]
Length=327

 Score =   379 bits (972),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 203/329 (62%), Positives = 254/329 (77%), Gaps = 4/329 (1%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQSNA--QLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGAS  220
             M+    +LA+   + I F  SNA  +L+ TFY  TCPNV  IV  V++Q  + D R GA 
Sbjct  1     MSFLRFILAIFFLVSINFGVSNAHYKLTPTFYDCTCPNVIHIVRDVMEQIQRRDVRAGAK  60

Query  221   LIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGV  400
             +IRLHFHDCFVNGCDGS+LL NN T I+SEKDA   N  A GFD+VD IKTA+EN CPGV
Sbjct  61    IIRLHFHDCFVNGCDGSILL-NNATGIISEKDA-NPNVGAGGFDIVDEIKTALENECPGV  118

Query  401   VSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTN  580
             VSCADILALASE  V LAGGPSW V LGRRD  TAN+ GAN+ +P+P + L+ +  +FT 
Sbjct  119   VSCADILALASEIGVVLAGGPSWQVPLGRRDSLTANRSGANSDIPSPTETLAVMIPQFTR  178

Query  581   VGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSG  760
              G+++ DLVALSGAHTFGRA+CRTFN RLFNFS +G PDPT+++ YL TLQ++CPQGG+G
Sbjct  179   KGMDLTDLVALSGAHTFGRARCRTFNQRLFNFSGSGRPDPTIDSNYLKTLQRLCPQGGNG  238

Query  761   STVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQS  940
              T  NLD +T D FDN YF+NL+N++GLL++DQELFSTSG++TI+IV N++ NQ  FF  
Sbjct  239   GTFANLDKSTPDEFDNYYFTNLKNHQGLLQTDQELFSTSGSSTISIVTNYANNQHKFFDD  298

Query  941   FVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FV SMI +GNISPLTG++GEIR +C+R+N
Sbjct  299   FVCSMIKLGNISPLTGTNGEIRKDCKRIN  327



>emb|CAA62227.1| peroxidase1C [Medicago sativa]
Length=358

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 230/307 (75%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             S+AQLS TFYS TCP VSSIVS V+    + D R+ ASL+RLHFHDCFV GCD S+LL N
Sbjct  24    SDAQLSPTFYSKTCPTVSSIVSNVLTNVSKTDPRMLASLVRLHFHDCFVLGCDASVLL-N  82

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             N  TIVSE+ A  NNNS RG DVV+ IK AVE  CP  VSCADILALA++++  LA GPS
Sbjct  83    NTATIVSEQQAFPNNNSLRGLDVVNQIKLAVEVPCPNTVSCADILALAAQASSVLAQGPS  142

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W V LGRRDG TAN+  AN +LP PF+ L  L   FT  GLN  DLVALSGAHTFGRA C
Sbjct  143   WTVPLGRRDGLTANRTLANQNLPAPFNSLDQLKAAFTAQGLNTTDLVALSGAHTFGRAHC  202

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
               F +RL+NFS+TG+PDPTLNTTYL  L+ +CP GG G+ +TN DPTT D FD NY+SNL
Sbjct  203   AQFVSRLYNFSSTGSPDPTLNTTYLQQLRTICPNGGPGTNLTNFDPTTPDKFDKNYYSNL  262

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q  +GLL+SDQELFSTSGA TI+IVN FS +Q AFF+SF  +MI MGNI  LTG+ GEIR
Sbjct  263   QVKKGLLQSDQELFSTSGADTISIVNKFSTDQNAFFESFKAAMIKMGNIGVLTGTKGEIR  322

Query  1007  LNCRRLN  1027
               C  +N
Sbjct  323   KQCNFVN  329



>dbj|BAD97437.1| peroxidase [Pisum sativum]
Length=356

 Score =   379 bits (972),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 208/335 (62%), Positives = 246/335 (73%), Gaps = 6/335 (2%)
 Frame = +2

Query  32    LNPKKMASFSALLAMAVAIFI---FFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQND  202
             +NP  ++S  A   + V + I    FS SNAQL  +FYSTTCPNVSSIV  V+    Q D
Sbjct  1     MNPLGLSS-RAFCCVVVCVLIGGVSFS-SNAQLDPSFYSTTCPNVSSIVRGVLTNVSQTD  58

Query  203   ARIGASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVE  382
              R+ ASLIRLHFHDCFV GCDGS+LL N+  TIVSE+ AA NNNS RG DVV+ IKTAVE
Sbjct  59    PRMLASLIRLHFHDCFVQGCDGSVLL-NDTATIVSEQTAAPNNNSIRGLDVVNQIKTAVE  117

Query  383   NACPGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNL  562
             NACP  VSCADILAL++E +  LA GP+W V LGRRD  TAN+  A  +LP P  +LS L
Sbjct  118   NACPNTVSCADILALSAEISSDLAQGPTWQVPLGRRDSLTANKTLATQNLPGPSFNLSLL  177

Query  563   TRKFTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVC  742
                F    LN  DLVALSG HT GR QCR F +RL+NF++TGNPD TLNTTYL TLQ +C
Sbjct  178   KSTFLIQNLNTTDLVALSGGHTIGRGQCRFFVDRLYNFNSTGNPDTTLNTTYLQTLQSIC  237

Query  743   PQGGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQ  922
             P GG G+ +T+LDPTT DTFD+NY+SNLQ+ +GL +SDQELFST+GA TIAIVN+F  NQ
Sbjct  238   PNGGPGTNLTDLDPTTPDTFDSNYYSNLQDGKGLFQSDQELFSTTGADTIAIVNSFINNQ  297

Query  923   TAFFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             T FF++FV SMI MGN+  LTG+ GEIR  C  LN
Sbjct  298   TLFFENFVASMIKMGNLGVLTGTQGEIRTQCNALN  332



>ref|XP_004985087.1| PREDICTED: peroxidase 15-like [Setaria italica]
Length=392

 Score =   379 bits (974),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 193/321 (60%), Positives = 237/321 (74%), Gaps = 2/321 (1%)
 Frame = +2

Query  65    LLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHD  244
             LL+ A A+        AQL   +Y  TCP+V  IV  V+++A + DARI ASL RLHFHD
Sbjct  72    LLSAAAALGFGVRAGAAQLCGEYYDRTCPDVHRIVRRVLKKAHEADARIYASLTRLHFHD  131

Query  245   CFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIla  424
             CFV GCDGS+LLDN+ ++IVSEK AA NNNSARG+ VVD +K A+E ACPGVVSCADILA
Sbjct  132   CFVQGCDGSILLDNS-SSIVSEKFAAPNNNSARGYPVVDAVKAALEEACPGVVSCADILA  190

Query  425   lasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDL  604
             +A++ +V L+GGP W V LGRRDGTTAN   AN  LP+PFD+L+ L +KF  VGL+  DL
Sbjct  191   IAAKISVELSGGPRWRVPLGRRDGTTANITAAN-DLPSPFDNLTALQQKFGAVGLDDTDL  249

Query  605   VALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
             VALSGAHTFGR QC+    RL+NFS T  PDPTL+  Y A L   CP+GG G+ + +LDP
Sbjct  250   VALSGAHTFGRVQCQFVTPRLYNFSGTNRPDPTLDRGYRAFLSLRCPRGGDGTALNDLDP  309

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             TT D FDN+Y++N++  RG L+SDQEL ST GA T AIV  F+ +Q AFF+SF +SMINM
Sbjct  310   TTPDAFDNSYYTNIEARRGTLQSDQELLSTPGAPTAAIVGRFAGSQKAFFKSFARSMINM  369

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GNI  LTGS GE+R NCR +N
Sbjct  370   GNIEVLTGSQGEVRKNCRVVN  390



>ref|XP_003594495.1| Peroxidase [Medicago truncatula]
Length=520

 Score =   384 bits (985),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 199/307 (65%), Positives = 232/307 (76%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             S+AQLS TFYS TCP VSSIVS V+    + D R+ ASL+RLHFHDCFV GCD S+LL N
Sbjct  24    SDAQLSPTFYSKTCPTVSSIVSNVLTNVSKTDQRMLASLVRLHFHDCFVLGCDASVLL-N  82

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             N  TIVSE+ A  NNNS RG DVV+ IKTA+E+ACP  VSCADILALA++++  LA GPS
Sbjct  83    NTATIVSEQQAFPNNNSLRGLDVVNQIKTAIESACPNTVSCADILALAAQASSVLAQGPS  142

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W V LGRRDG TAN+  AN +LP PF+ L  L   FT  GLN  DLVALSGAHTFGRA C
Sbjct  143   WTVPLGRRDGLTANRTLANQNLPAPFNTLVQLKAAFTAQGLNTTDLVALSGAHTFGRAHC  202

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
               F  RL+NFS+TG+PDPTLNTTYL  L+ +CP GG G+ +TN DPTT D FD NY+SNL
Sbjct  203   AQFVGRLYNFSSTGSPDPTLNTTYLQQLRTICPNGGPGTNLTNFDPTTPDKFDKNYYSNL  262

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q  +GLL+SDQELFSTSGA TI+IVN FS +Q AFF+SF  +MI MGNI  LTG+ GEIR
Sbjct  263   QVKKGLLQSDQELFSTSGADTISIVNKFSTDQNAFFESFKAAMIKMGNIGVLTGTKGEIR  322

Query  1007  LNCRRLN  1027
               C  +N
Sbjct  323   KQCNFVN  329



>gb|AAO13837.1|AF403735_1 extensin peroxidase [Lupinus albus]
Length=355

 Score =   378 bits (970),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 196/319 (61%), Positives = 236/319 (74%), Gaps = 5/319 (2%)
 Frame = +2

Query  71    AMAVAIFIFFS----QSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHF  238
             A+   + +F +     S+AQLS+ FY   CPN+ +IV  V   A ++D RIGASL+RLHF
Sbjct  10    ALCCVVIVFITALPFSSDAQLSTLFYDKKCPNLHAIVRNVTSNASKSDPRIGASLVRLHF  69

Query  239   HDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADI  418
             HDCFV GCD S+LL NN  TIVSE+ A  NNNS RG DVV+ IKTAVENACPGVVSCADI
Sbjct  70    HDCFVQGCDASILL-NNTATIVSEQQAFPNNNSIRGLDVVNQIKTAVENACPGVVSCADI  128

Query  419   lalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN  598
             L LA+E +V L  GP W V LGRRD  TAN+  AN +LP P   L  L   F    L  +
Sbjct  129   LTLAAEISVVLGNGPDWKVPLGRRDSLTANRTLANQNLPAPSSTLDQLKSAFAVQNLTTS  188

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNL  778
             DLVALSGAH+FGRA C  F NRL+NFSN+G+PDP+LNTTYL TL+ +CP GG+G+ +TN 
Sbjct  189   DLVALSGAHSFGRAHCNFFVNRLYNFSNSGSPDPSLNTTYLQTLRTICPNGGAGTNLTNF  248

Query  779   DPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMI  958
             DPTT DTFD NY+SNLQ ++GLL+SDQELFST+GA TI+ VN+FS NQT FF++F  SMI
Sbjct  249   DPTTPDTFDKNYYSNLQVHKGLLQSDQELFSTTGADTISTVNSFSTNQTLFFEAFKVSMI  308

Query  959   NMGNISPLTGSSGEIRLNC  1015
              MGNIS LTG+ GEIR +C
Sbjct  309   KMGNISVLTGNQGEIRKHC  327



>gb|AFK40247.1| unknown [Medicago truncatula]
Length=355

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 230/307 (75%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             S+AQLS TFYS TCP VSSIVS V+    + D R+ ASL+RLHFHD FV GCD S+LL N
Sbjct  24    SDAQLSPTFYSKTCPTVSSIVSNVLTNVSKTDQRMLASLVRLHFHDRFVLGCDASVLL-N  82

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             N  TIVSE+ A  NNNS RG DVV+ IKTA+E+ACP  VSCADILALA++++  LA GPS
Sbjct  83    NTATIVSEQQAFPNNNSLRGLDVVNQIKTAIESACPNTVSCADILALAAQASSVLAQGPS  142

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W V LGRRDG TAN+  AN +LP PF+ L  L   FT  GLN  DLVALSGAHTFGRA C
Sbjct  143   WTVPLGRRDGLTANRTLANQNLPAPFNTLVQLKAAFTAQGLNTTDLVALSGAHTFGRAHC  202

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
               F  RL+NFS+TG+PDPTLNTTYL  L+ +CP GG G+ +TN DPTT D FD NY+SNL
Sbjct  203   AQFVGRLYNFSSTGSPDPTLNTTYLQQLRTICPNGGPGTNLTNFDPTTPDKFDKNYYSNL  262

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q  +GLL+SDQELFSTSGA TI+IVN FS +Q AF +SF  +MI MGNI  LTG+ GEIR
Sbjct  263   QVKKGLLQSDQELFSTSGADTISIVNKFSTDQNAFLESFKAAMIKMGNIGVLTGTKGEIR  322

Query  1007  LNCRRLN  1027
               C  +N
Sbjct  323   KQCNFVN  329



>gb|AGN03454.1| class III secretory peroxidase [Ginkgo biloba]
 gb|AGN03455.1| class III peroxidase [Ginkgo biloba]
Length=327

 Score =   374 bits (959),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 241/325 (74%), Gaps = 1/325 (0%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             +F+A     +  F+   ++NAQL+  +Y T+CP   +I+  V+QQA+Q D R+ ASL+RL
Sbjct  4     TFAACFLTFLISFLCVKKTNAQLTPLYYQTSCPTAEAIIRPVVQQAVQRDPRMAASLLRL  63

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFVNGCDGS+LLD+  +T   EK A  N NS RGF+V+DNIK AVE +C  VVSCA
Sbjct  64    HFHDCFVNGCDGSVLLDDT-STFTGEKSAGPNLNSLRGFEVIDNIKAAVEKSCNSVVSCA  122

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILA+A+  AV LAGGPSW  +LGRRD  TA+   ANT +P P D L  +  KF  VGL+
Sbjct  123   DILAIAARDAVVLAGGPSWTPMLGRRDSRTASASTANTVMPAPNDTLGIIISKFRAVGLS  182

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
             V D V LSGAHT GRA+C +F+ RL+NF NTGNPDP +N  YL TL+ +CP+GG+ + VT
Sbjct  183   VQDCVTLSGAHTIGRARCSSFSARLYNFGNTGNPDPAINPFYLNTLRGICPRGGNANAVT  242

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             +LD  T D FDN+YF+NL+ N GLL+SDQELFST+GA+T A+VN +S NQ  FFQ+F  S
Sbjct  243   SLDQRTPDRFDNSYFTNLRINEGLLQSDQELFSTTGASTTALVNLYSNNQIVFFQNFQNS  302

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MINMGNI PLTG++GEIR NCR++N
Sbjct  303   MINMGNIKPLTGNNGEIRTNCRKVN  327



>gb|AFK40001.1| unknown [Lotus japonicus]
Length=350

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/330 (59%), Positives = 236/330 (72%), Gaps = 4/330 (1%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFS---QSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGA  217
             M S S L+A+   + +F      SNAQL  +FY  TCP V SIV  V+++  + D R+ A
Sbjct  1     MRSLSTLIALLCVVVVFGGLSLSSNAQLDPSFYRNTCPKVHSIVREVVREVSKKDPRMLA  60

Query  218   SLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPG  397
             SL RLHFHDCFV GCD S+LL NN  TI+SE+ A  NNNS RG DV++ IKT+VE+ACP 
Sbjct  61    SLDRLHFHDCFVQGCDASILL-NNTNTILSEQQAFPNNNSIRGLDVINQIKTSVESACPN  119

Query  398   VVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFT  577
              VSCADILALASE +  LA GP W V LGRRDG TAN+  AN +LP P   L  L + F 
Sbjct  120   TVSCADILALASEISSRLAKGPDWKVPLGRRDGRTANRTAANENLPGPSFSLDRLKKAFG  179

Query  578   NVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGS  757
             + GLN NDLVALSGAHTFGRA C  F +RL+NF+ TG PDPTL+T YL  L+++CP GG 
Sbjct  180   DQGLNTNDLVALSGAHTFGRASCSLFVDRLYNFNKTGKPDPTLDTNYLQQLRKICPNGGP  239

Query  758   GSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQ  937
             GST+ N DPTT D  D NYF+NL+  +GLL+SDQELFSTSGA TI+IVN FS+NQ A F+
Sbjct  240   GSTLANFDPTTPDILDENYFTNLRAKKGLLQSDQELFSTSGADTISIVNKFSSNQAASFE  299

Query  938   SFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             SF  +MI MGNI  LTG+ GEIR +C  +N
Sbjct  300   SFEAAMIKMGNIGVLTGNRGEIRKHCNFVN  329



>ref|XP_008679463.1| PREDICTED: uncharacterized protein LOC100192603 isoform X1 [Zea 
mays]
 gb|ACF85874.1| unknown [Zea mays]
 tpg|DAA44276.1| TPA: hypothetical protein ZEAMMB73_993400 [Zea mays]
Length=336

 Score =   374 bits (959),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 190/324 (59%), Positives = 237/324 (73%), Gaps = 2/324 (1%)
 Frame = +2

Query  56    FSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLH  235
              + L++ A+A+        AQLSS +Y  TCP V  +   V+++A + D RI ASL RLH
Sbjct  13    LAVLVSAAIALGFGVRAGEAQLSSEYYGQTCPVVHRVARRVLKKAHEADVRIYASLTRLH  72

Query  236   FHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCAD  415
             FHDCFV GCDGS+LLDN+ ++IVSEK A  NNNSARG+ VVD +K A+E ACPGVVSCAD
Sbjct  73    FHDCFVQGCDGSILLDNS-SSIVSEKFATPNNNSARGYPVVDAVKAALEEACPGVVSCAD  131

Query  416   IlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNV  595
             ILA+A++ +V L+GGP W V LGRRDGTTAN   AN +LP+PFD+L+ L +KF  VGL+ 
Sbjct  132   ILAIAAKISVELSGGPRWRVPLGRRDGTTANITAAN-NLPSPFDNLTTLQQKFGAVGLDD  190

Query  596   NDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTN  775
              DLVALSGAHTFGR QC+    RL+NFS T  PDPTL+  Y A L   CP+ G+ S + +
Sbjct  191   TDLVALSGAHTFGRVQCQFVTARLYNFSGTNRPDPTLDRGYRAFLSLRCPRAGNASALND  250

Query  776   LDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSM  955
             LDPTT DTFDNNY++N++  RG L+SDQEL ST GA T  IV  F+A+Q  FF+SF +SM
Sbjct  251   LDPTTPDTFDNNYYTNIEARRGTLQSDQELLSTPGAPTAPIVGRFAASQKEFFRSFARSM  310

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             +NMGNI  LTGS GEIR NCR +N
Sbjct  311   VNMGNIQVLTGSQGEIRKNCRMVN  334



>gb|ABK22032.1| unknown [Picea sitchensis]
Length=324

 Score =   373 bits (957),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/320 (61%), Positives = 238/320 (74%), Gaps = 4/320 (1%)
 Frame = +2

Query  68    LAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDC  247
             L + + I  F   S+AQLS TFY  TCPNVSSIV  V+QQALQ D+R+ ASLI L FHDC
Sbjct  8     LNVELCILAFVVCSSAQLSPTFYQNTCPNVSSIVGQVLQQALQKDSRMAASLIHLFFHDC  67

Query  248   FVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlal  427
             FVNGCDGS+LL N+      E+    N +S RGF VVD++K AVEN C   VSCADILA+
Sbjct  68    FVNGCDGSVLLSNSAN-FTGEQT---NTSSLRGFGVVDDMKAAVENECSATVSCADILAI  123

Query  428   asesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLV  607
             A+E +VS++GGPSWNV LGRRD TTAN     T+  +P D LS +  KF  +G +V D+V
Sbjct  124   AAERSVSMSGGPSWNVQLGRRDSTTANATLVKTAFASPTDSLSTIITKFQKLGFSVTDVV  183

Query  608   ALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPT  787
             ALSGAHT GRA+C+TF++RL+NFS T  PDPTLN+ YL+TLQ  CPQ G+ S++T+ DP 
Sbjct  184   ALSGAHTIGRARCQTFSSRLYNFSGTAKPDPTLNSCYLSTLQSACPQNGNMSSITSFDPG  243

Query  788   TSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMG  967
             T +TFDNNYF NLQNN GLL+SDQEL ST+GA+TI  VN FS +Q  FF +F  SMI MG
Sbjct  244   TPNTFDNNYFINLQNNMGLLQSDQELLSTTGASTIFTVNEFSNSQANFFSNFSNSMIKMG  303

Query  968   NISPLTGSSGEIRLNCRRLN  1027
             NISPLTG+ GEIRLNC ++N
Sbjct  304   NISPLTGTRGEIRLNCWKVN  323



>ref|XP_007014794.1| Peroxidase 2, putative [Theobroma cacao]
 gb|EOY32413.1| Peroxidase 2, putative [Theobroma cacao]
Length=322

 Score =   373 bits (957),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/328 (59%), Positives = 251/328 (77%), Gaps = 7/328 (2%)
 Frame = +2

Query  47    MASFSALLAM-AVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASL  223
             M+SF  +  +  ++  +   +SNAQLS TFY+ TCPNVSSIV +V+Q A QND  I   L
Sbjct  1     MSSFKIIATLFLLSTAMMLRESNAQLSGTFYAKTCPNVSSIVRSVLQNAQQNDIWIFPKL  60

Query  224   IRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVV  403
             +RLHFHDCFV+GCD SLLL  NGT   SEK A  N ++  G+ V+D+IKTA+E++CP VV
Sbjct  61    VRLHFHDCFVHGCDASLLL--NGTD--SEKTATPNLSTG-GYSVIDDIKTALEHSCPRVV  115

Query  404   SCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNV  583
             SCADILALA++ +VSLAGGP+W V LGRRDG  A++  A  ++P+  + L+N+T KF N+
Sbjct  116   SCADILALAAQISVSLAGGPTWEVPLGRRDGRAAHRE-AIRAIPSAHESLNNITAKFKNM  174

Query  584   GLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGS  763
             GL+  DLVALSG HTFGRAQC +F +RL+NF  +G  DPTLN TYL  L Q+CP+G  G 
Sbjct  175   GLDSTDLVALSGVHTFGRAQCSSFMDRLYNFKGSGKSDPTLNATYLKALTQLCPKGRDGR  234

Query  764   TVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSF  943
             ++ +LD +TS TFDNNYF NLQN+RGLL+SDQELFSTSGA T+AIVN F+ +Q+ FF SF
Sbjct  235   SLIDLDESTSLTFDNNYFLNLQNHRGLLQSDQELFSTSGADTVAIVNRFANSQSQFFDSF  294

Query  944   VQSMINMGNISPLTGSSGEIRLNCRRLN  1027
              +SM+ MGNISPLTGS+GEIR +CR++N
Sbjct  295   AKSMVKMGNISPLTGSNGEIRSDCRKIN  322



>emb|CAA62226.1| peroxidase1B [Medicago sativa]
Length=355

 Score =   374 bits (959),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 195/322 (61%), Positives = 231/322 (72%), Gaps = 1/322 (0%)
 Frame = +2

Query  62    ALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFH  241
             AL  + V +      SNAQL  +FY  TCPNVSSIV  VI+   + D R+ ASL+RLHFH
Sbjct  10    ALCCIVVVLGGLPFSSNAQLDPSFYRNTCPNVSSIVREVIRSVSKKDPRMLASLVRLHFH  69

Query  242   DCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIl  421
             DCFV GCD S+LL N   T+VSE+DA  N NS RG DVV+ IKTAVE ACP  VSCADIL
Sbjct  70    DCFVQGCDASVLL-NKTDTVVSEQDAFPNRNSLRGLDVVNQIKTAVEKACPNTVSCADIL  128

Query  422   alasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVND  601
             AL++E + +LA GP W V LGRRDG TANQ  AN +LP PF+    L   F   GL+  D
Sbjct  129   ALSAELSSTLADGPDWKVPLGRRDGLTANQLLANQNLPAPFNTTDQLKAAFAAQGLDTTD  188

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRA C  F +RL+NFS TG+PDPTLNTTYL  L+ +CP GG G+ +TN D
Sbjct  189   LVALSGAHTFGRAHCSLFVSRLYNFSGTGSPDPTLNTTYLQQLRTICPNGGPGTNLTNFD  248

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMIN  961
             PTT D FD NY+SNLQ  +GLL+SDQELFSTSG+ TI+IVN F+ +Q AFF+SF  +MI 
Sbjct  249   PTTPDKFDKNYYSNLQVKKGLLQSDQELFSTSGSDTISIVNKFATDQKAFFESFRAAMIK  308

Query  962   MGNISPLTGSSGEIRLNCRRLN  1027
             MGNI  LTG+ GEIR  C  +N
Sbjct  309   MGNIGVLTGNQGEIRKQCNFVN  330



>gb|KEH37049.1| peroxidase family protein [Medicago truncatula]
Length=344

 Score =   373 bits (958),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 196/305 (64%), Positives = 230/305 (75%), Gaps = 1/305 (0%)
 Frame = +2

Query  113   AQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNG  292
             AQLS +FYS TCP +  IV  VI +A   D RIGASLIRLHFHDCFV GCDGS+LL NN 
Sbjct  22    AQLSPSFYSQTCPFLYPIVFRVIFEASLTDPRIGASLIRLHFHDCFVQGCDGSVLL-NNT  80

Query  293   TTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWN  472
              TIVSE+DA  N NS RG DVV+ IKTAVEN CP  VSCADIL +A++ A  L GGPSW 
Sbjct  81    NTIVSEQDALPNINSLRGLDVVNQIKTAVENECPATVSCADILTIAAQVASVLGGGPSWQ  140

Query  473   VLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRT  652
             + LGRRD  TANQ  AN +LP PF  L  L   F   GLN  DLV LSGAHTFGRA+C T
Sbjct  141   IPLGRRDSLTANQALANQNLPAPFFTLDQLKAAFLVQGLNTTDLVTLSGAHTFGRAKCST  200

Query  653   FNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQN  832
             F NRL+NF++TGNPD TLNTTYL TL+++CPQ G+G+ +TNLD TT + FDN ++SNLQ+
Sbjct  201   FINRLYNFNSTGNPDQTLNTTYLQTLREICPQNGTGNNLTNLDLTTPNQFDNKFYSNLQS  260

Query  833   NRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLN  1012
             ++GLL+SDQELFST  A TIAIVN+FS+NQ  FF++F  SMI M NIS LTG+ GEIRL 
Sbjct  261   HKGLLQSDQELFSTPNADTIAIVNSFSSNQALFFENFRVSMIKMANISVLTGNEGEIRLQ  320

Query  1013  CRRLN  1027
             C  +N
Sbjct  321   CNFIN  325



>ref|XP_007014795.1| Peroxidase 2, putative [Theobroma cacao]
 gb|EOY32414.1| Peroxidase 2, putative [Theobroma cacao]
Length=319

 Score =   372 bits (954),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/329 (60%), Positives = 248/329 (75%), Gaps = 12/329 (4%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLI  226
             M SF  + A+ + + +    SNAQLS TFYS TC +V SIV  V++QA+QND R+GA +I
Sbjct  1     MPSFQ-MTAIVLLLSVMLGGSNAQLSPTFYSNTCSDVVSIVRGVLEQAVQNDIRVGAKII  59

Query  227   RLHFHDCFVNGCDGSLLLDNNGTT-IVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVV  403
             R HFHDC VNGCDGSLLLD++    IVSEKD    N +   F +VD+IKTA+EN+CPGVV
Sbjct  60    RAHFHDCMVNGCDGSLLLDDDAANGIVSEKDTPP-NETIEAFQIVDDIKTALENSCPGVV  118

Query  404   SCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNV  583
             SCADILAL S+  VSLAGGP+W V LGRRD  TANQ G  + +P+P DD   L RKF +V
Sbjct  119   SCADILALGSQIGVSLAGGPTWQVPLGRRDSRTANQAGT-SGIPSPLDDFDELQRKFRDV  177

Query  584   GL-NVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSG  760
             GL +  DLVALSGAHTFGRA+C TF++R+         D TL+ T+   L Q+CP+GG+G
Sbjct  178   GLDDSTDLVALSGAHTFGRARCSTFSHRI-------GTDTTLDPTFSQVLGQICPEGGNG  230

Query  761   STVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQS  940
               +TNLD +T+D FDNNY++NLQNNRGLL++DQ LFST+GA T++IVN F+ +QT FF +
Sbjct  231   DVLTNLDSSTADDFDNNYYTNLQNNRGLLQTDQSLFSTAGANTVSIVNRFANSQTDFFDT  290

Query  941   FVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FVQSMIN+GN+SPLTG++GEIR NCRR+N
Sbjct  291   FVQSMINLGNLSPLTGNNGEIRANCRRIN  319



>dbj|BAD97439.1| peroxidase [Pisum sativum]
Length=350

 Score =   373 bits (957),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 189/307 (62%), Positives = 229/307 (75%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             S+AQL ++FY  TCP+V SIV  VI+   + D R+ ASL+RLHFHDCFV GCD S+LL N
Sbjct  25    SDAQLDASFYRNTCPDVHSIVREVIRNVSKTDPRMLASLVRLHFHDCFVQGCDASVLL-N  83

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
                T+V+E++A  N NS RG DV++ IKTAVENACP  VSCADILAL+++ +  LA GP+
Sbjct  84    KTDTVVTEQEAFPNINSLRGLDVINRIKTAVENACPNTVSCADILALSAQISSILAQGPN  143

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W V LGRRDG TANQ  ANT+LP PF+ L  L   F   GL   DLVALSGAHTFGR+ C
Sbjct  144   WKVPLGRRDGLTANQSLANTNLPAPFNTLDELKAAFAKQGLTPTDLVALSGAHTFGRSHC  203

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
               F +RL+NFSNTG PDP+LNTTYL  L++ CP+GGSG+ + N DPTT D FD NY+SNL
Sbjct  204   SLFVDRLYNFSNTGKPDPSLNTTYLQELRKTCPKGGSGTNLANFDPTTPDRFDKNYYSNL  263

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q  +GLL+SDQELFSTSGA TI IVN FSA++ AFF SF  +MI MGNI  LTG+ GEIR
Sbjct  264   QVKKGLLQSDQELFSTSGADTITIVNKFSADKNAFFDSFETAMIKMGNIGVLTGNKGEIR  323

Query  1007  LNCRRLN  1027
              +C  +N
Sbjct  324   KHCNFVN  330



>ref|XP_006597070.1| PREDICTED: peroxidase, pathogen-induced isoform X1 [Glycine max]
Length=710

 Score =   385 bits (988),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 200/307 (65%), Positives = 233/307 (76%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             S+AQL  +FY  TCP V SIV  V++   ++D R+ ASLIRLHFHDCFV GCD S+LL N
Sbjct  382   SDAQLDPSFYRDTCPTVHSIVREVVRNVSKSDPRMLASLIRLHFHDCFVQGCDASILL-N  440

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             N  TI SE+ A  NNNS RG DVV+ IKTAVENACPGVVSCADILALA+E +  LA GP 
Sbjct  441   NTATIESEQQAFPNNNSIRGLDVVNQIKTAVENACPGVVSCADILALAAEISSVLAHGPD  500

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W V LGRRD  TAN+  AN +LP PF +L+ L   F   GLN  DLVALSGAHT G+AQC
Sbjct  501   WKVPLGRRDSLTANRTLANQNLPAPFFNLTQLKDAFAVQGLNTTDLVALSGAHTIGKAQC  560

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
             R F +RL+NFSNTGNPDPTLNTTYL TL  +CP GG G+ +TN DPTT DT D NY+SNL
Sbjct  561   RFFVDRLYNFSNTGNPDPTLNTTYLQTLSAICPNGGPGTNLTNFDPTTPDTLDKNYYSNL  620

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q ++GLL+SDQELFST+GA TI+IVN+FS+NQT FF++F  SMI MGNI  LTGS GEIR
Sbjct  621   QVHKGLLQSDQELFSTTGADTISIVNSFSSNQTLFFENFKASMIKMGNIGVLTGSQGEIR  680

Query  1007  LNCRRLN  1027
               C  +N
Sbjct  681   QQCNFVN  687


 Score =   357 bits (916),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 188/306 (61%), Positives = 216/306 (71%), Gaps = 2/306 (1%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
             +AQL  +FY  TCP V SIV  V++   + D R+ ASLIRLHFHDCFV GCD S+LL NN
Sbjct  26    DAQLDPSFYRDTCPRVHSIVREVVRNVSKKDPRMLASLIRLHFHDCFVQGCDASVLL-NN  84

Query  290   GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSW  469
               TI SE+ A  NNNS RG DVV++IKTAVE ACPGVVSCADIL LASE +  L GGP W
Sbjct  85    TATIESEQQALPNNNSLRGLDVVNDIKTAVEKACPGVVSCADILTLASEISSVLGGGPDW  144

Query  470   NVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCR  649
              V LGRRD  TAN+  AN +LP PF +LS L   F   GL+  DLVALSGAHTFGRA C 
Sbjct  145   KVPLGRRDSLTANRNLANQNLPAPFFNLSRLKSAFAVQGLDTTDLVALSGAHTFGRAHCN  204

Query  650   TFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQ  829
                +RL+NFS TG PDPTL+TTYL  L+Q+CP GG  + V N DP T D  D  YFSNLQ
Sbjct  205   FILDRLYNFSGTGKPDPTLDTTYLQQLRQICPNGGPNNLV-NFDPVTPDKIDRVYFSNLQ  263

Query  830   NNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
               +GLL+SDQELFST GA TI IVN FS++Q  FF +F  SMI MGNI  LTG  GEIR 
Sbjct  264   VKKGLLQSDQELFSTPGADTIPIVNRFSSDQKVFFDAFEASMIKMGNIGVLTGKKGEIRK  323

Query  1010  NCRRLN  1027
             +C  +N
Sbjct  324   HCNFVN  329



>gb|AII99875.1| peroxidase [Cicer arietinum]
Length=589

 Score =   380 bits (976),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 197/319 (62%), Positives = 231/319 (72%), Gaps = 1/319 (0%)
 Frame = +2

Query  59    SALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHF  238
             +AL  + V   +    SNAQL  +FYS TCPNVSSIV  V++   + D R+ ASL+RLHF
Sbjct  9     TALCYIVVVFGVLPFSSNAQLDPSFYSKTCPNVSSIVREVVRNVSKTDPRMLASLVRLHF  68

Query  239   HDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADI  418
             HDCFV GCD S+LL N   TIVSE+ A  NNNS RG DVV+ IKTA+E+ CP  VSCADI
Sbjct  69    HDCFVQGCDASVLL-NKTDTIVSEQQAFPNNNSLRGLDVVNQIKTALESVCPNTVSCADI  127

Query  419   lalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN  598
             LALA+E + +LAGGP W V LGRRD  TANQ  AN +LP PFD L  L   F   GLN  
Sbjct  128   LALAAELSSTLAGGPDWKVPLGRRDSLTANQSLANINLPAPFDTLDKLKSAFAAQGLNTT  187

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNL  778
             DLVALSGAHTFGRA C  F +RL+NFSNTG+PDPTLNTTYL  L+++CP  G G+ + N 
Sbjct  188   DLVALSGAHTFGRAHCNLFVSRLYNFSNTGSPDPTLNTTYLKDLRKICPNSGPGNNLANF  247

Query  779   DPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMI  958
             DPTT D FD NY+SNL+  +GLL+SDQELFSTSGA TI IVN FS +Q AFF+SF  +MI
Sbjct  248   DPTTPDKFDKNYYSNLKVKKGLLQSDQELFSTSGADTIDIVNKFSTDQKAFFESFKAAMI  307

Query  959   NMGNISPLTGSSGEIRLNC  1015
              MGNI  LTG+ GEIR  C
Sbjct  308   KMGNIGVLTGNKGEIRKQC  326


 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/234 (64%), Positives = 174/234 (74%), Gaps = 0/234 (0%)
 Frame = +2

Query  326   NNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTA  505
             NNNS RG DVV+ IKTA+E+ CP  VSCADILALA+E + +LAGGP W V LGRRD  TA
Sbjct  333   NNNSLRGLDVVNQIKTALESVCPNTVSCADILALAAELSSTLAGGPDWKVPLGRRDSLTA  392

Query  506   NQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNT  685
             NQ  AN +LP PFD L  L   F   GLN  DLVALSGAHTFGRA C  F +RL+NFSNT
Sbjct  393   NQSLANINLPAPFDTLDKLKSAFAAQGLNTTDLVALSGAHTFGRAHCNLFVSRLYNFSNT  452

Query  686   GNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQEL  865
             G+PDPTLNTTYL  L+++CP  G G+ + N DPTT D FD NY+SNL+  +GLL+SDQEL
Sbjct  453   GSPDPTLNTTYLQDLRKICPNSGPGNNLANFDPTTPDKFDKNYYSNLKVKKGLLQSDQEL  512

Query  866   FSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             FSTSGA TI IVN FS +Q AFF+SF  +MI MGNI  LTG+ GEIR  C  +N
Sbjct  513   FSTSGADTIDIVNKFSTDQKAFFESFKAAMIKMGNIGVLTGNKGEIRKQCNFIN  566



>ref|XP_002465591.1| hypothetical protein SORBIDRAFT_01g041770 [Sorghum bicolor]
 gb|EER92589.1| hypothetical protein SORBIDRAFT_01g041770 [Sorghum bicolor]
Length=337

 Score =   371 bits (953),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 191/324 (59%), Positives = 237/324 (73%), Gaps = 2/324 (1%)
 Frame = +2

Query  56    FSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLH  235
              + L+  AVA+        A+L S +Y  TCP+V  +V  V+++A + D RI ASL RLH
Sbjct  14    LAVLMFAAVALGFGVRAGAAELCSEYYDQTCPDVHRVVRRVLKKAHEADVRIYASLTRLH  73

Query  236   FHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCAD  415
             FHDCFV GCDGS+LLDN+ ++IVSEK A  NNNSARG+ VVD +K A+E ACPGVVSCAD
Sbjct  74    FHDCFVQGCDGSILLDNS-SSIVSEKFATPNNNSARGYPVVDAVKAALEEACPGVVSCAD  132

Query  416   IlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNV  595
             ILA+A++ +V L+GGP W V LGRRDGTTAN   AN +LP+PFD+L+ L +KF  VGL+ 
Sbjct  133   ILAIAAKISVELSGGPRWRVPLGRRDGTTANITAAN-NLPSPFDNLTTLQQKFGAVGLDD  191

Query  596   NDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTN  775
              DLVALSGAHTFGR QC+    RL+NFS T  PDPTL+  Y A L   CP+GG+ S + +
Sbjct  192   TDLVALSGAHTFGRVQCQFVTARLYNFSGTNRPDPTLDRGYRAFLSLRCPRGGNASALND  251

Query  776   LDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSM  955
             LDPTT DTFDNNY++N++  RG L+SDQEL ST GA T  IV  F+ +Q  FF+SF +SM
Sbjct  252   LDPTTPDTFDNNYYTNVEARRGTLQSDQELLSTPGAPTAPIVGRFAGSQKEFFKSFTRSM  311

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             INMGNI  LTGS GEIR NCR +N
Sbjct  312   INMGNIQVLTGSQGEIRNNCRVVN  335



>gb|AFK35578.1| unknown [Medicago truncatula]
Length=344

 Score =   372 bits (954),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 195/305 (64%), Positives = 230/305 (75%), Gaps = 1/305 (0%)
 Frame = +2

Query  113   AQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNG  292
             AQLS +FYS TCP +  IV  VI +A   D RIGASLIRLHFHDCFV GCDGS+LL NN 
Sbjct  22    AQLSPSFYSQTCPFLYPIVFRVIFEASLTDPRIGASLIRLHFHDCFVQGCDGSVLL-NNT  80

Query  293   TTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWN  472
              TIVSE+DA  N NS RG DVV+ I+TAVEN CP  VSCADIL +A++ A  L GGPSW 
Sbjct  81    NTIVSEQDALPNINSLRGLDVVNQIETAVENECPATVSCADILTIAAQVASVLGGGPSWQ  140

Query  473   VLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRT  652
             + LGRRD  TANQ  AN +LP PF  L  L   F   GLN  DLV LSGAHTFGRA+C T
Sbjct  141   IPLGRRDSLTANQALANQNLPAPFFTLDQLKAAFLVQGLNTTDLVTLSGAHTFGRAKCST  200

Query  653   FNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQN  832
             F NRL+NF++TGNPD TLNTTYL TL+++CPQ G+G+ +TNLD TT + FDN ++SNLQ+
Sbjct  201   FINRLYNFNSTGNPDQTLNTTYLQTLREICPQNGTGNNLTNLDLTTPNQFDNKFYSNLQS  260

Query  833   NRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLN  1012
             ++GLL+SDQELFST  A TIAIVN+FS+NQ  FF++F  SMI M NIS LTG+ GEIRL 
Sbjct  261   HKGLLQSDQELFSTPNADTIAIVNSFSSNQALFFENFRVSMIKMANISVLTGNEGEIRLQ  320

Query  1013  CRRLN  1027
             C  +N
Sbjct  321   CNFIN  325



>gb|AAL85344.1|AF479623_1 peroxidase [Ficus carica]
Length=364

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 209/324 (65%), Positives = 246/324 (76%), Gaps = 2/324 (1%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             +FS  L + +    F     AQL+ TFY  TCPNV+SIV  VI+ ALQ D RI ASLIRL
Sbjct  2     AFSHHLLVTLFFSAFVVGGYAQLTPTFYDDTCPNVTSIVRGVIEGALQTDPRIAASLIRL  61

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFV GCDGSLLLDN+  TIVSEK+A  NNNS RGF+VVD+IKTA+ENACPGVVSCA
Sbjct  62    HFHDCFVIGCDGSLLLDNS-DTIVSEKEALGNNNSVRGFNVVDDIKTALENACPGVVSCA  120

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFT-NVGL  589
             DILA+A+E +V L+GG SW V  GRRD   AN+  AN  LP+PF  L  L   F  N GL
Sbjct  121   DILAIAAEESVWLSGGTSWPVPSGRRDSLIANRTLANEVLPSPFLTLDQLKANFLDNQGL  180

Query  590   NVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTV  769
             N  DLVALSGAHTFGRAQC+ F+ RL+NF++TG+PDPTLNTT L TL+++CP+GG+GS +
Sbjct  181   NSTDLVALSGAHTFGRAQCQFFSRRLYNFNDTGSPDPTLNTTLLETLRKICPEGGNGSVI  240

Query  770   TNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQ  949
             T+LD TT D FDN YFSNL+   G+L++DQ LFSTSGA T AIVN FSA+Q AFF SFV 
Sbjct  241   TDLDQTTPDAFDNKYFSNLEVEYGILQTDQVLFSTSGADTTAIVNRFSADQNAFFDSFVA  300

Query  950   SMINMGNISPLTGSSGEIRLNCRR  1021
             SMI MGNI  LTG+  +IR NCRR
Sbjct  301   SMIKMGNIRVLTGNERKIRSNCRR  324



>gb|AES64745.2| peroxidase family protein [Medicago truncatula]
Length=355

 Score =   371 bits (953),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 193/322 (60%), Positives = 229/322 (71%), Gaps = 1/322 (0%)
 Frame = +2

Query  62    ALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFH  241
             AL  + V +      SNAQL  +FY  TCPNVSSIV  VI+   + D R+  SL+RLHFH
Sbjct  10    ALCCIVVVLGGLPFSSNAQLDPSFYRNTCPNVSSIVREVIRSVSKKDPRMLGSLVRLHFH  69

Query  242   DCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIl  421
             DCFV GCD S+LL N   T+VSE+DA  N NS RG DVV+ IKTAVE ACP  VSCADIL
Sbjct  70    DCFVQGCDASVLL-NKTDTVVSEQDAFPNRNSLRGLDVVNQIKTAVEKACPNTVSCADIL  128

Query  422   alasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVND  601
             AL++E + +LA GP W V LGRRDG TANQ  AN +LP PF+    L   F   GL+  D
Sbjct  129   ALSAELSSTLADGPDWKVPLGRRDGLTANQLLANKNLPAPFNTTDQLKAAFAAQGLDTTD  188

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHTFGRA C  F +RL+NF+ TG+PDPTLNTTYL  L+ +CP GG G+ +TN D
Sbjct  189   LVALSGAHTFGRAHCSLFVSRLYNFNGTGSPDPTLNTTYLQQLRTICPNGGPGTNLTNFD  248

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMIN  961
             PTT D FD NY+SNLQ  +GLL+SDQELFSTSG+ TI+IVN F+ +Q AFF+SF  +MI 
Sbjct  249   PTTPDKFDKNYYSNLQVKKGLLQSDQELFSTSGSDTISIVNKFATDQKAFFESFKAAMIK  308

Query  962   MGNISPLTGSSGEIRLNCRRLN  1027
             MGNI  LTG  GEIR  C  +N
Sbjct  309   MGNIGVLTGKQGEIRKQCNFVN  330



>ref|XP_003594494.1| Peroxidase [Medicago truncatula]
Length=814

 Score =   385 bits (990),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 242/332 (73%), Gaps = 5/332 (2%)
 Frame = +2

Query  44    KMASFSAL---LAMAVAIF-IFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARI  211
             KM S  A+   L   VA+F +    SNAQL+ +FYS TCPNVSSIV  VI+   + D R+
Sbjct  91    KMNSLRAVAIALCFIVALFGVLPFPSNAQLNPSFYSKTCPNVSSIVREVIRNVSKTDTRM  150

Query  212   GASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENAC  391
              ASL+RLHFHDCFV GCD S+LL NN  TIVSE+DA  N NS RG DVV+ IKTAVE AC
Sbjct  151   LASLVRLHFHDCFVQGCDASVLL-NNTATIVSEQDAFPNRNSLRGLDVVNQIKTAVEKAC  209

Query  392   PGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRK  571
             P  VSCADILALA+E + +L+ GP W V LGRRDG TANQ  AN +LP PF+ L  L   
Sbjct  210   PNTVSCADILALAAELSSTLSQGPDWKVPLGRRDGLTANQSLANQNLPAPFNSLDQLKAA  269

Query  572   FTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQG  751
             F + GL+  DLVALSGAHTFGRA C  F +RL+NFSNTG+PDPTLN TYL  L+ +CP G
Sbjct  270   FASQGLSTTDLVALSGAHTFGRAHCSLFVSRLYNFSNTGSPDPTLNATYLQQLRNICPNG  329

Query  752   GSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAF  931
             G G+ + + DPTT D FD NY+SNLQ  +GLL+SDQELFSTSGA TI+IVNNF+ +Q AF
Sbjct  330   GPGTPLASFDPTTPDKFDKNYYSNLQVKKGLLQSDQELFSTSGADTISIVNNFATDQKAF  389

Query  932   FQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             F+SF  +MI MGNI  LTG+ GEIR  C  +N
Sbjct  390   FESFKAAMIKMGNIGVLTGNQGEIRKQCNFVN  421


 Score =   372 bits (954),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 190/307 (62%), Positives = 224/307 (73%), Gaps = 1/307 (0%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             SNAQL  +FY  TCPNVSSIV  VI+   + D R+  SL+RLHFHDCFV GCD S+LL N
Sbjct  484   SNAQLDPSFYRNTCPNVSSIVREVIRSVSKKDPRMLGSLVRLHFHDCFVQGCDASVLL-N  542

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
                T+VSE+DA  N NS RG DVV+ IKTAVE ACP  VSCADILAL++E + +LA GP 
Sbjct  543   KTDTVVSEQDAFPNRNSLRGLDVVNQIKTAVEKACPNTVSCADILALSAELSSTLADGPD  602

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W V LGRRDG TANQ  AN +LP PF+    L   F   GL+  DLVALSGAHTFGRA C
Sbjct  603   WKVPLGRRDGLTANQLLANKNLPAPFNTTDQLKAAFAAQGLDTTDLVALSGAHTFGRAHC  662

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
               F +RL+NF+ TG+PDPTLNTTYL  L+ +CP GG G+ +TN DPTT D FD NY+SNL
Sbjct  663   SLFVSRLYNFNGTGSPDPTLNTTYLQQLRTICPNGGPGTNLTNFDPTTPDKFDKNYYSNL  722

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q  +GLL+SDQELFSTSG+ TI+IVN F+ +Q AFF+SF  +MI MGNI  LTG  GEIR
Sbjct  723   QVKKGLLQSDQELFSTSGSDTISIVNKFATDQKAFFESFKAAMIKMGNIGVLTGKQGEIR  782

Query  1007  LNCRRLN  1027
               C  +N
Sbjct  783   KQCNFVN  789



>gb|AAB41810.1| peroxidase [Medicago sativa]
Length=347

 Score =   370 bits (950),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 196/307 (64%), Positives = 228/307 (74%), Gaps = 2/307 (1%)
 Frame = +2

Query  107   SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDN  286
             S+AQLS TFYS TCP VSSIVS V+    + D R+ ASL+RLHFHDCFV GCD S+LL N
Sbjct  17    SDAQLSPTFYSKTCPTVSSIVSNVLTNVSKTDPRMLASLVRLHFHDCFVLGCDASVLL-N  75

Query  287   NGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
             N  TIVSE+ A  NNNS RG DVV+ IKTAVE+ACP  VSCADILALA  S+V   G PS
Sbjct  76    NTATIVSEQQAFPNNNSLRGLDVVNQIKTAVESACPNTVSCADILALAQASSVLAQG-PS  134

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W V LGRRDG TAN+  AN +LP PF+ L +L    T  GL    LVALSGAHTFGRA C
Sbjct  135   WTVPLGRRDGLTANRTLANQNLPAPFNSLDHLKLHLTAQGLITPVLVALSGAHTFGRAHC  194

Query  647   RTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNL  826
               F +RL+NFS+TG+PDPTLNTTYL  L+ +CP GG G+ +TN DPTT D FD NY+SNL
Sbjct  195   AQFVSRLYNFSSTGSPDPTLNTTYLQQLRTICPNGGPGTNLTNFDPTTPDKFDKNYYSNL  254

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q  +GLL+SDQELFSTSGA TI+IV+ FS +Q AFF+SF  +MI MGNI  LTG+ GEIR
Sbjct  255   QVKKGLLQSDQELFSTSGADTISIVDKFSTDQNAFFESFKAAMIKMGNIGVLTGTKGEIR  314

Query  1007  LNCRRLN  1027
               C  +N
Sbjct  315   KQCNFVN  321



>ref|XP_004486564.1| PREDICTED: uncharacterized protein LOC101505702 [Cicer arietinum]
Length=725

 Score =   382 bits (981),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 198/332 (60%), Positives = 237/332 (71%), Gaps = 5/332 (2%)
 Frame = +2

Query  44    KMASFSALLAMAVAIFIFFS----QSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARI  211
             KM SF   L +   + +        S+AQL  +FY  TCPNV SIV  VI+   + D R+
Sbjct  370   KMKSFDLTLTVLWCVVVVLGGLPFSSDAQLDPSFYRNTCPNVHSIVREVIRNVSKTDPRM  429

Query  212   GASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENAC  391
              ASL+RLHFHDCFV GCD S+LL+N+GT IVSE+ A  NNNS RG DVV+ IKTAVEN C
Sbjct  430   LASLVRLHFHDCFVQGCDASVLLNNSGT-IVSEQQAFPNNNSLRGLDVVNKIKTAVENVC  488

Query  392   PGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRK  571
             P  VSCADILALA++ +  LA GP+W V LGRRDG TANQ  AN +LP PF  L  L   
Sbjct  489   PNTVSCADILALAAQISSILADGPNWKVPLGRRDGLTANQSLANINLPAPFHSLDQLKSA  548

Query  572   FTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQG  751
             F   GLN  DLVALSGAHTFGR+ C  F NRL+NFSNTGNPDPTLNTTYL  L+++CP  
Sbjct  549   FAAQGLNTTDLVALSGAHTFGRSHCSLFVNRLYNFSNTGNPDPTLNTTYLQELRKLCPNS  608

Query  752   GSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAF  931
             G G+ + N DPTT DTFD NY+SNL+  +GLL+SDQELFSTSGA TI+IVN FS +Q AF
Sbjct  609   GPGTNLANFDPTTPDTFDKNYYSNLKVKKGLLQSDQELFSTSGADTISIVNKFSTDQDAF  668

Query  932   FQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             F+SF  +MI M +I  +TG+ GEIR +C  +N
Sbjct  669   FESFKAAMIKMSSIGVITGNKGEIRKHCNFVN  700


 Score =   365 bits (937),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 190/323 (59%), Positives = 225/323 (70%), Gaps = 1/323 (0%)
 Frame = +2

Query  59    SALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHF  238
             S L  + V   +    SNAQL   FYS TCP + S+V  V+      D R+ ASLIRLHF
Sbjct  9     STLCCVVVVFGVLPFSSNAQLDPLFYSKTCPQLHSLVYQVLWNVSTKDPRMLASLIRLHF  68

Query  239   HDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADI  418
             HDCFV GCD S+LL NN  TIVSE+ A  N NS RG DVV+ IKT VEN CP  VSCADI
Sbjct  69    HDCFVQGCDASVLL-NNTATIVSEQQAFPNVNSLRGLDVVNEIKTKVENVCPNTVSCADI  127

Query  419   lalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN  598
             LALA+  +  L  GP+W V LGRRD  TANQ  AN +LP P  +L+ L   F   GLN N
Sbjct  128   LALAAGISSILTRGPAWMVPLGRRDSLTANQSLANQNLPGPSFNLTQLKSSFAAQGLNTN  187

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNL  778
             DLVALSGAHTFGRA+C  F +RL+NFSNTG PDPTL+TTYL  LQ++CP+ G G+T+ N 
Sbjct  188   DLVALSGAHTFGRARCSLFIDRLYNFSNTGKPDPTLDTTYLKELQKICPKNGPGTTLANF  247

Query  779   DPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMI  958
             DPTT D  DN Y+SNL+  +GLL+SDQELFST GA T +IVN FS++Q AFF+SF  +MI
Sbjct  248   DPTTPDILDNTYYSNLKVKKGLLQSDQELFSTPGADTTSIVNKFSSDQNAFFESFKNAMI  307

Query  959   NMGNISPLTGSSGEIRLNCRRLN  1027
              MGNI  LTG+ GEIR  C  +N
Sbjct  308   KMGNIDVLTGNKGEIRKQCNFIN  330



>ref|XP_010102453.1| Peroxidase 15 [Morus notabilis]
 gb|EXB93489.1| Peroxidase 15 [Morus notabilis]
Length=369

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 198/368 (54%), Positives = 247/368 (67%), Gaps = 42/368 (11%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFF--------------SQSNAQLSSTFYSTTCPNVSSIVSTVIQ  184
             M++F +++A  +   IF                + + +LS+TFY+TTCP V++IV  V++
Sbjct  1     MSAFKSVVAAGLFFLIFVGGISVSYSNYIHDRDRDHQRLSATFYATTCPRVTAIVRRVVR  60

Query  185   Q-ALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVD  361
             +   + D RI ASL RLHFHDCFVNGCDGS+LLDN    I SEK+A  NNNS RGFDV+D
Sbjct  61    RFQYRTDPRITASLARLHFHDCFVNGCDGSILLDN-ADKIESEKEALPNNNSVRGFDVID  119

Query  362   NIKTAVENACPGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNP  541
              IKT VE ACP  VSCADILA+A+  +V L+GGPSW V +GRRD   AN+ GANT++P  
Sbjct  120   EIKTEVERACPATVSCADILAMAAAESVCLSGGPSWRVRVGRRDSRIANRSGANTAIPVG  179

Query  542   FDDLSNLTRKFTNVGLNVN-DLVALSG-------------------------AHTFGRAQ  643
             FD L  L  KF+ VGL+   DLV+LSG                         AHTFGR Q
Sbjct  180   FDTLDVLKSKFSAVGLDPTIDLVSLSGNHEILIDRDIFSSFTKKKMRNLLSGAHTFGRVQ  239

Query  644   CRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSN  823
             C    +RL+NFSNTG PDPTLN T+LA L+++CP+ G+G+T+ N DP T D FDN Y+S 
Sbjct  240   CGIIEHRLYNFSNTGAPDPTLNPTFLARLRRLCPRNGNGTTLANQDPITPDGFDNTYYSI  299

Query  824   LQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEI  1003
             L+ N+GLL SDQ LFST GA TI IVN FSA+Q  FF+SF +SMI MGNISPLTG+ GEI
Sbjct  300   LRANKGLLTSDQALFSTPGADTIHIVNRFSASQFTFFKSFAKSMIKMGNISPLTGTYGEI  359

Query  1004  RLNCRRLN  1027
             R NCRR+N
Sbjct  360   RFNCRRVN  367



>gb|AII99874.1| peroxidase [Cicer arietinum]
Length=333

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 194/306 (63%), Positives = 225/306 (74%), Gaps = 2/306 (1%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
             +AQL  +FYS TC NVSSIV  V++   + D R+  SL+RL+FHDCFV GCD S+LL NN
Sbjct  7     DAQLDPSFYSKTCTNVSSIVREVVRNVSKTDPRMLGSLVRLYFHDCFVQGCDASVLL-NN  65

Query  290   GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSW  469
               TIVSE+ A  NNNS RG DVV+ IKTAVE+ CP  VSCADILALA++ + SLAGGP W
Sbjct  66    TATIVSEQQAFPNNNSLRGLDVVNQIKTAVESVCPNTVSCADILALAAQVSSSLAGGPDW  125

Query  470   NVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCR  649
              V LGRRD  TANQ  AN +LP PFD L  L   F   GLN  DLVALSGAHTFGRA C 
Sbjct  126   KVPLGRRDSLTANQSLANQNLPAPFDTLDKLKSAFVAQGLNTTDLVALSGAHTFGRAHCS  185

Query  650   TFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQ  829
                +RL+NFSNTGNPDPTLNTTYL  L+Q+CP  G  + V N DPTT D FD NY+SNLQ
Sbjct  186   FILSRLYNFSNTGNPDPTLNTTYLQDLRQICPNSGPNNLV-NFDPTTPDKFDKNYYSNLQ  244

Query  830   NNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
               +GLL+SDQELFSTSGA TI+IVN FS++Q AFF+SF  +MI MGNI  LTG+ GEIR 
Sbjct  245   VKKGLLQSDQELFSTSGADTISIVNKFSSDQNAFFESFKAAMIKMGNIGVLTGNKGEIRK  304

Query  1010  NCRRLN  1027
              C  +N
Sbjct  305   QCNFIN  310



>gb|KHN22991.1| Peroxidase 15 [Glycine soja]
Length=350

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 198/322 (61%), Positives = 231/322 (72%), Gaps = 1/322 (0%)
 Frame = +2

Query  62    ALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFH  241
             AL  + V +      S AQL  +FY +TC NV+SIV  V+    Q+D RI ASLIRLHFH
Sbjct  7     ALCCVVVVLGALPHFSYAQLDPSFYDSTCSNVTSIVREVLSNVSQSDPRILASLIRLHFH  66

Query  242   DCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIl  421
             DCFV GCD S+LL N+  TIVSE+ A  NNNS RG DVV+ IKTAVENACPG+VSCADIL
Sbjct  67    DCFVQGCDASILL-NDTDTIVSEQSAVPNNNSIRGLDVVNQIKTAVENACPGIVSCADIL  125

Query  422   alasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVND  601
             ALA++ +  LA GP W V LGRRD  TANQ  AN +LP P   +  L   F N  LN+ D
Sbjct  126   ALAAQISSDLANGPVWQVPLGRRDSLTANQTLANQNLPAPTFTIDQLIESFGNQSLNITD  185

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSGAHT GRAQCR F +RL+NFSNTGNPDPTLNTT L +LQ +CP GG G+ +TNLD
Sbjct  186   LVALSGAHTIGRAQCRFFVDRLYNFSNTGNPDPTLNTTLLQSLQGICPNGGPGTNLTNLD  245

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMIN  961
              TT DTFD+NY+SNLQ   GLL+SDQEL S +    +AIVNNF +NQT FF++F  SMI 
Sbjct  246   LTTPDTFDSNYYSNLQLQNGLLQSDQELLSANNTDIVAIVNNFISNQTLFFENFKASMIK  305

Query  962   MGNISPLTGSSGEIRLNCRRLN  1027
             MGNI  LTGS GEIR  C  +N
Sbjct  306   MGNIGVLTGSQGEIRSQCNSVN  327



>gb|KFK25059.1| hypothetical protein AALP_AA8G061200 [Arabis alpina]
Length=254

 Score =   364 bits (935),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = +2

Query  296   TIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWNV  475
             +I SEK+A  N NSARGF VVDNIKTA+ENACPGVVSC+D+LALASE++VSLAGGPSW V
Sbjct  9     SIQSEKNAGPNANSARGFSVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSWTV  68

Query  476   LLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRTF  655
             LLGRRDG TANQ GAN+S+P+P + LSN+T KF+ VGLN NDLVALSGAHTFGRA+C  F
Sbjct  69    LLGRRDGLTANQAGANSSIPSPVESLSNITSKFSAVGLNTNDLVALSGAHTFGRARCGLF  128

Query  656   NNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQNN  835
             NNRLFNFS +GNPDPTLNTT L++LQQ+CPQ GS S +TNLD TT D FDNNYF+NLQ+N
Sbjct  129   NNRLFNFSGSGNPDPTLNTTLLSSLQQLCPQNGSASGITNLDLTTPDAFDNNYFTNLQSN  188

Query  836   RGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLNC  1015
              GLL+SDQELFST+G+ATIAIV +F++NQT FFQ+F QSMINMGNISPLTGSSGEIRL+C
Sbjct  189   NGLLQSDQELFSTTGSATIAIVTSFASNQTLFFQAFAQSMINMGNISPLTGSSGEIRLDC  248

Query  1016  RRLN  1027
             +++N
Sbjct  249   KKVN  252



>emb|CCJ34830.1| horseradish peroxidase isoenzyme HRP_22684.2 [Armoracia rusticana]
Length=349

 Score =   367 bits (943),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 186/310 (60%), Positives = 229/310 (74%), Gaps = 2/310 (1%)
 Frame = +2

Query  101   SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLL  280
             S SNA+L   FY  TCP+V  I+  VI   LQ+D RI ASL+RLHFHDCFV GCD S+LL
Sbjct  25    SNSNAKLRPDFYLKTCPSVFQIIGNVIVDELQSDPRIAASLLRLHFHDCFVRGCDASVLL  84

Query  281   DNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGG  460
             DN+ T+  SEKDAA N NSARGFDVVD +K A+E ACPG VSCAD+LA++++ +V L+GG
Sbjct  85    DNS-TSFQSEKDAAPNANSARGFDVVDRMKAALEKACPGTVSCADVLAISAQISVLLSGG  143

Query  461   PSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN-VNDLVALSGAHTFGR  637
             P W VLLGRRDG  A    ANT+LPNPF  L+ L  KF +VGL   +DLVALSGAHTFGR
Sbjct  144   PWWPVLLGRRDGVEAFFDLANTALPNPFAPLTELKEKFADVGLKRASDLVALSGAHTFGR  203

Query  638   AQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYF  817
             AQC     RL+NFS T  PDPTLN +YL  L+++CPQ G+G+ + N D  T + FD  Y+
Sbjct  204   AQCLLVTPRLYNFSGTNKPDPTLNPSYLVELRRLCPQNGNGTVLLNFDLVTPNAFDRQYY  263

Query  818   SNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSG  997
             +NL+N +GL++SDQELFST GA TI +VN +S N  AFF +FV ++I MGNI PLTG+ G
Sbjct  264   TNLRNGKGLIQSDQELFSTPGADTIPLVNLYSKNTFAFFGAFVDAIIRMGNIQPLTGTQG  323

Query  998   EIRLNCRRLN  1027
             EIR NCR +N
Sbjct  324   EIRQNCRVVN  333



>emb|CCJ34829.1| horseradish peroxidase isoenzyme HRP_22684.1 [Armoracia rusticana]
Length=349

 Score =   367 bits (943),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 186/310 (60%), Positives = 229/310 (74%), Gaps = 2/310 (1%)
 Frame = +2

Query  101   SQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLL  280
             S SNA+L   FY  TCP+V  I+  VI   LQ+D RI ASL+RLHFHDCFV GCD S+LL
Sbjct  25    SNSNAKLRPDFYLKTCPSVFQIIGNVIVDELQSDPRIAASLLRLHFHDCFVRGCDASVLL  84

Query  281   DNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGG  460
             DN+ T+  SEKDAA N NSARGFDVVD +K A+E ACPG VSCAD+LA++++ +V L+GG
Sbjct  85    DNS-TSFQSEKDAAPNANSARGFDVVDRMKAALEKACPGTVSCADVLAISAQISVLLSGG  143

Query  461   PSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN-VNDLVALSGAHTFGR  637
             P W VLLGRRDG  A    ANT+LPNPF  L+ L  KF +VGL   +DLVALSGAHTFGR
Sbjct  144   PWWPVLLGRRDGVEAFFDLANTALPNPFAPLTELKEKFADVGLKRASDLVALSGAHTFGR  203

Query  638   AQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYF  817
             AQC     RL+NFS T  PDPTLN +YL  L+++CPQ G+G+ + N D  T + FD  Y+
Sbjct  204   AQCLLVTPRLYNFSGTNKPDPTLNPSYLVELRRLCPQNGNGTVLLNFDLVTPNAFDRQYY  263

Query  818   SNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSG  997
             +NL+N +GL++SDQELFST GA TI +VN +S N  AFF +FV ++I MGNI PLTG+ G
Sbjct  264   TNLRNGKGLIQSDQELFSTPGADTIPLVNLYSKNTFAFFGAFVDAIIRMGNIQPLTGTQG  323

Query  998   EIRLNCRRLN  1027
             EIR NCR +N
Sbjct  324   EIRQNCRVVN  333



>gb|ACJ84393.1| unknown [Medicago truncatula]
Length=352

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 199/325 (61%), Positives = 234/325 (72%), Gaps = 1/325 (0%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             S +AL  + V +      SNAQL ++FY  TCPNV SIV  V++   + D RI ASLIRL
Sbjct  7     SLAALCCVVVVLGGLPFSSNAQLDNSFYRDTCPNVHSIVREVLRNVSKTDPRILASLIRL  66

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFV GCD S+LL N  +TI SE+ A  NNNS RG DVV+ IKTAVENACP  VSCA
Sbjct  67    HFHDCFVQGCDASILL-NTTSTITSEQTAFGNNNSIRGLDVVNQIKTAVENACPNTVSCA  125

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALA+E +  LA GP W V LGRRD  TAN   AN +LP+P  +L+ L   F N GL+
Sbjct  126   DILALAAEISSVLANGPDWKVPLGRRDSLTANLTLANINLPSPAFNLTQLKSNFDNQGLD  185

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
               DLVALSGAHT GR QCR F +RL+NFSNTGNPDPTLNTTYL TL+ +CP GG GST+T
Sbjct  186   ATDLVALSGAHTIGRGQCRFFVDRLYNFSNTGNPDPTLNTTYLQTLRTICPNGGPGSTLT  245

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             +LDP T DTFD+ Y+SNL+  +GL +SDQ L STSGA TIAIVN+F+ NQT FF++F  S
Sbjct  246   DLDPATPDTFDSAYYSNLRIQKGLFRSDQVLSSTSGADTIAIVNSFNNNQTLFFEAFKAS  305

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MI M  I  LTGS GEIR  C  +N
Sbjct  306   MIKMSRIKVLTGSQGEIRKQCNFVN  330



>gb|KFK26225.1| hypothetical protein AALP_AA8G219000 [Arabis alpina]
Length=329

 Score =   366 bits (940),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 242/321 (75%), Gaps = 2/321 (1%)
 Frame = +2

Query  71    AMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCF  250
             ++ ++I +F + +NAQLSS FYSTTCPNV+ I   +I+QA ++D R+ A ++RLHFHDCF
Sbjct  9     SLLLSILMFGALANAQLSSDFYSTTCPNVTVIARGLIEQASRSDVRLTAKVMRLHFHDCF  68

Query  251   VNGCDGSLLLDNN-GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlal  427
             VNGCDGS+LLD      +  EK+A QNNNS  GF V+D+IKTA+EN CPGVVSCADILA+
Sbjct  69    VNGCDGSVLLDAAPAEGVQGEKEAFQNNNSLDGFQVIDDIKTALENVCPGVVSCADILAI  128

Query  428   asesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLV  607
             A+E +VSLAGGPSW+VLLGRRDG TAN+  A  +LP   D L  LT KF+   L+  DLV
Sbjct  129   AAEISVSLAGGPSWDVLLGRRDGRTANRADAEAALPLGPDSLEILTSKFSVHNLDTTDLV  188

Query  608   ALSGAHTFGRAQCRTFNNRLFNFSN-TGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDP  784
              LSGAHTFGR QC   NNRL NFS   G  DP+++  +L TL++ CPQ G  +T  NLDP
Sbjct  189   VLSGAHTFGRVQCGVINNRLHNFSGYNGQSDPSIDPEFLQTLRRQCPQSGDQTTRINLDP  248

Query  785   TTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINM  964
             T+ D+FDN+YF NLQNNRG++ SDQ LFS++GA T+++VN F+ NQ+ FF++F +SMI M
Sbjct  249   TSPDSFDNDYFKNLQNNRGVIDSDQILFSSTGATTVSLVNRFAENQSEFFRNFARSMIKM  308

Query  965   GNISPLTGSSGEIRLNCRRLN  1027
             GN+  L G+ GEIR +C+R+N
Sbjct  309   GNVRVLAGTDGEIRRDCKRVN  329



>ref|XP_003594491.1| Peroxidase [Medicago truncatula]
 gb|AES64742.1| peroxidase family protein [Medicago truncatula]
Length=353

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             + +AL  + V +      S+AQL  +FY  TCP V SI+  VI+   + D R+ ASL+RL
Sbjct  7     TLTALCCVVVVLGGLPFSSDAQLDPSFYRDTCPKVHSIIREVIRNVSKTDPRMLASLVRL  66

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFV GCD S+LL N   TIVSE++A  N NS RG DVV+ IKTAVE ACP  VSCA
Sbjct  67    HFHDCFVLGCDASVLL-NKTDTIVSEQEAFPNINSLRGLDVVNQIKTAVEKACPNTVSCA  125

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILAL+++ +  LA GP+W V LGRRDG TANQ  AN +LP PF+ L  L   F   GL+
Sbjct  126   DILALSAQISSILADGPNWKVPLGRRDGLTANQSLANQNLPAPFNSLDQLKSAFAAQGLS  185

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
               DLVALSGAHTFGRA+C    +RL+NFS+TG PDPTLNTTYL  L+++CP GG  + + 
Sbjct  186   TTDLVALSGAHTFGRARCTFITDRLYNFSSTGKPDPTLNTTYLQELRKICPNGGPPNNLA  245

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             N DPTT D FD NY+SNLQ  +GLL+SDQELFSTSGA TI+IVN FSA++ AFF SF  +
Sbjct  246   NFDPTTPDKFDKNYYSNLQGKKGLLQSDQELFSTSGADTISIVNKFSADKNAFFDSFEAA  305

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MI MGNI  LTG  GEIR +C  +N
Sbjct  306   MIKMGNIGVLTGKKGEIRKHCNFVN  330



>gb|AAB41811.1| peroxidase [Medicago sativa]
Length=353

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 197/325 (61%), Positives = 235/325 (72%), Gaps = 1/325 (0%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             + +AL  + V +      SNAQL ++FY  TCPNV SIV  V++   + D RI ASL+R+
Sbjct  8     TLAALCCVVVVLGGLPFSSNAQLDNSFYRDTCPNVHSIVREVLRNVSKTDPRILASLMRV  67

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFV GCD S+LL N  +TI SE+ A  NNNS RG DVV+ IKTAVENACP  VSCA
Sbjct  68    HFHDCFVQGCDASILL-NTTSTITSEQTAFGNNNSIRGLDVVNQIKTAVENACPNTVSCA  126

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALA+E +  LA GP W V LGRRD  TAN   AN +LP+P  +LS L + F   GL+
Sbjct  127   DILALAAEISSVLAHGPDWKVPLGRRDSLTANLTLANENLPSPAFNLSELKKNFDRQGLD  186

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
               DLVALSGAHT GR QCR F +RL+NFSNTGNPDPTLNTTYL TL+ +CP GG GST+T
Sbjct  187   TTDLVALSGAHTIGRGQCRFFVDRLYNFSNTGNPDPTLNTTYLQTLRTICPNGGPGSTLT  246

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             +LDPTT DTFD+ Y+SNL+  +GL +SDQ L STSGA TIAIVN+F+ NQT FF++F  S
Sbjct  247   DLDPTTPDTFDSAYYSNLRIQKGLFESDQVLASTSGADTIAIVNSFNNNQTLFFEAFKAS  306

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MI M  I  LTGS GEIR  C  +N
Sbjct  307   MIKMSKIKVLTGSQGEIRKQCNFVN  331



>ref|XP_003594497.1| Peroxidase [Medicago truncatula]
 gb|AES64748.1| peroxidase family protein [Medicago truncatula]
Length=352

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 199/325 (61%), Positives = 234/325 (72%), Gaps = 1/325 (0%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             S +AL  + V +      SNAQL ++FY  TCPNV SIV  V++   + D RI ASLIRL
Sbjct  7     SLAALCCVVVVLGGLPFSSNAQLDNSFYRDTCPNVHSIVREVLRNVSKTDPRILASLIRL  66

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFV GCD S+LL N  +TI SE+ A  NNNS RG DVV+ IKTAVENACP  VSCA
Sbjct  67    HFHDCFVQGCDASILL-NTTSTITSEQTAFGNNNSIRGLDVVNQIKTAVENACPNTVSCA  125

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALA+E +  LA GP W V LGRRD  TAN   AN +LP+P  +L+ L   F N GL+
Sbjct  126   DILALAAEISSVLANGPDWKVPLGRRDSLTANLTLANINLPSPAFNLTQLKSNFDNQGLD  185

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
               DLVALSGAHT GR QCR F +RL+NFSNTGNPDPTLNTTYL TL+ +CP GG GST+T
Sbjct  186   ATDLVALSGAHTIGRGQCRFFVDRLYNFSNTGNPDPTLNTTYLQTLRTICPNGGPGSTLT  245

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             +LDP T DTFD+ Y+SNL+  +GL +SDQ L STSGA TIAIVN+F+ NQT FF++F  S
Sbjct  246   DLDPATPDTFDSAYYSNLRIQKGLFQSDQVLSSTSGADTIAIVNSFNNNQTLFFEAFKAS  305

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MI M  I  LTGS GEIR  C  +N
Sbjct  306   MIKMSRIKVLTGSQGEIRKQCNFVN  330



>gb|AFK40933.1| unknown [Medicago truncatula]
Length=353

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 190/325 (58%), Positives = 231/325 (71%), Gaps = 1/325 (0%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             + +AL  + V +      S+AQL  +FY  TCP V SI+  VI+   + D R+ ASL+RL
Sbjct  7     TLTALCCVVVVLGGLPFSSDAQLDPSFYRDTCPKVHSIIREVIRNVSKTDPRMLASLVRL  66

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFV GCD S+LL N   TIVSE++A  N NS RG DVV+ IKTAVE ACP  VSCA
Sbjct  67    HFHDCFVLGCDASVLL-NKTDTIVSEQEAFPNINSLRGLDVVNQIKTAVEKACPNTVSCA  125

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILAL+++ +  LA GP+W V LGRRDG TANQ  AN +LP PF+ L  L   F   GL+
Sbjct  126   DILALSAQISSILADGPNWKVPLGRRDGLTANQSLANQNLPAPFNSLDQLKSAFAAQGLS  185

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
               DLVALSGAHTFGRA+C    +RL+NFS+TG PDPTLNTTYL  L+++CP GG  + + 
Sbjct  186   TTDLVALSGAHTFGRARCTFITDRLYNFSSTGKPDPTLNTTYLQELRRICPNGGPPNNLA  245

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             N DPTT D FD NY+SNLQ  +GLL+SDQELFSTSGA TI+IVN FSA++ AFF SF  +
Sbjct  246   NFDPTTPDKFDKNYYSNLQGKKGLLQSDQELFSTSGADTISIVNKFSADKNAFFDSFEAA  305

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MI MGNI  LTG  GEIR +C  +N
Sbjct  306   MIKMGNIGVLTGKKGEIRKHCNFVN  330



>ref|XP_003561851.1| PREDICTED: peroxidase A2-like [Brachypodium distachyon]
Length=331

 Score =   365 bits (937),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 224/307 (73%), Gaps = 2/307 (1%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
              AQL   FY  +CP V  IV  V+++A Q D RI ASL RLHFHDCFV GCDGS+LLDN+
Sbjct  24    EAQLDEKFYDGSCPGVHRIVRRVLKEAHQADVRIYASLTRLHFHDCFVQGCDGSILLDNS  83

Query  290   GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSW  469
              T+IVSEK A  NNNS RG+ VVD +K A+E ACPGVVSCADILA+A++ +V L+GGP W
Sbjct  84    -TSIVSEKFAKPNNNSVRGYTVVDAVKAALEEACPGVVSCADILAVAAKISVELSGGPRW  142

Query  470   NVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCR  649
              V LGRRDGTTAN   AN  LP+P D+++ L RKF  VGL+  DLVALSGAHTFGRAQC+
Sbjct  143   RVPLGRRDGTTANLTAANHVLPSPRDNITMLQRKFRAVGLDDTDLVALSGAHTFGRAQCQ  202

Query  650   TFNNRLFNFSNTGNPDPTLNTTYLATLQQVCP-QGGSGSTVTNLDPTTSDTFDNNYFSNL  826
                +RL+NFS TG PDPT++  Y   L + CP + G+ + + +LDP T D FD +YF+NL
Sbjct  203   FVTDRLYNFSKTGKPDPTMDAGYRVQLARSCPRRHGNRTALRDLDPATPDAFDKSYFTNL  262

Query  827   QNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIR  1006
             Q +RG L+SDQEL    GA T AIV  F+ ++ AFF+SF  SM+NMGNI PLTG  GE+R
Sbjct  263   QASRGFLQSDQELLLAPGAPTAAIVARFAGSEKAFFRSFASSMVNMGNIRPLTGGQGEVR  322

Query  1007  LNCRRLN  1027
              NC ++N
Sbjct  323   KNCWKVN  329



>gb|EMT06857.1| Peroxidase 53 [Aegilops tauschii]
Length=336

 Score =   365 bits (937),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 227/306 (74%), Gaps = 2/306 (1%)
 Frame = +2

Query  113   AQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNG  292
             AQL   FY  + P    +V  V+++A + D RI ASL RLHFHDCFV GCDGS+LLDN+ 
Sbjct  30    AQLDDKFYDGSRPRGHQVVRRVLREAHKADVRIYASLTRLHFHDCFVQGCDGSILLDNS-  88

Query  293   TTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWN  472
             T+IVSEK A  NNNS RGF VVD++K A+E ACPGVVSCADIL +A++ +V L+GGP W 
Sbjct  89    TSIVSEKYAKPNNNSVRGFTVVDDVKAALEKACPGVVSCADILTIAAKVSVELSGGPRWR  148

Query  473   VLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRT  652
             V LGRRDGTTAN   AN+ LP+P ++L+ L RKF  VGL+  DLVALSGAHTFGRAQC+ 
Sbjct  149   VQLGRRDGTTANLTAANSLLPSPRNNLTMLQRKFAAVGLDDTDLVALSGAHTFGRAQCQF  208

Query  653   FNNRLFNFSNTGNPDPTLNTTYLATLQQVCP-QGGSGSTVTNLDPTTSDTFDNNYFSNLQ  829
               +RL+NFS TG PDPTL+ +Y A L   CP + G+ S + +LD TT D FD NYF+NLQ
Sbjct  209   VTDRLYNFSKTGMPDPTLDGSYRAQLAGSCPRRHGNRSALNDLDTTTPDAFDKNYFTNLQ  268

Query  830   NNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRL  1009
              NRG L+SDQEL +  GA T AIV  F++++ AFF+SF  +MINMGNI PLTG  GE+R 
Sbjct  269   GNRGFLQSDQELLAVPGATTAAIVGRFASDEKAFFRSFAAAMINMGNIKPLTGGQGEVRR  328

Query  1010  NCRRLN  1027
             NCRR+N
Sbjct  329   NCRRVN  334



>ref|XP_006289358.1| hypothetical protein CARUB_v10002844mg [Capsella rubella]
 gb|EOA22256.1| hypothetical protein CARUB_v10002844mg [Capsella rubella]
Length=330

 Score =   365 bits (936),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 239/324 (74%), Gaps = 3/324 (1%)
 Frame = +2

Query  65    LLAMAVAIFIFFS-QSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFH  241
             LL +  +I+I F    NAQLSS FYSTTCPN + I   +I+QA + D R+ A ++RLHFH
Sbjct  7     LLFILFSIWILFGVLGNAQLSSGFYSTTCPNATVIARGLIEQASRGDVRLTAKVMRLHFH  66

Query  242   DCFVNGCDGSLLLDNNGTTIVS-EKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADI  418
             DCFVNGCDGS+LLD     +V  EK+A QN  S  GF+V+D+IKTA+EN CPGVVSCADI
Sbjct  67    DCFVNGCDGSVLLDAAPADVVEGEKEAFQNAGSLGGFEVIDDIKTALENVCPGVVSCADI  126

Query  419   lalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVN  598
             LA+A+E +V+LAGGPSW+VLLGRRDG TA    A  +LP   D L  LT KF+   L+  
Sbjct  127   LAIAAEISVALAGGPSWDVLLGRRDGRTAISADAVATLPLGSDSLHILTSKFSVHNLDTT  186

Query  599   DLVALSGAHTFGRAQCRTFNNRLFNF-SNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTN  775
             DLVALSGAHTFGR QCR  NNRL +F    G  DPT+ T +L TL + CP+GG  +   N
Sbjct  187   DLVALSGAHTFGRVQCRVINNRLHSFIGKKGQSDPTIETKFLQTLLRKCPKGGDLTVRVN  246

Query  776   LDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSM  955
             LDPT+ D+FDN+YF NLQNNRG++KSDQ LFS++GA T+++VN+F+ +Q+ F+++F +SM
Sbjct  247   LDPTSPDSFDNDYFKNLQNNRGVIKSDQILFSSTGAPTVSLVNHFAESQSDFYRNFARSM  306

Query  956   INMGNISPLTGSSGEIRLNCRRLN  1027
             I MGN+  LTGS GEIR  CRR+N
Sbjct  307   IKMGNVKILTGSEGEIRRECRRVN  330



>gb|AII99877.1| peroxidase [Cicer arietinum]
Length=355

 Score =   365 bits (937),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 196/334 (59%), Positives = 240/334 (72%), Gaps = 6/334 (2%)
 Frame = +2

Query  32    LNPKKM--ASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDA  205
             +NP  +   +F  ++ + +    F   S+AQL  +FY+ TC NV SIV  V+    Q+D 
Sbjct  1     MNPLSLIATAFCCVVFIVIGTIPF---SDAQLDPSFYNDTCSNVHSIVRGVLTNVSQSDP  57

Query  206   RIGASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVEN  385
             RI ASLIRLHFHDCFV GCD S+LL N+ +TIVSE+ A  NNNS RG DV++ IKTAVEN
Sbjct  58    RILASLIRLHFHDCFVQGCDASILL-NDTSTIVSEQSAPPNNNSIRGLDVINQIKTAVEN  116

Query  386   ACPGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLT  565
              CP +VSCADILALA++ +V LA GP W V LGRRD  TAN+  A  +LP P  +L+ L 
Sbjct  117   GCPNIVSCADILALAAQISVDLANGPVWEVPLGRRDSLTANKSLATQNLPAPTFNLTQLK  176

Query  566   RKFTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCP  745
               F   GLN  DLVALSG HT GR QCR F +RL+NFSNTGNPD +LNT+YL TLQ +CP
Sbjct  177   STFATQGLNTTDLVALSGGHTIGRGQCRFFVDRLYNFSNTGNPDSSLNTSYLQTLQSICP  236

Query  746   QGGSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQT  925
               G G+ +TNLDPTT DTFD+NY+SNLQ   GL +SDQELFST+GA TI+IVN+F+ NQT
Sbjct  237   NSGPGTNLTNLDPTTPDTFDSNYYSNLQVGNGLFQSDQELFSTTGADTISIVNSFTNNQT  296

Query  926   AFFQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
              FF++F+ SMI MGNI  LTGS GEIR  C  +N
Sbjct  297   LFFENFIASMIKMGNIGVLTGSQGEIRTQCNAVN  330



>ref|XP_007147500.1| hypothetical protein PHAVU_006G129800g [Phaseolus vulgaris]
 gb|ESW19494.1| hypothetical protein PHAVU_006G129800g [Phaseolus vulgaris]
Length=352

 Score =   365 bits (937),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 193/325 (59%), Positives = 235/325 (72%), Gaps = 8/325 (2%)
 Frame = +2

Query  71    AMAVAIFIFFSQ------SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             A+AVA+F  F+       +NAQLS TFY+ TCP +S IV +V+  A   D RIGASL+RL
Sbjct  6     AVAVAVFCAFAMHASFLVTNAQLSPTFYNETCPTLSDIVFSVVSNASLTDPRIGASLVRL  65

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFV GCDGS+LL N+  TI+SE+DA  N NS RG DVV+NIKT VEN+CP  VSCA
Sbjct  66    HFHDCFVQGCDGSVLL-NSTDTILSEQDALPNANSLRGLDVVNNIKTEVENSCPQTVSCA  124

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILA+A+E    L GGPSW V LGRRD   A+Q  ANT+LP PF  +  LT  F   GLN
Sbjct  125   DILAIAAEVGSVLGGGPSWEVPLGRRDSLNASQALANTNLPAPFFTIDQLTASFAAQGLN  184

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
               DLV LSGAHTFGRA+C TF NRL+NF+N+  PDPTLN TYLA L+++CP+  +   +T
Sbjct  185   TTDLVTLSGAHTFGRARCSTFLNRLYNFNNS-EPDPTLNPTYLAVLREICPEDATVDNIT  243

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
              LD TT D FDN Y+SNLQ   GLL+SDQELFST GA T+ +VN+FS++Q+ FF +F+ S
Sbjct  244   GLDLTTPDQFDNAYYSNLQQLNGLLQSDQELFSTPGAVTVDLVNSFSSDQSVFFDNFIVS  303

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MI MGNI  LTG+ GEIR  C  +N
Sbjct  304   MIKMGNIGVLTGTDGEIRTQCNFVN  328



>ref|XP_003594498.1| Peroxidase [Medicago truncatula]
 gb|AES64749.1| peroxidase family protein [Medicago truncatula]
Length=353

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 195/322 (61%), Positives = 232/322 (72%), Gaps = 4/322 (1%)
 Frame = +2

Query  71    AMAVAIFIFFSQ---SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFH  241
             A    +F+F      SNAQL  +FY++TC NV SIV  V+    Q+D R+  SLIRLHFH
Sbjct  10    AFCCVVFVFIGGVPFSNAQLDPSFYNSTCSNVDSIVRGVLTNVSQSDPRMLGSLIRLHFH  69

Query  242   DCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIl  421
             DCFV GCD S+LL N+  TIVSE+ A  NNNS RG DV++ IKTAVENACP  VSCADIL
Sbjct  70    DCFVQGCDASILL-NDTATIVSEQSAPPNNNSIRGLDVINQIKTAVENACPNTVSCADIL  128

Query  422   alasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVND  601
             AL++E +  LA GP+W V LGRRD  TAN   A  +LP P  +L+ L   F N  L   D
Sbjct  129   ALSAEISSDLANGPTWQVPLGRRDSLTANNSLAAQNLPAPTFNLTQLKSSFDNQNLTTTD  188

Query  602   LVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLD  781
             LVALSG HT GR QCR F +RL+NFSNTGNPD TLNTTYL TLQ +CP GG G+ +T+LD
Sbjct  189   LVALSGGHTIGRGQCRFFVDRLYNFSNTGNPDSTLNTTYLQTLQAICPNGGPGTNLTDLD  248

Query  782   PTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMIN  961
             PTT DTFD+NY+SNLQ   GL +SDQELFST+G+ TI+IVN+F+ NQT FF++FV SMI 
Sbjct  249   PTTPDTFDSNYYSNLQVGNGLFQSDQELFSTNGSDTISIVNSFANNQTLFFENFVASMIK  308

Query  962   MGNISPLTGSSGEIRLNCRRLN  1027
             MGNI  LTGS GEIR  C  +N
Sbjct  309   MGNIGVLTGSQGEIRTQCNAVN  330



>gb|AAM60837.1| peroxidase [Arabidopsis thaliana]
Length=329

 Score =   363 bits (932),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 238/318 (75%), Gaps = 2/318 (1%)
 Frame = +2

Query  80    VAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNG  259
             + I +F   SNAQL+S FYSTTCPNV++I   +I++A +ND R+ A ++RLHFHDCFVNG
Sbjct  12    LPILMFGVLSNAQLTSDFYSTTCPNVTAIARGLIERASRNDVRLTAKVMRLHFHDCFVNG  71

Query  260   CDGSLLLDNN-GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalase  436
             CDGS+LLD      +  EK+A QN  S  GF+V+D+IKTA+EN CPGVVSCADILA+A+E
Sbjct  72    CDGSVLLDAAPADGVEGEKEAFQNAGSLDGFEVIDDIKTALENVCPGVVSCADILAIAAE  131

Query  437   savslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALS  616
              +V+LAGGPSW+VLLGRRDG TA +  A  +LP   D L  LT KF+   L+  DLVALS
Sbjct  132   ISVALAGGPSWDVLLGRRDGRTAIRADAVAALPLGPDSLEILTSKFSVHNLDTTDLVALS  191

Query  617   GAHTFGRAQCRTFNNRLFNFS-NTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTS  793
             GAHTFGR QC   NNRL NFS N+G  DP++   +L TL++ CPQGG  +   NLDPT+ 
Sbjct  192   GAHTFGRVQCGVINNRLHNFSGNSGQSDPSIEPEFLQTLRRQCPQGGDLTARANLDPTSP  251

Query  794   DTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNI  973
             D+FDN+YF NLQNNRG+++SDQ LFS++GA T+++VN F+ NQ  FF +F +SMI MGN+
Sbjct  252   DSFDNDYFKNLQNNRGVIESDQILFSSTGAPTVSLVNRFAENQNEFFTNFARSMIKMGNV  311

Query  974   SPLTGSSGEIRLNCRRLN  1027
               LTG  GEIR +CRR+N
Sbjct  312   RILTGREGEIRRDCRRVN  329



>gb|KHN14342.1| Peroxidase 15 [Glycine soja]
Length=350

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 195/305 (64%), Positives = 223/305 (73%), Gaps = 1/305 (0%)
 Frame = +2

Query  113   AQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNNG  292
             AQL  +FY +TC NVSSIV  V+    Q+D RI ASLIRLHFHDCFV GCD S+LL N+ 
Sbjct  24    AQLDPSFYDSTCSNVSSIVREVLSNVSQSDPRILASLIRLHFHDCFVQGCDASILL-NDT  82

Query  293   TTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPSWN  472
              TIVSE+ AA NNNS RG DVV+ IKTAVENACPG VSCADILALA++ +  LA GP W 
Sbjct  83    DTIVSEQSAAPNNNSIRGLDVVNQIKTAVENACPGTVSCADILALAAQISSDLASGPVWE  142

Query  473   VLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQCRT  652
             V LGRRD  TANQ  AN +LP P   +  L   F N  LN+ DLVALSGAHT GRAQCR 
Sbjct  143   VPLGRRDSLTANQTLANQNLPAPTFTIDQLINSFGNQSLNITDLVALSGAHTIGRAQCRF  202

Query  653   FNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSNLQN  832
             F +RL+NFSNTGNPDPTLNTT L +LQ +CP GG G+ +TNLD TT DTFD+NY+SNLQ 
Sbjct  203   FVDRLYNFSNTGNPDPTLNTTLLQSLQGICPNGGPGTNLTNLDLTTPDTFDSNYYSNLQL  262

Query  833   NRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEIRLN  1012
               GLL+SDQEL S +    +AIVNNF  NQT FF++F  SM  MGNI  LTGS GEIR  
Sbjct  263   QNGLLQSDQELLSANNTDIVAIVNNFIMNQTLFFENFKASMRKMGNIGVLTGSQGEIRSQ  322

Query  1013  CRRLN  1027
             C  +N
Sbjct  323   CNSVN  327



>emb|CDY35844.1| BnaC09g37760D [Brassica napus]
Length=330

 Score =   362 bits (929),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 189/330 (57%), Positives = 247/330 (75%), Gaps = 3/330 (1%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQSN-AQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASL  223
             M   +A+ ++ ++I +F    N AQL+S FYSTTCPNV+ I  ++I+QA ++D R+ A +
Sbjct  1     MGISNAIPSLLLSILMFGVLGNYAQLTSDFYSTTCPNVTVIARSLIKQASRSDVRLTAKV  60

Query  224   IRLHFHDCFVNGCDGSLLLDNN-GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGV  400
             +RLHFHDCFVNGCDGS+LLD      +  EK+A QN  S  GF+V+D+IKTA+EN CPGV
Sbjct  61    MRLHFHDCFVNGCDGSVLLDAAPADGVEGEKEAFQNAGSLDGFEVIDDIKTALENVCPGV  120

Query  401   VSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTN  580
             VSCADILA+A+E +VSLAGGPSW+VL GRRDG TAN+G A T+LP   D L  LT KF+ 
Sbjct  121   VSCADILAIAAEISVSLAGGPSWDVLFGRRDGRTANRGDAVTALPLGPDSLEILTSKFSV  180

Query  581   VGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFS-NTGNPDPTLNTTYLATLQQVCPQGGS  757
               L+  DLVALSGAHTFGR QC    NRL NFS N G  DPT+   +L TL++ CPQGGS
Sbjct  181   HNLDTTDLVALSGAHTFGRVQCGVITNRLHNFSGNNGQSDPTIEPEFLQTLRRQCPQGGS  240

Query  758   GSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQ  937
              +   NLD T+ D+FDN+YF NLQNNRG+++SDQ LFS++G+ T+++VN F+ NQ+ FF+
Sbjct  241   LTARVNLDDTSPDSFDNDYFKNLQNNRGVIESDQILFSSTGSPTVSLVNRFAENQSEFFR  300

Query  938   SFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             +F +SMI MGN+  LTG+ GEIR +CRR+N
Sbjct  301   NFARSMIKMGNVRVLTGTEGEIRRDCRRVN  330



>emb|CAC38073.1| peroxidase1A [Medicago sativa]
Length=350

 Score =   362 bits (930),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 194/332 (58%), Positives = 238/332 (72%), Gaps = 2/332 (1%)
 Frame = +2

Query  32    LNPKKMASFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARI  211
             +NP  +++ +A   M   +      SNAQL  +FY++TC N+ SIV  V+    Q+D R+
Sbjct  1     MNPLGLSA-TAFCCMVFVLIGGVPFSNAQLDPSFYNSTCSNLDSIVRGVLTNVSQSDPRM  59

Query  212   GASLIRLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENAC  391
               SLIRLHFHDCFV GCD S+LL N+  TIVSE+ A  NNNS RG DV++ IKTAVENAC
Sbjct  60    LGSLIRLHFHDCFVQGCDASILL-NDTATIVSEQSAPPNNNSIRGLDVINQIKTAVENAC  118

Query  392   PGVVSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRK  571
             P  VSCADILAL++E +  LA GP+W V LGRRD  TAN   A  +LP P  +L+ L   
Sbjct  119   PNTVSCADILALSAEISSDLANGPTWQVPLGRRDSLTANNSLAAQNLPAPTFNLTRLKSN  178

Query  572   FTNVGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQG  751
             F N   +  DLVALSG HT GR QCR F +RL+NFSNTGNPD TLNTTYL TLQ +CP G
Sbjct  179   FDNQNFSTTDLVALSGGHTIGRGQCRFFVDRLYNFSNTGNPDSTLNTTYLQTLQAICPNG  238

Query  752   GSGSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAF  931
             G G+ +T+LDPTT DTFD+NY+SNLQ  +GL +SDQELFST+G+ TI+IVN+F+ NQT F
Sbjct  239   GPGTNLTDLDPTTPDTFDSNYYSNLQVGKGLFQSDQELFSTNGSDTISIVNSFANNQTLF  298

Query  932   FQSFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             F++FV SMI MGNI  LTGS GEIR  C  +N
Sbjct  299   FENFVASMIKMGNIGVLTGSQGEIRTQCNAVN  330



>ref|XP_007147494.1| hypothetical protein PHAVU_006G129200g [Phaseolus vulgaris]
 gb|ESW19488.1| hypothetical protein PHAVU_006G129200g [Phaseolus vulgaris]
Length=355

 Score =   362 bits (929),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 194/327 (59%), Positives = 233/327 (71%), Gaps = 4/327 (1%)
 Frame = +2

Query  56    FSALLAMAVAIFIFFSQ---SNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLI  226
             FS  +A+   + +  +    S+AQL ++FY  TCP V S+V  V++   ++D RI ASLI
Sbjct  7     FSVKVALCCVVVLLAASPPFSHAQLDNSFYRDTCPKVHSLVREVVRNVSKSDPRILASLI  66

Query  227   RLHFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVS  406
             RLHFHDCFV GCD S+LL N+  TIVSE+ AA NNNS RG DVV+ IKTAVENACPG+VS
Sbjct  67    RLHFHDCFVQGCDASILL-NDTATIVSEQTAAPNNNSIRGLDVVNQIKTAVENACPGIVS  125

Query  407   CADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVG  586
             CADILALA++ +  LA GP W V LGRRD   A+   AN +LP P   L  L   F    
Sbjct  126   CADILALAAQISSVLAHGPDWKVPLGRRDSLNASFDLANQNLPGPNFSLDQLKSAFERQN  185

Query  587   LNVNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGST  766
             LN  DLVALSGAHT GRAQCR F+NRL+NF+ TGNPDPTLNTT L +LQ +CP GG G+ 
Sbjct  186   LNTTDLVALSGAHTIGRAQCRFFDNRLYNFNGTGNPDPTLNTTLLQSLQAICPNGGPGTN  245

Query  767   VTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFV  946
             +TNLD TT D  D+NY+SNLQ   GLL+SDQELFSTSGA TI IVN+FS+NQT F+++F 
Sbjct  246   LTNLDLTTPDELDSNYYSNLQLQNGLLRSDQELFSTSGADTIPIVNSFSSNQTLFYENFK  305

Query  947   QSMINMGNISPLTGSSGEIRLNCRRLN  1027
              SMI M  I  LTGS GEIR  C  +N
Sbjct  306   ASMIKMSIIQVLTGSQGEIRAQCNFVN  332



>ref|XP_006400552.1| hypothetical protein EUTSA_v10014083mg [Eutrema salsugineum]
 gb|ESQ42005.1| hypothetical protein EUTSA_v10014083mg [Eutrema salsugineum]
Length=330

 Score =   361 bits (927),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 184/308 (60%), Positives = 234/308 (76%), Gaps = 2/308 (1%)
 Frame = +2

Query  110   NAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLLLDNN  289
             NAQLSS FYSTTCPNV+ I   +I+QA + D R+ A ++RLHFHDCFVNGCDGS+LLD  
Sbjct  23    NAQLSSDFYSTTCPNVTVIARGLIEQASRGDVRLTAKVMRLHFHDCFVNGCDGSVLLDAA  82

Query  290   -GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaGGPS  466
                 +  EK+A QN NS  GF V+D+IKTA+EN CPG+VSCADILA+A+E +V+LAGGPS
Sbjct  83    PADGVEGEKEAFQNANSLDGFQVIDDIKTALENVCPGIVSCADILAIAAEISVALAGGPS  142

Query  467   WNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGRAQC  646
             W+VLLGRRDG TAN+  A  +LP   D L  LT KF+   L+  DLVALSGAHTFGR QC
Sbjct  143   WDVLLGRRDGRTANRADAVAALPLGPDSLDVLTSKFSVHNLDTTDLVALSGAHTFGRVQC  202

Query  647   RTFNNRLFNFS-NTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYFSN  823
                 NRL NFS N G  DP++   +L TL++ CPQGGS +   NLDPT+ D+FDN+YF N
Sbjct  203   GVITNRLHNFSGNNGQSDPSIEPEFLQTLRRQCPQGGSVTARVNLDPTSPDSFDNDYFKN  262

Query  824   LQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSGEI  1003
             LQNNRG+++SDQ LFS++GA T+++VN F+ +Q+ FF++F +SMI MGN+  LTG+ GEI
Sbjct  263   LQNNRGVIESDQILFSSTGAPTVSLVNRFAEDQSEFFRNFARSMIKMGNVRTLTGTEGEI  322

Query  1004  RLNCRRLN  1027
             R +CRR+N
Sbjct  323   RRDCRRVN  330



>ref|XP_009120849.1| PREDICTED: peroxidase 58 [Brassica rapa]
Length=330

 Score =   361 bits (927),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 190/330 (58%), Positives = 245/330 (74%), Gaps = 3/330 (1%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQSN-AQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASL  223
             M   +A+ ++ ++I +F    N AQL+S FYSTTCPNV+ I   +I+QA ++D R+ A +
Sbjct  1     MGISNAIPSLLLSILMFGVVGNYAQLTSDFYSTTCPNVTVIARGLIEQASRSDVRLTAKV  60

Query  224   IRLHFHDCFVNGCDGSLLLDNN-GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGV  400
             +RLHFHDCFVNGCDGS+LLD      +  EK+A QN  S  GF+V+D+IKTA+EN CPGV
Sbjct  61    MRLHFHDCFVNGCDGSVLLDAAPADGVEGEKEAFQNAGSLDGFEVIDDIKTALENVCPGV  120

Query  401   VSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTN  580
             VSCADILA+A+E +VSLAGGPSW+VLLGRRDG TAN+G A T+LP   D L  LT KF+ 
Sbjct  121   VSCADILAIAAEISVSLAGGPSWDVLLGRRDGRTANRGEAVTALPLGPDSLEILTSKFSV  180

Query  581   VGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFS-NTGNPDPTLNTTYLATLQQVCPQGGS  757
               L+  DLVALSGAHTFGR QC    NRL NFS N G  DPT+   +L TL++ CPQGGS
Sbjct  181   HNLDTTDLVALSGAHTFGRVQCGVITNRLHNFSGNNGQSDPTIEPEFLQTLRRQCPQGGS  240

Query  758   GSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQ  937
              +   NLD T+ D+FDN+YF NLQNNRG+++SDQ LFS++G+ T+++VN F+ NQ  FF 
Sbjct  241   LTARVNLDDTSPDSFDNDYFKNLQNNRGVIESDQILFSSTGSPTVSLVNRFAENQNEFFG  300

Query  938   SFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             +F +SMI MGN+  LTG+ GEIR +CRR+N
Sbjct  301   NFARSMIKMGNVKVLTGTEGEIRRDCRRVN  330



>gb|AFK47226.1| unknown [Medicago truncatula]
Length=352

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 197/325 (61%), Positives = 232/325 (71%), Gaps = 1/325 (0%)
 Frame = +2

Query  53    SFSALLAMAVAIFIFFSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRL  232
             S +AL  + V +       NAQL ++FY  TCPNV SIV  V++   + D RI ASLIRL
Sbjct  7     SLAALCCVVVVLGGLPFSPNAQLDNSFYRDTCPNVHSIVREVLRNVSKTDPRILASLIRL  66

Query  233   HFHDCFVNGCDGSLLLDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCA  412
             HFHDCFV GCD S+LL N  +TI SE+ A  NNNS RG DVV+ IKTAVENACP  VSCA
Sbjct  67    HFHDCFVQGCDASILL-NTTSTITSEQTAFGNNNSIRGLDVVNQIKTAVENACPNTVSCA  125

Query  413   DIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLN  592
             DILALA+E +  LA GP W V LGRRD  TAN   AN +LP+P  +L+ L   F N GL+
Sbjct  126   DILALAAEISSVLANGPDWKVPLGRRDSLTANLTLANINLPSPAFNLTQLKSNFDNQGLD  185

Query  593   VNDLVALSGAHTFGRAQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVT  772
               DLVALSGAHT GR QCR F +RL+NFSNTGNPDPTLNTTYL TL+ +CP GG GST+T
Sbjct  186   ATDLVALSGAHTIGRGQCRFFVDRLYNFSNTGNPDPTLNTTYLQTLRTICPNGGPGSTLT  245

Query  773   NLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQS  952
             +LDP T DT D+ Y+SNL+  +GL +SDQ L STSGA TIAIVN+F+ NQT FF++F  S
Sbjct  246   DLDPATPDTCDSAYYSNLRIQKGLFQSDQVLSSTSGADTIAIVNSFNNNQTLFFEAFKAS  305

Query  953   MINMGNISPLTGSSGEIRLNCRRLN  1027
             MI M  I  LTGS GEIR  C  +N
Sbjct  306   MIKMSRIKVLTGSQGEIRKQCNFVN  330



>ref|XP_007147503.1| hypothetical protein PHAVU_006G130100g [Phaseolus vulgaris]
 gb|ESW19497.1| hypothetical protein PHAVU_006G130100g [Phaseolus vulgaris]
Length=350

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 225/310 (73%), Gaps = 1/310 (0%)
 Frame = +2

Query  98    FSQSNAQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASLIRLHFHDCFVNGCDGSLL  277
             F  S A LS+T+Y  TCP + SIV  VI  A   D  IGASLIRLHFHDCFV GCD S+L
Sbjct  19    FPVSCADLSTTYYDITCPLLYSIVYGVINNAYLTDPLIGASLIRLHFHDCFVQGCDASVL  78

Query  278   LDNNGTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGVVSCADIlalasesavslaG  457
             L N+ T I SE+DA  N NS RG DVV+NIKTAVEN+CP  VSCADILA+A+E    L G
Sbjct  79    LKNSAT-IESEQDAIPNINSIRGLDVVNNIKTAVENSCPETVSCADILAIAAEVGSVLGG  137

Query  458   GPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTNVGLNVNDLVALSGAHTFGR  637
             GPSW+VLLGRRD  TAN+  AN +LP P   L  L + F   GLN  DLVALSGAHTFGR
Sbjct  138   GPSWSVLLGRRDSLTANRSLANLNLPAPSSTLDQLQQSFAVQGLNTTDLVALSGAHTFGR  197

Query  638   AQCRTFNNRLFNFSNTGNPDPTLNTTYLATLQQVCPQGGSGSTVTNLDPTTSDTFDNNYF  817
             A C  F+NRL NF++T +PDPTLN+TYLATL ++CP   +   + NLD TT D FDN Y+
Sbjct  198   AHCSLFSNRLHNFNDTESPDPTLNSTYLATLSEICPLDATEDNLANLDLTTPDKFDNKYY  257

Query  818   SNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQSFVQSMINMGNISPLTGSSG  997
             SNLQN+ GLL+SD+ELFSTSGA TI +VN+FS++Q+ FF +F  SM  MG+IS LTG  G
Sbjct  258   SNLQNHNGLLQSDKELFSTSGADTIHLVNSFSSDQSVFFDNFAVSMTKMGSISVLTGDEG  317

Query  998   EIRLNCRRLN  1027
             EIRL C  +N
Sbjct  318   EIRLQCNLVN  327



>emb|CDX92493.1| BnaA10g15320D [Brassica napus]
Length=330

 Score =   360 bits (923),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 189/330 (57%), Positives = 245/330 (74%), Gaps = 3/330 (1%)
 Frame = +2

Query  47    MASFSALLAMAVAIFIFFSQSN-AQLSSTFYSTTCPNVSSIVSTVIQQALQNDARIGASL  223
             M   +A+ ++ ++I +F    N AQL+S FYSTTCPNV+ I   +I+QA ++D R+ A +
Sbjct  1     MGISNAIPSLLLSILMFGVVGNYAQLTSDFYSTTCPNVTVITRGLIEQASRSDVRLTAKV  60

Query  224   IRLHFHDCFVNGCDGSLLLDNN-GTTIVSEKDAAQNNNSARGFDVVDNIKTAVENACPGV  400
             +RLHFHDCFVNGCDGS+LLD      +  EK+A QN  S  GF+V+D+IKTA+EN CPGV
Sbjct  61    MRLHFHDCFVNGCDGSVLLDAAPADGVEGEKEAFQNAGSLDGFEVIDDIKTALENVCPGV  120

Query  401   VSCADIlalasesavslaGGPSWNVLLGRRDGTTANQGGANTSLPNPFDDLSNLTRKFTN  580
             VSCADILA+A+E +VSLAGGPSW+VLLGRRDG TAN+G A T+LP   D L  LT KF+ 
Sbjct  121   VSCADILAIAAEISVSLAGGPSWDVLLGRRDGRTANRGEAVTALPLGPDSLEILTSKFSV  180

Query  581   VGLNVNDLVALSGAHTFGRAQCRTFNNRLFNFS-NTGNPDPTLNTTYLATLQQVCPQGGS  757
               L+  DLVALSGAHTFGR QC    NRL NFS + G  DPT+   +L TL++ CPQGGS
Sbjct  181   HNLDTTDLVALSGAHTFGRVQCGVITNRLHNFSGDNGQSDPTIEPEFLQTLRRQCPQGGS  240

Query  758   GSTVTNLDPTTSDTFDNNYFSNLQNNRGLLKSDQELFSTSGAATIAIVNNFSANQTAFFQ  937
              +   NLD T+ D+FDN+YF NLQNNRG+++SDQ LFS++G+ T+++VN F+ NQ  FF 
Sbjct  241   LTARVNLDDTSPDSFDNDYFKNLQNNRGVIESDQILFSSTGSPTVSLVNRFAENQNEFFG  300

Query  938   SFVQSMINMGNISPLTGSSGEIRLNCRRLN  1027
             +F +SMI MGN+  LTG+ GEIR +CRR+N
Sbjct  301   NFARSMIKMGNVKVLTGTEGEIRRDCRRVN  330



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3249488224448