BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25415_g2_i3 len=1206 path=[3943:0-183 6834:184-206 2324:207-249
7751:250-265 7767:266-273 6922:274-330 4270:331-333 4273:334-418
7715:419-422 7862:423-443 7883:444-463 5865:464-742 4678:743-797
8000:798-800 7553:801-816 1161:817-845 1190:846-872 4803:873-880
4811:881-905 8049:906-919 2134:920-946 664:947-1025 743:1026-1061
1972:1062-1080 1991:1081-1104 2015:1105-1147 2058:1148-1205]

Length=1206
                                                                      Score     E

ref|XP_009798057.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     549   0.0      
ref|XP_009629383.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     549   0.0      
ref|XP_006339667.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     542   0.0      
ref|XP_004229972.1|  PREDICTED: GDSL esterase/lipase At4g01130          540   0.0      
ref|XP_011093343.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     540   0.0      
ref|XP_009788631.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     539   0.0      
ref|XP_009798059.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     538   0.0      
ref|XP_006345572.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     537   0.0      
ref|XP_009631126.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     533   0.0      
ref|XP_004240088.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     530   0.0      
emb|CDP08726.1|  unnamed protein product                                530   0.0      
ref|XP_009629382.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     526   0.0      
ref|XP_007051643.1|  Esterase, putative isoform 1                       522   0.0      
gb|KDO86384.1|  hypothetical protein CISIN_1g016356mg                   520   3e-180   
ref|XP_006444901.1|  hypothetical protein CICLE_v10023404mg             518   5e-180   
ref|XP_006491222.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     518   1e-179   
ref|NP_001240253.1|  uncharacterized protein LOC100780915 precursor     518   1e-179   
ref|XP_002320844.2|  acetylesterase family protein                      518   1e-179   Populus trichocarpa [western balsam poplar]
gb|KHN27060.1|  GDSL esterase/lipase                                    516   5e-179   
ref|XP_007155875.1|  hypothetical protein PHAVU_003G239200g             514   3e-178   
ref|XP_011037535.1|  PREDICTED: GDSL esterase/lipase At4g01130          512   2e-177   
ref|XP_010251552.1|  PREDICTED: GDSL esterase/lipase At4g01130 is...    512   3e-177   
gb|KHG21398.1|  hypothetical protein F383_26467                         509   2e-176   
gb|EYU32203.1|  hypothetical protein MIMGU_mgv11b006860mg               508   5e-176   
ref|XP_004494780.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     507   1e-175   
gb|AFK46362.1|  unknown                                                 505   1e-174   
ref|XP_002276525.1|  PREDICTED: GDSL esterase/lipase At4g01130          505   1e-174   Vitis vinifera
gb|AES82745.2|  lanatoside 15-O-acetylesterase                          502   1e-173   
gb|KHN35354.1|  GDSL esterase/lipase                                    501   2e-173   
ref|XP_003626527.1|  GDSL esterase/lipase                               503   4e-173   
ref|XP_007218163.1|  hypothetical protein PRUPE_ppa007486mg             499   7e-173   
ref|XP_008233226.1|  PREDICTED: GDSL esterase/lipase At4g01130          500   8e-173   
ref|XP_003520865.1|  PREDICTED: GDSL esterase/lipase At4g01130-li...    498   4e-172   
ref|XP_010669500.1|  PREDICTED: GDSL esterase/lipase At4g01130          499   4e-172   
emb|CAA09694.1|  lanatoside 15'-O-acetylesterase                        498   8e-172   Digitalis lanata [Grecian foxglove]
gb|AAY41077.1|  lanatoside 15-O-acetylesterase                          496   3e-171   Digitalis lanata [Grecian foxglove]
gb|AAY41078.1|  lanatoside 15-O-acetylesterase                          494   2e-170   Digitalis grandiflora
gb|AAY41079.1|  lanatoside 15-O-acetylesterase                          493   5e-170   Digitalis subalpina
gb|AAY42522.1|  lanatoside 15'-O-acetylesterase                         492   2e-169   Digitalis lanata [Grecian foxglove]
gb|KDP28531.1|  hypothetical protein JCGZ_14302                         490   8e-169   
ref|XP_008347156.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     490   1e-168   
ref|XP_004306703.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     489   3e-168   
ref|XP_002511954.1|  Esterase precursor, putative                       486   3e-167   Ricinus communis
ref|XP_010053782.1|  PREDICTED: GDSL esterase/lipase At4g01130          479   3e-164   
ref|XP_008793652.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    476   3e-163   
ref|XP_009134515.1|  PREDICTED: GDSL esterase/lipase At4g01130          473   3e-162   
emb|CDX91879.1|  BnaC03g31810D                                          473   3e-162   
ref|XP_010427723.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     471   3e-161   
ref|XP_009421235.1|  PREDICTED: GDSL esterase/lipase At4g01130          471   3e-161   
ref|XP_010925787.1|  PREDICTED: GDSL esterase/lipase At4g01130          471   3e-161   
ref|XP_008458153.1|  PREDICTED: GDSL esterase/lipase At4g01130          469   9e-160   
ref|XP_004170182.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     467   9e-160   
ref|XP_010422775.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    467   1e-159   
ref|XP_011094782.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     467   1e-159   
ref|XP_006396297.1|  hypothetical protein EUTSA_v10028725mg             466   2e-159   
gb|EPS57812.1|  hypothetical protein M569_17003                         462   2e-158   
ref|XP_007051644.1|  Esterase, putative isoform 2                       462   3e-158   
ref|XP_006286509.1|  hypothetical protein CARUB_v10001068mg             464   4e-158   
gb|EYU32204.1|  hypothetical protein MIMGU_mgv1a008044mg                462   7e-158   
gb|EYU31639.1|  hypothetical protein MIMGU_mgv1a008086mg                462   1e-157   
gb|KDO86383.1|  hypothetical protein CISIN_1g016356mg                   460   2e-157   
gb|KGN45708.1|  hypothetical protein Csa_6G007420                       461   9e-157   
ref|XP_002874995.1|  predicted protein                                  456   2e-155   
gb|KFK30700.1|  hypothetical protein AALP_AA6G016400                    455   4e-155   
ref|NP_192022.1|  GDSL esterase/lipase                                  454   1e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002437870.1|  hypothetical protein SORBIDRAFT_10g004120          453   5e-154   Sorghum bicolor [broomcorn]
gb|AFS60085.1|  lanatoside 15-O-acetylesterase                          452   2e-153   
ref|XP_010522937.1|  PREDICTED: GDSL esterase/lipase At4g01130          447   1e-151   
ref|NP_001056878.1|  Os06g0160200                                       446   2e-151   Oryza sativa Japonica Group [Japonica rice]
gb|AAB61024.1|  similar to the GDSL family of lipolytic enzymes         442   2e-150   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001141819.1|  hypothetical protein precursor                     443   3e-150   Zea mays [maize]
gb|KHN15973.1|  GDSL esterase/lipase                                    441   5e-150   
gb|KHN27264.1|  GDSL esterase/lipase                                    442   7e-150   
gb|EEC80060.1|  hypothetical protein OsI_21767                          436   1e-147   Oryza sativa Indica Group [Indian rice]
ref|XP_006656665.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     434   5e-147   
ref|XP_007135191.1|  hypothetical protein PHAVU_010G108700g             432   9e-146   
gb|AFK36392.1|  unknown                                                 431   1e-145   
ref|XP_003637203.1|  GDSL esterase/lipase                               429   8e-145   
gb|ACU23212.1|  unknown                                                 423   4e-142   Glycine max [soybeans]
ref|XP_008376070.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    423   3e-141   
ref|XP_006843362.1|  hypothetical protein AMTR_s00053p00063310          372   1e-123   
ref|XP_010251553.1|  PREDICTED: GDSL esterase/lipase At4g01130 is...    373   1e-123   
ref|XP_004510740.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     354   2e-115   
gb|EPS57895.1|  hypothetical protein M569_16921                         338   2e-110   
ref|XP_006577336.1|  PREDICTED: GDSL esterase/lipase At4g01130-li...    314   2e-101   
dbj|BAF01373.1|  putative acetyltransferase                             310   5e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007141041.1|  hypothetical protein PHAVU_008G162300g             308   2e-97    
ref|XP_003589576.1|  Early nodulin                                      308   3e-97    
ref|XP_007141040.1|  hypothetical protein PHAVU_008G162300g             308   3e-97    
ref|XP_004966736.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     301   2e-96    
gb|KDO82203.1|  hypothetical protein CISIN_1g016007mg                   306   2e-96    
ref|XP_006438238.1|  hypothetical protein CICLE_v10031741mg             305   3e-96    
ref|XP_007224356.1|  hypothetical protein PRUPE_ppa020848mg             303   2e-95    
ref|XP_010912877.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     302   2e-95    
ref|XP_010044557.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     302   2e-95    
ref|XP_010999386.1|  PREDICTED: esterase-like                           301   5e-95    
ref|XP_007227294.1|  hypothetical protein PRUPE_ppa017062mg             301   8e-95    
ref|XP_010044556.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     301   1e-94    
ref|XP_008219730.1|  PREDICTED: LOW QUALITY PROTEIN: esterase-like      299   7e-94    
ref|XP_010682277.1|  PREDICTED: GDSL esterase/lipase At3g26430          298   1e-93    
ref|XP_011087101.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     297   2e-93    
ref|XP_003545634.1|  PREDICTED: esterase-like isoform X1                297   3e-93    
ref|XP_007223054.1|  hypothetical protein PRUPE_ppa006965mg             296   5e-93    
gb|KEH22102.1|  GDSL-like lipase/acylhydrolase                          296   6e-93    
gb|EPS70495.1|  acetylcholinesterase                                    295   7e-93    
ref|XP_002530043.1|  Alpha-L-fucosidase 2 precursor, putative           296   8e-93    Ricinus communis
ref|XP_010248683.1|  PREDICTED: GDSL esterase/lipase At3g26430          295   1e-92    
gb|KHN25211.1|  Esterase                                                294   2e-92    
gb|KHN29023.1|  GDSL esterase/lipase                                    295   2e-92    
ref|XP_003531330.1|  PREDICTED: GDSL esterase/lipase At3g26430 is...    295   3e-92    
ref|XP_003547701.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    294   3e-92    
ref|XP_008219729.1|  PREDICTED: esterase-like                           294   4e-92    
gb|ABR16845.1|  unknown                                                 293   6e-92    Picea sitchensis
ref|XP_007019070.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    294   7e-92    
dbj|BAG09557.1|  acetylcholinesterase                                   293   8e-92    Macroptilium atropurpureum
ref|XP_003544687.2|  PREDICTED: esterase-like                           295   8e-92    
ref|XP_006852384.1|  hypothetical protein AMTR_s00049p00231110          292   9e-92    
ref|XP_007227131.1|  hypothetical protein PRUPE_ppa026073mg             292   2e-91    
gb|KDP32799.1|  hypothetical protein JCGZ_12091                         292   2e-91    
ref|XP_010044555.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     292   2e-91    
gb|ABK27056.1|  unknown                                                 291   3e-91    Picea sitchensis
ref|XP_002285512.1|  PREDICTED: GDSL esterase/lipase At3g26430          291   4e-91    Vitis vinifera
ref|XP_004493252.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     292   4e-91    
ref|XP_007159263.1|  hypothetical protein PHAVU_002G223300g             291   4e-91    
ref|XP_009415970.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     291   5e-91    
gb|KCW86642.1|  hypothetical protein EUGRSUZ_B03271                     293   5e-91    
gb|KHN34622.1|  GDSL esterase/lipase                                    291   5e-91    
ref|XP_008221893.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     291   5e-91    
ref|XP_003554066.1|  PREDICTED: GDSL esterase/lipase At3g26430          291   7e-91    
ref|XP_007224644.1|  hypothetical protein PRUPE_ppa026400mg             290   1e-90    
ref|XP_007224325.1|  hypothetical protein PRUPE_ppa020425mg             290   2e-90    
ref|XP_008221894.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     290   2e-90    
ref|XP_004158356.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     289   2e-90    
ref|XP_007221845.1|  hypothetical protein PRUPE_ppa024482mg             290   2e-90    
gb|AGZ15410.1|  acetylcholinesterase                                    290   2e-90    
ref|XP_010551928.1|  PREDICTED: GDSL esterase/lipase At5g14450          290   2e-90    
ref|XP_004491984.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    289   3e-90    
gb|EYU30623.1|  hypothetical protein MIMGU_mgv1a007766mg                289   4e-90    
gb|KDP46394.1|  hypothetical protein JCGZ_10234                         289   4e-90    
ref|XP_008782097.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     289   4e-90    
gb|KDP26686.1|  hypothetical protein JCGZ_17844                         289   4e-90    
ref|XP_010242789.1|  PREDICTED: esterase-like isoform X1                289   4e-90    
gb|ABK25197.1|  unknown                                                 283   5e-90    Picea sitchensis
ref|XP_011034054.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    289   5e-90    
gb|KHG01494.1|  Esterase                                                288   5e-90    
ref|XP_010929893.1|  PREDICTED: alpha-L-fucosidase 3                    288   5e-90    
ref|XP_004504128.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     288   8e-90    
gb|KGN59717.1|  hypothetical protein Csa_3G840430                       288   8e-90    
gb|KEH20768.1|  GDSL-like lipase/acylhydrolase                          288   9e-90    
emb|CDP16617.1|  unnamed protein product                                288   9e-90    
ref|XP_009386685.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     288   1e-89    
ref|XP_010100371.1|  GDSL esterase/lipase                               288   1e-89    
ref|XP_008446147.1|  PREDICTED: GDSL esterase/lipase At3g26430          288   1e-89    
ref|XP_004292695.1|  PREDICTED: esterase-like                           288   1e-89    
ref|XP_008464935.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    288   1e-89    
ref|XP_009406370.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     288   2e-89    
ref|XP_007031630.1|  Esterase, putative                                 287   2e-89    
ref|XP_003589577.1|  Early nodulin                                      286   3e-89    
ref|XP_008219728.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    304   3e-89    
ref|XP_002307434.1|  early nodulin 8 precursor family protein           286   4e-89    Populus trichocarpa [western balsam poplar]
gb|KHN33852.1|  Esterase                                                286   4e-89    
ref|XP_006446639.1|  hypothetical protein CICLE_v10015574mg             286   4e-89    
ref|XP_009611346.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     286   4e-89    
ref|XP_008464936.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    286   5e-89    
gb|KEH40535.1|  GDSL-like lipase/acylhydrolase                          286   5e-89    
ref|XP_008340355.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     286   5e-89    
ref|XP_002530042.1|  Alpha-L-fucosidase 2 precursor, putative           286   6e-89    Ricinus communis
ref|XP_010029090.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     286   7e-89    
ref|XP_004173555.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    285   7e-89    
ref|XP_003624763.1|  GDSL esterase/lipase                               286   8e-89    
ref|XP_004304671.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     285   8e-89    
ref|XP_007141047.1|  hypothetical protein PHAVU_008G162800g             286   8e-89    
gb|ABK26504.1|  unknown                                                 283   1e-88    Picea sitchensis
ref|XP_004298997.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     285   1e-88    
ref|XP_006470214.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     285   2e-88    
ref|XP_008353024.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     285   2e-88    
ref|XP_004141116.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     284   2e-88    
ref|XP_006446637.1|  hypothetical protein CICLE_v10015586mg             285   2e-88    
ref|XP_008464934.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     284   2e-88    
ref|XP_003624771.1|  GDSL esterase/lipase                               284   2e-88    
ref|XP_008804229.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     284   3e-88    
ref|XP_002284695.1|  PREDICTED: esterase                                284   3e-88    Vitis vinifera
emb|CDX83618.1|  BnaC07g23580D                                          284   3e-88    
ref|XP_006434193.1|  hypothetical protein CICLE_v10001435mg             284   4e-88    
ref|XP_002513813.1|  Esterase precursor, putative                       283   4e-88    Ricinus communis
ref|NP_001060128.1|  Os07g0586100                                       284   4e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007140861.1|  hypothetical protein PHAVU_008G147700g             284   5e-88    
ref|XP_009771354.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    284   5e-88    
emb|CBI16798.3|  unnamed protein product                                283   5e-88    
ref|XP_011101808.1|  PREDICTED: GDSL esterase/lipase At5g14450          284   5e-88    
ref|XP_009363153.1|  PREDICTED: esterase-like isoform X1                283   6e-88    
ref|XP_002311760.2|  GDSL-motif lipase/hydrolase family protein         283   6e-88    Populus trichocarpa [western balsam poplar]
ref|XP_004298998.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     283   6e-88    
gb|KDO49031.1|  hypothetical protein CISIN_1g016659mg                   283   6e-88    
ref|XP_010682275.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     284   6e-88    
gb|EEC82351.1|  hypothetical protein OsI_26660                          284   6e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_011101807.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     283   7e-88    
gb|KDP26685.1|  hypothetical protein JCGZ_17843                         283   8e-88    
ref|XP_002513811.1|  Esterase precursor, putative                       283   9e-88    Ricinus communis
emb|CAN71345.1|  hypothetical protein VITISV_024250                     283   9e-88    Vitis vinifera
ref|XP_007159696.1|  hypothetical protein PHAVU_002G259500g             283   1e-87    
ref|XP_008230503.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    283   1e-87    
ref|XP_003589586.1|  Enod8.3                                            283   1e-87    
ref|XP_006470213.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     283   1e-87    
gb|KHG05491.1|  hypothetical protein F383_30482                         282   1e-87    
gb|EYU44799.1|  hypothetical protein MIMGU_mgv1a008141mg                282   1e-87    
ref|XP_010492254.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     283   1e-87    
ref|XP_002282372.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     282   2e-87    Vitis vinifera
ref|XP_007223009.1|  hypothetical protein PRUPE_ppa006817mg             282   2e-87    
ref|XP_011097366.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    281   2e-87    
ref|XP_007216389.1|  hypothetical protein PRUPE_ppa021457mg             281   2e-87    
ref|XP_009779715.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     281   3e-87    
ref|XP_002521491.1|  Esterase precursor, putative                       282   3e-87    Ricinus communis
ref|XP_008230934.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     281   3e-87    
gb|EYU34754.1|  hypothetical protein MIMGU_mgv11b006645mg               281   3e-87    
ref|XP_010453569.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     281   3e-87    
ref|XP_010110055.1|  GDSL esterase/lipase                               283   3e-87    
ref|XP_006852383.1|  hypothetical protein AMTR_s00049p00230810          281   3e-87    
ref|XP_008340092.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     283   3e-87    
ref|XP_009771353.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    281   4e-87    
ref|XP_009121660.1|  PREDICTED: GDSL esterase/lipase At5g14450          281   5e-87    
ref|XP_010420084.1|  PREDICTED: GDSL esterase/lipase At5g14450          281   5e-87    
ref|XP_006438239.1|  hypothetical protein CICLE_v10031753mg             281   5e-87    
ref|XP_004290869.1|  PREDICTED: esterase-like                           281   5e-87    
ref|XP_004135278.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     281   5e-87    
gb|KDO80652.1|  hypothetical protein CISIN_1g015153mg                   282   5e-87    
ref|XP_002871620.1|  GDSL-motif lipase/hydrolase family protein         281   6e-87    
ref|XP_010248682.1|  PREDICTED: GDSL esterase/lipase At5g14450          281   6e-87    
emb|CDP13237.1|  unnamed protein product                                281   6e-87    
ref|XP_007225083.1|  hypothetical protein PRUPE_ppa017577mg             281   7e-87    
ref|XP_009359342.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    283   8e-87    
ref|XP_006852380.1|  hypothetical protein AMTR_s00049p00229270          280   8e-87    
sp|Q7Y1X1.1|EST_HEVBR  RecName: Full=Esterase; AltName: Full=Earl...    280   9e-87    Hevea brasiliensis [jebe]
emb|CDY09855.1|  BnaC09g43060D                                          280   9e-87    
ref|XP_010425337.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     280   9e-87    
ref|XP_010029093.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     280   1e-86    
ref|XP_002875320.1|  GDSL-motif lipase/hydrolase family protein         280   1e-86    
ref|XP_009771352.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    280   1e-86    
emb|CBI16795.3|  unnamed protein product                                282   1e-86    
ref|XP_010556209.1|  PREDICTED: alpha-L-fucosidase 3                    280   1e-86    
ref|XP_002530044.1|  Alpha-L-fucosidase 2 precursor, putative           280   2e-86    Ricinus communis
ref|XP_011042393.1|  PREDICTED: alpha-L-fucosidase 3-like               280   2e-86    
ref|XP_006289899.1|  hypothetical protein CARUB_v10003515mg             280   2e-86    
ref|XP_004239139.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     279   2e-86    
ref|XP_006357594.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     279   2e-86    
ref|XP_007215529.1|  hypothetical protein PRUPE_ppa007107mg             279   3e-86    
ref|XP_007161910.1|  hypothetical protein PHAVU_001G107900g             279   3e-86    
ref|XP_010320940.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    279   3e-86    
ref|XP_008230502.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    279   3e-86    
dbj|BAD43265.1|  ENOD8-like protein                                     278   4e-86    Arabidopsis thaliana [mouse-ear cress]
ref|NP_196949.1|  GDSL esterase/lipase                                  279   4e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007044829.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    279   4e-86    
ref|NP_176949.1|  alpha-L-fucosidase 1                                  278   4e-86    Arabidopsis thaliana [mouse-ear cress]
gb|KHG01562.1|  hypothetical protein F383_21105                         278   4e-86    
ref|XP_010930359.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     279   4e-86    
emb|CBI19019.3|  unnamed protein product                                278   5e-86    
gb|AAL68831.1|AF463407_2  Enod8.2                                       278   6e-86    Medicago truncatula
ref|XP_011042394.1|  PREDICTED: alpha-L-fucosidase 3-like               278   6e-86    
gb|AAB41547.1|  early nodulin                                           278   8e-86    Medicago sativa [alfalfa]
ref|XP_009152056.1|  PREDICTED: GDSL esterase/lipase At3g26430          278   9e-86    
ref|XP_006357593.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     278   9e-86    
gb|EMT24719.1|  GDSL esterase/lipase                                    278   1e-85    
gb|KFK33571.1|  hypothetical protein AALP_AA5G030900                    277   1e-85    
ref|XP_010089185.1|  GDSL esterase/lipase                               277   1e-85    
ref|XP_010100370.1|  GDSL esterase/lipase                               288   1e-85    
ref|XP_004304672.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     277   1e-85    
ref|XP_009779717.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    277   2e-85    
gb|KHN33853.1|  Esterase                                                277   2e-85    
emb|CDY13633.1|  BnaA06g32900D                                          276   2e-85    
ref|XP_007044830.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    277   2e-85    
dbj|BAJ97846.1|  predicted protein                                      277   2e-85    
ref|XP_009377244.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    273   3e-85    
ref|XP_009370349.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     276   3e-85    
gb|AAL68832.1|AF463407_3  Enod8.1                                       276   3e-85    Medicago truncatula
ref|XP_006302412.1|  hypothetical protein CARUB_v10020484mg             276   3e-85    
ref|XP_007031628.1|  Esterase, putative isoform 2                       276   4e-85    
ref|XP_008379194.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     276   5e-85    
ref|NP_001242659.1|  uncharacterized protein LOC100805314 precursor     276   5e-85    
ref|XP_011097365.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     275   5e-85    
gb|EYU44795.1|  hypothetical protein MIMGU_mgv1a008122mg                276   6e-85    
ref|XP_008365369.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     275   6e-85    
ref|XP_004239137.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    275   7e-85    
emb|CCG48014.1|  conserved hypothetical protein, expressed              275   7e-85    
emb|CCG48013.1|  conserved hypothetical protein, expressed              275   8e-85    
ref|XP_009359341.1|  PREDICTED: alpha-L-fucosidase 3-like               275   9e-85    
ref|NP_189274.1|  GDSL esterase/lipase                                  275   9e-85    
ref|XP_002970794.1|  hypothetical protein SELMODRAFT_411673             275   1e-84    
gb|AAC26810.1|  early nodule-specific protein                           275   1e-84    
ref|XP_010664210.1|  PREDICTED: esterase-like                           275   1e-84    
ref|XP_004141199.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     274   1e-84    
gb|KEH40536.1|  GDSL-like lipase/acylhydrolase                          275   1e-84    
ref|XP_008341370.1|  PREDICTED: GDSL esterase/lipase At5g14450          275   1e-84    
ref|XP_011003110.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     275   1e-84    
ref|XP_010502567.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     275   1e-84    
ref|XP_008344421.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     275   2e-84    
gb|EYU22538.1|  hypothetical protein MIMGU_mgv1a008099mg                274   2e-84    
ref|XP_007147074.1|  hypothetical protein PHAVU_006G094100g             274   2e-84    
gb|EAZ04511.1|  hypothetical protein OsI_26662                          274   2e-84    
ref|XP_004292697.1|  PREDICTED: esterase-like                           274   2e-84    
ref|XP_002299380.2|  early nodulin 8 precursor family protein           274   2e-84    
ref|XP_006473022.1|  PREDICTED: uncharacterized protein LOC102624203    288   3e-84    
gb|KFK25684.1|  hypothetical protein AALP_AA8G145800                    274   3e-84    
ref|XP_002888627.1|  hypothetical protein ARALYDRAFT_475890             273   3e-84    
ref|NP_001060129.1|  Os07g0586200                                       274   4e-84    
emb|CBI19020.3|  unnamed protein product                                274   4e-84    
ref|XP_006291234.1|  hypothetical protein CARUB_v10017365mg             274   4e-84    
ref|XP_010470714.1|  PREDICTED: alpha-L-fucosidase 3-like               273   4e-84    
ref|XP_009617545.1|  PREDICTED: GDSL esterase/lipase At3g27950 is...    273   5e-84    
ref|XP_011008211.1|  PREDICTED: esterase-like                           273   5e-84    
ref|XP_010100372.1|  GDSL esterase/lipase                               273   6e-84    
ref|XP_010556339.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    273   7e-84    
ref|XP_009778765.1|  PREDICTED: GDSL esterase/lipase At3g27950-li...    273   8e-84    
ref|XP_002300062.1|  hypothetical protein POPTR_0001s35620g             273   8e-84    
gb|AAA91034.1|  nodulin                                                 273   8e-84    
ref|XP_006399957.1|  hypothetical protein EUTSA_v10013537mg             275   8e-84    
ref|XP_004491983.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     272   1e-83    
emb|CBI34838.3|  unnamed protein product                                271   1e-83    
ref|XP_002285509.2|  PREDICTED: uncharacterized protein LOC100264440    283   1e-83    
ref|XP_008221990.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    272   1e-83    
gb|ACJ85056.1|  unknown                                                 272   1e-83    
ref|XP_010510464.1|  PREDICTED: alpha-L-fucosidase 3                    271   1e-83    
ref|XP_009371742.1|  PREDICTED: GDSL esterase/lipase At5g14450          272   2e-83    
gb|EYU22539.1|  hypothetical protein MIMGU_mgv1a008099mg                272   2e-83    
ref|XP_007044833.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    273   2e-83    
emb|CBI16797.3|  unnamed protein product                                271   2e-83    
ref|XP_002271320.2|  PREDICTED: GDSL esterase/lipase At5g14450          272   2e-83    
ref|XP_011099272.1|  PREDICTED: GDSL esterase/lipase At1g54790          271   2e-83    
ref|XP_010511747.1|  PREDICTED: alpha-L-fucosidase 3                    271   2e-83    
ref|XP_010025155.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    271   3e-83    
ref|XP_009406457.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    271   3e-83    
ref|XP_010415375.1|  PREDICTED: alpha-L-fucosidase 3-like               271   3e-83    
ref|XP_006850822.1|  hypothetical protein AMTR_s00025p00126710          271   4e-83    
ref|XP_009359196.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     271   4e-83    
dbj|BAI23204.1|  acetylcholinesterase                                   271   5e-83    
ref|XP_010025156.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    270   5e-83    
ref|XP_008246516.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    270   7e-83    
ref|XP_010514280.1|  PREDICTED: GDSL esterase/lipase At3g26430          270   9e-83    
ref|XP_010278961.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     270   1e-82    
ref|XP_010678671.1|  PREDICTED: GDSL esterase/lipase At5g14450          270   1e-82    
ref|XP_004306388.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     270   1e-82    
ref|XP_010044562.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    270   1e-82    
emb|CDP17963.1|  unnamed protein product                                269   2e-82    
dbj|BAK03632.1|  predicted protein                                      270   2e-82    
ref|XP_010675009.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    269   2e-82    
ref|XP_004300927.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     269   2e-82    
ref|XP_004302456.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    268   3e-82    
gb|KEH22100.1|  GDSL-like lipase/acylhydrolase                          269   3e-82    
ref|XP_010675010.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    268   4e-82    
gb|KFK41199.1|  hypothetical protein AALP_AA2G098300                    267   5e-82    
ref|XP_009602454.1|  PREDICTED: GDSL esterase/lipase At1g54790          268   6e-82    
ref|XP_004302457.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    268   6e-82    
ref|XP_007140963.1|  hypothetical protein PHAVU_008G155800g             268   6e-82    
ref|XP_008246517.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    267   7e-82    
ref|XP_006391214.1|  hypothetical protein EUTSA_v10018726mg             267   7e-82    
ref|XP_010229940.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    265   7e-82    
ref|XP_002524808.1|  Alpha-L-fucosidase 2 precursor, putative           269   8e-82    
ref|XP_008370518.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     267   8e-82    
ref|XP_007031629.1|  Esterase, putative                                 267   8e-82    
ref|XP_004494638.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    267   9e-82    
gb|KDO82202.1|  hypothetical protein CISIN_1g017691mg                   266   1e-81    
ref|XP_009335632.1|  PREDICTED: GDSL esterase/lipase At1g54790          267   1e-81    
ref|XP_007207217.1|  hypothetical protein PRUPE_ppa001667mg             278   1e-81    
ref|XP_010025157.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    270   1e-81    
ref|XP_006347466.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     267   1e-81    
ref|XP_006595232.1|  PREDICTED: uncharacterized protein LOC100779421    277   1e-81    
ref|XP_006361875.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     266   1e-81    
ref|XP_010044559.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    267   2e-81    
ref|XP_010322965.1|  PREDICTED: GDSL esterase/lipase At3g27950          266   2e-81    
ref|XP_009406458.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    266   2e-81    
ref|XP_008388596.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    266   2e-81    
gb|KDP21506.1|  hypothetical protein JCGZ_21977                         266   2e-81    
ref|XP_003554667.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    266   2e-81    
gb|EMT15425.1|  GDSL esterase/lipase                                    266   2e-81    
ref|XP_004230167.1|  PREDICTED: GDSL esterase/lipase At1g54790          266   3e-81    
gb|ABR16067.1|  unknown                                                 266   4e-81    
ref|XP_006483961.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     266   4e-81    
gb|KCW59731.1|  hypothetical protein EUGRSUZ_H02484                     266   4e-81    
emb|CDY56207.1|  BnaAnng14060D                                          265   5e-81    
ref|XP_010664903.1|  PREDICTED: uncharacterized protein LOC100262628    279   5e-81    
gb|ACU22979.1|  unknown                                                 265   5e-81    
gb|KEH22099.1|  GDSL-like lipase/acylhydrolase                          265   6e-81    
ref|XP_009773596.1|  PREDICTED: GDSL esterase/lipase At1g54790          265   7e-81    
gb|AES82539.2|  GDSL-like lipase/acylhydrolase                          265   8e-81    
ref|XP_009105337.1|  PREDICTED: alpha-L-fucosidase 3                    264   9e-81    
ref|XP_007030926.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    265   9e-81    
gb|ACG38411.1|  alpha-L-fucosidase 2 precursor                          265   1e-80    
ref|XP_002284922.1|  PREDICTED: GDSL esterase/lipase At1g54790          264   1e-80    
ref|XP_006382646.1|  GDSL-motif lipase/hydrolase family protein         265   1e-80    
ref|XP_002463099.1|  hypothetical protein SORBIDRAFT_02g037820          265   1e-80    
gb|EYU34753.1|  hypothetical protein MIMGU_mgv1a008002mg                264   1e-80    
gb|ABD32376.1|  Lipolytic enzyme, G-D-S-L                               264   2e-80    
ref|XP_002975996.1|  hypothetical protein SELMODRAFT_104760             264   2e-80    
ref|XP_009631128.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     257   2e-80    
ref|XP_007226193.1|  hypothetical protein PRUPE_ppa015908mg             263   2e-80    
ref|XP_002319556.2|  hypothetical protein POPTR_0013s02730g             263   2e-80    
ref|XP_008455063.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    263   2e-80    
ref|XP_007031627.1|  Esterase, putative isoform 1                       264   2e-80    
ref|XP_006387516.1|  early nodulin 8 precursor family protein           264   2e-80    
ref|XP_011027532.1|  PREDICTED: esterase-like                           264   2e-80    
dbj|BAJ89757.1|  predicted protein                                      264   2e-80    
ref|XP_006471885.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    263   3e-80    
ref|XP_002300989.2|  hypothetical protein POPTR_0002s08430g             264   3e-80    
ref|XP_011071156.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    265   3e-80    
ref|XP_006577255.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    263   3e-80    
ref|XP_004494637.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    263   4e-80    
ref|XP_004139194.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     263   4e-80    
ref|XP_006382647.1|  hypothetical protein POPTR_0005s04100g             263   4e-80    
ref|XP_009373965.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    263   4e-80    
ref|XP_004156431.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     263   5e-80    
ref|XP_004156429.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     263   5e-80    
ref|NP_001105800.1|  uncharacterized protein LOC606473 precursor        263   5e-80    
ref|XP_011048917.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    263   6e-80    
gb|KGN60869.1|  hypothetical protein Csa_2G020920                       262   6e-80    
ref|XP_002512338.1|  Alpha-L-fucosidase 2 precursor, putative           262   6e-80    
ref|NP_001266613.1|  alpha-L-fucosidase 2 precursor                     263   7e-80    
ref|XP_011010771.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    262   8e-80    
ref|XP_002319029.2|  GDSL-motif lipase/hydrolase family protein         262   1e-79    
gb|AFK34131.1|  unknown                                                 262   1e-79    
ref|XP_003562799.2|  PREDICTED: uncharacterized protein LOC100833243    273   1e-79    
gb|KDP23550.1|  hypothetical protein JCGZ_23383                         261   2e-79    
ref|XP_011048918.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    261   2e-79    
ref|XP_004139196.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     261   2e-79    
ref|XP_002968490.1|  hypothetical protein SELMODRAFT_90062              261   2e-79    
ref|XP_008388597.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    261   2e-79    
ref|XP_011023543.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    261   3e-79    
ref|XP_003626321.1|  GDSL esterase/lipase                               263   3e-79    
ref|XP_010553740.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    261   3e-79    
emb|CDY01865.1|  BnaC06g29050D                                          260   3e-79    
ref|XP_011023542.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    261   3e-79    
ref|XP_008455108.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     263   3e-79    
ref|NP_001185228.1|  GDSL esterase/lipase                               261   3e-79    
ref|XP_007044832.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    272   3e-79    
ref|XP_010278953.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     260   4e-79    
gb|KHG03048.1|  hypothetical protein F383_28241                         260   5e-79    
ref|XP_010255785.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    260   5e-79    
emb|CDP13238.1|  unnamed protein product                                261   6e-79    
gb|EPS58572.1|  hypothetical protein M569_16239                         259   6e-79    
ref|XP_008812793.1|  PREDICTED: GDSL esterase/lipase At1g54790          259   8e-79    
ref|XP_004958162.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     260   9e-79    
ref|XP_002301566.1|  hypothetical protein POPTR_0002s22450g             259   9e-79    
ref|XP_008345621.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    259   1e-78    
ref|XP_010511213.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    259   1e-78    
ref|XP_009123458.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    259   1e-78    
ref|XP_010255784.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    260   1e-78    
ref|XP_010243019.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    259   1e-78    
ref|XP_006438237.1|  hypothetical protein CICLE_v10031879mg             259   1e-78    
ref|XP_008365371.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    259   1e-78    
ref|XP_002272185.2|  PREDICTED: GDSL esterase/lipase At5g14450-like     259   1e-78    
ref|XP_003589580.1|  Early nodulin                                      274   2e-78    
ref|XP_007030927.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    259   2e-78    
emb|CBI34837.3|  unnamed protein product                                259   2e-78    
ref|XP_003536096.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    258   2e-78    
ref|XP_010414922.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    259   2e-78    
emb|CDY32569.1|  BnaC02g17620D                                          260   2e-78    
gb|KDP45345.1|  hypothetical protein JCGZ_09594                         260   2e-78    
emb|CDX71574.1|  BnaC04g18090D                                          258   3e-78    
ref|XP_010089184.1|  GDSL esterase/lipase                               258   3e-78    
ref|XP_010682312.1|  PREDICTED: uncharacterized protein LOC104897187    268   3e-78    
ref|XP_010255795.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     258   4e-78    
ref|XP_009373966.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    258   4e-78    
ref|XP_010682276.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     258   4e-78    
gb|KHG16970.1|  hypothetical protein F383_21767                         258   4e-78    
ref|XP_010044558.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    258   5e-78    
ref|XP_009127580.1|  PREDICTED: alpha-L-fucosidase 3-like               257   6e-78    
ref|XP_006599078.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     257   7e-78    
ref|XP_010256199.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     257   8e-78    
ref|XP_010110056.1|  GDSL esterase/lipase                               257   9e-78    
ref|XP_006392486.1|  hypothetical protein EUTSA_v10023524mg             257   1e-77    
ref|XP_008455055.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    256   1e-77    
ref|XP_010044561.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    257   1e-77    
gb|AFW77932.1|  hypothetical protein ZEAMMB73_209815                    256   2e-77    
ref|XP_010414921.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    256   2e-77    
ref|XP_010026633.1|  PREDICTED: uncharacterized protein LOC104417005    268   2e-77    
gb|ACU17816.1|  unknown                                                 256   2e-77    
ref|XP_008458756.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     256   3e-77    
ref|XP_002513810.1|  Esterase precursor, putative                       255   3e-77    
ref|XP_006355000.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     255   4e-77    
emb|CBI34924.3|  unnamed protein product                                255   5e-77    
ref|XP_002274412.3|  PREDICTED: GDSL esterase/lipase At3g27950          255   5e-77    
ref|XP_010270892.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     254   7e-77    
gb|KDP28305.1|  hypothetical protein JCGZ_14076                         254   9e-77    
emb|CDY12671.1|  BnaA02g13390D                                          256   1e-76    
ref|XP_002889747.1|  GDSL-motif lipase/hydrolase family protein         253   2e-76    
ref|XP_010938793.1|  PREDICTED: GDSL esterase/lipase At1g54790          253   2e-76    
ref|XP_006577256.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    253   3e-76    
ref|XP_011097367.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    251   3e-76    
ref|XP_010029183.1|  PREDICTED: GDSL esterase/lipase At3g27950 is...    253   3e-76    
gb|KCW59732.1|  hypothetical protein EUGRSUZ_H02485                     253   3e-76    
ref|XP_003554666.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    253   4e-76    
ref|XP_008365370.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    253   4e-76    
ref|XP_006852386.1|  hypothetical protein AMTR_s00049p00231360          252   5e-76    
ref|XP_010270891.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     252   5e-76    
ref|XP_007031463.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    252   6e-76    
emb|CAN82038.1|  hypothetical protein VITISV_033903                     252   8e-76    
ref|XP_008811524.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         251   1e-75    
ref|XP_006471886.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    251   1e-75    
ref|XP_001757953.1|  predicted protein                                  251   1e-75    
ref|XP_010559217.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     251   2e-75    
ref|XP_010941498.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         250   2e-75    
ref|XP_010909995.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...    251   2e-75    



>ref|XP_009798057.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Nicotiana sylvestris]
Length=380

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/360 (72%), Positives = 304/360 (84%), Gaps = 7/360 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSNTDTGGF+AAFP+  PP+GMTYFKKPVGRATDGRVI+DFLAQGLGL F
Sbjct  27    CGFKAIFNFGDSNTDTGGFWAAFPAQGPPHGMTYFKKPVGRATDGRVILDFLAQGLGLPF  86

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGANFAT++STV  P +SLF + VSPFSLAIQ  Q K+FKV VDE  
Sbjct  87    LSPYLQSIGSDYRHGANFATLASTVRLPQTSLFVTGVSPFSLAIQLRQMKEFKVKVDEH-  145

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                HH    G T LP  +IFGK+LYTFYIGQNDF  +LA +GISGV + LP+VV+QI  T
Sbjct  146   ---HHK---GKTNLPSPDIFGKSLYTFYIGQNDFTGNLARIGISGVKEYLPQVVSQIAST  199

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+I+ LGGRTF++LNLAPIGCYP+FL +L HNTSD+DQFGCL SYNNAV DYNN+LK A
Sbjct  200   IKEIHALGGRTFWVLNLAPIGCYPAFLVELPHNTSDIDQFGCLISYNNAVVDYNNMLKAA  259

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L +TR++I DANV+YVDTH+++L+LFQHPTSHGLKYGTKACCGYGGG YNF +++FCG+T
Sbjct  260   LAKTRKEIADANVIYVDTHAVLLDLFQHPTSHGLKYGTKACCGYGGGAYNFNQQIFCGNT  319

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               +NG TVTA AC+DP NYVSWDG H TDAANK+T  AI +GSYFDPPFPLHH+C + PI
Sbjct  320   KQINGTTVTANACKDPQNYVSWDGIHATDAANKLTAYAILNGSYFDPPFPLHHYCDVQPI  379



>ref|XP_009629383.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Nicotiana tomentosiformis]
Length=389

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/361 (73%), Positives = 303/361 (84%), Gaps = 7/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSNTDTGGF+AAFP+  PP+GMTYFKKPVGRATDGRVI+DFLAQGLGL F
Sbjct  36    CGFKAIFNFGDSNTDTGGFWAAFPAQGPPHGMTYFKKPVGRATDGRVILDFLAQGLGLPF  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGANFAT++STV  P +SLF + VSPFSL IQ  Q K+FKV VDE  
Sbjct  96    LSPYLQSIGSDYRHGANFATLASTVRLPQTSLFVTGVSPFSLEIQLRQMKEFKVKVDEH-  154

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                HH    G T LP  +IFGK+LYTFYIGQNDF  +LA +GISGV + LP VV+QI  T
Sbjct  155   ---HHK---GKTNLPSPDIFGKSLYTFYIGQNDFTGNLARIGISGVKEYLPRVVSQIAST  208

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF++LNLAPIGCYP+FL +L HNTSD+DQFGCL SYNNAV DYNN+LK A
Sbjct  209   IKEIYALGGRTFWVLNLAPIGCYPAFLVELPHNTSDIDQFGCLISYNNAVVDYNNMLKAA  268

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L +TR++I DANVVYVDTH+++L+LFQHPTS+GLKYGTKACCGYGGG YNF ++LFCG+T
Sbjct  269   LAKTRKEIGDANVVYVDTHAVLLDLFQHPTSYGLKYGTKACCGYGGGAYNFNQQLFCGNT  328

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               +NG  VTA+ACEDP NYVSWDG H TDAANK+T  +I +GSYFDPPFPLHH+C I PI
Sbjct  329   KQINGTKVTAKACEDPQNYVSWDGIHATDAANKLTAYSILNGSYFDPPFPLHHYCDIQPI  388

Query  126   G  124
             G
Sbjct  389   G  389



>ref|XP_006339667.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Solanum tuberosum]
Length=376

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/361 (71%), Positives = 301/361 (83%), Gaps = 7/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F AIFNFGDSNTDTGGF+AAFP+  PP+GMTYF KPVGRATDGRV+VDFLAQ L L F
Sbjct  23    CAFKAIFNFGDSNTDTGGFWAAFPAQAPPHGMTYFNKPVGRATDGRVVVDFLAQALDLPF  82

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD++HGANFAT++STV  P +SLF + VSPFSL IQ  Q K+FKV VDE  
Sbjct  83    LSPYLQSIGSDYKHGANFATLASTVRLPQTSLFVTGVSPFSLEIQLRQMKEFKVKVDELP  142

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             ++       G + LP  NIFGK+LYTFYIGQNDF  +LA LGISGV + LP+VV+QI  T
Sbjct  143   RK-------GKSNLPFPNIFGKSLYTFYIGQNDFTGNLARLGISGVKEFLPQVVSQIAST  195

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF++LNLAPIGCYP+FL +L HNTSD+DQFGCL SYNNAV DYNN+LK A
Sbjct  196   IKEIYALGGRTFWVLNLAPIGCYPAFLVQLPHNTSDIDQFGCLISYNNAVVDYNNMLKAA  255

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L +TR+D+ DANVVYVDTH+++LELFQHPTSHGL+YGTK CCGYGGG YN+ +++FCG+T
Sbjct  256   LAKTRKDLADANVVYVDTHTVLLELFQHPTSHGLRYGTKTCCGYGGGLYNYNQQVFCGNT  315

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               +NG+TVTA AC+DP NYVSWDG H TDAANK+T  AI +GSYFDPPFPLH +C I PI
Sbjct  316   KQVNGKTVTANACKDPQNYVSWDGIHATDAANKLTADAILNGSYFDPPFPLHKYCDIQPI  375

Query  126   G  124
             G
Sbjct  376   G  376



>ref|XP_004229972.1| PREDICTED: GDSL esterase/lipase At4g01130 [Solanum lycopersicum]
Length=377

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/361 (70%), Positives = 302/361 (84%), Gaps = 7/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F AIFNFGDSNTDTGGF+AAFP+  PP+GMTYF KPVGRATDGRV+VDFLAQ L L F
Sbjct  24    CAFKAIFNFGDSNTDTGGFWAAFPAQAPPHGMTYFNKPVGRATDGRVVVDFLAQALDLPF  83

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD++HGANFAT++STV  P +SLF + VSPFSL IQ  Q K+FK  VDE  
Sbjct  84    LSPYLQSIGSDYKHGANFATLASTVRLPQTSLFVTGVSPFSLEIQLRQMKEFKAKVDELP  143

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             ++       G T LP  NIFGK+LYTFYIGQNDF  +LA LGISGV + LP+VV+QI  T
Sbjct  144   RK-------GKTSLPSPNIFGKSLYTFYIGQNDFTGNLARLGISGVKEFLPQVVSQIAST  196

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF++LNLAPIGCYP+FL +L HNTSD+DQFGCL SYNNAVADYNN+LK A
Sbjct  197   IKEIYALGGRTFWVLNLAPIGCYPAFLVQLPHNTSDIDQFGCLISYNNAVADYNNMLKAA  256

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L +TR+++ DA+VVYVDTH+++LELFQHPTS+GL+YGTKACCGYGGG YN+ +++FCG+T
Sbjct  257   LAKTRKELVDASVVYVDTHTVLLELFQHPTSNGLRYGTKACCGYGGGLYNYNQQVFCGNT  316

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               +NG TVTA+AC+DP NYVSWDG H TDAANK+T  AI +GSYFDPPFPLH +C I PI
Sbjct  317   KQVNGTTVTAKACKDPQNYVSWDGIHATDAANKLTAYAILNGSYFDPPFPLHKYCDIQPI  376

Query  126   G  124
             G
Sbjct  377   G  377



>ref|XP_011093343.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Sesamum indicum]
Length=387

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/361 (70%), Positives = 296/361 (82%), Gaps = 7/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+  PP GMTYFKKP GRATDGR+I+DFLAQ LGL F
Sbjct  34    CDFKAIFNFGDSNSDTGGFWAAFPAERPPNGMTYFKKPAGRATDGRLIIDFLAQALGLPF  93

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGANFAT++STV  PH+SLF + VSPFSLAIQ NQ KQFK  VDE  
Sbjct  94    LSPYLQSIGSDYRHGANFATLASTVRLPHTSLFVTGVSPFSLAIQLNQMKQFKAKVDEL-  152

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                   ++ G   LPP NIFGK+LYTFYIGQNDF   LASLGI+GV Q LPEVV+QI  T
Sbjct  153   ------HSSGKANLPPPNIFGKSLYTFYIGQNDFTGSLASLGINGVKQFLPEVVSQIAST  206

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF +LNLAPIGCYP+FL +L H+ SD+D FGC+ SYN AVADYN++LK+A
Sbjct  207   IKEIYALGGRTFLVLNLAPIGCYPAFLVELPHSVSDIDSFGCMISYNRAVADYNSMLKEA  266

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             LR+TR+DI DANV+Y D HS++LELFQHP+SHG+KYGTKACCGYGGG YNF  ++FCG+T
Sbjct  267   LRETRKDIPDANVIYADIHSVMLELFQHPSSHGMKYGTKACCGYGGGAYNFNPQVFCGNT  326

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              ++NG  +TA AC DP+NYVSWDG H T+AANK+   A+ +GSYFDPPF LH FC I PI
Sbjct  327   KLINGHNLTATACSDPHNYVSWDGIHATEAANKLVADAMINGSYFDPPFSLHKFCDIQPI  386

Query  126   G  124
             G
Sbjct  387   G  387



>ref|XP_009788631.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Nicotiana sylvestris]
Length=383

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/361 (71%), Positives = 296/361 (82%), Gaps = 7/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F AIFNFGDSNTDTGGF+AAFPS   PYGMTYFKKPVGR TDGRVIVDFLAQ LGL F
Sbjct  30    CAFEAIFNFGDSNTDTGGFYAAFPSQGSPYGMTYFKKPVGRPTDGRVIVDFLAQALGLPF  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGS++ HGANFAT +STV+ P +SLF S VSPFSL IQ  Q K+FKV VDE +
Sbjct  90    LSPYLQSIGSNYIHGANFATSASTVLLPQTSLFVSGVSPFSLEIQLGQMKEFKVKVDELQ  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +       GNT LPP +IFGK+LYT YIGQNDF  +LA +GISGV Q LP+VV+QIT T
Sbjct  150   SK-------GNTNLPPPDIFGKSLYTIYIGQNDFTGNLARIGISGVKQYLPKVVSQITST  202

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF +LNLAPIGCYP FL +L H +SD+DQFGC+ SYNNAV DYNN+LK+A
Sbjct  203   IKEIYGLGGRTFLVLNLAPIGCYPMFLVELPHESSDIDQFGCMISYNNAVVDYNNMLKEA  262

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR+ + DANVVYVDTHS++LELFQHPTSHGLKYGTKACCG GGG YNF +++FCG+T
Sbjct  263   LTQTRKQLSDANVVYVDTHSVLLELFQHPTSHGLKYGTKACCGQGGGAYNFNQQVFCGNT  322

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               +NGQT+TA ACEDPYNYVSWDG H T+AANK+T  AI +GS FDPPF L  FC I  I
Sbjct  323   KQINGQTLTATACEDPYNYVSWDGIHATEAANKLTTYAILNGSNFDPPFSLQKFCDIQSI  382

Query  126   G  124
             G
Sbjct  383   G  383



>ref|XP_009798059.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Nicotiana sylvestris]
Length=406

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/357 (71%), Positives = 295/357 (83%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSNTDTGG++AAFP+  PP+GMTYFKKPVGRATDGRVI+DFLAQ  GL F
Sbjct  57    CGFKAIFNFGDSNTDTGGYWAAFPAQGPPHGMTYFKKPVGRATDGRVILDFLAQAFGLPF  116

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGANFAT +STV  P +SLF + VSPFSL IQ  Q K+FKV VDE +
Sbjct  117   LSPYLQSIGSDYRHGANFATAASTVRLPQTSLFVTGVSPFSLEIQLRQMKEFKVKVDELQ  176

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +       G T LP  ++FGK+LYTFYIGQNDF  +LA +GI GV + LP++++QI  T
Sbjct  177   HK-------GQTNLPSPDVFGKSLYTFYIGQNDFTGNLARIGIIGVKEFLPQLISQIVST  229

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF++LNLAPIGCYP+FL +L HNTSD+DQFGCL SYNNAV DYNN+LK A
Sbjct  230   IKEIYALGGRTFWVLNLAPIGCYPAFLVELPHNTSDIDQFGCLVSYNNAVVDYNNMLKAA  289

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L +TR++I DANVVYVD+H+++L+LFQHPTSHGLKYGTKACCGYGGGDYNF + LFCG T
Sbjct  290   LAKTREEISDANVVYVDSHAVLLDLFQHPTSHGLKYGTKACCGYGGGDYNFNQHLFCGQT  349

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHI  136
               +NG  VTA ACEDP NYVSWDG H TDAAN++TV AI +GSYFDPPFPLHH C I
Sbjct  350   KQVNGTKVTANACEDPQNYVSWDGIHTTDAANELTVHAILNGSYFDPPFPLHHICDI  406



>ref|XP_006345572.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Solanum tuberosum]
Length=385

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/362 (71%), Positives = 295/362 (81%), Gaps = 8/362 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F AIFNFGDSNTDTGGF AAFPS  PPYGMTYFK+P GRATDGRVIVDFLAQGLGL F
Sbjct  31    CAFEAIFNFGDSNTDTGGFNAAFPSQGPPYGMTYFKRPTGRATDGRVIVDFLAQGLGLPF  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT +STV+ P +SLF S VSPF L IQ  QFK FK  +DE +
Sbjct  91    LSPYLQSIGSDFRHGANFATSASTVLMPQTSLFVSGVSPFYLGIQLQQFKLFKAKIDEFQ  150

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +       GNT LPP +IFGK+LYTFYIGQNDF  DL S GI GV + LP+VV+QI  T
Sbjct  151   SK-------GNTNLPPSDIFGKSLYTFYIGQNDFTGDLGSKGIGGVKEYLPQVVSQIVST  203

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF +LNLAPIGCYP+FL KL H +SD+D+ GCL SYNNAV DYNN+LKDA
Sbjct  204   IKEIYGLGGRTFLVLNLAPIGCYPAFLVKLPHESSDIDECGCLISYNNAVVDYNNMLKDA  263

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR+D+ DANV+YVDTH+++LELFQHPTSHGLKYG KACCG GGG YNF +E++CG+T
Sbjct  264   LAQTRKDLSDANVIYVDTHAVLLELFQHPTSHGLKYGNKACCGQGGGSYNFNQEVYCGNT  323

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFS-GSYFDPPFPLHHFCHIHP  130
               +NGQT++A ACEDPYNYVSWDG H T+AANK+T   I + GS FDPPF LH FC I P
Sbjct  324   KEVNGQTLSATACEDPYNYVSWDGIHATEAANKITANIILNDGSIFDPPFSLHKFCDIQP  383

Query  129   IG  124
             +G
Sbjct  384   VG  385



>ref|XP_009631126.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Nicotiana tomentosiformis]
Length=383

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/361 (71%), Positives = 293/361 (81%), Gaps = 7/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F AIFNFGDSNTDTGGF+AAFPS   PYGMTYFKKPVGR TDGRVIVDFLAQ LG  F
Sbjct  30    CAFEAIFNFGDSNTDTGGFYAAFPSQGSPYGMTYFKKPVGRPTDGRVIVDFLAQALGYPF  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD++HGANFAT +STV+ P +SLF S VSPFSL IQ  Q K+FKV VDE +
Sbjct  90    LSPYLQSIGSDYKHGANFATSASTVLLPQTSLFVSGVSPFSLEIQLRQMKEFKVKVDELQ  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +       GNT LP  +IFGK+LYTFYIGQNDF  +LA +GISG+ Q  P+VV+QIT T
Sbjct  150   SK-------GNTNLPSPDIFGKSLYTFYIGQNDFTGNLARIGISGLKQYFPKVVSQITST  202

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF +LNLAPIGCYP FL +L H +SD+DQFGCL SYNNAV DYNN+LK+A
Sbjct  203   IKEIYGLGGRTFLVLNLAPIGCYPMFLVELPHESSDIDQFGCLISYNNAVVDYNNMLKEA  262

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L Q R+ + DANVVYVDT++++LELFQHPTS GLKYGTKACCG GGG YNF ++LFCG+T
Sbjct  263   LTQIRKQLSDANVVYVDTNAVLLELFQHPTSQGLKYGTKACCGQGGGAYNFNQQLFCGNT  322

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               +NGQ +TA ACEDPYNYVSWDG H T+AANK T  AI +GSYFDPPF L  FC I PI
Sbjct  323   KQINGQILTATACEDPYNYVSWDGIHATEAANKFTTYAILNGSYFDPPFSLQKFCDIQPI  382

Query  126   G  124
             G
Sbjct  383   G  383



>ref|XP_004240088.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Solanum lycopersicum]
Length=385

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/362 (69%), Positives = 294/362 (81%), Gaps = 8/362 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F AIFNFGDSN+DTGGF AAFPS  PPYGMTYFK+P GRA+DGRVIVDFLAQGLGL +
Sbjct  31    CAFEAIFNFGDSNSDTGGFNAAFPSQGPPYGMTYFKRPTGRASDGRVIVDFLAQGLGLPY  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT +STV+ P +SLF S VSPF L IQ  QFK FK  +DE +
Sbjct  91    LSPYLQSIGSDFRHGANFATSASTVLMPQTSLFVSGVSPFYLGIQLQQFKLFKTKIDEFQ  150

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +       GNT LPP +IFGK+LYTFYIGQNDF  +L S GI GV + LP+VV+QI  T
Sbjct  151   SK-------GNTNLPPSDIFGKSLYTFYIGQNDFTGELGSKGIGGVKEYLPQVVSQIAST  203

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF +LNLAPIGCYP+FL KL H +SD+D++GCL SYNNAV DYNN+LKDA
Sbjct  204   IKEIYGLGGRTFLVLNLAPIGCYPAFLVKLPHESSDIDEYGCLISYNNAVVDYNNMLKDA  263

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR+D+ DANV+YVDTH+++LELFQHPTSHGLKYG KACCG GGG YNF +E++CG+T
Sbjct  264   LAQTRKDLSDANVIYVDTHAVLLELFQHPTSHGLKYGNKACCGQGGGSYNFNQEVYCGNT  323

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFS-GSYFDPPFPLHHFCHIHP  130
               +NGQT++A ACEDPYNYVSWDG H T+AANK+T   I +  S FDPPF LH FC I  
Sbjct  324   KEINGQTLSATACEDPYNYVSWDGIHATEAANKITANVILNEASIFDPPFSLHKFCDIQT  383

Query  129   IG  124
             +G
Sbjct  384   VG  385



>emb|CDP08726.1| unnamed protein product [Coffea canephora]
Length=389

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/361 (68%), Positives = 297/361 (82%), Gaps = 5/361 (1%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F AIFNFGDSN+DTGGF+AAFP+  PP+GMTYFK+PVGRATDGR+I+DFLAQ LG  F
Sbjct  34    CAFKAIFNFGDSNSDTGGFWAAFPAQSPPFGMTYFKRPVGRATDGRLIIDFLAQALGQPF  93

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
              SPYL+SIGSDFRHGANFAT++STV+ P++SLF + +SPFSLAIQ NQ KQFKV     E
Sbjct  94    PSPYLQSIGSDFRHGANFATLASTVLLPNTSLFVTGISPFSLAIQLNQMKQFKV-----E  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              E+HH  +    KLP  +IFGK+LYTFYIGQNDF  +L SLGISGV Q LP+VV+QI  T
Sbjct  149   VEKHHRTHAKGAKLPAPSIFGKSLYTFYIGQNDFTSNLVSLGISGVKQFLPQVVSQIAYT  208

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IKD+Y LGGRTF +LNLAP+GCYP+ L +L HN++D+D+FGCL SYNNAV DYNN+LK+A
Sbjct  209   IKDLYSLGGRTFLVLNLAPVGCYPALLVELPHNSTDVDEFGCLISYNNAVVDYNNMLKEA  268

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L   R+D+  A+VVYVDTH+++LELFQHP SHGLKYGTKACCGYGGG +NF ++++CG+ 
Sbjct  269   LTNIRKDLPKASVVYVDTHAVLLELFQHPKSHGLKYGTKACCGYGGGAHNFNQQVYCGNN  328

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              ++NG  VTA AC DP NYVSWDG H T+AANK+T  AI +GSY DPPFPLH FC I PI
Sbjct  329   KLVNGHNVTATACSDPQNYVSWDGIHATEAANKLTAHAILNGSYSDPPFPLHKFCDIQPI  388

Query  126   G  124
             G
Sbjct  389   G  389



>ref|XP_009629382.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Nicotiana tomentosiformis]
Length=385

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/357 (69%), Positives = 295/357 (83%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSNTDTGGF+AAFP+  PP+GMTYFKKPVGRATDGRVI+DFLAQ  GL +
Sbjct  36    CGFKAIFNFGDSNTDTGGFWAAFPAQGPPHGMTYFKKPVGRATDGRVILDFLAQAFGLPY  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD++HGANFAT +STV  P +SLF + VSPFSL IQ  Q K+FKV VDE +
Sbjct  96    LSPYLQSIGSDYKHGANFATAASTVRLPQTSLFVTGVSPFSLQIQLRQMKEFKVKVDELQ  155

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +       G T LP  ++FGK+LYTFYIGQNDF  +LA +GI GV + LP++++QI  T
Sbjct  156   HK-------GQTNLPSPDVFGKSLYTFYIGQNDFTGNLARIGIIGVKEFLPQLISQIVST  208

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF++LNLAPIGCYP+FL +L HN+SD+DQFGCL SYNNAV DYNN+LK A
Sbjct  209   IKEIYALGGRTFWVLNLAPIGCYPAFLVELPHNSSDIDQFGCLISYNNAVMDYNNMLKAA  268

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L +TR++I DA+VVYVDT++++L+LFQHPTSHGLKYGTKACCGYGGG YNF ++LFCG+T
Sbjct  269   LAKTREEIADADVVYVDTNTVLLDLFQHPTSHGLKYGTKACCGYGGGAYNFNQQLFCGNT  328

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHI  136
               +NG  VTA ACEDP NYVSWDG H TD AN++T+ AI +GSYFDPPFPLHH C I
Sbjct  329   KQINGTKVTANACEDPQNYVSWDGIHTTDVANELTIYAILNGSYFDPPFPLHHICDI  385



>ref|XP_007051643.1| Esterase, putative isoform 1 [Theobroma cacao]
 gb|EOX95800.1| Esterase, putative isoform 1 [Theobroma cacao]
Length=393

 Score =   522 bits (1344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/364 (66%), Positives = 300/364 (82%), Gaps = 8/364 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFK+P GRATDGR++VDFLAQ LGL F
Sbjct  35    CEFKAIFNFGDSNSDTGGFWAAFPAQSGPFGMTYFKRPAGRATDGRLMVDFLAQALGLPF  94

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYL+SIGSDFRHGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ K+FK  V E  
Sbjct  95    ISPYLQSIGSDFRHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKEFKAKVVE--  152

Query  846   QEQHHSYNHG---NTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQI  676
                +HS N      TKLP  +IFGK+LYTFYIGQNDF  +L ++GI GV Q LP+VV+QI
Sbjct  153   ---YHSGNKKGSTTTKLPSPDIFGKSLYTFYIGQNDFTSNLKAIGIEGVEQYLPQVVSQI  209

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
                +K++Y LGGRTFF+LNLAPIGCYP+FL +L HNTSDLD+FGCL SYN AV DYNN+L
Sbjct  210   AGNVKELYGLGGRTFFVLNLAPIGCYPAFLVQLPHNTSDLDKFGCLTSYNKAVVDYNNML  269

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K+AL QTR+D+ +A+++YVDTH+++LELFQHPT+HGL+YGT+ACCGYGGG YNF +E++C
Sbjct  270   KEALSQTRRDLPNASLIYVDTHAVLLELFQHPTAHGLRYGTRACCGYGGGTYNFHQEVYC  329

Query  315   GDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHI  136
             G+T V+NG  +TA ACEDP NYVSWDG H ++AANK+T  AI +GS FDPPFPLH  C +
Sbjct  330   GNTKVINGTNMTASACEDPNNYVSWDGIHASEAANKLTTLAILNGSLFDPPFPLHKLCDL  389

Query  135   HPIG  124
             H IG
Sbjct  390   HHIG  393



>gb|KDO86384.1| hypothetical protein CISIN_1g016356mg [Citrus sinensis]
Length=391

 Score =   520 bits (1338),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 240/361 (66%), Positives = 301/361 (83%), Gaps = 4/361 (1%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFK+P GRA+DGR+IVDFLAQ LGL F
Sbjct  35    CEFEAIFNFGDSNSDTGGFWAAFPAQSGPFGMTYFKRPAGRASDGRLIVDFLAQALGLPF  94

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ K+FK  VDE  
Sbjct  95    LSPYLQSIGSDYRHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKEFKARVDEF-  153

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                H S   G+TKLP  +IFGK+LYTFYIGQNDF  +LA++GI GV Q LP+VV+QI  T
Sbjct  154   ---HSSCTSGSTKLPSPDIFGKSLYTFYIGQNDFTSNLAAIGIGGVKQFLPQVVSQIAGT  210

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             ++++Y LGGRTF +LNLAPIGCYP+FL +L H++SDLD +GC+ SYNNAV DYNN+LK+A
Sbjct  211   VEELYALGGRTFLVLNLAPIGCYPAFLVQLPHSSSDLDAYGCMISYNNAVLDYNNMLKEA  270

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR+++ +A+++ VDTHS++LELFQ+PTSHGLKYGT+ACCG+G G YNF  ++FCG+T
Sbjct  271   LAQTRRNLPNASLICVDTHSVLLELFQNPTSHGLKYGTQACCGHGDGAYNFDAKVFCGNT  330

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG TVTA AC DP +YVSWDG H T+AANK+T  AI +GSYFDPPFPLH  C ++PI
Sbjct  331   KVINGSTVTATACSDPQDYVSWDGIHATEAANKLTTWAILNGSYFDPPFPLHQLCDLNPI  390

Query  126   G  124
             G
Sbjct  391   G  391



>ref|XP_006444901.1| hypothetical protein CICLE_v10023404mg [Citrus clementina]
 gb|ESR58141.1| hypothetical protein CICLE_v10023404mg [Citrus clementina]
Length=369

 Score =   518 bits (1334),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 239/361 (66%), Positives = 300/361 (83%), Gaps = 4/361 (1%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFK+P GRA+DGR+IVDFLAQ LGL F
Sbjct  13    CEFEAIFNFGDSNSDTGGFWAAFPAQSGPFGMTYFKRPAGRASDGRLIVDFLAQALGLPF  72

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ K+FK  VDE  
Sbjct  73    LSPYLQSIGSDYRHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKEFKARVDEF-  131

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                H S   G+TKLP  +IFGK+LYTFYIGQNDF  +LA++GI GV Q LP+VV+QI  T
Sbjct  132   ---HSSCTSGSTKLPSPDIFGKSLYTFYIGQNDFTSNLAAIGIGGVKQFLPQVVSQIAGT  188

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             ++++Y LGGRTF +LNLAPIGCYP+FL +L H++SDLD +GC+ SYNNAV DYNN+LK+A
Sbjct  189   VEELYALGGRTFLVLNLAPIGCYPAFLVQLPHSSSDLDAYGCMISYNNAVLDYNNMLKEA  248

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR+++ +A+++ VDTHS++LELFQ+PTSHGLKYGT+ACCG+G G YNF  ++FCG+T
Sbjct  249   LAQTRRNLPNASLICVDTHSVLLELFQNPTSHGLKYGTQACCGHGDGAYNFDAKVFCGNT  308

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG  VTA AC DP +YVSWDG H T+AANK+T  AI +GSYFDPPFPLH  C ++PI
Sbjct  309   KVINGSAVTATACSDPQDYVSWDGIHATEAANKLTTWAILNGSYFDPPFPLHQLCDLNPI  368

Query  126   G  124
             G
Sbjct  369   G  369



>ref|XP_006491222.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Citrus sinensis]
Length=391

 Score =   518 bits (1334),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 239/361 (66%), Positives = 300/361 (83%), Gaps = 4/361 (1%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFK+P GRA+DGR+IVDFLAQ LGL F
Sbjct  35    CEFEAIFNFGDSNSDTGGFWAAFPAQSGPFGMTYFKRPAGRASDGRLIVDFLAQALGLPF  94

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ K+FK  VDE  
Sbjct  95    LSPYLQSIGSDYRHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKEFKARVDEF-  153

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                H S   G+TKLP  +IFGK+LYTFYIGQNDF  +LA++GI GV Q LP+VV+QI  T
Sbjct  154   ---HSSCTSGSTKLPSPDIFGKSLYTFYIGQNDFTSNLAAIGIGGVKQFLPQVVSQIAGT  210

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             ++++Y LGGRTF +LNLAPIGCYP+FL +L H++SDLD +GC+ SYNNAV DYNN+LK+A
Sbjct  211   VEELYALGGRTFLVLNLAPIGCYPAFLVQLPHSSSDLDAYGCMISYNNAVLDYNNMLKEA  270

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR+++ +A+++ VDTHS++LELFQ+PTSHGLKYGT+ACCG+G G YNF  ++FCG+T
Sbjct  271   LAQTRRNLPNASLICVDTHSVLLELFQNPTSHGLKYGTQACCGHGDGAYNFDAKVFCGNT  330

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG  VTA AC DP +YVSWDG H T+AANK+T  AI +GSYFDPPFPLH  C ++PI
Sbjct  331   KVINGSAVTATACSDPQDYVSWDGIHATEAANKLTTWAILNGSYFDPPFPLHQLCDLNPI  390

Query  126   G  124
             G
Sbjct  391   G  391



>ref|NP_001240253.1| uncharacterized protein LOC100780915 precursor [Glycine max]
 gb|ACU18463.1| unknown [Glycine max]
Length=387

 Score =   518 bits (1333),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 239/361 (66%), Positives = 298/361 (83%), Gaps = 1/361 (0%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRATDGR+IVDFLAQ LGL F
Sbjct  28    CDFKAIFNFGDSNSDTGGFWAAFPAQSSPFGMTYFKKPTGRATDGRLIVDFLAQALGLPF  87

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGS+++HGANFAT++STV+ P++SLF + +SPFSLAIQ NQ KQFK  V++  
Sbjct  88    LSPYLQSIGSNYKHGANFATLASTVLLPNTSLFVTGISPFSLAIQLNQLKQFKTKVNQVY  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             ++     + G T+LP  +IFGK+LYTFYIGQNDF  +LA++GI GV Q LP+VV+QI  T
Sbjct  148   EQVPFDCSSG-TELPSPDIFGKSLYTFYIGQNDFTSNLAAIGIGGVQQYLPQVVSQIAST  206

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF +LNLAP+GCYP+FL +L HN+SD+D+FGCL SYNNAV +YNN+LK+ 
Sbjct  207   IKEIYNLGGRTFLVLNLAPVGCYPAFLVELPHNSSDIDEFGCLVSYNNAVVEYNNMLKET  266

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             LRQTR+ + DA+V+YVD ++++LELF+HPTSHGLKYG KACCGYGGGDYNF  + +CG++
Sbjct  267   LRQTRESLSDASVIYVDVYAVLLELFRHPTSHGLKYGIKACCGYGGGDYNFDPKAYCGNS  326

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG  VT+ AC DPYNYVSWDG H T+AANK+T  AI +GSY DPPFP H  C + PI
Sbjct  327   KVINGSRVTSTACIDPYNYVSWDGIHATEAANKLTTFAILNGSYSDPPFPFHERCDLQPI  386

Query  126   G  124
             G
Sbjct  387   G  387



>ref|XP_002320844.2| acetylesterase family protein [Populus trichocarpa]
 gb|EEE99159.2| acetylesterase family protein [Populus trichocarpa]
Length=391

 Score =   518 bits (1333),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 240/360 (67%), Positives = 290/360 (81%), Gaps = 4/360 (1%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFK+P GRA+DGR++VDFLAQ LGL F
Sbjct  35    CDFEAIFNFGDSNSDTGGFWAAFPAQSGPFGMTYFKRPAGRASDGRLMVDFLAQALGLPF  94

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ K+FK  V    
Sbjct  95    LSPYLQSIGSDYRHGANYATLASTVLLPNTSLFVTGISPFSLAIQINQMKEFKAKV----  150

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              E H +   G+T LP  +IFGK+LYTFYIGQNDF  +LA++GI GV Q LP+V AQI  +
Sbjct  151   HEFHSARKQGSTPLPSPDIFGKSLYTFYIGQNDFTSNLAAIGIGGVKQYLPQVAAQIAGS  210

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGGR F +LNLAPIGCYP+FL +L HNTSD+D FGCL SYNNAV DYNN+LK A
Sbjct  211   IKELYALGGRAFLVLNLAPIGCYPAFLVQLHHNTSDIDAFGCLISYNNAVVDYNNMLKKA  270

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR ++  A+++YVD H+I+LELFQHP SHGLKYGTKACCG+GGG YNF  + +CG+T
Sbjct  271   LSQTRMELPKASLIYVDIHAILLELFQHPGSHGLKYGTKACCGHGGGQYNFDPKAYCGNT  330

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG TVTA AC DPY YVSWDG H T+AANK+   AI  GSYFDPPFPLHH C + PI
Sbjct  331   RVINGSTVTASACGDPYKYVSWDGIHATEAANKLATIAILKGSYFDPPFPLHHLCDLQPI  390



>gb|KHN27060.1| GDSL esterase/lipase [Glycine soja]
Length=380

 Score =   516 bits (1328),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 238/361 (66%), Positives = 296/361 (82%), Gaps = 8/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRATDGR+IVDFLAQ LGL F
Sbjct  28    CDFKAIFNFGDSNSDTGGFWAAFPAQSSPFGMTYFKKPTGRATDGRLIVDFLAQALGLPF  87

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGS+++HGANFAT++STV+ P++SLF + +SPFSLAIQ NQ KQFK  V++  
Sbjct  88    LSPYLQSIGSNYKHGANFATLASTVLLPNTSLFVTGISPFSLAIQLNQLKQFKTKVNQVY  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             ++         T+LP  +IFGK+LYTFYIGQNDF  +LA++GI GV Q LP+VV+QI  T
Sbjct  148   EQ--------GTELPSPDIFGKSLYTFYIGQNDFTSNLAAIGIGGVQQYLPQVVSQIAST  199

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF +LNLAP+GCYP+FL +L HN+SD+D+FGCL SYNNAV +YNN+LK+ 
Sbjct  200   IKEIYNLGGRTFLVLNLAPVGCYPAFLVELPHNSSDIDEFGCLVSYNNAVVEYNNMLKET  259

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             LRQTR+ + DA+V+YVD ++++LELF+HPTSHGLKYG KACCGYGGGDYNF  + +CG++
Sbjct  260   LRQTRESLSDASVIYVDVYAVLLELFRHPTSHGLKYGIKACCGYGGGDYNFDPKAYCGNS  319

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG  VT+ AC DPYNYVSWDG H T+AANK+T  AI +GSY DPPFP H  C + PI
Sbjct  320   KVINGSRVTSTACIDPYNYVSWDGIHATEAANKLTTFAILNGSYSDPPFPFHERCDLQPI  379

Query  126   G  124
             G
Sbjct  380   G  380



>ref|XP_007155875.1| hypothetical protein PHAVU_003G239200g [Phaseolus vulgaris]
 gb|ESW27869.1| hypothetical protein PHAVU_003G239200g [Phaseolus vulgaris]
Length=380

 Score =   514 bits (1323),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 237/360 (66%), Positives = 293/360 (81%), Gaps = 8/360 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+  PP+GMTYF KPVGRATDGR+I+DFLA+ LGL F
Sbjct  28    CDFEAIFNFGDSNSDTGGFWAAFPAQSPPFGMTYFNKPVGRATDGRLIIDFLAEALGLPF  87

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYL+SIGSD+ HGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ KQFK  V+E  
Sbjct  88    ISPYLQSIGSDYTHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKQFKTQVNEVH  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             ++         +KLP  +IFGK+LYTFYIGQNDF  +LAS+GI GV Q LP+VV+QI  T
Sbjct  148   EQ--------GSKLPSPDIFGKSLYTFYIGQNDFTSNLASIGIRGVQQYLPQVVSQIAAT  199

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGGRTF +LNLAP+GCYPSFL  L HN+SD+DQFGCL SYNNAV +YN +LK +
Sbjct  200   IKELYNLGGRTFLVLNLAPVGCYPSFLVLLPHNSSDIDQFGCLVSYNNAVREYNTMLKQS  259

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             LR+ R+ + DA+V+YVDTH+++LELFQHPTSHGLKYGTKACCGYGGGDYNF  +L+CG++
Sbjct  260   LREVRESLSDASVIYVDTHTVLLELFQHPTSHGLKYGTKACCGYGGGDYNFDPKLYCGNS  319

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               ++G  VTA AC DPYNYVSWDG H T+AANK+T  AI +GS+ DPPFP    C + PI
Sbjct  320   KEIHGSKVTATACNDPYNYVSWDGIHATEAANKLTTFAILNGSFSDPPFPFQEHCDLQPI  379



>ref|XP_011037535.1| PREDICTED: GDSL esterase/lipase At4g01130 [Populus euphratica]
Length=390

 Score =   512 bits (1319),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 237/360 (66%), Positives = 289/360 (80%), Gaps = 4/360 (1%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFK+P GRA+DGR++VDFLAQ LGL F
Sbjct  34    CDFEAIFNFGDSNSDTGGFWAAFPAQSGPFGMTYFKRPAGRASDGRLMVDFLAQALGLPF  93

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ K+FK  V    
Sbjct  94    LSPYLQSIGSDYRHGANYATLASTVLLPNTSLFVTGISPFSLAIQINQMKEFKAKV----  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              E H +   G+T LP  +IFGK+LYTFYIGQNDF  +LA++GI GV Q LP+V AQI  +
Sbjct  150   HEFHSARKQGSTPLPSPDIFGKSLYTFYIGQNDFTSNLAAIGIGGVKQYLPQVAAQIAGS  209

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGGR F +LNLAPIGCYP+FL +L HNTSD+D FGCL +YNNAV DYNN+LK A
Sbjct  210   IKELYALGGRAFLVLNLAPIGCYPAFLVQLHHNTSDIDAFGCLITYNNAVVDYNNMLKKA  269

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR ++  A+++YVD H+I+LELFQHP SHGL YGTKACCG+GGG YNF  + +CG+T
Sbjct  270   LSQTRMELPKASLIYVDIHAILLELFQHPGSHGLNYGTKACCGHGGGQYNFDPKAYCGNT  329

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG TVTA AC DPY YVSWDG H T+AANK+   AI +GSYFDPPF LHH C + PI
Sbjct  330   RVINGSTVTASACGDPYKYVSWDGIHATEAANKLATIAILNGSYFDPPFLLHHLCDLQPI  389



>ref|XP_010251552.1| PREDICTED: GDSL esterase/lipase At4g01130 isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   512 bits (1318),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 236/361 (65%), Positives = 291/361 (81%), Gaps = 10/361 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA DGR+IVDFLAQ LGL F
Sbjct  37    CDFKAIFNFGDSNSDTGGFWAAFPAESGPFGMTYFKKPSGRAADGRLIVDFLAQALGLPF  96

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYL+SIGSDFRHGANFAT++STV+ P++SLF + +SPFSLAIQ NQ K FK  VDE+ 
Sbjct  97    ISPYLQSIGSDFRHGANFATLASTVLLPNTSLFVTGISPFSLAIQLNQIKAFKARVDEKA  156

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                          LP  +IFGK+LYT YIGQNDF  +L S+GI+GV + LP+VVAQI  T
Sbjct  157   PG----------PLPSPDIFGKSLYTLYIGQNDFTSNLKSIGIAGVKEYLPQVVAQIAAT  206

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             ++++Y LGGRTF +LN+AP+GCYP+FL +L HN+SDLD +GC+ SYNNAV DYNN+LK+A
Sbjct  207   VQELYGLGGRTFLVLNIAPVGCYPAFLVQLPHNSSDLDMYGCMVSYNNAVMDYNNMLKNA  266

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR+ + DA+V+YVD +SI+LELF+HP SHGL YGTKACCGYGGGDYNF  +++CG++
Sbjct  267   LTQTRRALPDASVIYVDIYSIMLELFRHPKSHGLIYGTKACCGYGGGDYNFNPQVYCGNS  326

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              ++NG TV A ACEDPYNYVSWDG H T+AANK+   AI +GSYFDPPFP+H  C + PI
Sbjct  327   RIINGSTVKATACEDPYNYVSWDGIHATEAANKLVTLAILNGSYFDPPFPIHQLCDLQPI  386

Query  126   G  124
             G
Sbjct  387   G  387



>gb|KHG21398.1| hypothetical protein F383_26467 [Gossypium arboreum]
Length=392

 Score =   509 bits (1312),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 231/361 (64%), Positives = 295/361 (82%), Gaps = 4/361 (1%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMT+F KP GRATDGR+I+DFLAQ LG+ F
Sbjct  36    CEFKAIFNFGDSNSDTGGFWAAFPAQSGPFGMTFFHKPSGRATDGRLILDFLAQALGMPF  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYL+SI SD+RHG NFAT++STV+ P++SLF + +SPFSLAIQ NQ K+FK  V E  
Sbjct  96    ISPYLQSIVSDYRHGVNFATLASTVLLPNTSLFVTGISPFSLAIQLNQMKEFKAKVVEYH  155

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              E       G+T+LP  +IFGK++YTFYIGQNDF  +L ++ I GV Q LP+VV+QI  T
Sbjct  156   SEN----TKGSTQLPSPDIFGKSIYTFYIGQNDFTSNLKAIDIEGVKQYLPQVVSQIAAT  211

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             +K+++ LGGRTFF+LNLAP+GCYP+ L +L H TSDLD+FGCL SYN AV DYNN+LK+A
Sbjct  212   VKELFGLGGRTFFVLNLAPVGCYPALLVQLPHETSDLDKFGCLISYNKAVVDYNNMLKEA  271

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR+++ + +++YVDTH+++L+LFQ PTSHGL+YGTKACCGYGGG+YNF  E++CG+T
Sbjct  272   LSQTRRELSNVSLIYVDTHAVLLQLFQDPTSHGLRYGTKACCGYGGGNYNFHPEVYCGNT  331

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG  VTA AC+DP NYVSWDG H T+AANK+T  AI +GSYFDPPFPLH  C++HP+
Sbjct  332   KVMNGTKVTASACKDPNNYVSWDGIHATEAANKLTTLAILNGSYFDPPFPLHKLCYLHPV  391

Query  126   G  124
             G
Sbjct  392   G  392



>gb|EYU32203.1| hypothetical protein MIMGU_mgv11b006860mg [Erythranthe guttata]
Length=377

 Score =   508 bits (1308),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 238/351 (68%), Positives = 288/351 (82%), Gaps = 5/351 (1%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFPS   PYGMTYFKKPVGRATDGRVI+DFLAQ LGL F
Sbjct  26    CDFEAIFNFGDSNSDTGGFYAAFPSENLPYGMTYFKKPVGRATDGRVILDFLAQALGLPF  85

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYL+SIGSDFRHGANFAT++STV  P +S+F + VSPFSLAIQ NQ KQFK  VDE  
Sbjct  86    VSPYLQSIGSDFRHGANFATLASTVRLPQTSVFVTGVSPFSLAIQLNQMKQFKSKVDEL-  144

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                 HS       +PP +IFGK+LYTFYIGQNDF  +LASLGISGV Q LP+VV+QI  T
Sbjct  145   ----HSLGQAEKNIPPPDIFGKSLYTFYIGQNDFTGNLASLGISGVKQYLPQVVSQIATT  200

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF +LNLAPIGCYP+FL +L H+TSD+D FGC+ SYNNAVADYN +L + 
Sbjct  201   IKEIYELGGRTFLVLNLAPIGCYPAFLVELPHDTSDIDSFGCMVSYNNAVADYNLMLDEE  260

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L +TR+DI DAN++Y D HS++L+LF+HP+S+G+KYGTKACCGYGGG +NF ++++CG+T
Sbjct  261   LIKTRKDIIDANIIYADIHSVMLDLFRHPSSYGMKYGTKACCGYGGGPHNFDQKVYCGNT  320

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPL  154
              ++NGQ +TA AC DP+NYVSWDG H T+AAN++   AI +GS FDPP PL
Sbjct  321   KLVNGQNLTATACNDPFNYVSWDGIHATEAANEIVANAIINGSCFDPPLPL  371



>ref|XP_004494780.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Cicer arietinum]
Length=381

 Score =   507 bits (1306),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 232/361 (64%), Positives = 293/361 (81%), Gaps = 8/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   PY MTYF KP GRA+DGR+++DF+AQ +G+ F
Sbjct  29    CDFKAIFNFGDSNSDTGGFYAAFPAESGPYVMTYFNKPAGRASDGRLVIDFIAQAIGIPF  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD++HGAN+AT++STV+ P++SLF + +SPFSLAIQFNQ KQF   V E +
Sbjct  89    LSPYLQSIGSDYKHGANYATLASTVLLPNTSLFVTGISPFSLAIQFNQMKQFITKVKEAQ  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             Q++        TKLP  +IFGK+LYTFYIGQNDF  +LA++G  GV + LP+VV+QI  T
Sbjct  149   QQE--------TKLPSPDIFGKSLYTFYIGQNDFTSNLATIGTGGVQEFLPQVVSQIVST  200

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGGRTF +LNLAPIGCYPSFL +L HN SDLD+FGC+ SYNNAV DYN +LK++
Sbjct  201   IKELYNLGGRTFMVLNLAPIGCYPSFLVELPHNNSDLDEFGCMVSYNNAVVDYNKMLKES  260

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L++ R+ + DA+V+YVDT+S++LELFQHPTSHG+KYGTKACCGYGGGDYNF  +++CG+T
Sbjct  261   LKEARESLSDASVIYVDTYSVLLELFQHPTSHGIKYGTKACCGYGGGDYNFNPKVYCGNT  320

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               ++G+TVTA AC DPYNYVSWDG H T+AANK+   AI +GSY DPPF     C I PI
Sbjct  321   KEIDGKTVTATACNDPYNYVSWDGIHATEAANKLITFAILNGSYSDPPFSFQQHCDIQPI  380

Query  126   G  124
             G
Sbjct  381   G  381



>gb|AFK46362.1| unknown [Medicago truncatula]
Length=381

 Score =   505 bits (1300),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 228/361 (63%), Positives = 293/361 (81%), Gaps = 8/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   PYGMTYF KP GRA+DGR+++DF+AQ +G+ F
Sbjct  29    CDFKAIFNFGDSNSDTGGFYAAFPAESGPYGMTYFNKPAGRASDGRLVIDFIAQAIGIPF  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGS ++HGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ KQF   V E +
Sbjct  89    LSPYLQSIGSYYKHGANYATLASTVLLPNTSLFATGISPFSLAIQLNQMKQFATKVKEAD  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             Q++        TKLP  +I GK+LYTFYIGQNDF  +LA +G  GV + LP+VV+QI  T
Sbjct  149   QQE--------TKLPSPDILGKSLYTFYIGQNDFTSNLAVIGTGGVQEFLPQVVSQIAAT  200

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGGRTF +LNLAP+GCYPSFL +L HN+SDLD+FGC+ SYNNAV DYN +LK++
Sbjct  201   IKELYNLGGRTFMVLNLAPVGCYPSFLVELPHNSSDLDEFGCMVSYNNAVVDYNKMLKES  260

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L+QTR+ I DA+V+YVDT++++LELF+HPTSHGL+YGTKACCGYGGG+YNF  +++CG+T
Sbjct  261   LKQTRESISDASVIYVDTYTVLLELFRHPTSHGLQYGTKACCGYGGGEYNFNPKVYCGNT  320

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               +NG+ VTA AC+DPYNYVSWDG H T+AA+K+   AI +GSY DPPFP    C + PI
Sbjct  321   KEINGKRVTATACDDPYNYVSWDGIHATEAASKLITYAILNGSYSDPPFPFQEHCDLQPI  380

Query  126   G  124
             G
Sbjct  381   G  381



>ref|XP_002276525.1| PREDICTED: GDSL esterase/lipase At4g01130 [Vitis vinifera]
 emb|CBI40467.3| unnamed protein product [Vitis vinifera]
Length=383

 Score =   505 bits (1300),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 234/361 (65%), Positives = 293/361 (81%), Gaps = 7/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+  PP GMT+FKKP GRA DGR+I+DFLAQ LGL F
Sbjct  30    CEFKAIFNFGDSNSDTGGFWAAFPAPSPPNGMTFFKKPSGRACDGRLILDFLAQALGLPF  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYL+SIGSD+RHGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ KQFKV+VDE  
Sbjct  90    ISPYLQSIGSDYRHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKQFKVLVDE--  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                HH    G++ LP  +IF K+LYTFYIGQNDF  +LA++GI GV Q LP+V++QI  T
Sbjct  148   ---HHF--SGSSYLPQPDIFAKSLYTFYIGQNDFTSNLAAIGIDGVKQYLPQVISQIAGT  202

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGG TF +LNLAP+GCYP+ LA+L HN+SD+D+FGCL SYN AV DYNN+LK+A
Sbjct  203   IKELYELGGHTFLVLNLAPVGCYPALLAQLKHNSSDIDEFGCLVSYNRAVVDYNNMLKEA  262

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR+ + DA+V+YV+TH ++L+LFQHPT HGLKY TKACCG+GGG YNF  ++FCG  
Sbjct  263   LSQTRKLLPDASVIYVNTHDVLLKLFQHPTLHGLKYSTKACCGHGGGAYNFDPKIFCGRK  322

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG+ VTAEAC DP +YVSWDG H T+AANK+  +AI  G+YFDPPFP+   C + PI
Sbjct  323   QVVNGRNVTAEACSDPQSYVSWDGVHSTEAANKIVTEAILKGNYFDPPFPISKLCDLQPI  382

Query  126   G  124
             G
Sbjct  383   G  383



>gb|AES82745.2| lanatoside 15-O-acetylesterase [Medicago truncatula]
Length=381

 Score =   502 bits (1293),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 227/361 (63%), Positives = 292/361 (81%), Gaps = 8/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   PYGMTYF KP GRA+DGR+++DF+AQ +G+ F
Sbjct  29    CDFKAIFNFGDSNSDTGGFYAAFPAESGPYGMTYFNKPAGRASDGRLVIDFIAQAIGIPF  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGS ++HGAN+AT++STV+ P++SLF + +SPFSLAIQ  Q KQF   V E +
Sbjct  89    LSPYLQSIGSYYKHGANYATLASTVLLPNTSLFVTGISPFSLAIQLTQMKQFATKVKEAD  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             Q++        TKLP  +I GK+LYTFYIGQNDF  +LA +G  GV + LP+VV+QI  T
Sbjct  149   QQE--------TKLPSPDILGKSLYTFYIGQNDFTSNLAVIGTGGVQEFLPQVVSQIAAT  200

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGGRTF +LNLAP+GCYPSFL +L HN+SDLD+FGC+ SYNNAV DYN +LK++
Sbjct  201   IKELYNLGGRTFMVLNLAPVGCYPSFLVELPHNSSDLDEFGCMVSYNNAVVDYNKMLKES  260

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L+QTR+ I DA+V+YVDT++++LELF+HPTSHGL+YGTKACCGYGGG+YNF  +++CG+T
Sbjct  261   LKQTRESISDASVIYVDTYTVLLELFRHPTSHGLQYGTKACCGYGGGEYNFNPKVYCGNT  320

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               +NG+ VTA AC+DPYNYVSWDG H T+AA+K+   AI +GSY DPPFP    C + PI
Sbjct  321   KEINGKRVTATACDDPYNYVSWDGIHATEAASKLITYAILNGSYSDPPFPFQEHCDLQPI  380

Query  126   G  124
             G
Sbjct  381   G  381



>gb|KHN35354.1| GDSL esterase/lipase [Glycine soja]
Length=380

 Score =   501 bits (1291),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 230/361 (64%), Positives = 290/361 (80%), Gaps = 8/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F AIFNFGDSN+DTGGF+AAFP    PYGMTYFKKP GRA+DGR+I+DFLAQ LGL F
Sbjct  28    CNFKAIFNFGDSNSDTGGFYAAFPGESGPYGMTYFKKPAGRASDGRLIIDFLAQALGLPF  87

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD++HGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ KQFK  V+E+ 
Sbjct  88    LSPYLQSIGSDYKHGANYATMASTVLMPNTSLFVTGISPFSLAIQLNQMKQFKTKVEEKV  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             ++          KLP  +IFG +LYTFYIGQNDF F+LA +G+ GV + LP+VV+QI  T
Sbjct  148   EQ--------GIKLPSSDIFGNSLYTFYIGQNDFTFNLAVIGVGGVQEYLPQVVSQIVAT  199

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGGRTF +LNLAP+GCYP+FL +  H++S++D FGCL SYNNAV +YNN+LK+ 
Sbjct  200   IKELYNLGGRTFMVLNLAPVGCYPAFLVEFPHDSSNIDDFGCLISYNNAVLNYNNMLKET  259

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L+QTR+ + DA+V+YVDTHS++LELFQHPTSHGL+YGTKACCGYGGGDYNF  ++ CG+T
Sbjct  260   LKQTRESLSDASVIYVDTHSVLLELFQHPTSHGLQYGTKACCGYGGGDYNFDPKVSCGNT  319

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               +NG  +TA  C DPYNYVSWDG H T+AANK+   AI +GS+ DPPF     C + PI
Sbjct  320   KEINGSIMTATTCNDPYNYVSWDGIHSTEAANKLITFAILNGSFSDPPFIFQEHCDLQPI  379

Query  126   G  124
             G
Sbjct  380   G  380



>ref|XP_003626527.1| GDSL esterase/lipase [Medicago truncatula]
Length=426

 Score =   503 bits (1294),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 227/361 (63%), Positives = 292/361 (81%), Gaps = 8/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   PYGMTYF KP GRA+DGR+++DF+AQ +G+ F
Sbjct  29    CDFKAIFNFGDSNSDTGGFYAAFPAESGPYGMTYFNKPAGRASDGRLVIDFIAQAIGIPF  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGS ++HGAN+AT++STV+ P++SLF + +SPFSLAIQ  Q KQF   V E +
Sbjct  89    LSPYLQSIGSYYKHGANYATLASTVLLPNTSLFVTGISPFSLAIQLTQMKQFATKVKEAD  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             Q++        TKLP  +I GK+LYTFYIGQNDF  +LA +G  GV + LP+VV+QI  T
Sbjct  149   QQE--------TKLPSPDILGKSLYTFYIGQNDFTSNLAVIGTGGVQEFLPQVVSQIAAT  200

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGGRTF +LNLAP+GCYPSFL +L HN+SDLD+FGC+ SYNNAV DYN +LK++
Sbjct  201   IKELYNLGGRTFMVLNLAPVGCYPSFLVELPHNSSDLDEFGCMVSYNNAVVDYNKMLKES  260

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L+QTR+ I DA+V+YVDT++++LELF+HPTSHGL+YGTKACCGYGGG+YNF  +++CG+T
Sbjct  261   LKQTRESISDASVIYVDTYTVLLELFRHPTSHGLQYGTKACCGYGGGEYNFNPKVYCGNT  320

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               +NG+ VTA AC+DPYNYVSWDG H T+AA+K+   AI +GSY DPPFP    C + PI
Sbjct  321   KEINGKRVTATACDDPYNYVSWDGIHATEAASKLITYAILNGSYSDPPFPFQEHCDLQPI  380

Query  126   G  124
             G
Sbjct  381   G  381



>ref|XP_007218163.1| hypothetical protein PRUPE_ppa007486mg [Prunus persica]
 gb|EMJ19362.1| hypothetical protein PRUPE_ppa007486mg [Prunus persica]
Length=366

 Score =   499 bits (1286),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 233/360 (65%), Positives = 288/360 (80%), Gaps = 7/360 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   PYGMTYFK+PVGRATDGR+++DFLAQ LGL F
Sbjct  13    CEFEAIFNFGDSNSDTGGFWAAFPAQSGPYGMTYFKRPVGRATDGRLMLDFLAQALGLPF  72

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYL+SIGSD+RHGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ K FK  V+E  
Sbjct  73    ISPYLQSIGSDYRHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKAFKAQVEEHS  132

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +Q  S      +LP  +IFGK+LYTFYIGQNDF  +LA++G+ GV Q LP+VV+QI  T
Sbjct  133   WDQQES-----KRLPSWDIFGKSLYTFYIGQNDFTSNLAAIGVGGVKQYLPQVVSQIAGT  187

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGGR F +LNLAP+GCYPSFL  L    S+LD FGC  SYNNAV DYNN+LK+ 
Sbjct  188   IKELYALGGRAFLVLNLAPVGCYPSFLVGLP--PSELDAFGCSISYNNAVVDYNNMLKET  245

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             LRQTR  + +A+++YVDT S++LELF+HPTSHGLKYGTKACCG+GGG +NF   +FCG+T
Sbjct  246   LRQTRGSLPNASLIYVDTSSVLLELFRHPTSHGLKYGTKACCGHGGGAHNFDPRVFCGNT  305

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG+TVTA A  DPYNYVSWDG H T+AANK+   AI +GSY DPPFP H FC + P+
Sbjct  306   KVINGRTVTATASSDPYNYVSWDGVHATEAANKLVTWAILNGSYSDPPFPFHDFCDLQPL  365



>ref|XP_008233226.1| PREDICTED: GDSL esterase/lipase At4g01130 [Prunus mume]
Length=386

 Score =   500 bits (1288),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 233/360 (65%), Positives = 289/360 (80%), Gaps = 7/360 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   PYGMTYFK+PVGRATDGR+++DFLAQ LGL F
Sbjct  33    CEFEAIFNFGDSNSDTGGFWAAFPAQSGPYGMTYFKRPVGRATDGRLMLDFLAQALGLPF  92

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYL+SIGSD+RHGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ K FK  V+E  
Sbjct  93    ISPYLQSIGSDYRHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKAFKTQVEEHS  152

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +Q  S      +LP  +IFGK+LYTFYIGQNDF  +LA++G+ GV Q LP+VV+QI  T
Sbjct  153   WDQQES-----KRLPSLDIFGKSLYTFYIGQNDFTSNLAAIGVGGVKQYLPQVVSQIAGT  207

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGGR F +LNLAP+GCYPSFL  L    S+LD FGC  SYNNAV DYNN+LK+ 
Sbjct  208   IKELYALGGRAFLVLNLAPVGCYPSFLVGLP--PSELDAFGCSISYNNAVVDYNNMLKET  265

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             LRQTR  + +A+++YVDT S++LELF+HPTSHGLKYGTKACCG+GGG +NF  ++FCG+T
Sbjct  266   LRQTRGSLPNASLIYVDTSSVLLELFRHPTSHGLKYGTKACCGHGGGAHNFDPKVFCGNT  325

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG+TVTA A  DPYNYVSWDG H T+AANK+   AI +GSY DPPFP H FC + P+
Sbjct  326   KVINGRTVTATASSDPYNYVSWDGVHATEAANKLVTWAILNGSYSDPPFPFHDFCDLQPL  385



>ref|XP_003520865.1| PREDICTED: GDSL esterase/lipase At4g01130-like isoform X1 [Glycine 
max]
Length=380

 Score =   498 bits (1283),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 229/361 (63%), Positives = 289/361 (80%), Gaps = 8/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F AIFNFGDSN+DTGGF+AAFP    PYGMTYFKKP GRA+DGR+I+DFLAQ LGL F
Sbjct  28    CNFKAIFNFGDSNSDTGGFYAAFPGESGPYGMTYFKKPAGRASDGRLIIDFLAQALGLPF  87

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD++HGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ KQFK  V+E+ 
Sbjct  88    LSPYLQSIGSDYKHGANYATMASTVLMPNTSLFVTGISPFSLAIQLNQMKQFKTKVEEKV  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             ++          KLP  +IFG +LYTFYIGQNDF F+LA +G+ GV + LP+VV+QI  T
Sbjct  148   EQ--------GIKLPSSDIFGNSLYTFYIGQNDFTFNLAVIGVGGVQEYLPQVVSQIVAT  199

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGGRTF +LNLAP+GCYP+FL +  H++S++D FGCL SYNNAV +YNN+LK+ 
Sbjct  200   IKELYNLGGRTFMVLNLAPVGCYPAFLVEFPHDSSNIDDFGCLISYNNAVLNYNNMLKET  259

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L+QTR+ + DA+V+YVDTHS++LELFQHPTSHGL+YGTKACCGYGGGDYNF  ++ CG+T
Sbjct  260   LKQTRESLSDASVIYVDTHSVLLELFQHPTSHGLQYGTKACCGYGGGDYNFDPKVSCGNT  319

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               +NG  + A  C DPYNYVSWDG H T+AANK+   AI +GS+ DPPF     C + PI
Sbjct  320   KEINGSIMPATTCNDPYNYVSWDGIHSTEAANKLITFAILNGSFSDPPFIFQEHCDLQPI  379

Query  126   G  124
             G
Sbjct  380   G  380



>ref|XP_010669500.1| PREDICTED: GDSL esterase/lipase At4g01130 [Beta vulgaris subsp. 
vulgaris]
Length=386

 Score =   499 bits (1284),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 234/361 (65%), Positives = 286/361 (79%), Gaps = 0/361 (0%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C    IFNFGDSNTDTGGF+AAFPS   P+GMT+FKKP GRATDGRVIVDFLAQ +G+ F
Sbjct  26    CDIKGIFNFGDSNTDTGGFYAAFPSERGPFGMTFFKKPTGRATDGRVIVDFLAQAIGIPF  85

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGANFAT++STV  P++SLF + VSPFSL+IQ NQ K+ +  V E  
Sbjct  86    LSPYLRSIGSDYRHGANFATLASTVRLPNTSLFVTGVSPFSLSIQLNQMKELQFRVLEFS  145

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                 +      T LP   IF KALYTFYIGQNDF  +L  +GI GV Q LP+V+ QIT  
Sbjct  146   NSTFNYVPKLATPLPSMGIFEKALYTFYIGQNDFTGNLPYIGIIGVKQYLPQVILQITSA  205

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y +GGRTF++LNLAPIGCYPSFL +L H +SDLD+FGC+ SYNNAV DYNN+LK+A
Sbjct  206   IKELYGIGGRTFWVLNLAPIGCYPSFLVELPHESSDLDEFGCMISYNNAVKDYNNMLKEA  265

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             ++QTR  + DA+++YVDTHS++L+LFQHPTS+GLKYGT+ACCG GGG YNF  ++FCG+T
Sbjct  266   MQQTRALLPDASIIYVDTHSVLLDLFQHPTSYGLKYGTRACCGEGGGPYNFNPQVFCGNT  325

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              ++NG T+TA ACEDP  YVSWDG H T+AANK+   AI +GSYFDPPFPLH  C + PI
Sbjct  326   KLINGTTLTATACEDPNMYVSWDGIHATEAANKIVTLAILNGSYFDPPFPLHRVCDLQPI  385

Query  126   G  124
             G
Sbjct  386   G  386



>emb|CAA09694.1| lanatoside 15'-O-acetylesterase [Digitalis lanata]
Length=386

 Score =   498 bits (1281),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 237/362 (65%), Positives = 285/362 (79%), Gaps = 7/362 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+  PP GMTYFK+P GR TDGR+I+DFLAQG+G+ F
Sbjct  31    CDFKAIFNFGDSNSDTGGFWAAFPAENPPNGMTYFKRPAGRVTDGRLIIDFLAQGIGIPF  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL SIGSDFRHGANFAT +STV+ P +SLF + VSPFSL IQ NQ KQFK+ VD   
Sbjct  91    LSPYLLSIGSDFRHGANFATAASTVLLPRTSLFVTGVSPFSLGIQLNQMKQFKLQVDRL-  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSL-PEVVAQITK  670
                HHS   G   LP  +IF K+LYT YIGQNDF  +L SLGISGV + + P+VV+QI+ 
Sbjct  150   ---HHS--PGKLNLPAPDIFRKSLYTLYIGQNDFTGNLGSLGISGVKKKIIPQVVSQISS  204

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             TIK +Y LGGRTF +LNLAPIGCYP FL  L HN+SD+D FGC+ SYN AV +YN +LK+
Sbjct  205   TIKKLYELGGRTFLVLNLAPIGCYPLFLVDLPHNSSDIDSFGCMISYNKAVVEYNYMLKE  264

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             AL QTR+DI+DA+V+Y D HS++L+LFQHPTS+GLKYGTKACCGYGGG +NF +++FC  
Sbjct  265   ALAQTRKDIQDADVIYTDIHSVMLQLFQHPTSNGLKYGTKACCGYGGGAFNFNQQVFCSY  324

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHP  130
             + ++NG+ VTA AC+DP NYVSWDG H T+AANK    AI  GS+FDPPF LH  C I P
Sbjct  325   SKLINGKNVTANACKDPQNYVSWDGIHATEAANKHVAHAILEGSHFDPPFSLHKLCDIQP  384

Query  129   IG  124
             IG
Sbjct  385   IG  386



>gb|AAY41077.1| lanatoside 15-O-acetylesterase [Digitalis lanata]
Length=386

 Score =   496 bits (1277),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 237/362 (65%), Positives = 284/362 (78%), Gaps = 7/362 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+  PP GMTYFK+P GR TDGR+I+DFLAQG+G+ F
Sbjct  31    CDFNAIFNFGDSNSDTGGFWAAFPAENPPNGMTYFKRPAGRVTDGRLIIDFLAQGIGIPF  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL SIGSDFRHGANFAT +STV+ P +SLF + VSPFSL IQ NQ KQFK+ VD   
Sbjct  91    LSPYLLSIGSDFRHGANFATAASTVLLPRTSLFVTGVSPFSLGIQLNQMKQFKLQVDRL-  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSL-PEVVAQITK  670
                HHS   G   LP  NIF K+LYT YIGQNDF  +L SLGISGV + + P+VV+QI+ 
Sbjct  150   ---HHS--PGKLNLPAPNIFRKSLYTLYIGQNDFTGNLGSLGISGVKKKIIPQVVSQISS  204

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             TIK +Y LGGRTF +LNLAPIGCYP FL  L HN+SD+D FGC+ SYN AV +YN +LK+
Sbjct  205   TIKKLYELGGRTFLVLNLAPIGCYPLFLVDLPHNSSDIDSFGCMISYNKAVVEYNYMLKE  264

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             AL QTR+DI+DA+V+Y D HS++L+LFQHPTS+GLKYGTKACCGYGGG +NF +++FC  
Sbjct  265   ALAQTRKDIQDADVIYTDIHSVMLQLFQHPTSNGLKYGTKACCGYGGGAFNFNQQVFCSY  324

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHP  130
             + ++NG+ VTA AC+DP NYVSWDG H T+A NK    AI  GS+FDPPF LH  C I P
Sbjct  325   SKLINGKNVTANACKDPQNYVSWDGIHATEAPNKHVAHAILEGSHFDPPFSLHKLCDIQP  384

Query  129   IG  124
             IG
Sbjct  385   IG  386



>gb|AAY41078.1| lanatoside 15-O-acetylesterase [Digitalis grandiflora]
Length=386

 Score =   494 bits (1272),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 236/362 (65%), Positives = 283/362 (78%), Gaps = 7/362 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+  PP GMTYFK+P GRA DGR+I+DFLAQG+G+ F
Sbjct  31    CDFKAIFNFGDSNSDTGGFWAAFPAENPPNGMTYFKRPAGRAADGRLIIDFLAQGIGIPF  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL  IGSDFRHGANFAT  STV+ P +SLF + VSPFSL IQ NQ KQFK+ VD   
Sbjct  91    LSPYLLPIGSDFRHGANFATSGSTVLLPRTSLFVTGVSPFSLGIQLNQMKQFKLQVDRL-  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSL-PEVVAQITK  670
                HHS   G   LP  +IF K+LYT YIGQNDF  +L SLGISGV + + P+VV+QI+ 
Sbjct  150   ---HHS--SGKLNLPAPDIFRKSLYTLYIGQNDFTGNLGSLGISGVKKRIIPQVVSQISS  204

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             TIK +Y LGGRTF +LNLAPIGCYP FL  L HN+SD+D FGCL SYN AV +YN +LK+
Sbjct  205   TIKKLYELGGRTFLVLNLAPIGCYPLFLVDLPHNSSDIDSFGCLISYNKAVVEYNYMLKE  264

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             AL QTR+DI+DA+V+Y D HS++L+LFQHPTS+GLKYGTKACCGYGGG +NF +++FC  
Sbjct  265   ALAQTRKDIQDADVIYTDIHSVMLQLFQHPTSNGLKYGTKACCGYGGGSFNFNQQVFCSY  324

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHP  130
             + ++NG+ VTA AC+DP NYVSWDG H T+AANK   +AI  GS+FDPPF  H  C I P
Sbjct  325   SKLINGKNVTANACKDPQNYVSWDGIHATEAANKHVARAILEGSHFDPPFSFHKLCDIQP  384

Query  129   IG  124
             IG
Sbjct  385   IG  386



>gb|AAY41079.1| lanatoside 15-O-acetylesterase [Digitalis subalpina]
Length=386

 Score =   493 bits (1270),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 235/362 (65%), Positives = 285/362 (79%), Gaps = 7/362 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+  PP GMTYFK P GRATDGR+I+DFLAQ +G+ F
Sbjct  31    CDFKAIFNFGDSNSDTGGFWAAFPAENPPNGMTYFKTPAGRATDGRLIIDFLAQAIGIPF  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL SIGSDFRHGANFAT +STV+ P +SLF + VSPFSL IQ NQ KQFK+ VD   
Sbjct  91    LSPYLLSIGSDFRHGANFATAASTVLLPRTSLFVTGVSPFSLGIQLNQTKQFKLQVDRL-  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSL-PEVVAQITK  670
                HHS    N  LPP +IF K+LYT YIGQNDF  +L SLGISGV + + P+VV+QI+ 
Sbjct  150   ---HHSSAKLN--LPPPDIFRKSLYTLYIGQNDFTGNLGSLGISGVKKKIIPQVVSQISS  204

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             TIK++Y LGGRTF +LNLAPIGCYP FL  L HN+SD+D FGC+ SYN AV +YN +LK+
Sbjct  205   TIKNLYELGGRTFLVLNLAPIGCYPLFLVDLPHNSSDIDSFGCMISYNKAVVEYNYMLKE  264

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             AL QTR+DI++A+++Y D H ++L+LFQHPTS+GLKYGTKACCGYGGG +NF +++FC  
Sbjct  265   ALAQTRKDIQEADIIYTDIHYVMLQLFQHPTSNGLKYGTKACCGYGGGAFNFNQQVFCSY  324

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHP  130
             + ++NG+ VTA AC+DP NYVSWDG H T+AANK    AI  GS+FDPPF LH  C I P
Sbjct  325   SKLINGKNVTANACKDPQNYVSWDGIHATEAANKHVADAILEGSHFDPPFSLHKLCDIQP  384

Query  129   IG  124
             IG
Sbjct  385   IG  386



>gb|AAY42522.1| lanatoside 15'-O-acetylesterase [Digitalis lanata]
Length=386

 Score =   492 bits (1267),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 236/362 (65%), Positives = 284/362 (78%), Gaps = 7/362 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+  PP GMTYFK+P GR TDGR+I+DFLAQG+G+ F
Sbjct  31    CYFKAIFNFGDSNSDTGGFWAAFPAENPPNGMTYFKRPAGRVTDGRLIIDFLAQGIGIPF  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL SIGSDFRHGANFAT +STV+ P +SLF + VSPFSL IQ NQ KQFK+ VD   
Sbjct  91    LSPYLLSIGSDFRHGANFATAASTVLLPRTSLFVTGVSPFSLGIQLNQMKQFKLQVDRL-  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSL-PEVVAQITK  670
                HHS   G   LP  +IF K+LYT YIGQNDF  +L SLGISGV + + P+VV+QI+ 
Sbjct  150   ---HHS--PGKLNLPAPDIFRKSLYTLYIGQNDFTGNLGSLGISGVKKKIIPQVVSQISS  204

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             TI+ +Y LGGRTF +LNLAPIGCYP FL  L HN+SD+D FGC  SYN AV +YN +LK+
Sbjct  205   TIQKLYELGGRTFLVLNLAPIGCYPLFLVDLPHNSSDIDSFGCTISYNKAVVEYNYMLKE  264

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             AL QTR+DI+DA+V+Y D HS++L+LFQHPTS+GLKYGTKACCGYGGG +NF +++FC  
Sbjct  265   ALAQTRKDIQDADVIYTDIHSVMLQLFQHPTSNGLKYGTKACCGYGGGAFNFNQQVFCSY  324

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHP  130
             + ++NG+ VTA AC+DP NYVSWDG H T+AANK    AI  GS+FDPPF LH  C I P
Sbjct  325   SKLINGKNVTANACKDPQNYVSWDGIHATEAANKHVAHAILEGSHFDPPFSLHKPCDIQP  384

Query  129   IG  124
             IG
Sbjct  385   IG  386



>gb|KDP28531.1| hypothetical protein JCGZ_14302 [Jatropha curcas]
Length=389

 Score =   490 bits (1262),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 230/362 (64%), Positives = 289/362 (80%), Gaps = 8/362 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFPS   P+G TYF +PVGRA+DGR+IVDFLA+ LG  F
Sbjct  31    CEFKAIFNFGDSNSDTGGFWAAFPSQSGPFGKTYFGRPVGRASDGRLIVDFLAEALGFPF  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ K+FKV VDE  
Sbjct  91    LSPYLQSIGSDFRHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKEFKVKVDE--  148

Query  846   QEQHHSYNH--GNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQIT  673
                 HS N   G+T LP  +IFGK++YT YIGQNDF  +L ++GI+GV Q LP+V+AQI 
Sbjct  149   ---FHSTNKKTGSTNLPSPDIFGKSIYTLYIGQNDFTSNLGAIGIAGVKQYLPQVIAQIV  205

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
              TIK++Y LGGRTF +LNLAP+GCYP+ LA L  NTSD+D+FGCL SYNNAV DYNN+LK
Sbjct  206   GTIKELYALGGRTFLVLNLAPVGCYPALLAGLPKNTSDIDRFGCLISYNNAVVDYNNMLK  265

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
              AL + R  +++A+++ VD ++++L+LFQ PTSHGLKY TKACCG GGG YNF  +++CG
Sbjct  266   QALSEARVALRNASLINVDINALMLQLFQRPTSHGLKYSTKACCGQGGGAYNFNPKVYCG  325

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
             +T V++G+ VTA AC+DPYNYVSWDG H T+AANK+    I +GSY DPPF L H C +H
Sbjct  326   NTRVIDGKNVTALACDDPYNYVSWDGIHATEAANKIITMGIINGSYSDPPFSLQH-CELH  384

Query  132   PI  127
             PI
Sbjct  385   PI  386



>ref|XP_008347156.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Malus domestica]
 ref|XP_008364821.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Malus domestica]
Length=388

 Score =   490 bits (1261),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 234/362 (65%), Positives = 287/362 (79%), Gaps = 7/362 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   PYGMTYFK+PVGRATDGR+IVDFLAQ LGL F
Sbjct  33    CEFEAIFNFGDSNSDTGGFWAAFPAQSGPYGMTYFKRPVGRATDGRLIVDFLAQALGLPF  92

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYLKSIGSD++HGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ K FK     Q 
Sbjct  93    ISPYLKSIGSDYKHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKAFKT----QV  148

Query  846   QEQHHSYNHGNTK-LPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITK  670
             +E HHS N    K LP  +IFGK+LYTFYIGQNDF  +LA++G+ GV Q LP+VV+QI  
Sbjct  149   EEFHHSSNQQELKRLPSLDIFGKSLYTFYIGQNDFTSNLAAIGVGGVKQYLPQVVSQIAX  208

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             TIK++Y LGGR F +LNLAP+GCYPSFLA L    S LD FGC  +YN AV DYN +LK+
Sbjct  209   TIKELYALGGRAFLVLNLAPVGCYPSFLAGLP--PSXLDAFGCSIAYNKAVVDYNXLLKE  266

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             AL QTR  + +A++VYVDT S++LELF+HPTSHGLKYGTK+CCG+GGG +NF  ++FCG+
Sbjct  267   ALSQTRGSLXNASLVYVDTSSVLLELFRHPTSHGLKYGTKSCCGHGGGAHNFDPQVFCGN  326

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHP  130
             T V+NG+ VTA AC DPYNYVSWDG H T+AANK+T  AI +G++ DPP P   FC +H 
Sbjct  327   TKVINGRPVTATACSDPYNYVSWDGVHATEAANKLTTLAILNGTFSDPPXPFEQFCDLHR  386

Query  129   IG  124
             I 
Sbjct  387   IA  388



>ref|XP_004306703.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Fragaria vesca 
subsp. vesca]
Length=389

 Score =   489 bits (1258),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 227/361 (63%), Positives = 285/361 (79%), Gaps = 4/361 (1%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA+DGR+IVDFLAQ LGL F
Sbjct  33    CDFQAIFNFGDSNSDTGGFWAAFPAQSGPFGMTYFKKPTGRASDGRLIVDFLAQALGLPF  92

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHG NFAT++STV+ P++SLF + +SPFSLAIQ NQ K FK  V+E  
Sbjct  93    LSPYLQSIGSDYRHGVNFATLASTVLLPNTSLFVTGISPFSLAIQLNQMKAFKTRVEEFH  152

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             Q         N  LP  +IFG++LYTFYIGQNDF  +L ++G+ GV Q LP+VV+QI  T
Sbjct  153   QSNLDKQEPEN--LPSPDIFGRSLYTFYIGQNDFTSNLGAIGVGGVRQYLPQVVSQIAGT  210

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGGR F +LNLAP+GCYP+FL  L    S+LD FGC  SYNNAV DYNN+L++ 
Sbjct  211   IKELYALGGRAFLVLNLAPVGCYPAFLEGLP--LSELDAFGCSISYNNAVQDYNNMLRET  268

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR  +++A+++YVD+ S +LELF HPT+HGLKYGTK+CCG+GGG YN+ ++++CG+T
Sbjct  269   LSQTRASLQNASLIYVDSSSALLELFIHPTNHGLKYGTKSCCGHGGGAYNYDRQVYCGNT  328

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG TVTA AC+DPYNYVSWDG H T+AANK+   AI +GSY DPPFPL   C ++PI
Sbjct  329   KVINGSTVTATACDDPYNYVSWDGIHATEAANKLVTWAILNGSYLDPPFPLQQLCDLYPI  388

Query  126   G  124
             G
Sbjct  389   G  389



>ref|XP_002511954.1| Esterase precursor, putative [Ricinus communis]
 gb|EEF50623.1| Esterase precursor, putative [Ricinus communis]
Length=390

 Score =   486 bits (1251),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 230/361 (64%), Positives = 288/361 (80%), Gaps = 8/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA+DGR+IVDFLAQ LG  F
Sbjct  36    CEFEAIFNFGDSNSDTGGFWAAFPAQSGPFGMTYFKKPSGRASDGRLIVDFLAQALGFPF  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGAN+AT++STV+ P++SLF S +SPF LAIQ NQ K+FKV V    
Sbjct  96    LSPYLQSIGSDYRHGANYATLASTVLMPNTSLFVSGLSPFFLAIQLNQMKEFKVKV----  151

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             +E H +   G++ LP  +IF +++YT +IGQNDF  +LA++GISGV Q LP+VV+QI  T
Sbjct  152   EEFHSTNERGSSTLPSPHIFKRSIYTLFIGQNDFTSNLAAVGISGVKQYLPQVVSQIAGT  211

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSH-NTSDLDQFGCLKSYNNAVADYNNILKD  490
             IK++Y LGGRTF +LNLAP+GCYPS L  + H  +SDLD FGCL SYNNAV DYNN+LK 
Sbjct  212   IKELYGLGGRTFLVLNLAPVGCYPSLL--VGHPRSSDLDAFGCLISYNNAVMDYNNMLKQ  269

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              L +TR+ + +A++VY+D H+++L+LFQHPTSHGLKYG KACCG+GGG YNF  +++CG+
Sbjct  270   TLTETRKTLPNASLVYIDIHAVLLDLFQHPTSHGLKYGIKACCGHGGGAYNFDSQVYCGN  329

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHP  130
             T V+NG  VTA AC+DPYNYVSWDG H T+AANK+   AI SGSY DPPF   H C +HP
Sbjct  330   TKVINGSKVTAAACDDPYNYVSWDGIHATEAANKIIAMAILSGSYSDPPFSFQH-CRLHP  388

Query  129   I  127
             I
Sbjct  389   I  389



>ref|XP_010053782.1| PREDICTED: GDSL esterase/lipase At4g01130 [Eucalyptus grandis]
 ref|XP_010053783.1| PREDICTED: GDSL esterase/lipase At4g01130 [Eucalyptus grandis]
Length=389

 Score =   479 bits (1232),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 235/361 (65%), Positives = 283/361 (78%), Gaps = 5/361 (1%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSNTDTGGF+AAFP    P+GMTYFK+P GRA+DGR+IVDFLAQ LGL F
Sbjct  34    CEFKAIFNFGDSNTDTGGFYAAFPGQTGPFGMTYFKRPSGRASDGRLIVDFLAQALGLPF  93

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGAN+AT++STV+ P++SLF S +SPF+L IQ NQ K FK  VDE  
Sbjct  94    LSPYLQSIGSDYRHGANYATLASTVLLPNTSLFVSGLSPFALPIQLNQMKAFKARVDE--  151

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                +HS     T LP  +IFGK++YTFYIGQNDF  +LAS GI GV Q LP+VVAQ   T
Sbjct  152   ---YHSSGQKGTNLPSPDIFGKSIYTFYIGQNDFTSNLASAGIGGVQQYLPQVVAQTAAT  208

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGGRTFF+LNL+PIGCYPSFL +L H++SDLD +GC+ SYNNAV +YN +LK  
Sbjct  209   IKELYALGGRTFFVLNLSPIGCYPSFLVELPHSSSDLDMYGCMISYNNAVVEYNKLLKGT  268

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR  + +AN++YVDTHS++LELFQ PT HGLKYGT+ACCGYGGG YNF   ++CG +
Sbjct  269   LAQTRASLANANLIYVDTHSVLLELFQPPTYHGLKYGTRACCGYGGGGYNFDPRVYCGSS  328

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               +NG  +TA AC DP NYVSWDG H T+AANK+  +AI SGSYFDPPF L   C + PI
Sbjct  329   KEINGSLLTASACNDPSNYVSWDGIHATEAANKLITRAIISGSYFDPPFSLKQHCDLQPI  388

Query  126   G  124
             G
Sbjct  389   G  389



>ref|XP_008793652.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At4g01130 
[Phoenix dactylifera]
Length=372

 Score =   476 bits (1224),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 226/361 (63%), Positives = 277/361 (77%), Gaps = 9/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA+DGRV+VDFLAQ LGL F
Sbjct  21    CKFPAIFNFGDSNSDTGGFWAAFPAQHGPFGMTYFKKPAGRASDGRVVVDFLAQALGLPF  80

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL SIGSDFRHGANFAT++STV+ P++SLF + +SPFSL IQ NQ K  K  V E +
Sbjct  81    LSPYLNSIGSDFRHGANFATLASTVLLPNTSLFVTGISPFSLGIQLNQIKDLKAKVLEPK  140

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                     +GN  LPP NIF +ALYT  IGQNDF   L ++GI GV Q LP+V +QI  T
Sbjct  141   P-------YGN--LPPPNIFSEALYTIDIGQNDFTSXLKAIGIEGVKQYLPQVSSQIAWT  191

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y +GGRTF + NLAP+GC+P+FL +L HN+SDLD++GC+ SYNNAV DYN +L + 
Sbjct  192   IKELYDMGGRTFMVFNLAPVGCFPAFLTELPHNSSDLDEYGCMISYNNAVVDYNIMLNET  251

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L Q    ++DA+++YVDTHS+ LELF+HP  HGL YGTKACCG+GGG YNF  E+FCG++
Sbjct  252   LHQVLDMLQDASMIYVDTHSVKLELFRHPKDHGLLYGTKACCGHGGGAYNFDPEVFCGNS  311

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG  VTA ACEDP NYVSWDG H T++ANK+   A+ S SY  PPFPL   C +HPI
Sbjct  312   KVINGINVTATACEDPQNYVSWDGIHATESANKLITSAVLSDSYSHPPFPLSRLCDLHPI  371

Query  126   G  124
             G
Sbjct  372   G  372



>ref|XP_009134515.1| PREDICTED: GDSL esterase/lipase At4g01130 [Brassica rapa]
 emb|CDX74361.1| BnaA03g26860D [Brassica napus]
Length=383

 Score =   473 bits (1218),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 225/355 (63%), Positives = 273/355 (77%), Gaps = 4/355 (1%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKPVGRA+DGR+IVDFLA+ LG+ F
Sbjct  30    CEFKAIFNFGDSNSDTGGFWAAFPAQSGPWGMTYFKKPVGRASDGRLIVDFLAESLGVPF  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT++STV+ P++SLF S +SPFSLAIQ NQ KQFKV VDE  
Sbjct  90    LSPYLQSIGSDFRHGANFATLASTVLLPNTSLFVSGISPFSLAIQLNQMKQFKVRVDEF-  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                H S   G   LPP NIFGK+LYTFYIGQNDF  +LAS+G+ GV Q LP+V+ QI  T
Sbjct  149   ---HSSNRQGLHILPPSNIFGKSLYTFYIGQNDFTSNLASIGVDGVKQYLPQVIGQIAGT  205

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY +GGRTF +LNLAP+GCYP+ +    H  SDLD+FGCL   NNAV  YN +L  A
Sbjct  206   IKEIYGIGGRTFLVLNLAPVGCYPAIITGYPHTISDLDKFGCLIPVNNAVKYYNMLLDKA  265

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L +T+  +K+A V+Y+DTH I+L+LFQHP S+G+KYG KACCGYGG  YNF ++LFCG T
Sbjct  266   LSETKTVLKNATVIYLDTHKILLDLFQHPKSYGMKYGIKACCGYGGRPYNFNQKLFCGTT  325

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
              V+   + TA+AC DP +YVSWDG H T+AAN+    AI  GS   PPF L+H C
Sbjct  326   KVIGNSSATAKACRDPKDYVSWDGIHATEAANRRISTAILDGSISYPPFALNHLC  380



>emb|CDX91879.1| BnaC03g31810D [Brassica napus]
Length=383

 Score =   473 bits (1218),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 224/355 (63%), Positives = 272/355 (77%), Gaps = 4/355 (1%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F A+FNFGDSN+DTGGF+AAFP+   P+GMTYFKKPVGRA+DGR+I+DFLA+ LG+ F
Sbjct  30    CEFKAVFNFGDSNSDTGGFWAAFPAQSGPWGMTYFKKPVGRASDGRLIIDFLAESLGMPF  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT++STV+ P++SLF S +SPFSLAIQ NQ K FKV VDE  
Sbjct  90    LSPYLQSIGSDFRHGANFATLASTVLLPNTSLFVSGISPFSLAIQLNQMKDFKVRVDEF-  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                H S   G   LPP NIFGK+LYTFYIGQNDF  +LAS+G+ GV Q LP+V+ QI  T
Sbjct  149   ---HSSQQPGLHILPPSNIFGKSLYTFYIGQNDFTSNLASIGVDGVKQYLPQVIGQIAGT  205

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY +GGRTF +LNLAP+GCYP+ L    H  SDLD+FGCL   NNAV  YN +L  A
Sbjct  206   IKEIYGIGGRTFLVLNLAPVGCYPAILTGYPHTMSDLDKFGCLIPVNNAVKYYNMLLDKA  265

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L +TR  +K+A V+Y+DTH I+L+LFQHP S+G+KYG KACCGYGG  YNF ++LFCG T
Sbjct  266   LSETRTVLKNATVIYLDTHKILLDLFQHPKSYGMKYGIKACCGYGGRSYNFNQKLFCGTT  325

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
              ++   + TA+AC DP NYVSWDG H T+AAN+    AI  GS   PPF L+H C
Sbjct  326   KIIGNSSATAKACRDPKNYVSWDGIHATEAANRRISTAILDGSISYPPFALNHLC  380



>ref|XP_010427723.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Camelina sativa]
Length=384

 Score =   471 bits (1212),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 223/355 (63%), Positives = 273/355 (77%), Gaps = 4/355 (1%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA+DGR+I+DFLA+ LG+ F
Sbjct  32    CDFEAIFNFGDSNSDTGGFWAAFPAQSGPWGMTYFKKPAGRASDGRLIIDFLAKSLGMPF  91

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT++STV+ P++SLF S +SPFSLAIQ NQ KQFKV VDE  
Sbjct  92    LSPYLQSIGSDFRHGANFATLASTVLLPNTSLFVSGISPFSLAIQLNQMKQFKVKVDES-  150

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                H S   G   LP +N+FGK+LYTFYIGQNDF  +LAS+G+  V Q LP+V+ QI  T
Sbjct  151   ---HSSDQPGLKILPSRNVFGKSLYTFYIGQNDFTSNLASIGVDRVKQYLPQVIGQIAGT  207

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY +GGRTF +LNLAP+GCYP+ L   +H  SDLD+FGCL S NNAV  YN +L   
Sbjct  208   IKEIYGIGGRTFLVLNLAPVGCYPAILTGYTHTVSDLDKFGCLISVNNAVKYYNELLNKT  267

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L +TR ++K+A V+Y+DTH I+L+LFQHP S+GLKYG KACCGYGG  YNF ++LFCG+T
Sbjct  268   LSETRAELKNATVIYLDTHKILLDLFQHPKSYGLKYGIKACCGYGGRPYNFDQKLFCGNT  327

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
              V+   + TA+AC DP+NYVSWDG H T+AAN     AI  GS   PPF L + C
Sbjct  328   KVIGNSSATAKACRDPHNYVSWDGIHATEAANHHISMAILDGSISYPPFTLINLC  382



>ref|XP_009421235.1| PREDICTED: GDSL esterase/lipase At4g01130 [Musa acuminata subsp. 
malaccensis]
Length=393

 Score =   471 bits (1213),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 221/361 (61%), Positives = 272/361 (75%), Gaps = 9/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGGF+AAFP+   P+GMTYFK+P GRA+DGR+ +DFLAQ LGL F
Sbjct  42    CVFPAIFNFGDSNSDTGGFWAAFPAQTGPFGMTYFKRPSGRASDGRLFIDFLAQALGLPF  101

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT++STV  P++SLF + +SPFSL IQ NQ K  +  V   +
Sbjct  102   LSPYLQSIGSDFRHGANFATLASTVRLPNTSLFVTGISPFSLGIQLNQMKDLRTRVLALK  161

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
               +H         LPP N+FG++LYTF IGQNDF  +L SLGI  V Q LP+V +QI  T
Sbjct  162   GTEH---------LPPGNVFGQSLYTFDIGQNDFTSELGSLGIGAVKQYLPQVASQIAWT  212

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+I+ +GGRTF + NLAP+GCYP+FL +L HNTSDLD +GC+ SYNNAV DYNN+L D 
Sbjct  213   IKEIHDIGGRTFMVFNLAPVGCYPAFLTELPHNTSDLDSYGCMISYNNAVVDYNNLLNDT  272

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L+  R  +  A ++YVDTHS+ LELF+HP +HGL +GTKACCG+GGG YNF  ++FCG++
Sbjct  273   LQHMRDMLPGATIIYVDTHSVKLELFRHPKNHGLIHGTKACCGHGGGAYNFDPQVFCGNS  332

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG  VTA AC DP NYVSWDG H T+AANK    A+  GS F PPFPL   C + PI
Sbjct  333   KVINGIKVTATACGDPQNYVSWDGIHGTEAANKRVTGAVLGGSIFHPPFPLSKLCDLQPI  392

Query  126   G  124
             G
Sbjct  393   G  393



>ref|XP_010925787.1| PREDICTED: GDSL esterase/lipase At4g01130 [Elaeis guineensis]
Length=388

 Score =   471 bits (1212),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 225/361 (62%), Positives = 273/361 (76%), Gaps = 9/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA+DGR+++DFLAQ LGL F
Sbjct  37    CKFPAIFNFGDSNSDTGGFWAAFPAEHSPFGMTYFKKPAGRASDGRLVIDFLAQALGLPF  96

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYLKSIGSDFRHGANFAT +STV+ P++SLF + +SPFSLAIQ NQ K  +  V E  
Sbjct  97    LSPYLKSIGSDFRHGANFATAASTVLLPNTSLFVTGISPFSLAIQLNQIKDLQAHVLEPN  156

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                     +GN  LP   IF KALYT  IGQNDF  +L ++GI GV Q LP+V +QI  T
Sbjct  157   H-------YGN--LPHPKIFSKALYTIDIGQNDFTSNLNAIGIEGVKQYLPQVASQIAWT  207

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y +GGR F + NLAPIGC+P+FL +L HN SDLD++GC+ SYNNAV DYNN+L + 
Sbjct  208   IKELYDMGGRNFMVFNLAPIGCFPAFLTELRHNISDLDEYGCMISYNNAVVDYNNMLNET  267

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L Q    ++DA+V+YVDTHS+ LELFQHP  HGL YGTKACCG+GGG YNF  E+FCG++
Sbjct  268   LHQVLDVLQDASVIYVDTHSVKLELFQHPKEHGLLYGTKACCGHGGGAYNFDPEVFCGNS  327

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG  +TA ACEDP NYVSWDG H T+AANK+   A+  GSY  P FPL   C + PI
Sbjct  328   KVINGINITATACEDPQNYVSWDGIHATEAANKIITWAVLGGSYSHPFFPLSKLCDLQPI  387

Query  126   G  124
             G
Sbjct  388   G  388



>ref|XP_008458153.1| PREDICTED: GDSL esterase/lipase At4g01130 [Cucumis melo]
Length=444

 Score =   469 bits (1208),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 216/360 (60%), Positives = 278/360 (77%), Gaps = 1/360 (0%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+A FP+   P GMT+FKKP GRATDGR+I+DFLA  +GL F
Sbjct  85    CKFEAIFNFGDSNSDTGGFWAVFPAQHGPNGMTFFKKPTGRATDGRLILDFLANSVGLPF  144

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPY+K+IGSDF+HGANFAT++STV+ P++SLF + +SPFSLAIQ NQ K+FK+ VDE  
Sbjct  145   ISPYMKAIGSDFKHGANFATLASTVLLPNTSLFVTGISPFSLAIQLNQMKEFKLRVDEFY  204

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                    + G ++LPP +IFGKALY FYIGQNDF  +L ++GI GVNQ LP+VV+QI  T
Sbjct  205   SSSSSF-SKGWSQLPPPDIFGKALYIFYIGQNDFTSNLKAIGIEGVNQYLPQVVSQIIDT  263

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGG TF ++N+AP+GCYP+ L +L H +SD+DQ+GC  SYN AV DYN +LK  
Sbjct  264   IKEVYKLGGETFLVMNMAPVGCYPALLVQLPHKSSDIDQYGCFISYNKAVTDYNAMLKKE  323

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L + R  +  A++VY DTHSI+L+LF+HP S+GLKY TKACCG+GGG YNF   +FCG++
Sbjct  324   LERARSVLPKASLVYFDTHSILLQLFRHPNSYGLKYSTKACCGHGGGPYNFDPTIFCGNS  383

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               +N +T+TA AC DPYNYVSWDG H T+AANK+   AI +GSY DPPF   + C + P+
Sbjct  384   KKMNNKTLTATACSDPYNYVSWDGIHATEAANKLVTLAILNGSYSDPPFSFQNLCDLQPL  443



>ref|XP_004170182.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Cucumis sativus]
Length=389

 Score =   467 bits (1202),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 215/360 (60%), Positives = 275/360 (76%), Gaps = 8/360 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+A FP    P GMT+FKKP GRATDGR+I+DFLA  LGL F
Sbjct  37    CKFEAIFNFGDSNSDTGGFWAVFPPQHEPNGMTFFKKPTGRATDGRLIIDFLANSLGLPF  96

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYLK+IGSDF+HGANFAT++STV+ P++SLF + +SPFSLAIQ NQ K+FK  VDE +
Sbjct  97    ISPYLKAIGSDFKHGANFATLASTVLLPNTSLFVTGISPFSLAIQLNQMKEFKFRVDEGD  156

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             +        G ++LP  +IFGKALYTFYIGQNDF  +L ++GI GVNQ LP+VV+QI  T
Sbjct  157   E--------GWSQLPAPDIFGKALYTFYIGQNDFTSNLKAIGIQGVNQYLPQVVSQIIDT  208

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK++Y LGG TF ++N+AP+GCYP+ L +L   +SD+DQ+GC  SYN AV DYN +LK  
Sbjct  209   IKELYKLGGETFLVMNMAPVGCYPALLVQLPLESSDIDQYGCFISYNKAVTDYNAMLKKE  268

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L + R  +  A+++Y DTHS++L+LFQHP S+GLKY TKACCG+GGG YNF   + CG++
Sbjct  269   LERARSTLPKASLIYFDTHSVLLQLFQHPNSYGLKYSTKACCGHGGGPYNFDPTILCGNS  328

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
               +N + +TA AC DPYNYVSWDG H T+AANK+   AI +GSY DPPF   + CH+ P+
Sbjct  329   KKINNKILTATACSDPYNYVSWDGIHATEAANKLVALAILNGSYSDPPFSFQNLCHLQPL  388



>ref|XP_010422775.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At4g01130-like 
[Camelina sativa]
Length=383

 Score =   467 bits (1201),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 222/356 (62%), Positives = 274/356 (77%), Gaps = 6/356 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA+DGR+I+DFLA+ LG+ F
Sbjct  31    CDFEAIFNFGDSNSDTGGFWAAFPAQSGPWGMTYFKKPAGRASDGRLIIDFLAKSLGMPF  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT++STV+ P++SLF S +SPFSLAIQ NQ KQFKV VDE  
Sbjct  91    LSPYLQSIGSDFRHGANFATLASTVLLPNTSLFVSGISPFSLAIQLNQMKQFKVKVDES-  149

Query  846   QEQHHSYNHGNTK-LPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITK  670
                 HS +    K LP +N+FGK+LYTFYIGQNDF  +LAS+G+  V Q LP+V+ QI  
Sbjct  150   ----HSLDQPGLKILPSRNVFGKSLYTFYIGQNDFTSNLASIGVDRVKQYLPQVIGQIAG  205

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             TIK+IY +GGRTF +LNLAP+GCYP+ L   +H  SDLD+FGCL S NNAV  YN +L  
Sbjct  206   TIKEIYGIGGRTFLVLNLAPVGCYPAILTGXTHTVSDLDKFGCLISVNNAVKYYNELLNK  265

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              L +TR ++K+A V+Y+DTH I+L+LFQHP S+G+KYG KACCGYGG  YNF ++LFCG+
Sbjct  266   TLSETRAELKNATVIYLDTHKILLDLFQHPKSYGMKYGIKACCGYGGRPYNFDQKLFCGN  325

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             T V+   + TA+AC DP+NYVSWDG H T+AAN     AI  GS   PPF L + C
Sbjct  326   TKVIGNFSATAKACRDPHNYVSWDGIHATEAANHHISMAILDGSISYPPFTLINLC  381



>ref|XP_011094782.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Sesamum indicum]
Length=395

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 278/359 (77%), Gaps = 7/359 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F A+F FGDSN+D+GGF AAFPS   P GMTYF +P GRATDGR+ VDFLAQGLGL F
Sbjct  43    CAFEAMFIFGDSNSDSGGFNAAFPSQPSPNGMTYFNRPTGRATDGRLYVDFLAQGLGLPF  102

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYL+SIGSD+RHGANFAT +STV+ P +SLF + VSPF LA+Q NQ KQFK  V+E +
Sbjct  103   VSPYLQSIGSDYRHGANFATAASTVLMPTTSLFVNGVSPFYLAVQINQMKQFKAKVEEFK  162

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +       G T LP  +IFGKALY  YIGQNDF     S G  G  Q  P++V+Q+  T
Sbjct  163   SQ-------GQTNLPQPDIFGKALYVIYIGQNDFTGFAGSAGAGGAKQYAPQIVSQVVST  215

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             +K++Y LGGRTF +LNL P+GCYP+FL +  H +SD+D  GC+ S+NNAV +YN++LKDA
Sbjct  216   VKELYSLGGRTFLVLNLGPVGCYPAFLVQFPHGSSDIDPSGCMMSHNNAVNEYNSMLKDA  275

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L Q RQD+KDAN+++VDT+S++LEL+++PTSHG+++GT ACCGYGGG YN+ +++FCG +
Sbjct  276   LGQARQDLKDANLIHVDTNSVLLELYRNPTSHGMQHGTTACCGYGGGSYNYNQQVFCGYS  335

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHP  130
              V+NGQTVTA AC DP NYVSWDG HLT+AANK+   AI SGS+FDPPF L  +C I P
Sbjct  336   KVVNGQTVTASACSDPQNYVSWDGIHLTEAANKIMASAILSGSHFDPPFSLSQYCDIKP  394



>ref|XP_006396297.1| hypothetical protein EUTSA_v10028725mg [Eutrema salsugineum]
 gb|ESQ37750.1| hypothetical protein EUTSA_v10028725mg [Eutrema salsugineum]
Length=382

 Score =   466 bits (1199),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/355 (61%), Positives = 273/355 (77%), Gaps = 4/355 (1%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA+DGR+I+DFLA+ LG+ F
Sbjct  30    CDFKAIFNFGDSNSDTGGFWAAFPAQSGPWGMTYFKKPAGRASDGRLIIDFLAESLGMPF  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT++STV+ P++SLF S +SPFSLAIQ NQ K FKV VDE  
Sbjct  90    LSPYLQSIGSDFRHGANFATLASTVLLPNTSLFVSGISPFSLAIQLNQMKHFKVKVDET-  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                H S       LP +++FGK+LYTFYIGQNDF  +LA++G+ GV Q LP+V++QI  T
Sbjct  149   ---HSSDQQALKILPSRDVFGKSLYTFYIGQNDFTSNLAAIGVDGVKQYLPQVISQIAGT  205

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY +GGRTF +LNLAP+GCYPS L    H  SDLD+FGCL S N AV  YN +LK  
Sbjct  206   IKEIYGIGGRTFLVLNLAPVGCYPSILTGYIHTASDLDKFGCLISVNKAVEYYNALLKKT  265

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L +TR ++K+A V+Y+DTH I+ +LFQ+P S+G+K+G KACCG+GG  YNF ++LFCG +
Sbjct  266   LSKTRTEVKNATVIYLDTHKILFDLFQYPNSYGMKHGIKACCGHGGHPYNFDQKLFCGTS  325

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
              V+   TVTA+AC DP+NYVSWDG H+T+AAN     AI  GS  DPPF L + C
Sbjct  326   KVIRNSTVTAKACHDPHNYVSWDGIHMTEAANHRISTAILDGSLSDPPFTLSNLC  380



>gb|EPS57812.1| hypothetical protein M569_17003, partial [Genlisea aurea]
Length=351

 Score =   462 bits (1190),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 220/356 (62%), Positives = 271/356 (76%), Gaps = 7/356 (2%)
 Frame = -1

Query  1191  IFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAFLSPYL  1012
             IFNFGDSN+DTGGF+AAFP+  PP+GMT+FK P GRA+DGR+I+DFLAQGLGL FLSPYL
Sbjct  1     IFNFGDSNSDTGGFWAAFPAAYPPHGMTFFKTPSGRASDGRLIIDFLAQGLGLPFLSPYL  60

Query  1011  KSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQEQEQHH  832
             KSIGSD+RHGANFAT++STV  P SSLF + VSPFSL IQ NQ+K FK  VD        
Sbjct  61    KSIGSDYRHGANFATLASTVSLPLSSLFVAGVSPFSLGIQINQWKNFKSEVDRLNDSS--  118

Query  831   SYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKTIKDIY  652
                 G TKLPP ++F ++L+TFYIGQNDF  +LASLGI+G  + LP+VV+QI   IK+IY
Sbjct  119   ----GKTKLPPPDVFRRSLFTFYIGQNDFTGNLASLGIAGAKRVLPDVVSQIAAAIKEIY  174

Query  651   LLGGRTFFILNLAPIGCYPSFLAKLSHNTS-DLDQFGCLKSYNNAVADYNNILKDALRQT  475
               GGRTF +LNLAPIGCY SFL +L HNTS D+D FGC+  YN+AV DYN++L + L Q 
Sbjct  175   AFGGRTFMVLNLAPIGCYSSFLVELPHNTSSDMDSFGCMIPYNDAVNDYNSLLNETLTQA  234

Query  474   RQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDTNVLN  295
             R D+ D++++Y D +S++L LF +P+SHGLKYGTKACCGYGG  YNF  + +CG+  ++ 
Sbjct  235   RNDLPDSDLLYADINSVMLNLFHNPSSHGLKYGTKACCGYGGDPYNFNPKAYCGNGGMVG  294

Query  294   GQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
             G+ V+  AC DPYNYVSWDG H T+AANKV  +AI SGS   PPF L   C I PI
Sbjct  295   GRNVSGVACSDPYNYVSWDGIHATEAANKVVAEAILSGSVLYPPFSLDKLCDIQPI  350



>ref|XP_007051644.1| Esterase, putative isoform 2 [Theobroma cacao]
 gb|EOX95801.1| Esterase, putative isoform 2 [Theobroma cacao]
Length=366

 Score =   462 bits (1190),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 222/364 (61%), Positives = 275/364 (76%), Gaps = 35/364 (10%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFK+P GRATDGR++VDFLAQ LGL F
Sbjct  35    CEFKAIFNFGDSNSDTGGFWAAFPAQSGPFGMTYFKRPAGRATDGRLMVDFLAQALGLPF  94

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYL+SIGSDFRHGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ K+FK  V E  
Sbjct  95    ISPYLQSIGSDFRHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKEFKAKVVE--  152

Query  846   QEQHHSYNHG---NTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQI  676
                +HS N      TKLP  +IFGK+LYTFYIGQNDF  +L ++GI GV Q LP+VV+QI
Sbjct  153   ---YHSGNKKGSTTTKLPSPDIFGKSLYTFYIGQNDFTSNLKAIGIEGVEQYLPQVVSQI  209

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
                +K                           L HNTSDLD+FGCL SYN AV DYNN+L
Sbjct  210   AGNVK---------------------------LPHNTSDLDKFGCLTSYNKAVVDYNNML  242

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K+AL QTR+D+ +A+++YVDTH+++LELFQHPT+HGL+YGT+ACCGYGGG YNF +E++C
Sbjct  243   KEALSQTRRDLPNASLIYVDTHAVLLELFQHPTAHGLRYGTRACCGYGGGTYNFHQEVYC  302

Query  315   GDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHI  136
             G+T V+NG  +TA ACEDP NYVSWDG H ++AANK+T  AI +GS FDPPFPLH  C +
Sbjct  303   GNTKVINGTNMTASACEDPNNYVSWDGIHASEAANKLTTLAILNGSLFDPPFPLHKLCDL  362

Query  135   HPIG  124
             H IG
Sbjct  363   HHIG  366



>ref|XP_006286509.1| hypothetical protein CARUB_v10001068mg, partial [Capsella rubella]
 gb|EOA19407.1| hypothetical protein CARUB_v10001068mg, partial [Capsella rubella]
Length=414

 Score =   464 bits (1194),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 217/357 (61%), Positives = 276/357 (77%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA+DGR+I+DFLA+ LG+ F
Sbjct  61    CDFEAIFNFGDSNSDTGGFWAAFPAQSGPWGMTYFKKPAGRASDGRLIIDFLAKSLGMPF  120

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT++STV+ P++SLF + +SPFSLAIQ NQ KQFKV VDE  
Sbjct  121   LSPYLQSIGSDFRHGANFATLASTVLLPNTSLFVTGISPFSLAIQLNQMKQFKVKVDES-  179

Query  846   QEQHHSYNHGNTK--LPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQIT  673
                 HS +   +K  LP +N+FGK+LYTFYIGQNDF  +LAS+G+ GV Q LP+V+ QI 
Sbjct  180   ----HSSDQPESKKMLPSRNVFGKSLYTFYIGQNDFTSNLASIGVDGVKQYLPQVIGQIA  235

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
              TIK+IY +GGRTF +LNLAP+GCYP+ L   +H ++DLD+FGCL   N AV  YN +L 
Sbjct  236   GTIKEIYGIGGRTFLVLNLAPVGCYPAILTGYTHTSADLDKFGCLIPVNKAVQYYNALLN  295

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
               L +TR ++KDA V+Y+DTH I+L+LFQHP S+G+K+G KACCG+GG  YNF +++FCG
Sbjct  296   KTLSETRTELKDATVIYLDTHKILLDLFQHPKSYGMKHGIKACCGHGGRPYNFDQKIFCG  355

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             +T V+   + TA+AC DP+NYVSWDG H T+AAN     AI  GS   PPF L++ C
Sbjct  356   NTKVIGNSSATAKACRDPHNYVSWDGIHATEAANHHISMAILDGSISYPPFTLNNLC  412



>gb|EYU32204.1| hypothetical protein MIMGU_mgv1a008044mg [Erythranthe guttata]
Length=386

 Score =   462 bits (1190),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 223/361 (62%), Positives = 278/361 (77%), Gaps = 7/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F AIFNFGDSN+DTGGFFAAFPS   P GMTYF +P GR ++GR+ +DFLAQGLGL F
Sbjct  33    CAFEAIFNFGDSNSDTGGFFAAFPSQSSPNGMTYFNRPTGRPSNGRLFIDFLAQGLGLPF  92

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT +STV+ P++SL+ + VSPF LA+Q NQ K FK  V+E +
Sbjct  93    LSPYLQSIGSDFRHGANFATSASTVLQPNTSLYVTGVSPFYLAVQINQLKNFKARVEEFK  152

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +       G T LP  ++FGK+LYTFYIGQNDF    +S G  GV Q  P++++QI   
Sbjct  153   SQ-------GQTNLPQPDVFGKSLYTFYIGQNDFTGYASSAGPGGVKQIQPQIISQIVSA  205

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF +LNLAP+GCYP+FL + S   SD+D  GC+ SYNNAV DYN  LK A
Sbjct  206   IKEIYWLGGRTFMVLNLAPVGCYPTFLVQQSQGGSDIDPSGCMMSYNNAVNDYNENLKQA  265

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L Q RQ++ DANV+YVDT+S+IL+LF++PTSHG+++ T ACCGYGGG YN+ +++FCG T
Sbjct  266   LSQVRQELHDANVIYVDTNSVILDLFRNPTSHGMQHATTACCGYGGGSYNYNQQVFCGAT  325

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V++GQTVTA AC DP NYVSWDG HLT+AANK+   +I SGS FDP F L+ +C I PI
Sbjct  326   KVVDGQTVTASACSDPQNYVSWDGIHLTEAANKIVAYSILSGSNFDPSFALNQYCDIQPI  385

Query  126   G  124
             G
Sbjct  386   G  386



>gb|EYU31639.1| hypothetical protein MIMGU_mgv1a008086mg [Erythranthe guttata]
Length=385

 Score =   462 bits (1188),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 221/361 (61%), Positives = 276/361 (76%), Gaps = 7/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F AIFNFGDSN+DTGGFFAAFPS   P GMTYF +P GR ++GR+ +DFLAQGLGL F
Sbjct  32    CAFEAIFNFGDSNSDTGGFFAAFPSQSSPNGMTYFNRPTGRPSNGRLFIDFLAQGLGLPF  91

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGANFAT +STV+ P++SL+ + VSPF LA+Q NQ K FK  V+E +
Sbjct  92    LSPYLQSIGSDYRHGANFATSASTVLQPNTSLYVTGVSPFYLAVQINQMKNFKARVEEFK  151

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +       G T LP  ++FGK+LYTFYIGQNDF    +S G  GV Q  P++++QI   
Sbjct  152   SQ-------GQTNLPQPDVFGKSLYTFYIGQNDFTGYASSAGPGGVKQIQPQIISQIVSA  204

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY LGGRTF +LNLAP+GCYP+FL + S   SD+D  GC+ SYNNAV DYN  LK A
Sbjct  205   IKEIYWLGGRTFMVLNLAPVGCYPTFLVQQSQGGSDIDPSGCMMSYNNAVNDYNENLKQA  264

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L Q RQ++ DANV+Y DT+S+IL+LF++PTSHG+++ T ACCGYGGG YN+ +++FCG T
Sbjct  265   LSQVRQELNDANVIYADTNSVILDLFRNPTSHGMQHATTACCGYGGGSYNYNQQVFCGAT  324

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NGQTVTA AC DP NYVSWDG HLT+AANK+   +I SGS FD  F L+ +C I PI
Sbjct  325   KVVNGQTVTASACNDPQNYVSWDGIHLTEAANKIVASSILSGSNFDSSFALNQYCDIQPI  384

Query  126   G  124
             G
Sbjct  385   G  385



>gb|KDO86383.1| hypothetical protein CISIN_1g016356mg [Citrus sinensis]
Length=361

 Score =   460 bits (1184),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 218/361 (60%), Positives = 276/361 (76%), Gaps = 34/361 (9%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFK+P GRA+DGR+IVDFLAQ LGL F
Sbjct  35    CEFEAIFNFGDSNSDTGGFWAAFPAQSGPFGMTYFKRPAGRASDGRLIVDFLAQALGLPF  94

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ K+FK  VD   
Sbjct  95    LSPYLQSIGSDYRHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKEFKARVD---  151

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              E H S                                +++GI GV Q LP+VV+QI  T
Sbjct  152   -EFHSSCT------------------------------SAIGIGGVKQFLPQVVSQIAGT  180

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             ++++Y LGGRTF +LNLAPIGCYP+FL +L H++SDLD +GC+ SYNNAV DYNN+LK+A
Sbjct  181   VEELYALGGRTFLVLNLAPIGCYPAFLVQLPHSSSDLDAYGCMISYNNAVLDYNNMLKEA  240

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR+++ +A+++ VDTHS++LELFQ+PTSHGLKYGT+ACCG+G G YNF  ++FCG+T
Sbjct  241   LAQTRRNLPNASLICVDTHSVLLELFQNPTSHGLKYGTQACCGHGDGAYNFDAKVFCGNT  300

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              V+NG TVTA AC DP +YVSWDG H T+AANK+T  AI +GSYFDPPFPLH  C ++PI
Sbjct  301   KVINGSTVTATACSDPQDYVSWDGIHATEAANKLTTWAILNGSYFDPPFPLHQLCDLNPI  360

Query  126   G  124
             G
Sbjct  361   G  361



>gb|KGN45708.1| hypothetical protein Csa_6G007420 [Cucumis sativus]
Length=413

 Score =   461 bits (1185),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 216/376 (57%), Positives = 275/376 (73%), Gaps = 16/376 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+A FP    P GMT+FKKP GRATDGR+I+DFLA  LGL F
Sbjct  37    CKFEAIFNFGDSNSDTGGFWAVFPPQHEPNGMTFFKKPTGRATDGRLIIDFLANSLGLPF  96

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYLK+IGSDF+HGANFAT++STV+ P++SLF + +SPFSLAIQ NQ K+FK  VDE  
Sbjct  97    ISPYLKAIGSDFKHGANFATLASTVLLPNTSLFVTGISPFSLAIQLNQMKEFKFRVDEYY  156

Query  846   QEQHHSY----------------NHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGIS  715
                  S                 + G ++LP  +IFGKALYTFYIGQNDF  +L ++GI 
Sbjct  157   SSSSSSSSSSSCSSSSSSSFLKGDEGWSQLPAPDIFGKALYTFYIGQNDFTSNLKAIGIQ  216

Query  714   GVNQSLPEVVAQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLK  535
             GVNQ LP+VV+QI  TIK++Y LGG TF ++N+AP+GCYP+ L +L   +SD+DQ+GC  
Sbjct  217   GVNQYLPQVVSQIIDTIKELYKLGGETFLVMNMAPVGCYPALLVQLPLESSDIDQYGCFI  276

Query  534   SYNNAVADYNNILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGY  355
             SYN AV DYN +LK  L + R  +  A+++Y DTHS++L+LFQHP S+GLKY TKACCG+
Sbjct  277   SYNKAVTDYNAMLKKELERARSTLPKASLIYFDTHSVLLQLFQHPNSYGLKYSTKACCGH  336

Query  354   GGGDYNFKKELFCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSY  175
             GGG YNF   + CG++  +N + +TA AC DPYNYVSWDG H T+AANK+   AI +GSY
Sbjct  337   GGGPYNFDPTILCGNSKKINNKILTATACSDPYNYVSWDGIHATEAANKLVALAILNGSY  396

Query  174   FDPPFPLHHFCHIHPI  127
              DPPF   + CH+ P+
Sbjct  397   SDPPFSFQNLCHLQPL  412



>ref|XP_002874995.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51254.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=382

 Score =   456 bits (1173),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 218/356 (61%), Positives = 271/356 (76%), Gaps = 6/356 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA+DGR+I+DFLA+ LG+ F
Sbjct  30    CDFEAIFNFGDSNSDTGGFWAAFPAQSGPWGMTYFKKPAGRASDGRLIIDFLAKSLGMPF  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT++STV+ P++SLF S +SPFSLAIQ NQ KQFKV VDE  
Sbjct  90    LSPYLQSIGSDFRHGANFATLASTVLLPNTSLFVSGISPFSLAIQLNQMKQFKVNVDES-  148

Query  846   QEQHHSYNHGNTK-LPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITK  670
                 HS +    K LP KN+FGK+LYTFYIGQNDF  +LAS+G+  V Q LP+V+ QI  
Sbjct  149   ----HSLDRPGLKILPSKNVFGKSLYTFYIGQNDFTSNLASIGVERVKQYLPQVIGQIAG  204

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             TIK+IY +GG TF +LNLAP+GCYP+ L   +H  SDLD+FGCL   N AV  YN +LK 
Sbjct  205   TIKEIYGIGGLTFLVLNLAPVGCYPAILTGYTHTVSDLDKFGCLIPVNKAVKYYNALLKK  264

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              L +TR  +++A V+Y+DTH I+L+LFQHP S+G+K+G KACCGYGG  YNF ++LFCG+
Sbjct  265   TLSETRTQLRNATVIYLDTHKILLDLFQHPNSYGMKHGIKACCGYGGRPYNFDQKLFCGN  324

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             T V+   + TA+AC DP+NYVSWDG H T+AAN     AI  G    PPF L++ C
Sbjct  325   TKVIENFSATAKACRDPHNYVSWDGIHATEAANHHISTAILDGLISYPPFILNNLC  380



>gb|KFK30700.1| hypothetical protein AALP_AA6G016400 [Arabis alpina]
Length=382

 Score =   455 bits (1171),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 213/357 (60%), Positives = 273/357 (76%), Gaps = 6/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA+DGR+I+DFLA+ LG+ F
Sbjct  30    CVFEAIFNFGDSNSDTGGFWAAFPAQSGPWGMTYFKKPAGRASDGRLIIDFLAESLGMPF  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT++STV+ P++SLF + +SPFSLAIQ NQ K FKV+VDE  
Sbjct  90    LSPYLQSIGSDFRHGANFATLASTVLLPNTSLFVTGISPFSLAIQLNQMKHFKVIVDES-  148

Query  846   QEQHHSYNHGNTK-LPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITK  670
                 HS +    K LP K++FGK+LYTFYIGQNDF  +LA++G+ GV + LP V+ QI  
Sbjct  149   ----HSSDQPELKTLPSKDVFGKSLYTFYIGQNDFTSNLATIGVDGVKKYLPHVIGQIAG  204

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             TIK+IY +GGRTF +LNLAP+GCYP+ L   +H  SD+D+FGCL   N AV  YN +LK 
Sbjct  205   TIKEIYGIGGRTFLVLNLAPVGCYPAILTGFTHTFSDIDKFGCLIPVNKAVKYYNTLLKK  264

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              L +TR ++K+A ++Y+DT+ I+L+LF HP S+GLKYG KACCGYGG  YNF ++L+CG+
Sbjct  265   TLSETRTELKNATIIYLDTNKILLDLFHHPKSYGLKYGVKACCGYGGRPYNFDQKLYCGN  324

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T ++   + TA+AC DP NYVSWDG H T+AAN     AI  GS   PPF L++ C+
Sbjct  325   TKMIGNASATAKACRDPQNYVSWDGIHATEAANHRISMAILDGSISYPPFSLNNICN  381



>ref|NP_192022.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9M153.1|GDL61_ARATH RecName: Full=GDSL esterase/lipase At4g01130; AltName: Full=Extracellular 
lipase At4g01130; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB80922.1| putative acetyltransferase [Arabidopsis thaliana]
 gb|ABL66800.1| At4g01130 [Arabidopsis thaliana]
 gb|AEE81985.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=382

 Score =   454 bits (1167),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 217/356 (61%), Positives = 271/356 (76%), Gaps = 6/356 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA+DGR+I+DFLA+ LG+ F
Sbjct  30    CDFEAIFNFGDSNSDTGGFWAAFPAQSGPWGMTYFKKPAGRASDGRLIIDFLAKSLGMPF  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT++STV+ P++SLF S +SPFSLAIQ NQ KQFKV VDE  
Sbjct  90    LSPYLQSIGSDFRHGANFATLASTVLLPNTSLFVSGISPFSLAIQLNQMKQFKVNVDES-  148

Query  846   QEQHHSYNHGNTK-LPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITK  670
                 HS +    K LP K +FGK+LYTFYIGQNDF  +LAS+G+  V   LP+V+ QI  
Sbjct  149   ----HSLDRPGLKILPSKIVFGKSLYTFYIGQNDFTSNLASIGVERVKLYLPQVIGQIAG  204

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             TIK+IY +GGRTF +LNLAP+GCYP+ L   +H  +DLD++GCL   N AV  YN +L  
Sbjct  205   TIKEIYGIGGRTFLVLNLAPVGCYPAILTGYTHTDADLDKYGCLIPVNKAVKYYNTLLNK  264

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              L QTR ++K+A V+Y+DTH I+L+LFQHP S+G+K+G KACCGYGG  YNF ++LFCG+
Sbjct  265   TLSQTRTELKNATVIYLDTHKILLDLFQHPKSYGMKHGIKACCGYGGRPYNFNQKLFCGN  324

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             T V+   + TA+AC DP+NYVSWDG H T+AAN     AI  GS   PPF L++ C
Sbjct  325   TKVIGNFSTTAKACHDPHNYVSWDGIHATEAANHHISMAILDGSISYPPFILNNLC  380



>ref|XP_002437870.1| hypothetical protein SORBIDRAFT_10g004120 [Sorghum bicolor]
 gb|EER89237.1| hypothetical protein SORBIDRAFT_10g004120 [Sorghum bicolor]
Length=396

 Score =   453 bits (1165),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 206/355 (58%), Positives = 273/355 (77%), Gaps = 8/355 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPA+FNFGDSN+DTGGF+AAFP+   P+GMTYF +P GRA+DGR+++DF+AQ +GL  
Sbjct  48    CKFPAVFNFGDSNSDTGGFWAAFPAQQGPFGMTYFGRPAGRASDGRLVIDFIAQAMGLPL  107

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGAN AT++STV+ P++S+F + +SPFSL IQ NQ K+F+  V    
Sbjct  108   LSPYLQSIGSDYRHGANSATLASTVLLPNTSVFVTGISPFSLGIQLNQMKEFRNRV----  163

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                  S N  N +LP  +IFGKALYT  IGQNDF  +L SLG+  V +SLP +V QI+ T
Sbjct  164   ----LSSNGNNGQLPRPDIFGKALYTIDIGQNDFTSNLGSLGVESVKRSLPSIVNQISWT  219

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             I+D+Y +G R F + N+APIGCYP+FL +L HN++DLD+FGC+KSYN+ V  YN +L ++
Sbjct  220   IQDMYNIGARHFMVFNMAPIGCYPAFLTELPHNSNDLDEFGCMKSYNSGVTYYNELLNNS  279

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L + R+ ++DA+++YVD H++ LELFQHPT+HGLKYGT+ACCGYGGG YNF ++++CG++
Sbjct  280   LAEVRKKLQDASILYVDKHTVTLELFQHPTAHGLKYGTRACCGYGGGTYNFNQDVYCGNS  339

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
              V+NG+T TA AC DP NYVSWDG H T+AAN     A+ SGSY  PPF L   C
Sbjct  340   KVVNGKTATAGACGDPQNYVSWDGIHATEAANYKIAYAVISGSYSYPPFDLSKLC  394



>gb|AFS60085.1| lanatoside 15-O-acetylesterase [Paphiopedilum concolor]
Length=412

 Score =   452 bits (1162),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 214/380 (56%), Positives = 272/380 (72%), Gaps = 19/380 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   PYG+T+F +  GRA+DGRV +DFLAQ LGL F
Sbjct  33    CRFKAIFNFGDSNSDTGGFWAAFPAQNGPYGITFFHRHSGRASDGRVFIDFLAQALGLPF  92

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFK-------  868
             LSPYL+SIGSDF+HGANFAT +STV+ P++S+F S +SPF L++QFNQ K F+       
Sbjct  93    LSPYLRSIGSDFQHGANFATAASTVLMPNTSVFVSGISPFYLSVQFNQMKDFRDRLLGVC  152

Query  867   ------------VMVDEQEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASL  724
                           + E+ + +          LPP +I G+A+YT  IGQNDF  DLA +
Sbjct  153   SIQNTALHLRSRTTLMERGRVEGRKIGRTEGNLPPPDIIGQAVYTLDIGQNDFTSDLAII  212

Query  723   GISGVNQSLPEVVAQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFG  544
             GI GV Q LP+V  QI +TI+++Y +GGRTF + NLAPIGC+P+FL +L H+ SDLD++G
Sbjct  213   GIEGVKQYLPQVAYQIGRTIEELYDIGGRTFLVFNLAPIGCFPAFLKELPHSNSDLDEYG  272

Query  543   CLKSYNNAVADYNNILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKAC  364
             C+ SYN AV DYNN+L   L++ R  + DA+V+YVDTHS+ LEL+QHP +HG  Y T+AC
Sbjct  273   CMVSYNKAVVDYNNLLNQTLQEIRDQLSDASVIYVDTHSVKLELYQHPKTHGFSYSTRAC  332

Query  363   CGYGGGDYNFKKELFCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFS  184
             CG+GGGDYNF   LFCG+T  +NG  VTA AC DP NYVSWDG H T+AANK+   AI +
Sbjct  333   CGHGGGDYNFDPGLFCGNTKEINGCFVTANACPDPENYVSWDGIHATEAANKLLTMAILN  392

Query  183   GSYFDPPFPLHHFCHIHPIG  124
             GSYF PPFPL   C + PIG
Sbjct  393   GSYFYPPFPLFELCELKPIG  412



>ref|XP_010522937.1| PREDICTED: GDSL esterase/lipase At4g01130 [Tarenaya hassleriana]
 ref|XP_010522938.1| PREDICTED: GDSL esterase/lipase At4g01130 [Tarenaya hassleriana]
Length=387

 Score =   447 bits (1149),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 203/358 (57%), Positives = 272/358 (76%), Gaps = 6/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C    IFNFGDSN+DTGGF+AAFP+   P+G T+FKKP GRA+DGR+++DFLAQ LG+ F
Sbjct  33    CEIEGIFNFGDSNSDTGGFWAAFPAQTGPWGSTFFKKPAGRASDGRLVIDFLAQALGMPF  92

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYL+SIGSD+RHGANFAT++STV+ P++SLF S +SPFSLAIQ NQ K F V      
Sbjct  93    ISPYLQSIGSDYRHGANFATLASTVLLPNTSLFVSGISPFSLAIQLNQMKDFHV------  146

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             +   H ++ G++ LPP +IFGK++Y FYIGQNDF  +LA++G+  V Q LP+V+AQI  T
Sbjct  147   KAHPHPHSSGSSILPPPDIFGKSIYMFYIGQNDFTSNLAAIGVEAVRQFLPQVIAQIAST  206

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             I +IY +GGRTF ++NLAP+GCYP+ L    HN SD+D +GCL S NNAV  YN++L+ A
Sbjct  207   ITEIYGIGGRTFMVMNLAPVGCYPAILTTFRHNHSDVDAYGCLISVNNAVDYYNSLLQQA  266

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L  +R  + ++ +VY+DT+ I+L+LF+HP S+G+++GT+ACCG+GGG YN+   LFCG T
Sbjct  267   LADSRARLANSTIVYLDTNKILLDLFRHPKSYGMQHGTRACCGHGGGPYNYDPRLFCGTT  326

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
              V++G+++TA AC DPYNYVS+DG H T+AAN+    AI  GS   PPF L H C IH
Sbjct  327   KVIDGRSMTASACTDPYNYVSYDGIHATEAANRHISAAIIDGSISHPPFALSHLCRIH  384



>ref|NP_001056878.1| Os06g0160200 [Oryza sativa Japonica Group]
 dbj|BAA81842.1| putative lanatoside 15'-O-acetylesterase [Oryza sativa Japonica 
Group]
 dbj|BAF18792.1| Os06g0160200 [Oryza sativa Japonica Group]
 dbj|BAG93458.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65136.1| hypothetical protein OsJ_20209 [Oryza sativa Japonica Group]
Length=379

 Score =   446 bits (1146),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 196/361 (54%), Positives = 268/361 (74%), Gaps = 8/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPA+FNFGDSN+DTGGF+AAFP+   P+GMTYF++P GRA+DGR++VDFL Q +GL  
Sbjct  27    CRFPAVFNFGDSNSDTGGFWAAFPAQQAPFGMTYFRRPAGRASDGRLVVDFLVQAMGLPL  86

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+S+GS +RHGANFAT++ST + P++SLF + +SPF LA+Q NQ K+ +  V    
Sbjct  87    LSPYLQSVGSGYRHGANFATLASTALQPNTSLFVTGISPFFLAVQLNQMKELRTKV----  142

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                  + N  N +LP  ++   ALYT  IGQND   +L S  I  V QSLP VV++I+ T
Sbjct  143   ----LTSNGNNDQLPAPDVLHNALYTIDIGQNDLTSNLGSQSIETVKQSLPSVVSKISST  198

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             ++++Y +G R   + N+APIGCYP+FL KL H ++D+D +GC+K+YN+AV  YN +L ++
Sbjct  199   VQELYNIGARNIMVFNMAPIGCYPAFLTKLPHTSNDMDGYGCMKTYNSAVTYYNELLNNS  258

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L + R+ ++DA++VY+D H++ LELF+HP +HGLKYGTKACCGYG G YNF  +++CG +
Sbjct  259   LAEVRKKLQDASIVYLDKHAVTLELFRHPKAHGLKYGTKACCGYGDGAYNFNPDVYCGSS  318

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              +LNGQTVTA+AC DP NYVSWDG H T+AANK+   ++ SGSY  PPF L   CH+ PI
Sbjct  319   KLLNGQTVTAKACADPQNYVSWDGIHATEAANKIIASSLMSGSYSYPPFDLSKLCHLQPI  378

Query  126   G  124
              
Sbjct  379   A  379



>gb|AAB61024.1| similar to the GDSL family of lipolytic enzymes [Arabidopsis 
thaliana]
Length=367

 Score =   442 bits (1138),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 210/355 (59%), Positives = 264/355 (74%), Gaps = 19/355 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA+DGR+I+DFLA+ LG+ F
Sbjct  30    CDFEAIFNFGDSNSDTGGFWAAFPAQSGPWGMTYFKKPAGRASDGRLIIDFLAKSLGMPF  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT++STV+ P++SLF S +SPFSLAIQ NQ KQFK+      
Sbjct  90    LSPYLQSIGSDFRHGANFATLASTVLLPNTSLFVSGISPFSLAIQLNQMKQFKI------  143

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                          LP K +FGK+LYTFYIGQNDF  +LAS+G+  V   LP+V+ QI  T
Sbjct  144   -------------LPSKIVFGKSLYTFYIGQNDFTSNLASIGVERVKLYLPQVIGQIAGT  190

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK+IY +GGRTF +LNLAP+GCYP+ L   +H  +DLD++GCL   N AV  YN +L   
Sbjct  191   IKEIYGIGGRTFLVLNLAPVGCYPAILTGYTHTDADLDKYGCLIPVNKAVKYYNTLLNKT  250

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L QTR ++K+A V+Y+DTH I+L+LFQHP S+G+K+G KACCGYGG  YNF ++LFCG+T
Sbjct  251   LSQTRTELKNATVIYLDTHKILLDLFQHPKSYGMKHGIKACCGYGGRPYNFNQKLFCGNT  310

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
              V+   + TA+AC DP+NYVSWDG H T+AAN     AI  GS   PPF L++ C
Sbjct  311   KVIGNFSTTAKACHDPHNYVSWDGIHATEAANHHISMAILDGSISYPPFILNNLC  365



>ref|NP_001141819.1| hypothetical protein precursor [Zea mays]
 gb|ACF87109.1| unknown [Zea mays]
 gb|AFW85731.1| hypothetical protein ZEAMMB73_539252 [Zea mays]
Length=383

 Score =   443 bits (1139),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 201/356 (56%), Positives = 264/356 (74%), Gaps = 9/356 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPA+FNFGDSN+DTGGF+AAFP+   P+GMTYF +P GRA+DGR+++DF+AQ +GL  
Sbjct  34    CRFPAVFNFGDSNSDTGGFWAAFPAQQGPFGMTYFGRPAGRASDGRLVIDFIAQAMGLPL  93

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGANFAT++ST + P++S+F +  SPFSL IQ NQ K+F+  V   +
Sbjct  94    LSPYLQSIGSDYRHGANFATLASTALLPNTSVFVTGTSPFSLGIQLNQMKEFRNRVLASK  153

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                       N +LP   I G ALYT  IGQNDF  +L SLG+  V +SLP VV+QI+ T
Sbjct  154   GN--------NGQLPGSEILGDALYTIDIGQNDFTSNLGSLGVESVKRSLPSVVSQISWT  205

Query  666   IKDIYL-LGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             I+D+Y  +G R+F + N+ P+GCYP+FLA L  ++ DLD+FGC+KSYN  V  YN +L D
Sbjct  206   IQDLYSSIGARSFMVFNMVPVGCYPAFLAGLPRDSKDLDEFGCVKSYNGGVTYYNQLLND  265

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             +L + R+ ++DA+VVYVD H++ LELFQHPT+HGLK+G +ACCGYGGG YNF ++++CGD
Sbjct  266   SLAEVRKTLQDASVVYVDKHAVTLELFQHPTAHGLKHGARACCGYGGGTYNFDRDVYCGD  325

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             + V+NG+  TA AC DP NYVSWDG H T+AAN     A+ SGSY  PPF L   C
Sbjct  326   SKVVNGEAATAGACADPQNYVSWDGIHATEAANSRIAYAVISGSYSYPPFDLSKLC  381



>gb|KHN15973.1| GDSL esterase/lipase [Glycine soja]
Length=363

 Score =   441 bits (1135),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 212/362 (59%), Positives = 263/362 (73%), Gaps = 11/362 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF  +FP+   PYGMTYFKKPVGRA+DGR+IVDFLAQGLGL +
Sbjct  12    CDFEAIFNFGDSNSDTGGFHTSFPAQPAPYGMTYFKKPVGRASDGRLIVDFLAQGLGLPY  71

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+ HGANFA+ +STV+PP +S   S +SPFSL++Q  Q +QFK  VDE  
Sbjct  72    LSPYLQSIGSDYTHGANFASSASTVIPPTTSFSVSGLSPFSLSVQLRQMEQFKAKVDEFH  131

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLG-ISGVNQSLPEVVAQITK  670
             Q    +     TK+P  +IFGKALYTFYIGQNDF   +A+ G I GV  SLP +V+QI  
Sbjct  132   QTG--TRISSGTKIPSPDIFGKALYTFYIGQNDFTSKIAATGSIDGVRGSLPHIVSQINA  189

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK++Y  GGR F + NL P+GCYP +L +L H T D D+FGC+ S+NNAV DYN +L+D
Sbjct  190   AIKELYAQGGRAFMVFNLGPVGCYPGYLVELPHATPDYDEFGCIVSHNNAVNDYNKLLRD  249

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              L QT + + DA+++Y DTHS +LELF HPT +GLKY T+ CCGYGGG YNF  ++ CG 
Sbjct  250   TLTQTGESLVDASLIYADTHSALLELFHHPTFYGLKYNTRTCCGYGGGVYNFNPKILCGH  309

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHP  130
                     + A AC++P NYVSWDG H T+AANK+   AI +GS F PPFPLH  C + P
Sbjct  310   --------MLASACDEPQNYVSWDGIHFTEAANKIVAHAILNGSLFYPPFPLHKHCDLQP  361

Query  129   IG  124
             IG
Sbjct  362   IG  363



>gb|KHN27264.1| GDSL esterase/lipase [Glycine soja]
Length=387

 Score =   442 bits (1137),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 211/362 (58%), Positives = 264/362 (73%), Gaps = 11/362 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF  +FP+   PYGMTYFKKPVGR++DGR+IVDFLAQGLGL +
Sbjct  36    CDFEAIFNFGDSNSDTGGFHTSFPAQPGPYGMTYFKKPVGRSSDGRLIVDFLAQGLGLPY  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+ HG NFA+ +STV+PP +S F S +SPFSL++Q  Q +QFK  VDE  
Sbjct  96    LSPYLQSIGSDYTHGVNFASSASTVIPPTTSFFVSGLSPFSLSVQLRQMEQFKAKVDEFH  155

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLG-ISGVNQSLPEVVAQITK  670
             Q    +     TK+P  +IFGKALYTFYIGQNDF   +A+ G I  V  +LP +V QI  
Sbjct  156   QPG--TRISSGTKIPSPDIFGKALYTFYIGQNDFTSKIAATGGIDAVRGTLPHIVLQINA  213

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK++Y  GGR F + NL P+GCYP +L +L H TSD D+FGC+ SYNNAV DYN +LK 
Sbjct  214   AIKELYAQGGRRFMVFNLGPVGCYPGYLVELPHATSDYDEFGCMASYNNAVNDYNKLLKY  273

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              L  TR+ + DA+++YVDT+S +LELF HPT +GLKY T+ CCGYGGG YNF  ++ CG 
Sbjct  274   TLSLTRESLVDASLIYVDTNSALLELFHHPTFYGLKYSTRTCCGYGGGVYNFNPKILCGH  333

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHP  130
                     + A AC++P++YVSWDG H T+AANK+   AI +GS FDPPFPLH  C + P
Sbjct  334   --------MLASACDEPHSYVSWDGIHFTEAANKIVAHAILNGSLFDPPFPLHEHCDLQP  385

Query  129   IG  124
             IG
Sbjct  386   IG  387



>gb|EEC80060.1| hypothetical protein OsI_21767 [Oryza sativa Indica Group]
Length=382

 Score =   436 bits (1122),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 194/361 (54%), Positives = 265/361 (73%), Gaps = 8/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPA+FNFGDSN+DTGGF+AAFP+   P+GMTYF +P GRA+DGR++VDF+ Q +GL  
Sbjct  30    CRFPAVFNFGDSNSDTGGFWAAFPAQQAPFGMTYFCRPAGRASDGRLVVDFIVQAMGLPL  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+S+GS FRHGANFAT++ST + P++SLF + +SPF LA+Q NQ K  +  V    
Sbjct  90    LSPYLQSVGSGFRHGANFATLASTALQPNTSLFVTGISPFFLAVQLNQMKDLRNKV----  145

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                  + N  N +LP  ++   ALYT  IGQND   +L S  I  V QSLP VV++I+  
Sbjct  146   ----LTSNGNNGQLPAPDVLHNALYTIDIGQNDLTSNLGSQSIETVKQSLPSVVSKISSA  201

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             ++++Y +G R   + N+APIGCYP+FL KL H ++D+D +GC+K+YN+AV  YN +L ++
Sbjct  202   VQELYNIGARNIMVFNMAPIGCYPAFLTKLPHTSNDMDGYGCMKTYNSAVTYYNELLNNS  261

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L + ++ ++DA++VY+D H++ LELF+HP +HGLKYGTKACCGYG G YNF  +++CG +
Sbjct  262   LAKVQKKLQDASIVYLDKHAVTLELFRHPKAHGLKYGTKACCGYGDGAYNFNPDVYCGSS  321

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              +LNGQTVTA+AC DP NYVSWDG H T+AANK+   ++ SGSY  PPF L   CH+ PI
Sbjct  322   KLLNGQTVTAKACADPQNYVSWDGIHATEAANKIIAASLMSGSYSYPPFDLSKLCHLQPI  381

Query  126   G  124
              
Sbjct  382   A  382



>ref|XP_006656665.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Oryza brachyantha]
Length=381

 Score =   434 bits (1117),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 191/361 (53%), Positives = 259/361 (72%), Gaps = 8/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F A+FNFGDSN+DTGGF+AAFP+   P+GMTYF++P GRA+DGR+++DFL Q +GL  
Sbjct  29    CKFRAVFNFGDSNSDTGGFWAAFPAQQAPFGMTYFRRPAGRASDGRLVIDFLVQAMGLPL  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+S+GSD+R GANFAT++ST + P++SLF +  SPF L +Q NQ K+ +       
Sbjct  89    LSPYLQSVGSDYRRGANFATLASTALQPNTSLFVTGTSPFFLGVQLNQMKELRTKALRS-  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                    N  N +LP  ++   +LYT  IGQND   +L S  I  V QSLP VV+QIT T
Sbjct  148   -------NGNNAQLPAPDVLSNSLYTIDIGQNDLTSNLGSQSIETVKQSLPSVVSQITST  200

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             ++++Y +G R   + N+APIGCYP+FL KL H ++D+D FGC+K+YN+AV  YN +L  +
Sbjct  201   VQELYSIGARNIMVFNMAPIGCYPAFLTKLPHTSNDMDGFGCMKTYNSAVTYYNELLNTS  260

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             L + R+ ++DA++VY + H++ LELF+HP +HGLKYGTKACCGYG G YNF  +++CG +
Sbjct  261   LAEVRKKLQDASIVYANKHAVTLELFRHPKAHGLKYGTKACCGYGDGAYNFNPDVYCGSS  320

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPI  127
              VLNGQT +A+AC DP NYVSWDG H T+AANK+   ++ SGSY  PPF L   C + PI
Sbjct  321   KVLNGQTTSAKACADPQNYVSWDGIHGTEAANKIIASSLMSGSYSYPPFDLSKLCKLQPI  380

Query  126   G  124
              
Sbjct  381   A  381



>ref|XP_007135191.1| hypothetical protein PHAVU_010G108700g [Phaseolus vulgaris]
 gb|ESW07185.1| hypothetical protein PHAVU_010G108700g [Phaseolus vulgaris]
Length=412

 Score =   432 bits (1112),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 211/366 (58%), Positives = 261/366 (71%), Gaps = 13/366 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF  AFP+   PYGMTYFKKPVGRA+DGR+I+DFLA+GLGLA 
Sbjct  55    CEFEAIFNFGDSNSDTGGFHTAFPAQPGPYGMTYFKKPVGRASDGRLILDFLAEGLGLAH  114

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+ HGANFA+ +STV+PP +S F S +SPFSL+IQ +Q KQFK  VDE  
Sbjct  115   LSPYLESIGSDYSHGANFASSASTVIPPIASFFLSGLSPFSLSIQLSQIKQFKARVDELH  174

Query  846   QEQ--HHSYNHGNTKLPPK-NIFGKALYTFYIGQNDFIFDLASLG-ISGVNQSLPEVVAQ  679
             Q      S     TK+P   +IF KA+Y FYIGQND    +A+ G I GV  S P++V+Q
Sbjct  175   QTGTISSSGRSSGTKIPSSPDIFKKAIYMFYIGQNDLTSKIAATGSIDGVRDSFPQIVSQ  234

Query  678   ITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTS-DLDQFGCLKSYNNAVADYNN  502
             I   IK++Y LG RTF + NL P+GCYP +L +L H +S D D+FGC+ SY N V  YN 
Sbjct  235   INDAIKELYALGARTFMVFNLGPVGCYPGYLVELPHASSFDFDEFGCMISYQNVVNYYNK  294

Query  501   ILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKEL  322
             +LK  L QTR+ + D ++++VDTHS +LELF HPT +G KY TK CCGYGGGD+NF  ++
Sbjct  295   LLKWTLSQTRERLADVSLIHVDTHSALLELFHHPTLYGFKYATKTCCGYGGGDHNFHPKI  354

Query  321   FCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
              CG+        V A AC +P  YVSWDG H T+AANK+   AI +GS FDPPFPLH  C
Sbjct  355   LCGN--------VLASACAEPQEYVSWDGIHFTEAANKIVAHAILNGSLFDPPFPLHERC  406

Query  141   HIHPIG  124
              + PIG
Sbjct  407   DLQPIG  412



>gb|AFK36392.1| unknown [Lotus japonicus]
Length=389

 Score =   431 bits (1109),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 210/365 (58%), Positives = 270/365 (74%), Gaps = 14/365 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN DTGG+ AAFP+   P+GMTYFKKPVGRA+DGR+IVDFLA+ LGL +
Sbjct  33    CEFDAIFNFGDSNVDTGGYNAAFPAQASPFGMTYFKKPVGRASDGRLIVDFLAEALGLPY  92

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+RHGA+FA+ +STV+ P +S   S +SPF L IQ  Q +QFK  V E  
Sbjct  93    LSPYLQSIGSDYRHGASFASSASTVLKPTTSFHLSGLSPFFLNIQLKQLEQFKARVGEFY  152

Query  846   QEQHHSY----NHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLG-ISGVNQSLPEVVA  682
             QE+        + GN  LPP ++F K++YTFYIGQNDFI  LAS G I GV   +P++V+
Sbjct  153   QEKGRKLFDDCSIGNI-LPPPDVFKKSIYTFYIGQNDFISKLASNGSIDGVRDYIPQIVS  211

Query  681   QITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNN  502
             QI   IKD+Y  GGRT  + NLAP+GC+P++L +L H + D+D+FGC+ SYN AV DYN 
Sbjct  212   QIDAAIKDVYAQGGRTCLVFNLAPVGCFPAYLVELPHGSLDVDEFGCVLSYNKAVDDYNK  271

Query  501   ILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKEL  322
             +LK+ L +T + +K A+++YVDTHS++L+LF +P+SHGLK+G++ACCG+GGGDYNF  ++
Sbjct  272   LLKETLAKTGKTLKGASLIYVDTHSVLLKLFHNPSSHGLKFGSRACCGHGGGDYNFDPKI  331

Query  321   FCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
              CG +         A A EDP NYVSWDGFHLT+AANK    AI +GS FDPPFPLH  C
Sbjct  332   LCGHS--------AATAREDPQNYVSWDGFHLTEAANKHVTLAILNGSLFDPPFPLHQLC  383

Query  141   HIHPI  127
              + PI
Sbjct  384   DLKPI  388



>ref|XP_003637203.1| GDSL esterase/lipase [Medicago truncatula]
 gb|KEH18737.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=388

 Score =   429 bits (1103),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 205/364 (56%), Positives = 266/364 (73%), Gaps = 12/364 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F  IFNFGDSN+DTGGF++AFP+   PYGMTYFK PVGR++DGR+IVDFLA+ LGL +
Sbjct  32    CDFQGIFNFGDSNSDTGGFYSAFPAQPIPYGMTYFKTPVGRSSDGRLIVDFLAEALGLPY  91

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDE--  853
             LSPYL+SIGSD+ HGANFAT +STV+ P +SLF S +SPF+L IQ  Q +QF+  V +  
Sbjct  92    LSPYLQSIGSDYTHGANFATSASTVLLPTTSLFVSGLSPFALQIQLRQMQQFRAKVHDFH  151

Query  852   QEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQI  676
             +      S      K+P  +IFGK++Y FYIGQNDF   +A S GI+G+   LP+++ QI
Sbjct  152   KRDPLKPSTCASKIKIPSPDIFGKSIYMFYIGQNDFTSKIAASGGINGLKNYLPQIIYQI  211

Query  675   TKTIKDIYLL-GGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNI  499
                IK++Y   GGRTF +LNL P+GCYP +L +L H +SDLD+ GC+ +YNNAV DYN +
Sbjct  212   ASAIKELYYAQGGRTFMVLNLGPVGCYPGYLVELPHTSSDLDEHGCIITYNNAVDDYNKL  271

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             LK+ L QTR+ + DA+++YVDT+S ++ELF+HPTS+GLK+ TKACCG+GGGDYNF  +  
Sbjct  272   LKETLTQTRKSLSDASLIYVDTNSALMELFRHPTSYGLKHSTKACCGHGGGDYNFDPKAL  331

Query  318   CGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             CG+        + A ACEDP NYVSWDG H T+AANK+   AI +GS  DPPF LH  C 
Sbjct  332   CGN--------MLASACEDPQNYVSWDGIHFTEAANKIIAMAILNGSLSDPPFLLHKLCD  383

Query  138   IHPI  127
             + PI
Sbjct  384   LQPI  387



>gb|ACU23212.1| unknown [Glycine max]
Length=405

 Score =   423 bits (1087),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 202/346 (58%), Positives = 252/346 (73%), Gaps = 11/346 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF  +FP+   PYGMTYFKKPVGRA+DGR+IVDFLAQGLGL +
Sbjct  37    CDFEAIFNFGDSNSDTGGFHTSFPAQPAPYGMTYFKKPVGRASDGRLIVDFLAQGLGLPY  96

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD+ HGANFA+ +STV+PP +S   S +SPFSL++Q  Q +QFK  VDE  
Sbjct  97    LSPYLQSIGSDYTHGANFASSASTVIPPTTSFSVSGLSPFSLSVQLRQMEQFKAKVDEFH  156

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLG-ISGVNQSLPEVVAQITK  670
             Q    +     TK+P  +IFGKALYTFYIGQNDF   +A+ G I GV  SLP +V+QI  
Sbjct  157   QTG--TRISSGTKIPSPDIFGKALYTFYIGQNDFTSKIAATGSIDGVRGSLPHIVSQINA  214

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK++Y  GGR F + NL P+GCYP +L +L H TSD D+FGC+ S+NNAV DYN +L+D
Sbjct  215   AIKELYAQGGRAFMVFNLGPVGCYPGYLVELPHATSDYDEFGCIVSHNNAVNDYNKLLRD  274

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              L QT + + DA+++Y DTHS +LELF HPT +GLKY T+ CCGYGGG YNF  ++ CG 
Sbjct  275   TLTQTGESLVDASLIYADTHSALLELFHHPTFYGLKYNTRTCCGYGGGVYNFNPKILCGH  334

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYF  172
                     +   AC++P NYVSWDG H T+AANK+   AI +GS F
Sbjct  335   --------MLTSACDEPQNYVSWDGIHFTEAANKIVAHAILNGSLF  372



>ref|XP_008376070.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At4g01130-like 
[Malus domestica]
Length=480

 Score =   423 bits (1088),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 216/369 (59%), Positives = 269/369 (73%), Gaps = 22/369 (6%)
 Frame = -1

Query  1203  SFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFL--------A  1048
              F AIFNF +SN+DTG F+AAF +   PYGMTYFK+PVGRATDGR+IVDFL        A
Sbjct  125   EFEAIFNFENSNSDTGRFWAAFLAQPGPYGMTYFKRPVGRATDGRLIVDFLGNSHNLQFA  184

Query  1047  QGLGLAFLSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFK  868
             Q LGL F+SPYLKSIGSD++H AN+AT++S V+ P++SLF + +SPFSLAI    FK   
Sbjct  185   QALGLPFISPYLKSIGSDYKHWANYATLASIVLLPNTSLFVTGISPFSLAIXMKVFKT--  242

Query  867   VMVDEQEQEQHHSYNHGNTK-LPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPE  691
                  Q +E HHS +    K LP  +IFGK++YTF    NDF   LA++ + GV Q LP 
Sbjct  243   -----QVEEFHHSSDQQELKRLPSLDIFGKSVYTF---XNDFTSXLAAISVGGVKQYLP-  293

Query  690   VVAQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVAD  511
             +V+QI  TIK++Y LGGR F +LNLA +GCYPSFLA L    S+LD FGC  +YN AV D
Sbjct  294   LVSQIAGTIKELYTLGGRAFLVLNLAXVGCYPSFLAGLP--PSELDAFGCSIAYNKAVVD  351

Query  510   YNNILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFK  331
             YNN+LK AL QTR  + +A++VYVDT S++LELF HPTSHGLKYGTK+CCG+GGG YNF 
Sbjct  352   YNNLLKGALSQTRGSLPNASLVYVDTSSVLLELFXHPTSHGLKYGTKSCCGHGGGTYNFD  411

Query  330   KELFCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLH  151
              ++FCG+T V+NG+ VTA AC DPYNYVSWDG H T+AANK+T  AI + ++ DPPFP  
Sbjct  412   PQVFCGNTKVINGKPVTATACSDPYNYVSWDGVHATEAANKLTTLAILNDTFSDPPFPXE  471

Query  150   HFCHIHPIG  124
              FC +H I 
Sbjct  472   QFCDLHGIA  480



>ref|XP_006843362.1| hypothetical protein AMTR_s00053p00063310 [Amborella trichopoda]
 gb|ERN05037.1| hypothetical protein AMTR_s00053p00063310 [Amborella trichopoda]
Length=320

 Score =   372 bits (956),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 229/308 (74%), Gaps = 5/308 (2%)
 Frame = -1

Query  1047  QGLGLAFLSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFK  868
             Q LGL FLSPYL+S+GS+FRHGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ K FK
Sbjct  18    QALGLPFLSPYLQSLGSNFRHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKDFK  77

Query  867   VMVDEQEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEV  688
               V E    Q H  +H    LP  ++FGK+LYTF IGQNDF  +LA++GISGV Q LP+V
Sbjct  78    ARVIEL---QSHGMDHKTLPLP--DVFGKSLYTFDIGQNDFTSNLAAIGISGVQQYLPKV  132

Query  687   VAQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADY  508
              +QI  TIK++Y    RTF + NLAPIGC+P+FL +L HN +DLD  GC+ SYNNAVA Y
Sbjct  133   ASQIVATIKELYDDRARTFLVSNLAPIGCFPAFLTELPHNATDLDGSGCMISYNNAVAAY  192

Query  507   NNILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKK  328
             N +L  +L   R+ + +A ++YVDTH++ LELFQHP +HG K+GTKACCG GGG +NF  
Sbjct  193   NFMLNQSLDNVRKLLPNATLIYVDTHAVKLELFQHPAAHGFKHGTKACCGTGGGAHNFNP  252

Query  327   ELFCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHH  148
             ++FCG++ V+NG T+TA AC +P +YVSWDG HLT+AAN   V AI  GSYF P FPL  
Sbjct  253   QVFCGNSKVINGSTLTASACPNPQDYVSWDGIHLTEAANMALVHAILGGSYFYPSFPLGK  312

Query  147   FCHIHPIG  124
              CH+H IG
Sbjct  313   LCHLHTIG  320



>ref|XP_010251553.1| PREDICTED: GDSL esterase/lipase At4g01130 isoform X2 [Nelumbo 
nucifera]
Length=329

 Score =   373 bits (957),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/282 (63%), Positives = 224/282 (79%), Gaps = 11/282 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA DGR+IVDFLAQ LGL F
Sbjct  37    CDFKAIFNFGDSNSDTGGFWAAFPAESGPFGMTYFKKPSGRAADGRLIVDFLAQALGLPF  96

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +SPYL+SIGSDFRHGANFAT++STV+ P++SLF + +SPFSLAIQ NQ K FK  VDE+ 
Sbjct  97    ISPYLQSIGSDFRHGANFATLASTVLLPNTSLFVTGISPFSLAIQLNQIKAFKARVDEKA  156

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                          LP  +IFGK+LYT YIGQNDF  +L S+GI+GV + LP+VVAQI  T
Sbjct  157   P----------GPLPSPDIFGKSLYTLYIGQNDFTSNLKSIGIAGVKEYLPQVVAQIAAT  206

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             ++++Y LGGRTF +LN+AP+GCYP+FL +L HN+SDLD +GC+ SYNNAV DYNN+LK+A
Sbjct  207   VQELYGLGGRTFLVLNIAPVGCYPAFLVQLPHNSSDLDMYGCMVSYNNAVMDYNNMLKNA  266

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACC  361
             L QTR+ + DA+V+YVD +SI+LELF+HP SHG+ +G    C
Sbjct  267   LTQTRRALPDASVIYVDIYSIMLELFRHPKSHGV-FGEFGAC  307



>ref|XP_004510740.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Cicer arietinum]
Length=384

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/370 (49%), Positives = 236/370 (64%), Gaps = 25/370 (7%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C    IFNFGDSN++T  F + FP+ +  Y MTY KK V R++DGR+IV FLAQGLG  F
Sbjct  29    CDLKGIFNFGDSNSNTDRFDSTFPTQLSSYRMTYLKKYVRRSSDGRLIVIFLAQGLGFPF  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQ-FNQFKQFKVMVDEQ  850
             LSPYLKSIGSD+ HGANFAT +STV+ P +S F S ++PF+L IQ   Q KQFK  VD  
Sbjct  89    LSPYLKSIGSDYTHGANFATSASTVLLPTTSFFVSGLTPFALTIQLLRQMKQFKAKVDNF  148

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASL-GISGVNQSLPEVVAQIT  673
              +    S       +P  +IFGK++Y FYIGQNDF   +A+  GI+GV  ++PE+V QI 
Sbjct  149   HKMISCSGCASRIYVPSPDIFGKSIYLFYIGQNDFTSKIAATGGINGVKNNIPEIVLQIA  208

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               I ++Y  GGRTF +LNL PIGCYP FL +L H TS++D++GC+ S       YN +LK
Sbjct  209   SAIMELYAQGGRTFMVLNLGPIGCYPGFLVELPHATSEIDEYGCMIS-------YNKLLK  261

Query  492   DALRQTRQDIKDANVV--------YVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYN  337
             + L Q+R+ + D ++         YV     I  +       GLKY T+ACCG+GGGDYN
Sbjct  262   ETLSQSRESLTDVSLFMWIPTLLYYVLQVKCIFLVSICFLGAGLKYSTRACCGHGGGDYN  321

Query  336   FKKELFCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFP  157
             F  +  CG+        + A ACEDP+NYVSWDG H T+A NK+  +AI + S  DPPFP
Sbjct  322   FNPKALCGN--------MLASACEDPHNYVSWDGIHFTEAVNKLVAKAILNVSLSDPPFP  373

Query  156   LHHFCHIHPI  127
             LH  C I PI
Sbjct  374   LHKLCDIQPI  383



>gb|EPS57895.1| hypothetical protein M569_16921, partial [Genlisea aurea]
Length=296

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/274 (59%), Positives = 202/274 (74%), Gaps = 8/274 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F A+F FGDSN+D GGF+AAFPS   PYGMTYF KP GR TDGR+ VDFLAQGLGL F
Sbjct  30    CAFEAVFIFGDSNSDAGGFYAAFPSQPTPYGMTYFNKPTGRPTDGRLFVDFLAQGLGLPF  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDE-Q  850
              SPYL+SIGSDFRHGANFAT +STV+ P +SL+ S VSPF LAIQ NQ KQFK  V+E Q
Sbjct  90    ASPYLQSIGSDFRHGANFATSASTVLQPTTSLYVSGVSPFYLAIQINQMKQFKAKVEEFQ  149

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITK  670
              Q Q        T LP  +IFGK+LY  YIGQNDF    AS+G  GVN   P++++Q   
Sbjct  150   SQGQ-------TTNLPKADIFGKSLYVVYIGQNDFTGYAASVGPGGVNAIFPQMLSQTVA  202

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +K++Y LGGR+  +LN+ P+GCYP+FL +  H +SD+D  GC++SYNNA  DYN  L  
Sbjct  203   AVKELYWLGGRSILVLNIGPVGCYPAFLVQYPHESSDVDSAGCIRSYNNAADDYNRQLNA  262

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHG  388
             AL +TR ++ DAN++YVDTHS++ EL+Q+P +HG
Sbjct  263   ALEKTRGELNDANIIYVDTHSVLKELYQNPNAHG  296



>ref|XP_006577336.1| PREDICTED: GDSL esterase/lipase At4g01130-like isoform X2 [Glycine 
max]
Length=278

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 186/229 (81%), Gaps = 8/229 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F AIFNFGDSN+DTGGF+AAFP    PYGMTYFKKP GRA+DGR+I+DFLAQ LGL F
Sbjct  28    CNFKAIFNFGDSNSDTGGFYAAFPGESGPYGMTYFKKPAGRASDGRLIIDFLAQALGLPF  87

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSD++HGAN+AT++STV+ P++SLF + +SPFSLAIQ NQ KQFK  V+E+ 
Sbjct  88    LSPYLQSIGSDYKHGANYATMASTVLMPNTSLFVTGISPFSLAIQLNQMKQFKTKVEEKV  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             ++          KLP  +IFG +LYTFYIGQNDF F+LA +G+ GV + LP+VV+QI  T
Sbjct  148   EQ--------GIKLPSSDIFGNSLYTFYIGQNDFTFNLAVIGVGGVQEYLPQVVSQIVAT  199

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNA  520
             IK++Y LGGRTF +LNLAP+GCYP+FL +  H++S++D FGCL SYNNA
Sbjct  200   IKELYNLGGRTFMVLNLAPVGCYPAFLVEFPHDSSNIDDFGCLISYNNA  248



>dbj|BAF01373.1| putative acetyltransferase [Arabidopsis thaliana]
Length=248

 Score =   310 bits (793),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/242 (63%), Positives = 186/242 (77%), Gaps = 6/242 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGGF+AAFP+   P+GMTYFKKP GRA+DGR+I+DFLA+ LG+ F
Sbjct  11    CDFEAIFNFGDSNSDTGGFWAAFPAQSGPWGMTYFKKPAGRASDGRLIIDFLAKSLGMPF  70

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL+SIGSDFRHGANFAT++STV+ P++SLF S +SPFSLAIQ NQ KQFKV VDE  
Sbjct  71    LSPYLQSIGSDFRHGANFATLASTVLLPNTSLFVSGISPFSLAIQLNQMKQFKVNVDES-  129

Query  846   QEQHHSYNHGNTK-LPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITK  670
                 HS +    K LP K +FGK+LYTFYIGQNDF  +LAS+G+  V   LP+V+ QI  
Sbjct  130   ----HSLDRPGLKILPSKIVFGKSLYTFYIGQNDFTSNLASIGVERVKLYLPQVIGQIAG  185

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             TIK+IY +GGRTF +LNLAP+GCYP+ L   +H  +DLD++GCL   N AV  YN +L  
Sbjct  186   TIKEIYGIGGRTFLVLNLAPVGCYPAILTGYTHTDADLDKYGCLIPVNKAVKYYNTLLNK  245

Query  489   AL  484
              L
Sbjct  246   TL  247



>ref|XP_007141041.1| hypothetical protein PHAVU_008G162300g [Phaseolus vulgaris]
 gb|ESW13035.1| hypothetical protein PHAVU_008G162300g [Phaseolus vulgaris]
Length=391

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 159/357 (45%), Positives = 225/357 (63%), Gaps = 9/357 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAIFNFGDSN+DTGG  A+  +  PPYG TYF +P GR +DGR+I+DF+AQ LGL +
Sbjct  36    CAFPAIFNFGDSNSDTGGLAASIIAPKPPYGDTYFHRPAGRFSDGRLIIDFIAQSLGLPY  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +S YL S+G++F HGANFAT +ST+ PP S L +   SPF L +Q+ QF++FK     + 
Sbjct  96    ISAYLDSLGTNFSHGANFATSASTIRPPPSVLPEGGFSPFYLDVQYTQFREFK----PRT  151

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q   H      + +P K+ F KALYTF IGQND       +L +  VN ++P++V   ++
Sbjct  152   QFIRHQGGIFASLMPQKDYFRKALYTFDIGQNDLGAGFFGNLSVQQVNATVPDIVNAFSE  211

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +KDIY LG R+F+I N+ PIGC P  LA  S  +++ D +GC K YN     +N  LK+
Sbjct  212   NVKDIYDLGARSFWIHNIGPIGCLPYILA--SFLSAERDAYGCAKPYNEVAQYFNQKLKE  269

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+++  A + YVD +S+   LF HP  +G +    ACCG+ GG YN+   + CG+
Sbjct  270   AVVQLRRNLPQAAITYVDIYSVKYSLFSHPKKYGFELPLVACCGH-GGKYNY-SSVGCGE  327

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             +  +NG  +   +CE     V+WDG H T+AA K     I SG++ +PP PL+  CH
Sbjct  328   SIEVNGTEIFVGSCERQSVRVNWDGIHFTEAAAKFIFDQISSGAFSEPPLPLNMACH  384



>ref|XP_003589576.1| Early nodulin [Medicago truncatula]
 gb|AES59827.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=392

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 160/357 (45%), Positives = 219/357 (61%), Gaps = 8/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F AIFNFGDSN+DTGG  A+F +  PPYG TYF +P GR +DGR+IVDF+AQ  GL +
Sbjct  36    CNFRAIFNFGDSNSDTGGLAASFVAPKPPYGETYFHRPNGRFSDGRLIVDFIAQSFGLPY  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++F HGANFAT SST+ PP S +     SPF L +Q+ QF+ FK       
Sbjct  96    LSAYLDSLGTNFSHGANFATTSSTIRPPPSIIPQGGFSPFYLDVQYTQFRDFKPRTQFIR  155

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q+         + +P +  F KALYTF IGQND       ++ I  VN S+PE++   +K
Sbjct  156   QQG----GLFASLMPKEEYFSKALYTFDIGQNDLGAGFFGNMTIQQVNASVPEIINSFSK  211

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +KDIY LGGR+F+I N  PIGC P  L       ++ D+ GC K YN     +N  LK+
Sbjct  212   NVKDIYNLGGRSFWIHNTGPIGCLPYILVNFP--LAEKDENGCAKQYNEVAQYFNLKLKE  269

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ + R D+  A + YVD +S+   L+ +P  +G ++   ACCGY GG+YN+   + CG 
Sbjct  270   AVVKLRDDLPLAAITYVDIYSVKYSLYNNPKKYGFEHPLIACCGY-GGEYNYSSSVGCGG  328

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T  +NG  +   +CE P   V+WDG H T+AA+K+    I SG++ DPP  L+  CH
Sbjct  329   TIKVNGTQIFVGSCERPSARVNWDGVHYTEAASKIIFHEISSGAFSDPPISLNMACH  385



>ref|XP_007141040.1| hypothetical protein PHAVU_008G162300g [Phaseolus vulgaris]
 gb|ESW13034.1| hypothetical protein PHAVU_008G162300g [Phaseolus vulgaris]
Length=392

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 158/357 (44%), Positives = 226/357 (63%), Gaps = 8/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAIFNFGDSN+DTGG  A+  +  PPYG TYF +P GR +DGR+I+DF+AQ LGL +
Sbjct  36    CAFPAIFNFGDSNSDTGGLAASIIAPKPPYGDTYFHRPAGRFSDGRLIIDFIAQSLGLPY  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +S YL S+G++F HGANFAT +ST+ PP S L +   SPF L +Q+ QF++FK      +
Sbjct  96    ISAYLDSLGTNFSHGANFATSASTIRPPPSVLPEGGFSPFYLDVQYTQFREFK---PRTQ  152

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
               +H +     + +P K+ F KALYTF IGQND       +L +  VN ++P++V   ++
Sbjct  153   FIRHQAGGIFASLMPQKDYFRKALYTFDIGQNDLGAGFFGNLSVQQVNATVPDIVNAFSE  212

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +KDIY LG R+F+I N+ PIGC P  LA  S  +++ D +GC K YN     +N  LK+
Sbjct  213   NVKDIYDLGARSFWIHNIGPIGCLPYILA--SFLSAERDAYGCAKPYNEVAQYFNQKLKE  270

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+++  A + YVD +S+   LF HP  +G +    ACCG+ GG YN+   + CG+
Sbjct  271   AVVQLRRNLPQAAITYVDIYSVKYSLFSHPKKYGFELPLVACCGH-GGKYNY-SSVGCGE  328

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             +  +NG  +   +CE     V+WDG H T+AA K     I SG++ +PP PL+  CH
Sbjct  329   SIEVNGTEIFVGSCERQSVRVNWDGIHFTEAAAKFIFDQISSGAFSEPPLPLNMACH  385



>ref|XP_004966736.1| PREDICTED: GDSL esterase/lipase At4g01130-like [Setaria italica]
Length=255

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 187/260 (72%), Gaps = 10/260 (4%)
 Frame = -1

Query  933  LFDSRVSPFSLAIQFNQFKQFKVMVDEQEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQ  754
            L D R  PFSLAIQ NQ K+ +      ++E       G  +LPP +IFG ALYT  IGQ
Sbjct  3    LVDKR--PFSLAIQLNQMKELR------DRESVVECFVG--QLPPLDIFGHALYTIDIGQ  52

Query  753  NDFIFDLASLGISGVNQSLPEVVAQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLS  574
            NDF  +L SLG+  V QSLP VV QI+ TI+D+Y +G R F + N+APIGCYP+FL +L 
Sbjct  53   NDFTSNLGSLGVETVKQSLPSVVNQISWTIQDLYNIGARNFMVFNMAPIGCYPAFLTELP  112

Query  573  HNTSDLDQFGCLKSYNNAVADYNNILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTS  394
            H+++DLD+FGC+ +YN+ V  YN +L +++ + R+ + DA++VYVD H++ LELF+HP +
Sbjct  113  HSSNDLDEFGCMTTYNSGVVYYNELLNNSMAEVRKKLHDASIVYVDKHTVTLELFRHPDA  172

Query  393  HGLKYGTKACCGYGGGDYNFKKELFCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAA  214
            HGL+YGTKACCGYGGG YNF + ++CG++  +NGQTVTA AC DP NYVSWDG H T+AA
Sbjct  173  HGLEYGTKACCGYGGGAYNFNQNVYCGNSKTVNGQTVTATACGDPQNYVSWDGIHATEAA  232

Query  213  NKVTVQAIFSGSYFDPPFPL  154
            NK+   A+ SGSY  PP  L
Sbjct  233  NKIIASAVISGSYSYPPSKL  252



>gb|KDO82203.1| hypothetical protein CISIN_1g016007mg [Citrus sinensis]
Length=397

 Score =   306 bits (783),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 162/367 (44%), Positives = 214/367 (58%), Gaps = 15/367 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A F    PP+GM++F  P GR  DGR+IVDF+A+  GL +
Sbjct  32    CKFPAIFNFGDSNSDTGGLSAVFGQAGPPHGMSFFGGPAGRYCDGRLIVDFIAEAFGLPY  91

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +S YL SIGSDF HGANFAT  STV P +++L +S  SP SL +Q+N+F  F       +
Sbjct  92    VSAYLDSIGSDFSHGANFATAGSTVRPQNTTLRESGFSPISLDVQWNEFYDFH---RRSQ  148

Query  846   QEQHHS---------YNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSL  697
               ++HS          +    +LP    F  ALYTF IGQND      A++    V   +
Sbjct  149   IVRNHSGAYQKLLPDLDAALKRLPKAEDFPNALYTFDIGQNDLTAGYFANMTTDQVKAYV  208

Query  696   PEVVAQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAV  517
             PEVV Q+   I+ IY LGGR F+I N  P+GC P  L ++    S +D+ GC   +N+  
Sbjct  209   PEVVTQLQNVIRYIYGLGGRYFWIHNTGPVGCLPYVLERIPVLASQVDEAGCATPFNDVA  268

Query  516   ADYNNILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYN  337
               +N+ LK A+ Q R+D+  A + YVD +S+   LF  P  HG K   + CCG  GG YN
Sbjct  269   KYFNSQLKQAVVQLRKDLPSAALTYVDVYSVKYALFHQPQKHGFKQSIRNCCGR-GGRYN  327

Query  336   FKKELFCGDTNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPF  160
             +   + CG T + +G Q +  + C+DP  YV WDG H T AANK   Q    G+Y DPP 
Sbjct  328   YNINVGCGQTKMEHGKQVLLGKPCDDPSGYVVWDGVHFTQAANKFIFQQTAGGAYSDPPI  387

Query  159   PLHHFCH  139
             PL+  CH
Sbjct  388   PLNMACH  394



>ref|XP_006438238.1| hypothetical protein CICLE_v10031741mg [Citrus clementina]
 ref|XP_006483960.1| PREDICTED: alpha-L-fucosidase 3-like [Citrus sinensis]
 gb|ESR51478.1| hypothetical protein CICLE_v10031741mg [Citrus clementina]
Length=397

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 161/367 (44%), Positives = 214/367 (58%), Gaps = 15/367 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A F    PP+GM++F  P GR  DGR+IVDF+A+  GL +
Sbjct  32    CKFPAIFNFGDSNSDTGGLSAVFGQAGPPHGMSFFGGPAGRYCDGRLIVDFIAEAFGLPY  91

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +S YL SIGSDF HGANFAT  STV P +++L +S  SP SL +Q+N+F  F       +
Sbjct  92    VSAYLDSIGSDFSHGANFATAGSTVRPQNTTLRESGFSPISLDVQWNEFYDFH---RRSQ  148

Query  846   QEQHHS---------YNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSL  697
               ++HS          +    +LP    F  ALYTF +GQND      A++    V   +
Sbjct  149   IVRNHSGAYQKLLPDLDAALKRLPKAEDFPNALYTFDVGQNDLTAGYFANMTTDQVKAYV  208

Query  696   PEVVAQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAV  517
             PEVV Q+   I+ IY LGGR F+I N  P+GC P  L ++    S +D+ GC   +N+  
Sbjct  209   PEVVTQLQNVIRYIYGLGGRYFWIHNTGPVGCLPYVLERIPVLASQVDEAGCATPFNDVA  268

Query  516   ADYNNILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYN  337
               +N+ LK A+ Q R+D+  A + YVD +S+   LF  P  HG K   + CCG  GG YN
Sbjct  269   KYFNSQLKQAVVQLRKDLPSAALTYVDVYSVKYALFHQPQKHGFKQSIRNCCGR-GGRYN  327

Query  336   FKKELFCGDTNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPF  160
             +   + CG T + +G Q +  + C+DP  YV WDG H T AANK   Q    G+Y DPP 
Sbjct  328   YNINVGCGQTKMEHGKQVLLGKPCDDPSGYVVWDGVHFTQAANKFIFQQTAGGAYSDPPI  387

Query  159   PLHHFCH  139
             PL+  CH
Sbjct  388   PLNMACH  394



>ref|XP_007224356.1| hypothetical protein PRUPE_ppa020848mg [Prunus persica]
 gb|EMJ25555.1| hypothetical protein PRUPE_ppa020848mg [Prunus persica]
Length=388

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/357 (45%), Positives = 212/357 (59%), Gaps = 9/357 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A+  +  PPYG TYF  PVGR +DGRVI+DFLA+ LG +F
Sbjct  36    CEFPAIFNFGDSNSDTGGLAASLSAPPPPYGETYFHMPVGRFSDGRVIIDFLAKNLGHSF  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F +GANFAT  ST+  P         SPF L IQ+ QF Q K     + 
Sbjct  96    LSAYLDSLGSNFSYGANFATGGSTIRLPDQIFPAGGFSPFYLNIQYMQFMQLK----SRS  151

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q   H      + +P ++ F KALYTF IGQND     + ++ +  VN S+P+++  ++ 
Sbjct  152   QLIRHRGGIFASLMPKESYFSKALYTFDIGQNDLTEGFIGNMTVQQVNASVPDIIIGLSA  211

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK IY LG R+F+I N  PIGC PS LA L       D+ GC KSYN     +N  LK+
Sbjct  212   NIKKIYDLGARSFWIHNTGPIGCLPSILANLPGQK---DEAGCAKSYNEVAQHFNQKLKE  268

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A  Q R+D+  A + YVD +S+   LF+ P  +G +    ACCGY GG YN+     CG 
Sbjct  269   ATVQLRKDLPLAAITYVDVYSVKYSLFKEPQKYGFELPLVACCGY-GGKYNYNSSSQCGG  327

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T  +NG+     +C+DP   V+WDG H T+AA K     I +G++ DPP  L   CH
Sbjct  328   TARVNGRQTFVGSCKDPSVRVNWDGTHYTEAAAKFISDKISTGAFSDPPLALKQACH  384



>ref|XP_010912877.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Elaeis guineensis]
Length=382

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/360 (43%), Positives = 209/360 (58%), Gaps = 13/360 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPA+FN GDSN+DTGG  A F  L  PYG T+F+KP GR +DGR+I+DF+A+ LGL +
Sbjct  26    CHFPAVFNLGDSNSDTGGLSATFGPLTYPYGETFFRKPAGRYSDGRLIIDFIAESLGLPY  85

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +S YL S+G++F HGANFAT  ST++P + +L     SPFSL +Q  QF QFK       
Sbjct  86    ISAYLDSMGTNFSHGANFATALSTILPQNITLSQGGYSPFSLDVQLKQFSQFK-------  138

Query  846   QEQHHSYNHGNT---KLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQI  676
                   YN G      +P +  F +ALYTF IGQND    L  L  S   + +P  + + 
Sbjct  139   SRSRMIYNEGGVYKDVMPKEEYFSQALYTFDIGQNDLT-ALYFLNKS-AEECIPNALKEF  196

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
             +K ++ IY  GGR+F+I N  P+GC P  L +L    S+LD  GC   YN     +N +L
Sbjct  197   SKVVESIYKRGGRSFWIHNTGPLGCLPYVLVQLPLEASELDSAGCAIRYNKLAQKFNRLL  256

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
              D + Q R+D+  A    VD +S+   L       G K   +ACCG+GGG YN+     C
Sbjct  257   NDTVTQLRKDLSLAAFTLVDIYSVKYLLISQARKQGFKLPLRACCGHGGGMYNYNSNFRC  316

Query  315   GDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             GDT  +NG T+   ++C++P+  +SWDG H T+AAN+     I  G++ DP  PL   CH
Sbjct  317   GDTVKVNGTTILVGKSCKNPWKRISWDGAHYTEAANRWVFHQISRGAFSDPAIPLSMACH  376



>ref|XP_010044557.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Eucalyptus grandis]
 gb|KCW86645.1| hypothetical protein EUGRSUZ_B03273 [Eucalyptus grandis]
Length=383

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/363 (43%), Positives = 216/363 (60%), Gaps = 11/363 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPA+FNFGDSN+DTGG  A F     P G TYF  P GR TDGRV+VDF+A+ LGL +
Sbjct  26    CDFPAMFNFGDSNSDTGGLSAVFGQAPWPEGETYFHSPAGRYTDGRVVVDFIAESLGLPY  85

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQF--KVMVDE  853
             LS YL S+GS+F HGANFAT  ST+ P +++L  S  SP SL +Q+N+F +F  +  V  
Sbjct  86    LSAYLNSVGSNFSHGANFATAGSTIRPQNTTLQQSGFSPISLDVQYNEFYEFHNRTPVAR  145

Query  852   QEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQI  676
             Q+ E           LP + +F KALYTF IGQND       ++  S V   LP+V+ Q 
Sbjct  146   QKGEVFEKL------LPKEEVFSKALYTFDIGQNDLTAGYFMNMSTSEVRAYLPDVLGQF  199

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
                +  +Y  GGR F+I N  P+GC P  + ++    S +D  GC   +N    D+N  L
Sbjct  200   KNIVSYVYSQGGRFFWIHNTGPVGCLPYVMERVPIMASQVDHVGCASPFNEVAQDFNRGL  259

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K+ + Q RQ++  A + YVD +S+   L  HP  +G K+  + CCG+ GG YN+   + C
Sbjct  260   KEVVMQLRQELPQAAITYVDVYSVKYSLISHPEKYGFKHPLRTCCGH-GGRYNYDIHMGC  318

Query  315   GDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             G T +++G+ V  A++C++P  +V+WDG H T+AAN+   + I SG + DPP PL   C 
Sbjct  319   GATAMVDGEEVMVAKSCDNPALHVNWDGVHFTEAANRQIFKHIRSGLFSDPPVPLSSACL  378

Query  138   IHP  130
               P
Sbjct  379   RMP  381



>ref|XP_010999386.1| PREDICTED: esterase-like [Populus euphratica]
Length=381

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 161/358 (45%), Positives = 211/358 (59%), Gaps = 9/358 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGGF A+FP L PPYG TYF+ PVGR +DGR+I+DF+A+ L L+F
Sbjct  27    CEFPAIFNFGDSNSDTGGFVASFPPLNPPYGETYFQMPVGRFSDGRLIIDFVAKSLNLSF  86

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSL-FDSRVSPFSLAIQFNQFKQFKVMVDEQ  850
             LS YL S+G++F  GANFAT SST+  P   +  ++  SPF   +Q+NQF Q K    ++
Sbjct  87    LSAYLNSLGTNFTVGANFATASSTITLPARIIPANNGFSPFYFLVQYNQFVQLK----DR  142

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQIT  673
              Q            +P +  F KALYTF IGQND        + +  VN S+P +V   +
Sbjct  143   SQLIRKQGGVFAQLMPKEEYFQKALYTFDIGQNDLGAGFFGDMSVEEVNASVPNIVNTFS  202

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               +K IY LG R+F+I N  PIGC    LA     +++ D  GC KSYN     +N  LK
Sbjct  203   TNVKSIYNLGARSFWIHNTGPIGCLAYVLANFP--SAEKDSVGCAKSYNEVAQYFNYELK  260

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             + + Q R+    A   YVD +S+   LF  P  HG +    ACCGY GG YN+     CG
Sbjct  261   ETVLQLRKAFPSAAFTYVDVYSVKYSLFSEPKKHGFELPLVACCGY-GGLYNYSSSAGCG  319

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
              T  +NG  +T  +C+DP   V WDG H T+AANK   + I +G++ DPP PL   CH
Sbjct  320   ATITVNGTQITVGSCDDPSVRVVWDGIHYTEAANKFIFEQISTGAFSDPPIPLKMACH  377



>ref|XP_007227294.1| hypothetical protein PRUPE_ppa017062mg [Prunus persica]
 gb|EMJ28493.1| hypothetical protein PRUPE_ppa017062mg [Prunus persica]
Length=373

 Score =   301 bits (770),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 163/359 (45%), Positives = 217/359 (60%), Gaps = 11/359 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A+     PPYG TYF  P GR +DGR+I+DFLA+ LG  F
Sbjct  19    CEFPAIFNFGDSNSDTGGLAASIYPSPPPYGETYFHIPAGRISDGRLIIDFLAKNLGQPF  78

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSL-FDSRVSPFSLAIQFNQFKQFKVMVDEQ  850
             LS YL S+G++F HGANFAT SST+  P+  L      SPF+L IQ++QF Q K     +
Sbjct  79    LSAYLDSLGANFSHGANFATGSSTIRLPNRILPAPGGYSPFTLTIQYSQFLQLK----NR  134

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQIT  673
              Q          + +P +  F KALYTF IGQND      A+L I  VN S+P++++  +
Sbjct  135   SQLIRDRGGIFASLMPKEEYFSKALYTFDIGQNDLGEGFFANLTIQQVNASIPDIISSFS  194

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               IK IY LGGR+F+I N  PIGC P  LA      S  D+ GC KS+N     +N+ LK
Sbjct  195   ANIKKIYDLGGRSFWIHNTGPIGCLPYILANF---PSQKDEAGCAKSHNEVAQQFNHNLK  251

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFK-KELFC  316
             +A  Q R+D++ A + YVD +S+   L++ P  +G +     CCG  GG YNF  + L C
Sbjct  252   EATVQLRKDLRLAAITYVDVYSVKYSLYKEPKKYGFELPLVGCCG-SGGKYNFNGRTLDC  310

Query  315   GDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             G T  +NG+ + A +C+ PY  V+WDG H T+AA K+    I +G++ DPP P    CH
Sbjct  311   GRTVTVNGRQIFAGSCKRPYVKVNWDGIHYTEAAAKIVFDKISTGAFSDPPLPFKQACH  369



>ref|XP_010044556.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Eucalyptus grandis]
 gb|KCW86644.1| hypothetical protein EUGRSUZ_B03272 [Eucalyptus grandis]
Length=387

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/361 (42%), Positives = 211/361 (58%), Gaps = 7/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A F    PP+G T+F++PVGR +DGR++VDF+AQ  GL +
Sbjct  30    CDFPAIFNFGDSNSDTGGLSAVFGQAPPPHGETHFRRPVGRYSDGRLVVDFIAQSFGLPY  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL ++GS+F HGANFAT  ST+ P +++L  S  SP SL +QFN+F +F+     + 
Sbjct  90    LSAYLDAVGSNFSHGANFATAGSTIRPQNTTLHQSGFSPISLDVQFNEFYEFR----RRS  145

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q            LP + +F +ALYTF IGQND       ++  S V   +P+V+ Q   
Sbjct  146   QVARTRGGVYEKLLPKEEVFSRALYTFDIGQNDLTAGYFLNMSTSEVKAYIPDVLGQFKN  205

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +  IY  GGR F+I N  P+GC P  + ++    S +D+ GC   +N     +N  LK+
Sbjct  206   IVSYIYGEGGRYFWIHNTGPVGCLPYVMERIPILVSQVDRAGCASPFNEVARHFNRGLKE  265

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R+++  A + YVD +++   L   P  +G K   + CCG+ GG YNF   + CG 
Sbjct  266   VVTQLRKELPLAAITYVDVYAVKYALISQPEKYGFKQPLRTCCGF-GGKYNFNIHMGCGA  324

Query  309   TNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
                + G+ V    +CEDP  YV+WDG H T+AANK     I  GS+ DPP PL+  C   
Sbjct  325   KITVRGKEVLVGNSCEDPSVYVNWDGVHYTEAANKQIFDHIVGGSFSDPPVPLNKACQKR  384

Query  132   P  130
             P
Sbjct  385   P  385



>ref|XP_008219730.1| PREDICTED: LOW QUALITY PROTEIN: esterase-like [Prunus mume]
Length=385

 Score =   299 bits (765),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 161/362 (44%), Positives = 215/362 (59%), Gaps = 18/362 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  ++     PPYG TYF KP GR +DGR+IVDFLA+ LG  +
Sbjct  32    CEFPAIFNFGDSNSDTGGLSSSLYQAPPPYGETYFHKPAGRFSDGRLIVDFLAKSLGHPY  91

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++F  GANFAT +STV  P   +     SPF L IQ+ QF Q K       
Sbjct  92    LSAYLDSLGTNFSCGANFATAASTVRLPDPIIPAGGFSPFYLNIQYMQFMQLK-------  144

Query  846   QEQHHSYNHGN---TKLPPKNIFGKALYTFYIGQNDF---IFDLASLGISGVNQSLPEVV  685
                HH  + G    + +P +  F KALYTF IGQND     FD  +  I  VN S+P+++
Sbjct  145   SRSHHIRHRGGIFASLMPKEEYFSKALYTFDIGQNDLAKGFFDNQT--IQEVNASVPDIM  202

Query  684   AQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYN  505
             ++ +  IK IY LG R+F+I N  PIGC P   A  ++ ++  D+ GC KSYN     +N
Sbjct  203   SKFSTNIKKIYDLGARSFWIHNTGPIGCLPYVXA--TYLSAQKDEVGCAKSYNEVAQHFN  260

Query  504   NILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKE  325
             + L++A+ Q R+D+  A   YVD +S+   L++ P  +G +    ACCGY GG YNF   
Sbjct  261   HKLREAIVQLRKDLPLATFTYVDVYSVKYSLYKEPKRYGFELPLVACCGY-GGKYNFNSS  319

Query  324   LFCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHF  145
               CG T  +NG  +   +C+ P   V+WDG H T+AA K     I +G++ DPPFPL   
Sbjct  320   AECGGTVAVNGSQIFVGSCKRPSARVNWDGIHYTEAAAKFVFDKISTGAFSDPPFPLKQA  379

Query  144   CH  139
             CH
Sbjct  380   CH  381



>ref|XP_010682277.1| PREDICTED: GDSL esterase/lipase At3g26430 [Beta vulgaris subsp. 
vulgaris]
Length=390

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/358 (43%), Positives = 210/358 (59%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGGF A F    PP+G T+F  P GR  DGR+I+DF+AQ LGL +
Sbjct  36    CKFPAIFNFGDSNSDTGGFSATFGQAGPPHGETFFHSPAGRYCDGRLIIDFIAQSLGLPY  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL ++GS+F HGANFAT  ST+ P +++L  S  SP SL IQ  +F  F+     + 
Sbjct  96    LSGYLDAVGSNFSHGANFATAGSTIRPQNTTLHQSGFSPISLNIQSYEFNDFQ----RRS  151

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q      N     LP    F KALYTF IGQND       ++    V  ++P+V+ Q T 
Sbjct  152   QTFRQKGNVFKDLLPKGEYFSKALYTFDIGQNDLTAGYFLNMSSDQVKANIPDVLGQFTT  211

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +KDIY  GGR F+I N  P+GC P  + +++  +S++D+ GC    N     +N  LK+
Sbjct  212   VVKDIYEKGGRYFWIHNTGPLGCLPYVMDRVAVKSSEIDKVGCTGPCNKVAQVFNQKLKE  271

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              +   R+ +  A + YVD +S+  +L  H   +G +   +ACCG+ GG YN+ + + CG 
Sbjct  272   VVVHLRKKLPHAAITYVDIYSLKYDLISHARKYGFEQSLRACCGH-GGKYNYNQHVGCGG  330

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                + G Q +  +AC+DP   ++WDG H T+AANK     I  GSY DPP PL   CH
Sbjct  331   KVTVKGKQILVGKACKDPSLAINWDGVHYTEAANKWVFDRIVDGSYSDPPIPLKMACH  388



>ref|XP_011087101.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Sesamum indicum]
Length=387

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/361 (42%), Positives = 212/361 (59%), Gaps = 13/361 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP G +YF  P GR +DGR+++DF+A+ LGL +
Sbjct  33    CHFPAIFNFGDSNSDTGGLSAAFGQAPPPNGESYFHGPAGRYSDGRLVIDFIAKSLGLPY  92

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL ++GS+F HGANFAT  ST+ P +++L  S  SPFSL +QF QF  F       +
Sbjct  93    LSAYLDALGSNFTHGANFATAGSTIRPQNTTLHQSGFSPFSLNVQFYQFNDF-------Q  145

Query  846   QEQHHSYNHGNTK---LPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQ  679
             +  H     G+     LP   +F +ALYTF IGQND       ++    V   +P+V+ Q
Sbjct  146   RRSHLIRKQGSVYEGLLPEAEVFSRALYTFDIGQNDLTAGYFLNMTTDQVRAYVPDVLDQ  205

Query  678   ITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNI  499
                 +K IY  GGR+F+I N  P+GC P  +  L    + +D+ GC   +N     +N  
Sbjct  206   FKTVVKSIYEHGGRSFWIHNTGPVGCLPYVMDLLPVTAAQVDKVGCATPFNEVAKYFNLR  265

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             LK+ + Q R+D+  A + YVD +++  +L      HG  +  +ACCG+ GG YN+ K L 
Sbjct  266   LKETVVQLRKDLSSAALTYVDVYAVKYDLISQAKKHGFVHPLQACCGH-GGKYNYNKHLG  324

Query  318   CGDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             CG    +NG+ +   ++C+DP   ++WDG H T AANK     I +G+Y DPP PLH  C
Sbjct  325   CGSKIKVNGEEIMVGKSCKDPSVVINWDGVHYTQAANKWVFDQIVNGAYSDPPIPLHMAC  384

Query  141   H  139
             H
Sbjct  385   H  385



>ref|XP_003545634.1| PREDICTED: esterase-like isoform X1 [Glycine max]
 gb|KHN25209.1| Esterase [Glycine soja]
Length=392

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 155/357 (43%), Positives = 217/357 (61%), Gaps = 8/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A+  +  PPYG TYF +P GR +DGR+++DF+A+  GL +
Sbjct  36    CVFPAIFNFGDSNSDTGGLAASLIAPTPPYGETYFHRPAGRFSDGRLVIDFIAKSFGLPY  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++F HGANFAT +ST+  P S +     SPF L IQ+ QF+ FK     + 
Sbjct  96    LSAYLDSLGTNFSHGANFATSASTIRLPTSIIPQGGFSPFYLDIQYTQFRDFK----SRT  151

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q   H      + +P +  F KALYTF IGQND       +L +  VN ++P++V   +K
Sbjct  152   QFIRHQGGVFASLMPKEEYFDKALYTFDIGQNDLGAGFFGNLTVQQVNATVPDIVNAFSK  211

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IKDIY LG R+F+I N  PIGC P  LA     +++ D +GC K+YN+    +N+ LK+
Sbjct  212   NIKDIYDLGARSFWIHNTGPIGCLPYILANFL--SAERDAYGCAKTYNDIAQYFNHKLKE  269

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R+D+  A + YVD +S+   LF HP  +G K    ACCGY GG+YN+   + CG+
Sbjct  270   VVVQLRKDLPLAAITYVDIYSVKYSLFSHPKKYGFKLPLVACCGY-GGEYNYSGSVGCGE  328

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                 NG  +   +C  P   V+WDG H T+AA+K     I +G++ +   PL+  CH
Sbjct  329   NIEGNGTEIFVGSCGRPSARVNWDGIHYTEAASKFIFDQISTGAFSETAIPLNMACH  385



>ref|XP_007223054.1| hypothetical protein PRUPE_ppa006965mg [Prunus persica]
 gb|EMJ24253.1| hypothetical protein PRUPE_ppa006965mg [Prunus persica]
Length=388

 Score =   296 bits (759),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 159/357 (45%), Positives = 209/357 (59%), Gaps = 9/357 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGGF A+     PPYG TYF  PVGR +DGR+I+DFLA+ LG  F
Sbjct  36    CEFPAIFNFGDSNSDTGGFAASLSPPTPPYGETYFHMPVGRFSDGRLIIDFLAKSLGHPF  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F +GANFAT +ST+  P         SPF L IQ+ QF Q K     + 
Sbjct  96    LSAYLDSLGSNFSYGANFATAASTIRLPDQIFPAGGFSPFYLNIQYVQFMQLK----SRS  151

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             Q   H      + +P +  F KALYTF IGQND     + +L +  VN S+P++++  + 
Sbjct  152   QLIRHRGGIFASLMPKEEYFSKALYTFDIGQNDLGEGFSGNLTVQEVNASVPDIISGFSA  211

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK IY LG R+F+I N  PIGC P   A      +  D+ GC KSYN     +N  LK+
Sbjct  212   NIKKIYDLGARSFWIHNTGPIGCLPYIFANF---PAQKDEAGCAKSYNEVAQHFNQKLKE  268

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A  Q R+D+  A + YVD +S+   LF+    +G +    ACCGY GG YN+     CG 
Sbjct  269   ATVQLRKDLPLAAITYVDVYSVKYSLFKESQKYGFELPLVACCGY-GGKYNYNSSSECGG  327

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T  +NG+ +   +C+DP   V+WDG H T+AA K     I +G++ DPP  L   CH
Sbjct  328   TARVNGRQIFVGSCKDPSVRVNWDGIHYTEAAAKFISDKISTGAFSDPPLALKQACH  384



>gb|KEH22102.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=381

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 150/359 (42%), Positives = 210/359 (58%), Gaps = 7/359 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAI+NFGDSN+DTGG  AAF  +  PYG  +F KP GR +DGRVI+DF+A+ L L +
Sbjct  29    CSFPAIYNFGDSNSDTGGISAAFVPIPSPYGQGFFHKPFGRDSDGRVILDFIAEKLKLPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G+++RHGANFAT  ST+   + ++F   +SPFSL IQ  QF QFK    +  
Sbjct  89    LSAYLNSLGTNYRHGANFATGGSTIRKQNETIFQYGISPFSLDIQIVQFNQFKARTKQLY  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             QE ++S     +KLP    F KALYTF IGQND       +    + +++P++V Q+   
Sbjct  149   QEANNSLER--SKLPVPEEFAKALYTFDIGQNDLSVGFRKMNFDQIRETMPDIVNQLASA  206

Query  666   IKDIYLLGGRTFFILNLAPIGCYP-SFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             +K+IY  GGR+F+I N  PIGC P +   K        DQ+GC+K  N    ++N  LKD
Sbjct  207   VKNIYEQGGRSFWIHNTGPIGCMPVNLFYKHDVPAGYFDQYGCVKDQNTIAVEFNKKLKD  266

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R ++ +A + YVD ++    L  +  + G     K CCGY   D      ++CG+
Sbjct  267   RVVKLRTELPEAAITYVDVYAAKYGLISNTKNEGFVDPMKICCGYHVND----THIWCGN  322

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
                 NG+ V   +CE P  YVSWDG H  +AAN      I +G++ DP  P+   C+ H
Sbjct  323   LGTANGKDVYGTSCEKPSMYVSWDGVHYAEAANHWVADRILNGTFTDPATPILQACYRH  381



>gb|EPS70495.1| acetylcholinesterase, partial [Genlisea aurea]
Length=353

 Score =   295 bits (755),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 150/360 (42%), Positives = 213/360 (59%), Gaps = 13/360 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F A+F FGDSNTDTGG FAAF   +PPYG T+F +P GRA+DGR+I+DF+A+ LG+ +
Sbjct  1     CKFLAVFAFGDSNTDTGGIFAAFYPAIPPYGRTFFNRPAGRASDGRLIIDFIAEHLGVPY  60

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL S+GS ++HGANFAT  +T++ P  S F + VSPFSL IQ   F QFK  +    
Sbjct  61    LSPYLDSLGSTYKHGANFATGGATILHPDESWFVNGVSPFSLDIQVEHFTQFKNKI----  116

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                H +   GN +L     F +AL+   IGQND       L +    Q++P +++Q+   
Sbjct  117   TYFHSTGATGNGRLMKPGYFSEALFVLDIGQNDLAAGQRKLSLENQKQAIPNIISQLITQ  176

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKL----SHNTSDLDQFGCLKSYNNAVADYNNI  499
             I+++Y  GGR F++ N  PIGC P  +AK+          LD+ GC+KS N    ++N  
Sbjct  177   IQNLYERGGRYFWVHNTGPIGCLPVSVAKVGSAEKQQPGTLDEVGCVKSQNEVAMEFNRQ  236

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             L+D +   R+   + ++VYVD +    EL +     GL      CCGY G  Y    +++
Sbjct  237   LRDEIYNLRRG-SNLSIVYVDIYGAKYELVRKARELGLGDPFGICCGYHGIGY----DIW  291

Query  318   CGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             CG++  LNG  V A++C DP   +SWDG H ++AAN+     I +GS+ DPP  +H  CH
Sbjct  292   CGNSGALNGSQVYADSCSDPSAVISWDGVHYSEAANRWISNQIINGSFSDPPTSIHDSCH  351



>ref|XP_002530043.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
 gb|EEF32343.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
Length=388

 Score =   296 bits (758),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 155/362 (43%), Positives = 210/362 (58%), Gaps = 7/362 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP+G +YF  P GR  DGR+I+DF+A+ L L +
Sbjct  31    CHFPAIFNFGDSNSDTGGLSAAFGQAPPPHGESYFHHPAGRYCDGRLIIDFIAESLRLPY  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL SIGS+FRHGANFAT  STV P +++L  S  SP SL +Q+N+F  F      + 
Sbjct  91    LSAYLDSIGSNFRHGANFATAGSTVRPQNTTLRQSGYSPISLDVQYNEFHDFHT----RS  146

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q   +        LP    F +ALYTF IGQND       ++  S V   +PEV++Q   
Sbjct  147   QVVRNRGGIYKKLLPKAEDFSRALYTFDIGQNDLTAGYFLNMSTSEVMAYVPEVLSQFKT  206

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +  IY  GGR F+I N  P GC    L ++   + ++D  GC   +N     YN+ LK+
Sbjct  207   LVSYIYYEGGRNFWIHNTGPFGCLAYVLDRIPLPSGEIDGAGCGIPFNKVAQYYNHGLKN  266

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R++  DA + YVD +S+   L+     HG     +ACCG+GG  YN+ K++ CG 
Sbjct  267   VVAQLRKEFPDAAITYVDIYSLKYSLYSRTRKHGFNESLRACCGHGG-KYNYNKKIGCGG  325

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
                + G Q +  ++C+DP  +++WDG H T AANK   + I  GSY DPP PL   C  H
Sbjct  326   KITVRGKQVLVGKSCDDPSVWINWDGVHYTQAANKWIFEQIVDGSYSDPPIPLKMACQRH  385

Query  132   PI  127
             P+
Sbjct  386   PL  387



>ref|XP_010248683.1| PREDICTED: GDSL esterase/lipase At3g26430 [Nelumbo nucifera]
Length=383

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/359 (43%), Positives = 208/359 (58%), Gaps = 9/359 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP G TYF  P GR +DGR+++DF+A+ +GL +
Sbjct  29    CEFPAIFNFGDSNSDTGGLSAAFGQASPPAGETYFHTPAGRYSDGRLVIDFIAESVGLPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F HGANFAT  ST+ P +++L  S  SPFSL +Q+ QF  F      Q 
Sbjct  89    LSAYLDSVGSNFTHGANFATAGSTIRPQNTTLSQSGFSPFSLNVQYYQFHDF-----HQR  143

Query  846   QEQHHSYNHGNTKLPPK-NIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQIT  673
              +   +      KL PK   F +ALY   IGQND       ++    V   +P+V+ Q +
Sbjct  144   SQVARTRGEVFQKLLPKAEDFSRALYALDIGQNDLTAGYFLNMSTDQVRAYIPDVLGQFS  203

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               IK IY  GGR+F+I N  P+GC P  L +L     ++D+ GC   YN     +N  LK
Sbjct  204   TIIKYIYDQGGRSFWIHNTGPVGCLPYILDRLLVRAPEVDKAGCATPYNEVAQYFNIKLK  263

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             + + Q R  +  A + YVD +S+   L    T HG K+   ACCG+ GG YN+ + + CG
Sbjct  264   ETVVQLRNQLPLAAITYVDVYSVKYSLISQATKHGFKHSLSACCGH-GGKYNYNRNVGCG  322

Query  312   DTNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                 ++G Q +   +C DP  +++WDG H T+AANK   Q I  GS+ DPP PL   CH
Sbjct  323   GKVSMHGKQILLGRSCNDPSVWINWDGVHYTEAANKWVFQQIVDGSFSDPPIPLKFACH  381



>gb|KHN25211.1| Esterase [Glycine soja]
Length=359

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 158/358 (44%), Positives = 217/358 (61%), Gaps = 14/358 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVP--PYGMTYFKKPVGRATDGRVIVDFLAQGLGL  1033
             C FPAIFNFG SN DTGG  A+F    P  P G TYF +P GR +DGR+I+DFLAQ  GL
Sbjct  8     CDFPAIFNFGASNADTGGLAASFFVAAPKSPNGETYFHRPAGRFSDGRLIIDFLAQSFGL  67

Query  1032  AFLSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDE  853
              +LSPYL S+G++F  GA+FAT  ST++P  S     R SPFSL +Q++QF++FK    +
Sbjct  68    PYLSPYLDSLGTNFSRGASFATAGSTIIPQQS----FRSSPFSLGVQYSQFQRFKPTT-Q  122

Query  852   QEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQI  676
               +EQ   +    T +P +  F +ALYTF IGQND       ++ +   N ++P+++   
Sbjct  123   FIREQGGVF---ATLMPKEEYFHEALYTFDIGQNDLTAGFFGNMTLQQFNATIPDIIKSF  179

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
             T  IK+IY +G R+F+I N  PIGC P  LA     +++ D + C K+YN     +N+ L
Sbjct  180   TSNIKNIYNMGARSFWIHNTGPIGCLPLILANFP--SAERDSYDCAKAYNEVAQSFNHNL  237

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K+AL Q R ++  A + YVD +S    LF++P  +G +    ACCGY GG YNF + + C
Sbjct  238   KEALAQLRTELPLAAITYVDIYSAKYLLFKNPKKYGFELPHVACCGY-GGTYNFSQSVGC  296

Query  315   GDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             G T  +NG  +   +CE P   V WDG H T+AANKV    I SG++ DPP PL   C
Sbjct  297   GGTIQVNGTNIVVGSCERPSVRVVWDGTHYTEAANKVVFDLISSGAFTDPPIPLKRAC  354



>gb|KHN29023.1| GDSL esterase/lipase [Glycine soja]
Length=396

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/358 (43%), Positives = 210/358 (59%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFN GDSN+DTGG  AAF    PP G+TYF  P GR +DGR+I+DF+A+  GLA+
Sbjct  32    CIFPAIFNLGDSNSDTGGLSAAFGQAPPPNGITYFHSPNGRFSDGRLIIDFIAESSGLAY  91

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L  YL S+ S+F HGANFAT  STV P ++++  S  SP SL +QF QF  FK    +  
Sbjct  92    LRAYLDSVASNFTHGANFATAGSTVRPQNTTISQSGYSPISLDVQFVQFSDFKTR-SKLV  150

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             ++Q   +      LP +  F +ALYTF IGQND       +     V   +P+V+ Q + 
Sbjct  151   RQQGGVFKE---LLPKEEYFSQALYTFDIGQNDLTAGYKLNFTTEQVKAYIPDVLGQFSN  207

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK +Y  GGR+F+I N  P+GC P  L +     + +D+FGC K +N     +N  LK+
Sbjct  208   VIKGVYGEGGRSFWIHNTGPLGCLPYMLDRYPMKPTQMDEFGCAKPFNEVAQYFNRKLKE  267

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R+++  A + YVD +++   L  H   +G + G  ACCG+ GG YNF     CG 
Sbjct  268   VVEQLRKELPGAAITYVDVYTVKYTLISHAQKYGFEQGVIACCGH-GGKYNFNNTERCGA  326

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T  +NG + V A +C+DP   + WDG H T+AANK   Q I +GS+ DPP  L   C+
Sbjct  327   TKRVNGTEIVIANSCKDPSVRIIWDGIHYTEAANKWIFQQIVNGSFSDPPHSLKRACY  384



>ref|XP_003531330.1| PREDICTED: GDSL esterase/lipase At3g26430 isoform 1 [Glycine 
max]
Length=399

 Score =   295 bits (755),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 153/358 (43%), Positives = 210/358 (59%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFN GDSN+DTGG  AAF    PP G+TYF  P GR +DGR+I+DF+A+  GLA+
Sbjct  35    CIFPAIFNLGDSNSDTGGLSAAFGQAPPPNGITYFHSPNGRFSDGRLIIDFIAESSGLAY  94

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L  YL S+ S+F HGANFAT  STV P ++++  S  SP SL +QF QF  FK    +  
Sbjct  95    LRAYLDSVASNFTHGANFATAGSTVRPQNTTISQSGYSPISLDVQFVQFSDFKTR-SKLV  153

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             ++Q   +      LP +  F +ALYTF IGQND       +     V   +P+V+ Q + 
Sbjct  154   RQQGGVFKE---LLPKEEYFSQALYTFDIGQNDLTAGYKLNFTTEQVKAYIPDVLGQFSN  210

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK +Y  GGR+F+I N  P+GC P  L +     + +D+FGC K +N     +N  LK+
Sbjct  211   VIKGVYGEGGRSFWIHNTGPLGCLPYMLDRYPMKPTQMDEFGCAKPFNEVAQYFNRKLKE  270

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R+++  A + YVD +++   L  H   +G + G  ACCG+ GG YNF     CG 
Sbjct  271   VVEQLRKELPGAAITYVDVYTVKYTLISHAQKYGFEQGVIACCGH-GGKYNFNNTERCGA  329

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T  +NG + V A +C+DP   + WDG H T+AANK   Q I +GS+ DPP  L   C+
Sbjct  330   TKRVNGTEIVIANSCKDPSVRIIWDGIHYTEAANKWIFQQIVNGSFSDPPHSLKRACY  387



>ref|XP_003547701.1| PREDICTED: GDSL esterase/lipase At5g14450 isoform 1 [Glycine 
max]
 gb|KHN27565.1| GDSL esterase/lipase [Glycine soja]
Length=382

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/360 (42%), Positives = 209/360 (58%), Gaps = 9/360 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPA++NFGDSN+DTGG  A+F  +  PYG  +F KP GR  DGR+IVDF+A+ L L +
Sbjct  30    CTFPAVYNFGDSNSDTGGISASFVPIPAPYGEGFFHKPSGRDCDGRLIVDFIAEKLNLPY  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G+++RHGANFAT  ST+   + ++F   +SPFSL IQ  QF QFK    +  
Sbjct  90    LSAYLNSLGTNYRHGANFATGGSTIRKQNETIFQYGISPFSLDIQIVQFNQFKARTKQLY  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             +E      H  +KLP    F KALYTF IGQND       +    + +S+P+++ Q+   
Sbjct  150   EEAKAP--HEKSKLPVPEEFSKALYTFDIGQNDLSVGFRKMNFDQIRESMPDILNQLANA  207

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD--LDQFGCLKSYNNAVADYNNILK  493
             +K+IY  GGR F+I N +P GC P  L    HN  +  LDQ+GC+K  N    ++N  LK
Sbjct  208   VKNIYQQGGRYFWIHNTSPFGCMPVQLF-YKHNIPEGYLDQYGCVKDQNVMATEFNKQLK  266

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             D + + R ++ +A + YVD ++    L  +    G     K CCGY   D      ++CG
Sbjct  267   DRVIKLRTELPEAAITYVDVYAAKYALISNTKKEGFVDPMKICCGYHVND----THIWCG  322

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
             +    NG+ V   ACE+P  Y+SWD  H  +AAN      I +GSY DPP P+   C+ H
Sbjct  323   NLGTDNGKDVFGSACENPSQYISWDSVHYAEAANHWVANRILNGSYTDPPTPITQACYRH  382



>ref|XP_008219729.1| PREDICTED: esterase-like [Prunus mume]
Length=388

 Score =   294 bits (753),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 157/357 (44%), Positives = 208/357 (58%), Gaps = 9/357 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A+     PPYG TYF  PVGR +DGR+I+DFLA+ LG  F
Sbjct  36    CEFPAIFNFGDSNSDTGGLAASLSPPTPPYGETYFHMPVGRFSDGRLIIDFLAKSLGHPF  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++F +GANFAT +ST+  P         SPF L IQ+ QF Q K     + 
Sbjct  96    LSAYLDSLGTNFSYGANFATAASTIRLPDQVFPAGGFSPFYLNIQYVQFMQLK----SRS  151

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q          + +P +  F KALYTF IGQND       +L +  VN S+P++++  + 
Sbjct  152   QLIRRRGGIFASLMPKEEYFSKALYTFDIGQNDLGEGFFGNLTVQEVNASVPDIISGFSA  211

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK IY LG R+F+I N  PIGC P  LA      S  D+ GC KS+N     +N+ LK+
Sbjct  212   NIKKIYDLGARSFWIHNTGPIGCLPYILANF---PSQKDEAGCAKSHNEVAQQFNHKLKE  268

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A  Q R+D+  A + Y+D +S+   LF+ P  +G +    ACCGY GG YN+     CG 
Sbjct  269   ATVQLRKDLPLAAITYIDVYSVKYSLFKEPKKYGFELPLVACCGY-GGKYNYNGSSECGG  327

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T  +NG  +   +C+DP   V+WDG H T+AA K     I +G++ DPP  L   CH
Sbjct  328   TATVNGNQIFVGSCKDPSVRVNWDGIHYTEAAAKFISDKISTGAFSDPPLALKQACH  384



>gb|ABR16845.1| unknown [Picea sitchensis]
Length=381

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 164/368 (45%), Positives = 223/368 (61%), Gaps = 18/368 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFP-SLVP---PYGMTYFKKPVGRATDGRVIVDFLAQGL  1039
             C FPAIFNFGDSN+DTGG+  AFP  ++P   PYG T+F +P  R +DGR+ VDFLAQ L
Sbjct  24    CDFPAIFNFGDSNSDTGGWHFAFPYQMLPDNAPYGRTFFGQPSYRYSDGRLSVDFLAQAL  83

Query  1038  GLAFLSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMV  859
             GL F+SP+L+S+GS F  GANFA   ++V P  S+ F++   P SL +Q NQFK FK  V
Sbjct  84    GLPFISPFLQSVGSRFEQGANFAASGASVRP-TSTDFNA---PISLTVQLNQFKVFKQQV  139

Query  858   DEQEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGIS--GVNQS-LPEV  688
              +     H S N+    LP  + F   +YT  IG NDF     SL +S   V Q+ LP++
Sbjct  140   LD-TISSHGSLNY----LPSADSFKTGIYTIEIGGNDFDNAYRSLKLSPLQVKQTILPKL  194

Query  687   VAQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADY  508
                +   ++++Y  G RT  + ++ P GC P +L   SH  +D DQ GC  SYN+AV  Y
Sbjct  195   AKSVGGAVQELYNEGARTILVKDVGPQGCGPFWLTYFSHAPTDFDQHGCSISYNDAVQFY  254

Query  507   NNILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKK  328
             N  L++ L   R+ +  A++VYV  + II + F +P+ +G K  T++CCG  GG YNF  
Sbjct  255   NTQLREQLSLVRKQLPGADIVYVSQYDIIYDFFANPSKYGFKATTQSCCGV-GGKYNFTW  313

Query  327   ELFCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPP-FPLH  151
                CG T  +NG++VT  +C DP +Y+ WDG HLTD AN+V  Q I  G YF+P  F + 
Sbjct  314   AAQCGLTGPVNGKSVTVGSCSDPASYIIWDGIHLTDQANRVLTQQILGGKYFEPSTFSIT  373

Query  150   HFCHIHPI  127
               C I PI
Sbjct  374   SRCQIQPI  381



>ref|XP_007019070.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY16295.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=392

 Score =   294 bits (752),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 157/357 (44%), Positives = 206/357 (58%), Gaps = 8/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFN GDSN+DTGG+ A F     PYG TYF  P  R +DGR+++DF+A+  GL F
Sbjct  39    CDFPAIFNLGDSNSDTGGYAACFDPPTSPYGDTYFHMPARRFSDGRLMIDFIAETFGLPF  98

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L  YL S+G++F  G NFAT +ST+  P   + +   SPF L +Q++QF QFK     + 
Sbjct  99    LHAYLDSLGTNFSRGINFATAASTIRLPDRIIPNGGFSPFYLDLQYSQFVQFK----SRS  154

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q          + +P +  F KALYTF IGQND      A+L I  VN S+P++V + + 
Sbjct  155   QLIRERGGLFASLMPKEEYFPKALYTFDIGQNDLGEGFFANLTIEEVNASVPDIVNKFSA  214

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK+IY LG R+F+I N  PIGC P  L   S  +++ D  GCLK +N     +N  LK+
Sbjct  215   NIKNIYRLGARSFWIHNTGPIGCLPYILTAFS--SAEKDSVGCLKPHNEVAQYFNLKLKE  272

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R +   A   YVD +S+   LF  P  HG +     CCGY GG YNF  E+ CG 
Sbjct  273   AVTQLRNEFPSAAFTYVDIYSVKYSLFAEPQKHGFELPLVTCCGY-GGQYNFSTEVICGG  331

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T  +NG  +   +CE P   V WDG H T+AANK     I +GS+ DPP PL   CH
Sbjct  332   TITVNGTKIFVGSCERPSVRVVWDGIHYTEAANKFVFDQISTGSFSDPPIPLKRACH  388



>dbj|BAG09557.1| acetylcholinesterase [Macroptilium atropurpureum]
Length=382

 Score =   293 bits (750),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 146/360 (41%), Positives = 211/360 (59%), Gaps = 9/360 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAI+NFGDSN+DTGG  A+F  +  PYG  +F KP GR  DGR+I+DF+A+ L L +
Sbjct  30    CTFPAIYNFGDSNSDTGGISASFVPIPAPYGEGFFHKPSGRDCDGRLIIDFIAEKLNLPY  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G+++RHGANFAT  ST+   + ++F   +SPFSL IQ  QF QFK    +  
Sbjct  90    LSAYLNSLGTNYRHGANFATGGSTIRRQNETIFQYGISPFSLDIQIVQFNQFKARTKQLY  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             +E   S+    ++LP    F KALYTF IGQND       +    + +S+P+++ Q+   
Sbjct  150   EEAKTSFER--SRLPVPEEFAKALYTFDIGQNDLSVGFRKMNFDQIRESMPDILNQLANA  207

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD--LDQFGCLKSYNNAVADYNNILK  493
             +K+IY  GGR+F+I N +P GC P  L    HN     LDQ+GC+K  N    ++N  +K
Sbjct  208   VKNIYQQGGRSFWIHNTSPFGCMPVQLF-YKHNIPSGYLDQYGCVKDQNEMATEFNKQMK  266

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             D + + R ++ +A + YVD ++    L  +  + G     K CCGY   D      ++CG
Sbjct  267   DRIIKLRTELPEAAITYVDVYAAKYALISNTKTEGFVDPMKICCGYHVND----THIWCG  322

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
             +    +G+ V   ACE+P  Y+SWD  H  +AAN      I +GS+ DPP P+   C+ H
Sbjct  323   NLGSADGKDVFGSACENPSQYISWDSVHYAEAANHWVANRILNGSFTDPPTPITQACYKH  382



>ref|XP_003544687.2| PREDICTED: esterase-like [Glycine max]
Length=424

 Score =   295 bits (754),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 158/358 (44%), Positives = 217/358 (61%), Gaps = 14/358 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVP--PYGMTYFKKPVGRATDGRVIVDFLAQGLGL  1033
             C FPAIFNFG SN DTGG  A+F    P  P G TYF +P GR +DGR+I+DFLAQ  GL
Sbjct  73    CDFPAIFNFGASNADTGGLAASFFVAAPKSPNGETYFHRPAGRFSDGRLIIDFLAQSFGL  132

Query  1032  AFLSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDE  853
              +LSPYL S+G++F  GA+FAT  ST++P  S     R SPFSL +Q++QF++FK    +
Sbjct  133   PYLSPYLDSLGTNFSRGASFATAGSTIIPQQS----FRSSPFSLGVQYSQFQRFKPTT-Q  187

Query  852   QEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQI  676
               +EQ   +    T +P +  F +ALYTF IGQND       ++ +   N ++P+++   
Sbjct  188   FIREQGGVF---ATLMPKEEYFHEALYTFDIGQNDLTAGFFGNMTLQQFNATIPDIIKSF  244

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
             T  IK+IY +G R+F+I N  PIGC P  LA     +++ D + C K+YN     +N+ L
Sbjct  245   TSNIKNIYNMGARSFWIHNTGPIGCLPLILANFP--SAERDSYDCAKAYNEVAQSFNHNL  302

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K+AL Q R ++  A + YVD +S    LF++P  +G +    ACCGY GG YNF + + C
Sbjct  303   KEALAQLRTELPLAAITYVDIYSAKYLLFKNPKKYGFELPHVACCGY-GGTYNFSQSVGC  361

Query  315   GDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             G T  +NG  +   +CE P   V WDG H T+AANKV    I SG++ DPP PL   C
Sbjct  362   GGTIQVNGTNIVVGSCERPSVRVVWDGTHYTEAANKVVFDLISSGAFTDPPIPLKRAC  419



>ref|XP_006852384.1| hypothetical protein AMTR_s00049p00231110 [Amborella trichopoda]
 gb|ERN13851.1| hypothetical protein AMTR_s00049p00231110 [Amborella trichopoda]
Length=356

 Score =   292 bits (748),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 152/356 (43%), Positives = 203/356 (57%), Gaps = 12/356 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTG   A+F  + PP G T+F KP+GR  DGR+IVDF+A+ LGL +
Sbjct  10    CEFPAIFNFGDSNSDTGAISASFSQVAPPNGETFFGKPMGRVCDGRLIVDFIAETLGLPY  69

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L+ YL S+G+ F HGANFAT  STV P + +LF   VSPFSL  Q  QF QFK       
Sbjct  70    LTAYLDSLGNGFSHGANFATAGSTVRPQNVTLFQGGVSPFSLNYQVLQFTQFK-------  122

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                   Y  G T +P    F KALYTF IGQND      ++    V  S+P+++A I++ 
Sbjct  123   SRSSFLYIKGKTNVPKPEDFSKALYTFDIGQNDLAAGFRTISDDAVRASIPQILASISQA  182

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             I+ +Y  G RTF+I N  PIGC P           ++D++GC+ + N+   ++N  LK  
Sbjct  183   IQVLYGEGARTFWIHNTGPIGCLPFSAMYYPFKPRNIDKYGCVYTQNDVAQEFNRQLKLM  242

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             + Q R+ +  A + YVD +S    L  H    G     K CCGYG   YN     +CG +
Sbjct  243   VSQLREQLPHAELTYVDVYSAKFNLISHAKEEGFVDPLKFCCGYGKDGYN----AWCGRS  298

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
               +NG T+  + C+    YVSWDG H ++AAN+     IF+G   +PP PL   CH
Sbjct  299   TNVNG-TIVYDVCDKASMYVSWDGIHYSEAANRWIANHIFNGQLSEPPLPLTQACH  353



>ref|XP_007227131.1| hypothetical protein PRUPE_ppa026073mg, partial [Prunus persica]
 gb|EMJ28330.1| hypothetical protein PRUPE_ppa026073mg, partial [Prunus persica]
Length=369

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 154/361 (43%), Positives = 211/361 (58%), Gaps = 15/361 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGGF A F    PP+G +YF  P GR  DGR+++DF+A  LGL F
Sbjct  13    CKFPAIFNFGDSNSDTGGFSAVFGQARPPHGESYFHGPAGRYCDGRLVIDFIANSLGLPF  72

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F HGANFAT +ST+ P +++L  S  SP SL +Q+++F  F      + 
Sbjct  73    LSAYLDSVGSNFSHGANFATAASTIRPQNTTLHQSGFSPISLDVQYDEFYDFP----PRS  128

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQND----FIFDLASLGISGVNQSLPEVVAQ  679
             Q            +P    F +ALYTF IGQND    F F++++   + V   +P+V+ Q
Sbjct  129   QIVRSQGGVFEQLMPKAEDFSRALYTFDIGQNDLAAGFFFNMST---AQVKAYVPDVLNQ  185

Query  678   ITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNI  499
                 +K++Y  GGR F+I N  P+GC P  LA+L    S +D+ GC   YN     +N+ 
Sbjct  186   FKSIVKNVYDQGGRYFWIHNTGPVGCLPYVLARLPVLASQVDKAGCATPYNEVAQFFNHG  245

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             LK+ + Q R+++  A + YVD +S    L   P  HG +   +ACCG GG    +   L 
Sbjct  246   LKEVVVQLREELPLAAITYVDIYSAKYSLISQPKKHGFEQPIRACCGLGG---KYNNNLH  302

Query  318   CGDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             CG    ++G+ +   +AC+DP  +V+WDGFH T AANK     I  GSY DPP PL   C
Sbjct  303   CGRKIKVHGREILVGKACQDPSLWVNWDGFHYTQAANKRVFDQIVDGSYSDPPVPLKMAC  362

Query  141   H  139
             H
Sbjct  363   H  363



>gb|KDP32799.1| hypothetical protein JCGZ_12091 [Jatropha curcas]
Length=387

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 217/358 (61%), Gaps = 10/358 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGGF AAF    PPYG TYF  P GR +DGR+I+DF+A+ L L +
Sbjct  29    CEFPAIFNFGDSNSDTGGFSAAFGPRTPPYGQTYFGMPAGRDSDGRLIIDFIAKSLNLPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++F+HGANFA+ ++T+  P S + +   SPF L +Q++QF QFK     + 
Sbjct  89    LSAYLNSLGANFKHGANFASSAATIKLPPSVIPNGGYSPFYLQLQYDQFMQFK----SRS  144

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFI--FDLASLGISGVNQSLPEVVAQIT  673
             Q            +P K+ F KALYTF IGQN+F   F   ++ +  VN S+P++V   +
Sbjct  145   QIIREKGGLFAELMPEKDYFEKALYTFDIGQNEFDVGFFANNMSVEQVNASIPDIVNTFS  204

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
              ++K+IY LG R+F+I N  P GC P  L      +++ D  GC K+YN A   +N  LK
Sbjct  205   LSVKNIYNLGARSFWIHNTGPFGCLPYVLTNFP--SAEKDSAGCAKAYNKAAQYFNLRLK  262

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             +++ Q R+++  A   YVD +S+   LF  P  +G +    ACCGYGG  YNF   + CG
Sbjct  263   ESIAQLRKELPLAAFTYVDIYSVKYSLFAEPEKYGFELPLVACCGYGGM-YNFSGSVRCG  321

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             D   +NG  +   +C+ P   V+WDG H T+AANK     I +G++ DP  PL+  C 
Sbjct  322   DNVRVNGSQIVV-SCDRPSVRVNWDGIHYTEAANKFVFDQISTGAFSDPHTPLNMACR  378



>ref|XP_010044555.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Eucalyptus grandis]
Length=387

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/361 (40%), Positives = 210/361 (58%), Gaps = 7/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A +     P+G TYF++P GR +DGR++VDF+AQ  GL +
Sbjct  30    CDFPAIFNFGDSNSDTGGLSAVYGQAPSPHGETYFRQPAGRYSDGRLVVDFIAQSFGLPY  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL ++GS+F HGANFAT  ST+ P +++   +  SP SL +QFN+F +F+     + 
Sbjct  90    LSAYLDAVGSNFSHGANFATSGSTIRPQNTTFRQTGYSPISLDVQFNEFYEFR----RRS  145

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q            LP + +F +ALYTF IGQND       ++  + V   +P+++ Q   
Sbjct  146   QVARSRGGVYEKLLPTEEVFSRALYTFDIGQNDLTAGYFLNMSTNEVKAYIPDLLGQFKN  205

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +  IY  GGR F+I N  P GC P  + ++    S +D+ GC   +N     +N  LK+
Sbjct  206   VVSHIYGEGGRYFWIHNTGPFGCLPYVMERIPILVSQVDRAGCAAPFNEVARHFNRGLKE  265

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R+++  A + YVD +++   L   P  +G K   +ACCG+ GG YNF   + CG 
Sbjct  266   VVTQLRKELPLAAITYVDVYAVKYALISKPVKYGFKQPLRACCGH-GGKYNFDMHMGCGS  324

Query  309   TNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
                + G+ V    +C+DP  YV+WDG+H T+AANK     I  GS+ DPP PL+  CH  
Sbjct  325   KITVGGKEVLVGNSCKDPSVYVNWDGYHYTEAANKQIFDHIVGGSFSDPPVPLNKACHRL  384

Query  132   P  130
             P
Sbjct  385   P  385



>gb|ABK27056.1| unknown [Picea sitchensis]
Length=381

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 163/368 (44%), Positives = 222/368 (60%), Gaps = 18/368 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFP-SLVP---PYGMTYFKKPVGRATDGRVIVDFLAQGL  1039
             C FPAIFNFGDSN+DTGG+  AFP  ++P   PYG T+F +P  R +DGR+ VDFLAQ L
Sbjct  24    CDFPAIFNFGDSNSDTGGWHFAFPYQMLPDNAPYGRTFFGQPSYRYSDGRLSVDFLAQAL  83

Query  1038  GLAFLSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMV  859
             GL F+SP+L+S+GS F  GANFA   ++V P  S+ F++   P SL +Q NQFK FK  V
Sbjct  84    GLPFISPFLQSVGSRFEQGANFAASGASVRP-TSTDFNA---PISLTVQLNQFKVFKQQV  139

Query  858   DEQEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGIS--GVNQS-LPEV  688
              +     H S N+    LP  + F   +YT  IG NDF     SL +S   V Q+ LP++
Sbjct  140   LD-TISSHGSLNY----LPSADSFKTGIYTIEIGGNDFDNAYRSLKLSPLQVKQTILPKL  194

Query  687   VAQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADY  508
                +   ++++Y  G RT  + ++ P GC P +L   SH  +D DQ GC  SYN+AV  Y
Sbjct  195   AKSVGGAVQELYNEGARTILVKDVGPQGCGPFWLTYFSHAPTDFDQHGCSISYNDAVQFY  254

Query  507   NNILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKK  328
             N  L++ L   R+ +  A++VYV  + II + F +P+ +G K  T++CCG  GG YNF  
Sbjct  255   NTQLREQLSLVRKQLPGADIVYVSQYDIIYDFFANPSKYGFKATTQSCCGV-GGKYNFTW  313

Query  327   ELFCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPP-FPLH  151
                CG T  +NG++VT  +C DP +Y+ WDG HLTD AN+V  Q I  G YF+P  F + 
Sbjct  314   AAQCGLTGPVNGKSVTVGSCSDPASYIIWDGIHLTDQANRVLTQQILGGKYFEPSTFSIT  373

Query  150   HFCHIHPI  127
               C   PI
Sbjct  374   SRCQTQPI  381



>ref|XP_002285512.1| PREDICTED: GDSL esterase/lipase At3g26430 [Vitis vinifera]
 emb|CBI16796.3| unnamed protein product [Vitis vinifera]
Length=383

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/360 (40%), Positives = 212/360 (59%), Gaps = 6/360 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPA+FNFGDSN+DTGG  AAF    PP G TYF  P GR +DGR+I+DF+A+ +GL +
Sbjct  27    CEFPAVFNFGDSNSDTGGLSAAFGQAGPPAGETYFHAPAGRYSDGRLIIDFIAESVGLPY  86

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS +L ++GS+F HGANFAT  ST+ PP+++L  S  SP SL +Q+ +F  F      + 
Sbjct  87    LSAFLDALGSNFTHGANFATAGSTIRPPNATLSQSGFSPISLNVQWYEFHDFH----RRS  142

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q   +     +  +P +  F +ALYTF IGQND  +   +++    V   +P+V+ Q   
Sbjct  143   QIIRNRGGVFSQLMPKEESFSRALYTFDIGQNDLTYGYFSNMSTDQVRAYVPDVLDQFRT  202

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IKDIY  GGR+F+I N  P+GC P  + ++      +D++GC   +N     +N  LK+
Sbjct  203   VIKDIYDQGGRSFWIHNTGPVGCLPYVMDRVPITAGQVDKYGCADPFNEVAKYFNLKLKE  262

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              +++ RQ++ +A + YVD +S+   L       G     +ACCG+ GG YN+   + CG 
Sbjct  263   MVQKLRQELPEAAITYVDVYSVKYTLITKAKKFGFVQPLRACCGH-GGKYNYNIHVGCGG  321

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHP  130
                ++G+ V   +C+DP   ++WDG H T+AANK     I  G + DPP PL+  C  HP
Sbjct  322   KVKVDGKEVVVGSCKDPSVKINWDGVHFTEAANKWIFDKIVGGEFSDPPIPLNMACQRHP  381



>ref|XP_004493252.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Cicer arietinum]
Length=391

 Score =   292 bits (747),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 154/361 (43%), Positives = 212/361 (59%), Gaps = 8/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGG  AAF    PP+G ++F  PVGR  DGR+I+DF+A+ LG  +
Sbjct  35    CDFSAIFNFGDSNSDTGGLSAAFGQPGPPFGESFFHHPVGRYCDGRLIIDFIAEKLGHPY  94

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDS-RVSPFSLAIQFNQFKQFKVMVDEQ  850
             L+ YL ++GS+F HGANFAT  ST+ P +++L  +   SPFSL +QFNQF  F+     +
Sbjct  95    LNAYLDAVGSNFSHGANFATAGSTIRPQNTTLHQTGGFSPFSLDVQFNQFNDFQ----RR  150

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQIT  673
              Q   +      T LP    F +ALYTF IGQND       ++ I+ V   +P+V+AQ  
Sbjct  151   TQIFRNKGEIFKTLLPKAEDFSRALYTFDIGQNDLTSGYFHNMSINQVRAYVPDVLAQFK  210

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               IK++Y+ GGR+F++ N  P+GC P  +        D D+ GC   YN     +N+ LK
Sbjct  211   IIIKNVYVRGGRSFWVHNTGPVGCLPYIIDLHKVKADDFDKAGCAIPYNEVAQFFNHELK  270

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
              A+ Q R+ +  A + YVD +S    L  HP  HG +   + CCG+ GG YN+   + CG
Sbjct  271   SAVVQLRKKLPLAAITYVDVYSAKYSLISHPKKHGFEEPLRGCCGH-GGKYNYNLHIGCG  329

Query  312   DTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHI  136
                 +NG+ +   +AC+DP  +V+WDG H T A NK     I  GSY DPP PL+  CH 
Sbjct  330   AKVKINGKEILIGKACKDPSVWVNWDGVHYTQAGNKWVFDQIVDGSYSDPPIPLNKACHK  389

Query  135   H  133
             H
Sbjct  390   H  390



>ref|XP_007159263.1| hypothetical protein PHAVU_002G223300g [Phaseolus vulgaris]
 gb|ADR66028.1| acetylcholinesterase [Afgekia filipes]
 gb|ESW31257.1| hypothetical protein PHAVU_002G223300g [Phaseolus vulgaris]
Length=382

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/360 (41%), Positives = 208/360 (58%), Gaps = 9/360 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAI+NFGDSN+DTGG  A+F  +  PYG  +F KP GR  DGR+I+DF+A+ L L +
Sbjct  30    CSFPAIYNFGDSNSDTGGISASFVPIPAPYGEGFFHKPSGRDCDGRLIIDFIAEKLNLPY  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G+++RHGANFAT  ST+   + ++F   +SPFSL IQ  QF QFK    +  
Sbjct  90    LSAYLNSLGTNYRHGANFATGGSTIRKQNETIFQYGISPFSLDIQIVQFNQFKARTKQLY  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             +E         +KLP    F KALYTF IGQND       +    + +S+P++V Q+   
Sbjct  150   EEAKTPLER--SKLPVPEEFSKALYTFDIGQNDLSVGFRKMNFDQIRESMPDIVNQLANA  207

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHN--TSDLDQFGCLKSYNNAVADYNNILK  493
             +K+IY  GGR+F+I N +P GC P  L    HN     LDQ+GC+K  N    ++N  LK
Sbjct  208   VKNIYEQGGRSFWIHNTSPFGCMPVQLF-YKHNIPIGYLDQYGCVKDQNEMATEFNKHLK  266

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             D + + R ++  A + YVD ++    L  +  + G     K CCGY   D      ++CG
Sbjct  267   DRIIKLRTELPQAAITYVDAYAAKYALISNTKTEGFVDPMKICCGYHVND----THIWCG  322

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
             +    +G+ V   ACE+P  Y+SWD  H  +AAN      I +GS+ DPP P+   C+ H
Sbjct  323   NLGSADGKDVFGSACENPSQYISWDSVHYAEAANHWVANRILNGSFTDPPTPITQACYTH  382



>ref|XP_009415970.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score =   291 bits (745),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 150/360 (42%), Positives = 209/360 (58%), Gaps = 12/360 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAIFNFGDSN+DTGG  AAF    PP+G T+F  P GR  DGR+I+DF+AQGLGL F
Sbjct  26    CAFPAIFNFGDSNSDTGGLSAAFGPAPPPHGETFFGAPAGRYCDGRLIIDFIAQGLGLPF  85

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L+ YL S+ ++F HGANFAT  ST+   +++LF +  SPFSL +Q  Q+ QFK       
Sbjct  86    LNAYLDSVATNFSHGANFATAGSTIQRQNTTLFQTGYSPFSLDVQSWQYAQFK-------  138

Query  846   QEQHHSYNHG--NTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQI  676
                  +Y  G    +LPP++ F KALYTF IGQND     ++++    V  ++P+++ + 
Sbjct  139   SRSQIAYKKGVFKDELPPEDYFSKALYTFDIGQNDLTSGYVSNMTTDEVKATIPDILNKF  198

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
             T  IK +Y  GGR F+I N  P GC P  L +      ++D  GC   +N+    +N  L
Sbjct  199   TVVIKGVYGQGGRFFWIHNTGPFGCLPYVLDRYPIRAPEVDHVGCGAPFNDVAQLFNAKL  258

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K+ + Q R+D+  A   YVD ++I   L      H  ++   ACCG+ GG YN+     C
Sbjct  259   KETVAQLRKDLPQAVFTYVDVYTIKYSLISQAKKHSFEHPLVACCGH-GGKYNYNIHWGC  317

Query  315   GDTNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             G   ++NG + +  +AC DP   + WDG H T+AANK     I  G++ DPP PL   C 
Sbjct  318   GSKVIVNGTEVLVGKACRDPLKRICWDGVHYTEAANKWVYDQIVEGAFSDPPVPLRMACQ  377



>gb|KCW86642.1| hypothetical protein EUGRSUZ_B03271 [Eucalyptus grandis]
Length=421

 Score =   293 bits (749),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 146/361 (40%), Positives = 210/361 (58%), Gaps = 7/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A +     P+G TYF++P GR +DGR++VDF+AQ  GL +
Sbjct  64    CDFPAIFNFGDSNSDTGGLSAVYGQAPSPHGETYFRQPAGRYSDGRLVVDFIAQSFGLPY  123

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL ++GS+F HGANFAT  ST+ P +++   +  SP SL +QFN+F +F+     + 
Sbjct  124   LSAYLDAVGSNFSHGANFATSGSTIRPQNTTFRQTGYSPISLDVQFNEFYEFR----RRS  179

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q            LP + +F +ALYTF IGQND       ++  + V   +P+++ Q   
Sbjct  180   QVARSRGGVYEKLLPTEEVFSRALYTFDIGQNDLTAGYFLNMSTNEVKAYIPDLLGQFKN  239

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +  IY  GGR F+I N  P GC P  + ++    S +D+ GC   +N     +N  LK+
Sbjct  240   VVSHIYGEGGRYFWIHNTGPFGCLPYVMERIPILVSQVDRAGCAAPFNEVARHFNRGLKE  299

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R+++  A + YVD +++   L   P  +G K   +ACCG+ GG YNF   + CG 
Sbjct  300   VVTQLRKELPLAAITYVDVYAVKYALISKPVKYGFKQPLRACCGH-GGKYNFDMHMGCGS  358

Query  309   TNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
                + G+ V    +C+DP  YV+WDG+H T+AANK     I  GS+ DPP PL+  CH  
Sbjct  359   KITVGGKEVLVGNSCKDPSVYVNWDGYHYTEAANKQIFDHIVGGSFSDPPVPLNKACHRL  418

Query  132   P  130
             P
Sbjct  419   P  419



>gb|KHN34622.1| GDSL esterase/lipase [Glycine soja]
Length=385

 Score =   291 bits (745),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 156/361 (43%), Positives = 213/361 (59%), Gaps = 8/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP+G +YF  P GR  DGR+IVDFLA+ LGL +
Sbjct  29    CHFPAIFNFGDSNSDTGGLSAAFGQAGPPHGESYFHHPAGRYCDGRLIVDFLAKKLGLPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDS-RVSPFSLAIQFNQFKQFKVMVDEQ  850
             LS +L S+GS++ HGANFAT  ST+ P +++L  +   SPFSL +QFNQF  F+     +
Sbjct  89    LSAFLDSVGSNYSHGANFATAGSTIRPQNTTLHQTGGFSPFSLDVQFNQFSDFQ----RR  144

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQIT  673
              Q  H+      T LP    F +ALYTF IGQND       ++    V   +P+V+AQ  
Sbjct  145   TQFFHNKGGVYKTLLPKAEDFSQALYTFDIGQNDLASGYFHNMSTDQVKAYVPDVLAQFK  204

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               IK +Y  GGR+F++ N  P+GC P  +       S +D+ GC   YN     +N+ LK
Sbjct  205   NVIKYVYNHGGRSFWVHNTGPVGCLPYIMDLHPVKPSLVDKAGCATPYNEVAKFFNSKLK  264

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             + + Q R+++  A + YVD +S+   L   P  HG +   +ACCG+ GG YN+   + CG
Sbjct  265   EVVVQLRKELPLAAITYVDVYSVKYSLISQPKKHGFEEPLRACCGH-GGKYNYNLHIGCG  323

Query  312   DTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHI  136
                  +G+ +   + C+DP  +V+WDG H T AANK     IF GS+ DPP PL+  CH 
Sbjct  324   AKIKAHGKEILVGKPCKDPSVWVNWDGVHYTQAANKWVFDQIFDGSFSDPPIPLNMACHK  383

Query  135   H  133
             H
Sbjct  384   H  384



>ref|XP_008221893.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Prunus mume]
Length=400

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 153/361 (42%), Positives = 211/361 (58%), Gaps = 15/361 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGGF A F    PP+G +YF  P GR  DGR+++DF+A  LGL F
Sbjct  44    CKFPAIFNFGDSNSDTGGFSAVFGQARPPHGESYFHGPAGRYCDGRLVIDFIANSLGLPF  103

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F HGANFAT +ST+ P +++L  S  SP SL +Q+++F  F      + 
Sbjct  104   LSAYLDSVGSNFSHGANFATAASTIRPQNTTLHQSGFSPISLDVQYDEFYDFP----PRS  159

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQND----FIFDLASLGISGVNQSLPEVVAQ  679
             Q            +P    F +ALYTF IGQND    F F++++   + V   +P+V+ Q
Sbjct  160   QIVRSQGGVFEQLMPKAEDFSRALYTFDIGQNDLAAGFFFNMST---AQVKAYVPDVLNQ  216

Query  678   ITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNI  499
                 +K++Y  GGR F+I N  P+GC P  LA+L    S +D+ GC   YN     +N+ 
Sbjct  217   FKSIVKNVYDQGGRYFWIHNTGPVGCLPYVLARLPVLASQVDKAGCATPYNEVAQFFNHG  276

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             LK+ + Q R+++  A + YVD +S    L   P  HG +   +ACCG GG    +   L 
Sbjct  277   LKEVVVQLREELPLAAITYVDIYSAKYSLISQPKKHGFEQPIRACCGQGG---KYNNNLH  333

Query  318   CGDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             CG    ++G+ +   +AC+DP  +V+WDGFH T AANK     I  GS+ DPP PL   C
Sbjct  334   CGGKIKVHGREILVGKACQDPSLWVNWDGFHYTQAANKRVFDQIVDGSFSDPPVPLKMVC  393

Query  141   H  139
             H
Sbjct  394   H  394



>ref|XP_003554066.1| PREDICTED: GDSL esterase/lipase At3g26430 [Glycine max]
Length=393

 Score =   291 bits (745),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 156/361 (43%), Positives = 213/361 (59%), Gaps = 8/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP+G +YF  P GR  DGR+IVDFLA+ LGL +
Sbjct  37    CHFPAIFNFGDSNSDTGGLSAAFGQAGPPHGESYFHHPAGRYCDGRLIVDFLAKKLGLPY  96

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDS-RVSPFSLAIQFNQFKQFKVMVDEQ  850
             LS +L S+GS++ HGANFAT  ST+ P +++L  +   SPFSL +QFNQF  F+     +
Sbjct  97    LSAFLDSVGSNYSHGANFATAGSTIRPQNTTLHQTGGFSPFSLDVQFNQFSDFQ----RR  152

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQIT  673
              Q  H+      T LP    F +ALYTF IGQND       ++    V   +P+V+AQ  
Sbjct  153   TQFFHNKGGVYKTLLPKAEDFSQALYTFDIGQNDLASGYFHNMSTDQVKAYVPDVLAQFK  212

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               IK +Y  GGR+F++ N  P+GC P  +       S +D+ GC   YN     +N+ LK
Sbjct  213   NVIKYVYNHGGRSFWVHNTGPVGCLPYIMDLHPVKPSLVDKAGCATPYNEVAKFFNSKLK  272

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             + + Q R+++  A + YVD +S+   L   P  HG +   +ACCG+ GG YN+   + CG
Sbjct  273   EVVVQLRKELPLAAITYVDVYSVKYSLISQPKKHGFEEPLRACCGH-GGKYNYNLHIGCG  331

Query  312   DTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHI  136
                  +G+ +   + C+DP  +V+WDG H T AANK     IF GS+ DPP PL+  CH 
Sbjct  332   AKIKAHGKEILVGKPCKDPSVWVNWDGVHYTQAANKWVFDQIFDGSFSDPPIPLNMACHK  391

Query  135   H  133
             H
Sbjct  392   H  392



>ref|XP_007224644.1| hypothetical protein PRUPE_ppa026400mg, partial [Prunus persica]
 gb|EMJ25843.1| hypothetical protein PRUPE_ppa026400mg, partial [Prunus persica]
Length=367

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 153/358 (43%), Positives = 205/358 (57%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A F     P+G +YF  P GR  DGR+++DF+A+  GL F
Sbjct  10    CKFPAIFNFGDSNSDTGGLSAVFGQARSPHGESYFHGPAGRYCDGRLVIDFIAKSFGLPF  69

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F HGANFAT  ST+ P +++L  S  SP SL +Q+N+F  F      + 
Sbjct  70    LSAYLDSVGSNFSHGANFATAGSTIRPQNTTLRQSGFSPISLDVQYNEFYDFH----PRS  125

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDL-ASLGISGVNQSLPEVVAQITK  670
             Q   +        +P    F +ALYTF IGQND    L  ++  + V   +P+V+ Q   
Sbjct  126   QVARNRGGVFKQLMPKAQDFSRALYTFDIGQNDLTAGLFLNMSTTQVKAYVPDVLNQFKN  185

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +K+IY  GGR F+I N  PIGC P  L +L    + +D  GC   YN     +N  LK 
Sbjct  186   IVKNIYGQGGRYFWIHNTGPIGCLPYVLDRLPVLAAQVDNAGCAIPYNKVAQFFNRGLKQ  245

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+D+  A + YVD +S    L   P  HG K   +ACCG+ GG YN+   + CG 
Sbjct  246   AVFQLRKDLPLAAITYVDVYSAKYSLISQPEKHGFKEPVRACCGH-GGKYNYNLHIGCGG  304

Query  309   TNVLNGQT-VTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                ++G+  +  +AC+DP  +V+WDG H T AANK     I  GS+ DPP PL   CH
Sbjct  305   KAKVHGKVKLVGKACQDPSLWVNWDGVHYTQAANKRVFDQIVDGSFSDPPIPLKRACH  362



>ref|XP_007224325.1| hypothetical protein PRUPE_ppa020425mg [Prunus persica]
 gb|EMJ25524.1| hypothetical protein PRUPE_ppa020425mg [Prunus persica]
Length=373

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/359 (45%), Positives = 211/359 (59%), Gaps = 11/359 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AA     PP G T+F  P GR +DGR+I+DFLA+ LG  F
Sbjct  19    CHFPAIFNFGDSNSDTGGMAAAIYRPPPPSGKTHFHTPAGRFSDGRLIIDFLAKSLGHPF  78

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSL-FDSRVSPFSLAIQFNQFKQFKVMVDEQ  850
             LS YL SIG++F HGANFAT SST+  P   +      SPF+L IQ +QF Q K     +
Sbjct  79    LSAYLDSIGTNFSHGANFATASSTIRLPDPIIPAPGGFSPFTLNIQCSQFLQLK----SR  134

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQIT  673
              Q   H      + +P K  F KALYTF IGQND       +L +  VN S+P +V+  +
Sbjct  135   SQLIRHRGGIFASLMPKKKYFAKALYTFDIGQNDLPEGFFGNLTVQEVNASVPNIVSTFS  194

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               IK IY  GGR+F+I N  PIGC P  L       +  D+ GC K YN     +N+ LK
Sbjct  195   ANIKKIYDSGGRSFWIHNTGPIGCIPYILVNFP---AQKDEVGCAKLYNEVAQYFNHKLK  251

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNF-KKELFC  316
             +A  Q R+D+  A + YVD +S+   L++ P  +  +    +CCG  GG YNF  K + C
Sbjct  252   EATVQLRKDLPLAAITYVDIYSVKYSLYKEPQKYRFEQPLVSCCG-TGGKYNFNSKTVEC  310

Query  315   GDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             G T  +NG+ + A++C+ PY  V+WDG H TDAA K+    I +G++ DPP PL   CH
Sbjct  311   GRTVTVNGRQIFADSCKRPYVKVNWDGIHYTDAAAKIIFDKISTGAFSDPPLPLKQACH  369



>ref|XP_008221894.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Prunus mume]
Length=391

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 153/358 (43%), Positives = 205/358 (57%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A F     P+G +YF  P GR  DGR+++DF+A+  GL F
Sbjct  34    CKFPAIFNFGDSNSDTGGLSAVFGQARSPHGESYFHGPAGRYCDGRLVIDFIAKSFGLPF  93

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F HGANFAT  ST+ P +++L  S  SP SL +Q+N+F  F      + 
Sbjct  94    LSAYLDSVGSNFSHGANFATAGSTIRPQNTTLRQSGFSPISLDVQYNEFYDFH----PRS  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDL-ASLGISGVNQSLPEVVAQITK  670
             Q   +        +P    F +ALYTF IGQND    L  ++  + V   +P+V+ Q   
Sbjct  150   QVARNRGGVFKQLMPKAQDFSRALYTFDIGQNDLTAGLFLNMSTTQVKAYVPDVLNQFKN  209

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +K+IY  GGR F+I N  PIGC P  L +L    + +D  GC   YN     +N  LK 
Sbjct  210   IVKNIYGQGGRYFWIHNTGPIGCLPYVLDRLPVLAAQVDNAGCAIPYNKVAQFFNRGLKQ  269

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+D+  A + YVD +S    L   P  HG K   +ACCG+ GG YN+   + CG 
Sbjct  270   AVFQLRKDLPLAAITYVDVYSAKYSLISQPEKHGFKEPVRACCGH-GGKYNYNLHIGCGG  328

Query  309   TNVLNGQT-VTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                ++G+  +  +AC+DP  +V+WDG H T AANK     I  GS+ DPP PL   CH
Sbjct  329   KAKVHGKVKLVGKACQDPSLWVNWDGVHYTQAANKRVFDQIVDGSFSDPPIPLKRACH  386



>ref|XP_004158356.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Cucumis sativus]
Length=357

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/358 (41%), Positives = 213/358 (59%), Gaps = 9/358 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAI+NFGDSN+DTGG  AAF   + P G T+F K  GR  DGR+I+DF+A+ L L +
Sbjct  7     CNFPAIYNFGDSNSDTGGISAAFYPTILPCGQTFFHKTAGRGCDGRLIIDFIAKQLELPY  66

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFK-VMVDEQ  850
             LS YL SIG++FRHGANFAT  ST+   + S+F++ +SPFSL IQ  QF+QFK   +D  
Sbjct  67    LSAYLNSIGTNFRHGANFATGGSTIRRQNESVFENGISPFSLDIQVIQFRQFKNRTIDRY  126

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITK  670
              +    S     + LP    F KAL+T  IGQND       +      +++P+++++   
Sbjct  127   VEAIDDSI---RSTLPVPEEFSKALFTIDIGQNDLSAGFRKMTNDQFRKAIPDIISEFAT  183

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSH-NTSDLDQFGCLKSYNNAVADYNNILK  493
              ++D+Y  G R F++ N  PIGC P  +  +S+    DLD+ GC+K  N+A  ++N  LK
Sbjct  184   AVEDLYKEGARAFWVHNTGPIGCIPVAIRSVSNPKEGDLDRNGCVKEQNDAALEFNRQLK  243

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             + + + R ++ DA++VYVD ++  ++L  +    G       CCGY  G       ++CG
Sbjct  244   ERVVKLRANLLDASLVYVDVYAAKIKLIANAKEEGFMEKGAICCGYHEG----LNHVWCG  299

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             +   +NG  V A +CEDP  ++SWDG H T+AAN+     I  GS+ DP  P+ H C 
Sbjct  300   NRKTINGSEVYAGSCEDPSKFISWDGVHYTEAANQWIANQIVKGSFSDPQVPIMHACR  357



>ref|XP_007221845.1| hypothetical protein PRUPE_ppa024482mg [Prunus persica]
 gb|EMJ23044.1| hypothetical protein PRUPE_ppa024482mg [Prunus persica]
Length=391

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/359 (45%), Positives = 214/359 (60%), Gaps = 13/359 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTG + A+F  L PPYG TYF  PVGR +DGR+I+DFLA+ LG  F
Sbjct  36    CEFPAIFNFGDSNSDTGAY-ASFLPLPPPYGETYFHMPVGRFSDGRLIIDFLAKSLGHPF  94

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDS--RVSPFSLAIQFNQFKQFKVMVDE  853
             LS YL S+GS+F +GANFAT  ST+  P   +F +    SPF L IQ+ QF Q K +   
Sbjct  95    LSAYLNSLGSNFSYGANFATGGSTIRLP-DRIFPAGGGFSPFYLNIQYMQFLQLKSI---  150

Query  852   QEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQI  676
               Q   H      + +P ++ F KALYTF IGQND     + +L +  VN S+P++++  
Sbjct  151   -SQLIRHQGGIFASLMPKESNFSKALYTFDIGQNDLAEGFSDNLTVQQVNASVPDIISGF  209

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
             +  IK IY LG R+F+I N  PIGC P+ LA      +  D+ GC KSYN     +N  L
Sbjct  210   SANIKKIYDLGARSFWIHNTGPIGCLPTILANF---PAQKDEAGCAKSYNEVAQHFNQKL  266

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K+A  Q R+D+  A + YVD +S+   LF+ P  +G +    ACCGY GG YN+     C
Sbjct  267   KEATVQLRKDLPLAAITYVDVYSVKYSLFKEPQKYGFELPLVACCGY-GGKYNYNSSSSC  325

Query  315   GDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             G T  +NG  +   +C+DP   V+WDG H T+AA K     I +G++ DPP      CH
Sbjct  326   GGTARVNGSQIFVGSCKDPSVRVNWDGTHYTEAAAKFISDKISTGAFSDPPLAFKQACH  384



>gb|AGZ15410.1| acetylcholinesterase [Phaseolus vulgaris]
Length=382

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/360 (41%), Positives = 207/360 (58%), Gaps = 9/360 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAI+NFGDSN+DTGG  A+F  +  PYG  +F KP GR  DGR+I+DF+A  L L +
Sbjct  30    CSFPAIYNFGDSNSDTGGISASFVPIPAPYGEGFFHKPSGRDCDGRLIIDFIADKLNLPY  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +S YL S+G+++RHGANFAT  ST+   + ++F   +SPFSL IQ  QF QFK    +  
Sbjct  90    ISAYLNSLGTNYRHGANFATGGSTIRKQNETIFQYGISPFSLDIQIVQFNQFKARTKQLY  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             +E         +KLP    F KALYTF IGQND       +    + +S+P++V Q+   
Sbjct  150   EEAKTPLER--SKLPVPEEFSKALYTFDIGQNDLSVGFRKMNFDQIRESMPDIVNQLANA  207

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHN--TSDLDQFGCLKSYNNAVADYNNILK  493
             +K+IY  GGR+F+I N +P GC P  L    HN     LDQ+GC+K  N    ++N  LK
Sbjct  208   VKNIYEQGGRSFWIHNTSPFGCMPVQLF-YKHNIPIGYLDQYGCVKDQNEMATEFNKHLK  266

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             D + + R ++  A + YVD ++    L  +  + G     K CCGY   D      ++CG
Sbjct  267   DRIIKLRTELPQAAITYVDAYAAKYALISNTKTEGFVDPMKICCGYHVND----THIWCG  322

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
             +    +G+ V   ACE+P  Y+SWD  H  +AAN      I +GS+ DPP P+   C+ H
Sbjct  323   NLGSADGKDVFGSACENPSQYISWDSVHYAEAANHWVANRILNGSFTDPPTPITQACYTH  382



>ref|XP_010551928.1| PREDICTED: GDSL esterase/lipase At5g14450 [Tarenaya hassleriana]
Length=383

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/357 (41%), Positives = 211/357 (59%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAI+NFGDSN+DTGG  AAF  +  PYG ++F++P GR +DGR+ +DF+A+ LGL +
Sbjct  31    CSFPAIYNFGDSNSDTGGISAAFEPIRSPYGQSFFREPSGRDSDGRLTIDFIAERLGLPY  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++FR+GANFAT  ST+   + ++F   +SPFSL +Q  QF QFK     Q 
Sbjct  91    LSAYLNSLGANFRNGANFATGGSTIRRQNETIFQYGISPFSLDMQVVQFDQFKAR-SAQL  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
               Q  S    + KLP +  F KALYTF IGQND      ++    +  +LP++V+Q    
Sbjct  150   LSQSKSRAERD-KLPRQEDFSKALYTFDIGQNDISVGFRTMSFDQLKATLPDIVSQFASA  208

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILKD  490
             ++ IY  GGR+F++ N  P GC P  +  + +     LD+ GC+K+ N    ++N +LK+
Sbjct  209   VRSIYERGGRSFWVHNTGPFGCLPVNMFYMGNPPPGYLDEHGCVKAQNQMSMEFNRLLKE  268

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ + R ++ +A + YVD +S   E+  +P S G     K CCGY    +     ++CG+
Sbjct  269   AVIKLRSELTEAAITYVDVYSAKYEMISNPKSRGFADPLKVCCGY----HEKFDHIWCGN  324

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +N   +   +C  P   VSWDG H T+AANK       +GS  DPP P+   CH
Sbjct  325   KGKVNSTEIYGGSCPKPAAAVSWDGVHYTEAANKYVADRTLNGSLTDPPVPVTRACH  381



>ref|XP_004491984.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X1 [Cicer 
arietinum]
Length=385

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/357 (41%), Positives = 209/357 (59%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAI+NFGDSN+DTGG  AAF  +  PYG  +F KP GR +DGRVI+DF+A+ L L +
Sbjct  28    CDFPAIYNFGDSNSDTGGISAAFQPIPSPYGDGFFHKPSGRDSDGRVILDFIAEKLNLPY  87

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++++HGANFAT  ST+   + ++F+  +SPFSL IQ  QF QFK       
Sbjct  88    LSAYLNSLGTNYKHGANFATGGSTIRRQNETIFEYGISPFSLDIQIVQFNQFKTRTKLLY  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             QE  +S     +KLP    F KALYTF IGQND       +    +  S+P++V Q+   
Sbjct  148   QEAKNSVER--SKLPVPEEFSKALYTFDIGQNDLSVGFRKMNFDQIRVSMPDIVNQLASA  205

Query  666   IKDIYLLGGRTFFILNLAPIGCYP-SFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             +K+IY  GGR+F+I N  PIGC P +   K +     LDQ+GC+  +N    ++N  LKD
Sbjct  206   VKNIYQQGGRSFWIHNTGPIGCLPVNQFYKHNLPVGYLDQYGCVNDHNVMAVEFNKQLKD  265

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R ++ +A + YVD ++    L  +  + G       CCGY   D      ++CG+
Sbjct  266   RVVKMRTELPEAAITYVDVYAAKYGLISNTKNEGFVDPMNICCGYHVND----THIWCGN  321

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                 NG+ V   +CE P  YVSWDG H  +AAN+     I +G++ DP  P+ H C+
Sbjct  322   LGSANGKDVYGTSCEKPSMYVSWDGVHYAEAANRWVANRILNGNFTDPSTPISHACY  378



>gb|EYU30623.1| hypothetical protein MIMGU_mgv1a007766mg [Erythranthe guttata]
Length=396

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 154/366 (42%), Positives = 214/366 (58%), Gaps = 19/366 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP G +YF  P GR +DGR+++DF+A+ LGL +
Sbjct  42    CHFPAIFNFGDSNSDTGGLSAAFGQAPPPNGESYFHGPAGRYSDGRLVIDFIAESLGLPY  101

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL ++GS+F +GANFAT  ST+ P + +L  S  SPFSL +Q+ QF  F       +
Sbjct  102   LSAYLDALGSNFTNGANFATAGSTIRPQNMTLHQSGFSPFSLNVQYYQFNDF-------Q  154

Query  846   QEQHHSYNHGNT---KLPPKNIFGKALYTFYIGQND----FIFDLASLGISGVNQSLPEV  688
             +   +  N G      LP    F  ALYTF IGQND    + F++ +     V + +P+V
Sbjct  155   RRSQYIRNQGGVFARLLPNAEDFSHALYTFDIGQNDLTAGYFFNMTT---DQVREYVPDV  211

Query  687   VAQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADY  508
             + Q    +K IY  GGR+F+I N  P+GC P  + ++      +D+ GC   +N     Y
Sbjct  212   LDQFKTVVKYIYDHGGRSFWIHNTGPVGCLPYVMDRVPITAGQVDKVGCATPFNEVARYY  271

Query  507   NNILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKK  328
             N  LK+A+ Q R+D+  A   YVD +S+  EL      HG  +  KACCG+ GG YNF  
Sbjct  272   NLKLKEAVVQLRKDLPSAAFTYVDVYSVKYELISQAKKHGFVHPLKACCGH-GGKYNFNM  330

Query  327   ELFCGDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLH  151
                CG    ++G+ +   ++C+DP   ++WDG H T+AANK     I SG+Y DPP PL+
Sbjct  331   HHGCGSKIKVHGKEIMVGKSCKDPTVAINWDGVHYTEAANKWVFDQIVSGAYSDPPIPLN  390

Query  150   HFCHIH  133
               CH+H
Sbjct  391   KACHMH  396



>gb|KDP46394.1| hypothetical protein JCGZ_10234 [Jatropha curcas]
Length=389

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/357 (41%), Positives = 216/357 (61%), Gaps = 6/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAI+NFGDSN+DTGG  AAF  +  PYG  +F KP GR +DGR+I+DF+A+ L L +
Sbjct  36    CKFPAIYNFGDSNSDTGGISAAFEPIRAPYGEAFFHKPAGRDSDGRLIIDFIAETLKLPY  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL SIG+++RHGANFAT  ST+   + ++F+  +SPFSL +Q  QF QFK    +  
Sbjct  96    LSAYLNSIGTNYRHGANFATGGSTIRRQNETIFEYGISPFSLDMQIVQFDQFKSRTADLY  155

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              E  ++  H   KLP  + F KALYTF IGQND       + I  +  ++P+++ Q+   
Sbjct  156   NEVKNN-THEAGKLPRPDEFAKALYTFDIGQNDLSVGFRKMSIDQLRAAMPDIINQLATA  214

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILKD  490
             ++ +Y  GGR+F+I N  PIGC P  L  +S+  +  LD+ GC+K+ N+   ++N+ LK+
Sbjct  215   VQHLYQQGGRSFWIHNTGPIGCLPVNLFYVSNPPAGYLDEHGCIKAQNDMAVEFNSKLKE  274

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R ++ +A + YVD ++    L  +  + G+    K CCGY      F   ++CG+
Sbjct  275   RVVKLRAELPEAAITYVDVYAAKYGLISNAKNLGMADPLKVCCGY---HVKF-DHIWCGN  330

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +N   V   +C+DP  ++SWDG H T+AAN+       +GS  DPP P+ H CH
Sbjct  331   KGSVNNSEVYGASCKDPSLFISWDGVHYTEAANQWVADHTQNGSLTDPPIPITHACH  387



>ref|XP_008782097.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Phoenix dactylifera]
Length=382

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 152/363 (42%), Positives = 204/363 (56%), Gaps = 19/363 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPA+FN GDSN+DTGG  A F  L  PYG + F KP GR +DGR+I+DF+A+ LGL +
Sbjct  26    CHFPAVFNLGDSNSDTGGLSATFGPLTYPYGESLFGKPAGRYSDGRLIIDFIAESLGLPY  85

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +S YL S+G++F HGANFAT  ST++P + +L     SPFSL +Q  QF QFK       
Sbjct  86    ISAYLDSMGTNFSHGANFATALSTILPQNITLSQGGYSPFSLDVQLKQFLQFK-------  138

Query  846   QEQHHSYNHGNT---KLPPKNIFGKALYTFYIGQND---FIFDLASLGISGVNQSLPEVV  685
                   YN G      +P +  F +ALYTF IGQND   F F   S       + +P  +
Sbjct  139   SRSQMIYNEGGIYKDLIPKEEYFSRALYTFDIGQNDLTAFYFLNES-----TEEYIPNAL  193

Query  684   AQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYN  505
              + ++ IK IY  GGR+F+I N  P+GC P  L +     SDLD  GC   YN    ++N
Sbjct  194   KEFSRVIKSIYEEGGRSFWIHNTGPLGCLPYVLVQGHLAPSDLDSAGCAIRYNKLAQEFN  253

Query  504   NILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKE  325
              +L D + Q R+D+  A    VD +SI   L    T  G     +ACCGYGGG YN+   
Sbjct  254   RMLNDTVAQLRKDLPLAAFTLVDMYSIKYLLVSQATKQGFVLPFRACCGYGGGVYNYNSN  313

Query  324   LFCGDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHH  148
             + CGD   +NG  +   ++C +P   ++WDG H T+AAN+     I  G++ DP  PL  
Sbjct  314   IRCGDMAKVNGTMILLGKSCRNPRKRINWDGVHYTEAANRWVFNQISRGAFSDPAMPLSM  373

Query  147   FCH  139
              CH
Sbjct  374   ACH  376



>gb|KDP26686.1| hypothetical protein JCGZ_17844 [Jatropha curcas]
Length=394

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 155/364 (43%), Positives = 209/364 (57%), Gaps = 11/364 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A F    PP+G +YF  P GR  DGR+I+DF+A+ LGL +
Sbjct  37    CHFPAIFNFGDSNSDTGGLSAVFGQAPPPHGESYFHHPAGRYCDGRLIIDFIAESLGLPY  96

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+FRHGANFAT  ST+   +++L  S  SP SL  Q+N+F QF        
Sbjct  97    LSAYLDSVGSNFRHGANFATAGSTIRLQNTTLTQSGFSPISLNFQWNEFYQF------HN  150

Query  846   QEQHHSYNHGNTK--LPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQI  676
             + Q      G  K  LP    F +ALYTF IGQND       ++  + V   +PEV++Q 
Sbjct  151   RSQIFRQKGGIYKKLLPKAGDFARALYTFDIGQNDLTSGYFLNMSTTEVRAYVPEVLSQF  210

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
                +  +Y  GGR F+I N  P GC    L ++    S++D+ GC    N     YN+ L
Sbjct  211   KDIVSYVYGQGGRNFWIHNTGPFGCLAYVLDRIPLLASEIDRAGCGIPLNQVAKYYNHGL  270

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K  + Q R+++ +A + YVD +S+   LF      G     +ACCG+ GG YN+ K + C
Sbjct  271   KKVVTQLRKELPEAAITYVDIYSLKYSLFSQARKFGFNESLRACCGH-GGKYNYNKNIGC  329

Query  315   GDTNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             G      G Q +  +ACEDP  +++WDG H T AANK   + I  GS+ DPP PL+  CH
Sbjct  330   GGYITKGGRQVLVGKACEDPSVWINWDGVHFTQAANKWMFENIKDGSFSDPPIPLNMACH  389

Query  138   IHPI  127
              HP+
Sbjct  390   RHPL  393



>ref|XP_010242789.1| PREDICTED: esterase-like isoform X1 [Nelumbo nucifera]
Length=392

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 205/357 (57%), Gaps = 6/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAIFNFGDSN+DTGG  A++    PP G T+F  P GR +DGR+ +DF+AQ LGL +
Sbjct  37    CNFPAIFNFGDSNSDTGGLSASYYPTQPPNGETFFHMPAGRYSDGRLTIDFMAQSLGLPY  96

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+ S+F HGANFAT +S + P    L +   SPF L +Q+ QF QFK     + 
Sbjct  97    LSAYLNSLESNFTHGANFATAASPIRPVKRGLSEGGFSPFYLLVQYWQFMQFK----SRS  152

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q          + +P +  F +ALYTF IGQND       +  +  VN S+P++V+  ++
Sbjct  153   QLIKKRGGVFASLMPKEEYFSQALYTFDIGQNDLGAGFFGNQSVQEVNASVPDIVSNFSR  212

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +K IY LG R+F+I N  PIGC P  L  +    S +D+ GC   YN+    +N  LK+
Sbjct  213   DVKLIYDLGARSFWIHNTGPIGCLPYILVNMPITASQIDKAGCAAPYNDVAQYFNKKLKE  272

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+D+  A   YVD +S+   L      +G ++   ACCGY GG YN+     CGD
Sbjct  273   AVVQLRKDLPLAAFTYVDVYSVKYLLISQAEKYGFEHPLVACCGY-GGKYNYSPTAGCGD  331

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T  +NG  +   +C+ P   V WDG H T+AAN+     I  G Y DPP PL   CH
Sbjct  332   TITVNGTRLFVGSCKRPSVRVIWDGIHYTEAANRWVFDRIVDGKYSDPPLPLRMACH  388



>gb|ABK25197.1| unknown [Picea sitchensis]
Length=230

 Score =   283 bits (725),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 159/228 (70%), Gaps = 1/228 (0%)
 Frame = -1

Query  807  LPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKTIKDIYLLGGRTFF  628
            +P   +F +ALYT  IGQNDF   L  +GI GV Q LP+V +QI +T+K +Y  G RT F
Sbjct  4    IPTPEVFSQALYTLDIGQNDFTSKLGEIGIQGVKQFLPQVASQIGETVKALYAEGARTIF  63

Query  627  ILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDALRQTRQDIKDANV  448
            + NLAPIGC+PSFL +L H+ SDLD +GC+ SYN AV DYNN+L++ L + R+ + DA+V
Sbjct  64   VANLAPIGCFPSFLTELPHSQSDLDSYGCMISYNTAVVDYNNLLREKLEEVRKVLPDASV  123

Query  447  VYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDTNVLNGQTVTAEAC  268
            +YVD+H+I LE+F +PT HG KYGTKACCG  GGDYNF  +LFC     LNG  VTA  C
Sbjct  124  IYVDSHAIKLEIFTNPTKHGFKYGTKACCG-SGGDYNFSPQLFCSQRKELNGTVVTASVC  182

Query  267  EDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPIG  124
             DP +YVSWDG H TDAAN      I SG YF PPFPL   C + PIG
Sbjct  183  SDPSSYVSWDGIHNTDAANNYITNEILSGKYFQPPFPLSTLCDLQPIG  230



>ref|XP_011034054.1| PREDICTED: GDSL esterase/lipase At3g26430-like isoform X1 [Populus 
euphratica]
Length=390

 Score =   289 bits (739),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 151/358 (42%), Positives = 208/358 (58%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AA      P G TYF  P GR +DGR+I+DF+A+ LG+ +
Sbjct  33    CDFPAIFNFGDSNSDTGGLSAALGQAPSPNGETYFHHPAGRYSDGRLIIDFIAESLGVPY  92

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F HGANFAT  ST+ P +++   S  SP SL +Q  Q+  FK    ++ 
Sbjct  93    LSAYLDSVGSNFSHGANFATAGSTIRPQNTTQSQSGYSPISLNVQSVQYSDFK----KRS  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             Q          T +P  + F KALYT  IGQND       +L    V  S+P+++ Q + 
Sbjct  149   QTVRSQGGIFETLMPKADYFSKALYTIDIGQNDLTAGYKLNLTTEQVKASVPDMLGQFSN  208

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +K IY +GGR+F+I N  P+GC P  L +     + +D++GC   +N     +N+ LK+
Sbjct  209   AVKQIYAVGGRSFWIHNTGPVGCLPYSLDRFLITAAQIDKYGCASPFNEVSQFFNHRLKE  268

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+D+  A + YVD +S+   L       G K    ACCG+ GG YN+  +  CG 
Sbjct  269   AVVQLRKDLPQAAITYVDIYSLKYTLTTQAKKFGFKQPFVACCGH-GGKYNYNSQRRCGA  327

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +NG + V A +C+DP   + WDG H T+AANK   Q I +GS+ DPP PL   CH
Sbjct  328   KITVNGTEVVIANSCKDPSVRIIWDGVHFTEAANKWIFQQIVNGSFSDPPVPLKMACH  385



>gb|KHG01494.1| Esterase [Gossypium arboreum]
Length=372

 Score =   288 bits (737),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 149/357 (42%), Positives = 210/357 (59%), Gaps = 8/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPA+FN GDSN+DTGG+ +AF     PYG TYF  P  R +DGR+I+DF+A+  GL F
Sbjct  22    CDFPAVFNLGDSNSDTGGYASAFTPPTSPYGDTYFHMPARRFSDGRLIIDFIAEAFGLPF  81

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             ++ YL S+G++F HG NFAT +ST+  P S + +   SPF L +Q++QF+QFKV    + 
Sbjct  82    INAYLDSVGTNFSHGINFATSASTIRLPISVIPNGGFSPFYLGLQYSQFEQFKV----RS  137

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q          + +P +  F KALYTF IGQND      ++L +  VN S+P+++ + + 
Sbjct  138   QVIRKQGGLLASLMPKEEYFSKALYTFDIGQNDLGEGFFSNLTVQEVNASIPDIINKFSA  197

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK+IY LG R F++ N  PIGC P  L   +  +++ D  GCLK YN     +N  LK+
Sbjct  198   NIKNIYNLGARFFWVHNTGPIGCLPYVLVAFA--SAEKDPAGCLKPYNEVAQYFNLKLKE  255

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             ++ Q R +   A   YVD +S+   LF  P  HG +     CCGY GG+YN+   + CG 
Sbjct  256   SIAQLRNEFPSAAFTYVDIYSVKYSLFAEPQKHGFELPLVTCCGY-GGEYNYSAAVLCGG  314

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T  +NG  +   +C++P   V WDG H T+AANK     I +GS+ DP  PL   C 
Sbjct  315   TITVNGTEIFVGSCDNPSVRVVWDGIHYTEAANKFIFDQISTGSFSDPAVPLKQACQ  371



>ref|XP_010929893.1| PREDICTED: alpha-L-fucosidase 3 [Elaeis guineensis]
Length=384

 Score =   288 bits (738),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 155/363 (43%), Positives = 209/363 (58%), Gaps = 17/363 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP G T+F  P+GR  DGR+I+DF+AQ LGL +
Sbjct  29    CDFPAIFNFGDSNSDTGGLSAAFGPAPPPNGETFFGMPMGRYCDGRLIIDFIAQSLGLPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L+ YL S+G++F HGANFAT  ST+   + +LF S  SPFSL +Q  QF QFK       
Sbjct  89    LNAYLDSVGTNFSHGANFATAGSTIRRQNETLFQSGFSPFSLDVQSWQFSQFKT------  142

Query  846   QEQHHSYNHGNT---KLPPKNIFGKALYTFYIGQNDFI---FDLASLGISGVNQSLPEVV  685
                  +Y  G      LP ++ F +ALYTF IGQND     FD  ++    V   +P+V+
Sbjct  143   -RSQLAYERGGVFKDLLPTEDFFSRALYTFDIGQNDLTSGYFD--NMTTEEVKAYIPDVL  199

Query  684   AQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYN  505
              + T  +K+IY  GGR F+I N  P GC P  L +L    + +++ GC   +N+    +N
Sbjct  200   NKFTIVVKNIYGQGGRFFWIHNTGPFGCLPYVLDRLLLTAAQVNKVGCGSPFNDVAKLFN  259

Query  504   NILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKE  325
               LKD + Q R D+  A   YVD +S+  EL  H   HG ++    CCG+ GG YN+   
Sbjct  260   TKLKDTVYQLRTDLPLAVFTYVDIYSVKYELISHANKHGFEHPLLTCCGH-GGKYNYNVH  318

Query  324   LFCGDTNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHH  148
             L CG   ++N  + +  ++CEDP   + WDG H T+AANK     I  G++ DPP PL  
Sbjct  319   LGCGGKIIVNNTEILVGKSCEDPSKRICWDGVHYTEAANKWVFDQIVEGNFSDPPIPLRM  378

Query  147   FCH  139
              C 
Sbjct  379   ACQ  381



>ref|XP_004504128.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Cicer arietinum]
Length=396

 Score =   288 bits (738),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 150/357 (42%), Positives = 211/357 (59%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAIFNFGDSN+DTG   AAF    PP G+T+F  P GR +DGR+I+DF+A+ LGL +
Sbjct  36    CSFPAIFNFGDSNSDTGAISAAFGQAPPPNGITFFHTPAGRFSDGRLIIDFIAKSLGLPY  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F +GANFAT  ST+ P +++   S  SP SL +Q  Q+  FK       
Sbjct  96    LSAYLDSVGSNFSNGANFATAGSTIRPQNTTKSQSGYSPISLDVQLVQYSDFKTRSIRVR  155

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             ++           LP +  F KALYTF IGQND       ++    V   +P+V+ Q + 
Sbjct  156   KKG----GVFKKLLPKEEYFSKALYTFDIGQNDLTAGYKLNMTTEQVKAYIPDVLGQFSN  211

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK +Y  GGR+F+I N  P+GC P  L +   + + +D+FGC K +N     +N+ L++
Sbjct  212   VIKSVYGKGGRSFWIHNTGPLGCLPYMLDRYPMSAAQIDKFGCAKPFNEVAQFFNHKLEE  271

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ + R+++ +A +VYVD +++   L  H   +G + G  ACCG  GG YNF     CG 
Sbjct  272   AVVELRKELIEATIVYVDVYTVKYTLISHAQKYGFEKGVIACCG-DGGKYNFNNVARCGA  330

Query  309   TNVLNGQT-VTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             T  +NG+  V A++CEDP   + WDG H T+AANK     I +G + DPP  L   C
Sbjct  331   TKRVNGKNIVIAKSCEDPSVMIIWDGIHYTEAANKWIFLQIANGYFSDPPISLKLTC  387



>gb|KGN59717.1| hypothetical protein Csa_3G840430 [Cucumis sativus]
Length=379

 Score =   288 bits (737),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 145/358 (41%), Positives = 212/358 (59%), Gaps = 9/358 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAI+NFGDSN+DTGG  AAF   + P G T+F K  GR  DGR+I+DF+A+ L L +
Sbjct  29    CNFPAIYNFGDSNSDTGGISAAFYPTILPCGQTFFHKTAGRGCDGRLIIDFIAKQLELPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFK-VMVDEQ  850
             LS YL SIG++FRHGANFAT  ST+   + S+F++ +SPFSL IQ  QF+QFK   +D  
Sbjct  89    LSAYLNSIGTNFRHGANFATGGSTIRRQNESVFENGISPFSLDIQVVQFRQFKNRTIDRY  148

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITK  670
              +    S     + LP    F KAL+T  IGQND       +      +++P+++ +   
Sbjct  149   VEAIDDSI---RSTLPVPEEFSKALFTIDIGQNDLSAGFRKMTNDQFRKAIPDIINEFAT  205

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSH-NTSDLDQFGCLKSYNNAVADYNNILK  493
              ++D+Y  G R F++ N  PIGC P  +  +S+    DLD+ GC+K  N+A  ++N  LK
Sbjct  206   AVEDLYKEGARAFWVHNTGPIGCIPVAIRSVSNPKEGDLDRNGCVKEQNDAALEFNRQLK  265

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             + + + R ++ DA++VYVD ++  ++L  +    G       CCGY  G       ++CG
Sbjct  266   ERVVKLRANLLDASLVYVDVYAAKIKLIANAKEEGFMEKGAICCGYHEG----LNHVWCG  321

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             +   +NG  V A +CEDP  ++SWDG H T+AAN+     I  GS+ DP  P+ H C 
Sbjct  322   NRKTINGSEVYAGSCEDPSKFISWDGVHYTEAANQWIANQIVKGSFSDPQVPIMHACR  379



>gb|KEH20768.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=393

 Score =   288 bits (738),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 148/353 (42%), Positives = 212/353 (60%), Gaps = 7/353 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAIFNFGDSN+DTGG  AAF    PP G+T+F+ P GR +DGR+I+DFLAQ L L +
Sbjct  36    CSFPAIFNFGDSNSDTGGLSAAFGQAPPPNGITFFQTPAGRFSDGRLIIDFLAQNLSLPY  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F +GANFAT  ST+ P +++   S  SP SL +Q  Q+  FK       
Sbjct  96    LSAYLDSVGSNFSNGANFATAGSTIRPQNTTKSQSGYSPISLDVQLIQYSDFKARSILVR  155

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             ++           LP +  F +ALYTF IGQND       ++    V   +P+V+ Q + 
Sbjct  156   KKGGVFMKL----LPKEEYFSEALYTFDIGQNDLTAGYKLNMTTEQVKAYIPDVLGQFSD  211

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              I+ +Y  GGR+F+I N  P+GC P  L +   + + +D+FGC K +N     +N+ LK+
Sbjct  212   VIRSVYKEGGRSFWIHNTGPLGCLPYTLDRYPMSVAQMDKFGCAKPFNEVAQYFNSRLKE  271

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R+++ +A +VYVD +++   L  H   +G + G  ACCG  GG YNF     CG 
Sbjct  272   TVVQLRKEVPEAIIVYVDVYTVKYNLISHAKKYGFEKGVIACCGQ-GGKYNFNNVARCGA  330

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPL  154
             T ++NG + + A++C+DP   + WDG H T+A+NK   Q I +G + DPP  L
Sbjct  331   TKIVNGKKIIIAKSCKDPSVKIIWDGIHYTEASNKWIFQQIVNGYFSDPPISL  383



>emb|CDP16617.1| unnamed protein product [Coffea canephora]
Length=388

 Score =   288 bits (737),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 149/362 (41%), Positives = 210/362 (58%), Gaps = 17/362 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C +PAI+NFGDSN+DTGG  AAF  +  P G TYF +P GRA+DGR+I+DF+A  LGL F
Sbjct  35    CDYPAIYNFGDSNSDTGGIAAAFFPMAAPCGETYFHRPAGRASDGRLIIDFIADHLGLPF  94

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL S+GS+F+HGANFAT  +T+   + S F++ VSPF L IQ   + QFK       
Sbjct  95    LSPYLDSVGSNFQHGANFATGGATIRRQNESWFETGVSPFPLDIQVEHYTQFK-------  147

Query  846   QEQHHSYNH-----GNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVA  682
             +   + YN        ++LP    F KALYTF  GQND       +    +  +LP++V 
Sbjct  148   ERSAYFYNQDKVASDKSRLPKPEDFSKALYTFDAGQNDLAAAFRKMSWEELRAALPDIVN  207

Query  681   QITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYN  505
             Q  K I+ +Y  G R  +I N  PIGC P+   K+ +     LD+ GC+KS N+A  ++N
Sbjct  208   QFAKQIRGMYERGARAVWIHNTGPIGCLPASTVKVKNPPPGYLDEHGCIKSQNDAAMEFN  267

Query  504   NILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKE  325
               LK+ + Q R ++  A + YVD +S    L  +   HG +  +K CCG  G     + +
Sbjct  268   TQLKETVVQLRAELSGAAITYVDVYSAKYGLISNAKKHGFEEASKICCGIHG----LEND  323

Query  324   LFCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHF  145
             ++CG+  ++NG  V   +C +P   +SWDG H T+AANK     + +GS  DPP P+   
Sbjct  324   VWCGNKGIVNGSEVYGGSCAEPGGIISWDGVHYTEAANKWIANLVLNGSLSDPPLPIARA  383

Query  144   CH  139
             CH
Sbjct  384   CH  385



>ref|XP_009386685.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 211/358 (59%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAIFNFGDSN+DTGG  AAF ++ PP G T+F  PVGR  DGR+I+DF+AQ LGL F
Sbjct  30    CAFPAIFNFGDSNSDTGGLSAAFGAVPPPNGETFFGAPVGRYCDGRLIIDFIAQDLGLPF  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L+ YL S+G++F HGANFAT  ST+   +++LF +  SPFSL +Q  QF QFK    ++ 
Sbjct  90    LNAYLDSVGTNFSHGANFATAGSTIRRQNTTLFQTGYSPFSLDVQSWQFTQFKSR-SQRA  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLAS-LGISGVNQSLPEVVAQITK  670
              ++   + H    LPP   F +ALYT  +GQND      S +    V  ++P+++ + T 
Sbjct  149   SKKGAVFKH---LLPPLEYFSRALYTLDVGQNDLTAGYVSNMTTEEVKATIPDILTKFTD  205

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK +Y LGGR F+I N  P GC P  L +      ++D  GC   +N     +N  LK+
Sbjct  206   VIKAVYGLGGRFFWIHNTGPFGCLPYVLDRYPLRAPEVDHVGCGAPFNEVARLFNLKLKE  265

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R+    A   YVD +++   L     +HG ++   ACCG+ GG YN+     CG 
Sbjct  266   TVMQLRKRFPRAVFTYVDVYTVKYTLISQARTHGFEHPLVACCGH-GGKYNYDIHWGCGA  324

Query  309   TNVLN-GQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T V+N  + + +++CEDP   + WDG+H T+AAN+     I  G++ DPP P+   C 
Sbjct  325   TAVVNHTKVLISKSCEDPSKRICWDGYHYTEAANRWVYDQIVKGAFSDPPIPVTMACR  382



>ref|XP_010100371.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB82505.1| GDSL esterase/lipase [Morus notabilis]
Length=386

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/358 (41%), Positives = 207/358 (58%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A +    PP G +YF KP GR  DGR+++DF+A+ L L +
Sbjct  28    CEFPAIFNFGDSNSDTGGLAAIYAYNPPPNGESYFHKPAGRYCDGRLVIDFIAESLKLPY  87

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F HG NFAT  ST+ P +++   +  SP SL +Q+N+F  F      + 
Sbjct  88    LSAYLDSVGSNFTHGVNFATAGSTIRPQNTTFKQTGYSPISLDVQWNEFYSFY----SRS  143

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q            LP   +F +ALYTF IGQND       ++    V   +PE++ Q   
Sbjct  144   QTTRQRGGVFEKLLPKAEVFSRALYTFDIGQNDLTAGYFLNMTTGEVKAYVPELLNQFKT  203

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +K +Y  GGR F+I N  P+GC    L +L   ++ +D+ GC   +N     +N  LK+
Sbjct  204   IVKHVYGQGGRYFWIHNTGPVGCLAYVLERLPVTSAQMDKAGCASPFNEVAQFFNRGLKE  263

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+D+  A + YVD +S+   LF     HG +   +ACCG+ GG+YN+     CG 
Sbjct  264   AVVQLRKDLPLAAITYVDVYSVKYSLFSQSKKHGFEQPLRACCGH-GGEYNYNVSTGCGS  322

Query  309   TNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +NG+ +   +AC+DP  +++WDG+H T+AANK     I +GS+ DPP PL   CH
Sbjct  323   KMEVNGKDILVGKACKDPSVWINWDGYHFTEAANKQIFDQIVNGSFSDPPIPLKMACH  380



>ref|XP_008446147.1| PREDICTED: GDSL esterase/lipase At3g26430 [Cucumis melo]
Length=386

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/358 (42%), Positives = 211/358 (59%), Gaps = 6/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPA+FNFGDSN+DTGG  A F    PP G +YF  P GR +DGR+IVDF+A+ LGL +
Sbjct  29    CNFPAVFNFGDSNSDTGGLSAVFGQAPPPNGRSYFPGPAGRYSDGRLIVDFIAESLGLPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL ++G++F HGANFAT  ST+   + +L  S  SP SL +Q+N+F  F+       
Sbjct  89    LSAYLDALGANFSHGANFATAGSTIRLQNRTLQQSGFSPISLNVQYNEFYDFRRRSQTLR  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
                   +      LP +  F +ALYTF IGQND      A++ +  V   +P+V+ Q ++
Sbjct  149   NGLGGIFKQ---LLPKEESFSRALYTFDIGQNDLTSGYFANMSLHQVKLYIPDVLQQFSE  205

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +K ++  GGR F+I N  P+GC P  L +     SD DQ+GC   +N+    +N  LK 
Sbjct  206   IVKWVHSQGGRFFWIHNTGPVGCLPYVLDREPVPASDYDQYGCATPFNDLAQYFNRGLKQ  265

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ + R+ + D+ + YVD +S+   L      +G +Y  + CCG+ GG YNF  +L CG 
Sbjct  266   AVMELRKALPDSAITYVDVYSLKYALVSQHKKYGFEYPLRTCCGH-GGKYNFNVKLGCGG  324

Query  309   TNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +NG+ V   ++C++P  YV+WDG H T AANK     I  GSY DPP PL+  CH
Sbjct  325   KKTINGKEVLIGKSCKNPEVYVNWDGVHYTQAANKWIFNQIKDGSYSDPPIPLNKACH  382



>ref|XP_004292695.1| PREDICTED: esterase-like [Fragaria vesca subsp. vesca]
Length=396

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/360 (44%), Positives = 208/360 (58%), Gaps = 13/360 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A+F     P+G TYF  PVGR +DGR+IVDFLA+ L   +
Sbjct  36    CEFPAIFNFGDSNSDTGGLAASFYPPSTPFGETYFHMPVGRFSDGRLIVDFLAKSLSRPY  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSL-FDSRVSPFSLAIQFNQFKQFKVMVDEQ  850
             LS YL S+G++F HGANFAT +ST+  PH  L      SPF L IQ+ QF Q K     +
Sbjct  96    LSAYLDSLGTNFSHGANFATWASTIRLPHLILPLADGYSPFYLDIQYLQFLQLK----SR  151

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDF---IFDLASLGISGVNQSLPEVVAQ  679
              Q          + +P +  F KALYTF IGQND    IF   +  I  V+ S+P+++  
Sbjct  152   SQLIRQRGGIYASLMPEEEYFSKALYTFDIGQNDLGEGIF--GNKTIQEVSASVPDIIPG  209

Query  678   ITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNI  499
              +  IK IY LG RTF+I N  PIGC P  L +     +D D+ GC K+YN     +N  
Sbjct  210   FSANIKKIYDLGARTFWIHNTGPIGCLPYVLVRFP--AADKDEAGCAKAYNEVCQHFNQE  267

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             LK A+ Q R+D+  A    VD +S+   LF+ P  +G +    +CCGY GG YN+     
Sbjct  268   LKQAIVQLRKDLPLAAFTSVDVYSVKYSLFKEPQKYGFELPLVSCCGY-GGKYNYNSSAG  326

Query  318   CGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             CG T  +NG  +   +CE+P   ++WDG H T+AA K     I +G+Y DPP PL   CH
Sbjct  327   CGTTITVNGSQIFVGSCENPSTRLNWDGIHYTEAAAKFVFDKISTGAYSDPPLPLKQACH  386



>ref|XP_008464935.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X1 [Cucumis 
melo]
Length=383

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 210/356 (59%), Gaps = 8/356 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAI+NFGDSN+DTGG  AAF   + P G T+F K  GR  DGR+I+DF A+ L L +
Sbjct  29    CNFPAIYNFGDSNSDTGGISAAFYPTILPCGQTFFHKTAGRGCDGRLIIDFFAKHLELPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL SIG++FRHGANFAT  ST+   + S+F++ VSPF L IQ  QF+QFK    ++ 
Sbjct  89    LSAYLNSIGTNFRHGANFATGGSTIRRQNESVFENGVSPFPLDIQVVQFRQFKNRTIDRY  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              E   S     + LP    F KAL+T  IGQND       +      +++P+++ +    
Sbjct  149   VEVDGSI---RSSLPVPEEFSKALFTIDIGQNDLSAGFRKMTNDQFQKAIPDIINEFATA  205

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSH-NTSDLDQFGCLKSYNNAVADYNNILKD  490
             ++D+Y  GGR F++ N  PIGC P  +  +S  N  DLDQ GC+K  NNA  ++N  LK+
Sbjct  206   VEDLYKEGGRAFWVHNTGPIGCIPVAIRSISKPNPGDLDQNGCVKYQNNAALEFNRQLKE  265

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R  + +A +VYVD ++  ++L  +    G       CCGY  G       ++CG+
Sbjct  266   RVVKLRAKLSNAFIVYVDVYAAKIKLIANAKEEGFMEKGAICCGYHEG----VDHVWCGN  321

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
               ++NG  V A +C+DP  ++SWDG H T+AAN+     I  GS+ DP  P+ H C
Sbjct  322   KKIINGSEVYAGSCKDPSKFISWDGVHYTEAANQWIANQIVDGSFSDPQVPIIHAC  377



>ref|XP_009406370.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Musa acuminata 
subsp. malaccensis]
Length=411

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/357 (43%), Positives = 207/357 (58%), Gaps = 8/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAIFNFGDSN+DTGG  AAF    PP G T+F+KP GR  DGRVI+DF+A  LGL  
Sbjct  56    CAFPAIFNFGDSNSDTGGLSAAFGQAPPPNGETFFRKPAGRYCDGRVIIDFIANSLGLPR  115

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L+ YL SIG++F HGANFAT  ST+ P +++LF S  SPFSL +Q  QF QFK       
Sbjct  116   LNAYLDSIGTNFSHGANFATAGSTIRPQNTTLFQSGFSPFSLDVQTWQFSQFK-----SR  170

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
              +          +LP K  F +ALYTF IGQND      +++    V  S+P++V + + 
Sbjct  171   SQSFLDQGLFKDQLPKKEYFSRALYTFDIGQNDLTAGYFSNMTSEEVKASIPDIVDKFSM  230

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +K IY  GGR F++ N  P GC    L +L     ++D+FGC   +N     +N  L++
Sbjct  231   AVKSIYWGGGRFFWVHNTGPFGCLAYVLDRLLLRAPEVDRFGCGSPFNEVAQLFNTKLEE  290

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+D+  A   +VD +S+  EL  H T HG +    ACCG+ GG YN+     CG 
Sbjct  291   AVAQLREDLPLAVFTFVDVYSVKYELISHATKHGFELPLVACCGH-GGKYNYNANNGCGS  349

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             T  +NG + V  ++C+DP   + WDG H T+AAN+     I  G +  P  PL   C
Sbjct  350   TITVNGTEVVIGKSCKDPSKRIIWDGVHYTEAANRWVFDQIAEGKFSVPHTPLRMAC  406



>ref|XP_007031630.1| Esterase, putative [Theobroma cacao]
 gb|EOY02556.1| Esterase, putative [Theobroma cacao]
Length=382

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/356 (42%), Positives = 209/356 (59%), Gaps = 7/356 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F +++NFGDSN+DTGG  AAF    PP G T+F +P GR +DGR+I+DF+A+ LGL  
Sbjct  29    CNFRSVYNFGDSNSDTGGGSAAFYPAGPPSGETFFGRPAGRGSDGRLIIDFIAEHLGLPH  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL SIG+ +RHGANFA   ST+ P + S+  + VSPFSL IQF Q+ QFK       
Sbjct  89    LSPYLDSIGTSYRHGANFAIGGSTIRPQNESMSLNGVSPFSLNIQFIQYNQFKARTSYLY  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +   +Y   +  LP    F +ALY   IGQND          S  + S+P++V Q+TK 
Sbjct  149   NQAKKNYYRKH--LPRPQDFSQALYVIDIGQNDMAAGFRLKNDSEFHASMPDIVEQLTKA  206

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             ++++Y  G RTF+I N  PIGC P  L        +LD+ GCLKS N+   ++N  LK  
Sbjct  207   VQNLYDQGARTFWIHNTGPIGCLPVTL-HYHLKPDELDKQGCLKSQNDFAIEFNRQLKVR  265

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             + + R ++ DA + YVD ++   EL       G     + CCG+   D +    ++CG+ 
Sbjct  266   VIKLRTELPDAALTYVDMYAAKYELIGKAKQQGFVDAAEICCGFHEDDIH----VYCGNK  321

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
               LNG  + A +CEDP  Y+SWDG H T+AAN      I +GS+ DPP P+ H CH
Sbjct  322   MQLNGTEIYAGSCEDPSKYISWDGVHYTEAANHWIANHIINGSFSDPPLPITHACH  377



>ref|XP_003589577.1| Early nodulin [Medicago truncatula]
 gb|AES59828.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=381

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 154/354 (44%), Positives = 213/354 (60%), Gaps = 8/354 (2%)
 Frame = -1

Query  1197  PAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAFLSP  1018
             PAIFNFG SN DTGG  AAF +L  P G T+F +  GR +DGR+I+DF+AQ  GL FLSP
Sbjct  31    PAIFNFGASNADTGGLAAAFQALQLPNGETFFNRSTGRFSDGRIIIDFIAQSFGLPFLSP  90

Query  1017  YLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQEQEQ  838
             YL S+G +F HG NFAT +ST+  P+S + +   SPF L IQ+ QF+ F +   +  ++Q
Sbjct  91    YLNSLGPNFTHGVNFATAASTIKIPNSIIPNGMFSPFYLRIQYIQFRDF-IPRTKFIRDQ  149

Query  837   HHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITKTIK  661
                +    T +P +  F KALYTF IGQND       ++ I  VN ++P++V      IK
Sbjct  150   GGVF---ATLIPKEEYFSKALYTFDIGQNDLTGGFFGNVTIQQVNATIPDIVNNFIVNIK  206

Query  660   DIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDALR  481
             +I+ LG R+F+I N  PIGC P  LA     ++  D +GC K YN     +N  LK+AL 
Sbjct  207   NIHSLGARSFWIHNTGPIGCLPLILANFP--SAIKDSYGCAKQYNEVSQYFNLKLKEALA  264

Query  480   QTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDTNV  301
             Q R D+  A + YVD +S    LFQ+P  +G +    ACCGY GG+YN+     CG+T  
Sbjct  265   QLRVDLPLAAITYVDVYSPKYSLFQNPKKYGFELPLVACCGY-GGEYNYDNRARCGETIN  323

Query  300   LNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             +NG  +   +C+ P   + WDG H T+AANK+    I +G++ DPP PL+  C+
Sbjct  324   INGTRIFVGSCKSPSTRIIWDGTHYTEAANKIVFDQISTGAFTDPPIPLNRACY  377



>ref|XP_008219728.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103319914 
[Prunus mume]
Length=1226

 Score =   304 bits (778),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 165/359 (46%), Positives = 218/359 (61%), Gaps = 11/359 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A+     PPYG TYF  P GR +DGR+I+DFLA+ LG  F
Sbjct  448   CEFPAIFNFGDSNSDTGGLAASIYPSPPPYGETYFHIPAGRISDGRLIIDFLAKSLGHPF  507

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSL-FDSRVSPFSLAIQFNQFKQFKVMVDEQ  850
             LS YL S+G++F HGANFAT SST+  P+  L      SPF+L IQ++QF Q K     +
Sbjct  508   LSAYLDSLGANFSHGANFATGSSTIRLPNRILPAPGGYSPFTLTIQYSQFLQLK----NR  563

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQIT  673
              Q   H      + +P +  F KALYTF IGQND      A+L I  VN S+P++++  +
Sbjct  564   SQLIRHRGGIFASLMPKEEYFSKALYTFDIGQNDLGEGFFANLTIQQVNASVPDIISSFS  623

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               IK IY LGGR+F+I N  PIGC P  LA      S  D+ GC KS+N     +N+ LK
Sbjct  624   ANIKKIYDLGGRSFWIHNTGPIGCLPYILANFP---SQKDEAGCAKSHNEVAQQFNHKLK  680

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFK-KELFC  316
             +A  Q R+D+  A + YVD +S+   L++ P  +G +     CCG  GG YNF  + L C
Sbjct  681   EATVQLRKDLPLAAITYVDVYSVKYSLYKEPKKYGFELPLVGCCG-SGGKYNFNGRTLDC  739

Query  315   GDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             G T  +NG+ + A +C+ PY  V+WDG H T+AA K+    I +G++ DPP PL   CH
Sbjct  740   GRTVTVNGRQIFAGSCKRPYVKVNWDGIHYTEAAAKIVFDKISTGAFSDPPLPLKQACH  798


 Score =   296 bits (757),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 162/359 (45%), Positives = 214/359 (60%), Gaps = 11/359 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AA     PP+G T+F  P GR +DGR+I+DFLA+ LG  F
Sbjct  37    CHFPAIFNFGDSNSDTGGMAAAIYRPPPPFGKTHFHTPAGRFSDGRLIIDFLAKSLGHPF  96

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSL-FDSRVSPFSLAIQFNQFKQFKVMVDEQ  850
             LS YL SIG++F HGANFAT SST+  P   +      SPF+L IQ +QF Q K     +
Sbjct  97    LSAYLDSIGTNFSHGANFATASSTIRLPEPIIPAPGGFSPFTLNIQCSQFLQLK----SR  152

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDL-ASLGISGVNQSLPEVVAQIT  673
              Q   H      + +P K  F KALYTF IGQND       +L +  VN S+P++V+  +
Sbjct  153   SQLIRHRGGIFASLMPRKKYFAKALYTFDIGQNDLPEGFFGNLTVQEVNASVPDIVSTFS  212

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               IK IY  GGR+F+I N  PIGC P  L       +  D+ GC K YN     +N+ LK
Sbjct  213   ANIKKIYDSGGRSFWIHNTGPIGCIPYILVNFP---AQKDEVGCAKLYNEVAQYFNHKLK  269

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNF-KKELFC  316
             +A  Q R+D+  A + YVD +S+   L++ P  +G +    +CCG  GG YNF  K + C
Sbjct  270   EATVQLRKDLPLAAITYVDIYSVKYSLYKEPQKYGFEQPLVSCCG-TGGQYNFNSKTVEC  328

Query  315   GDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             G T  +NG+ + A++C+ PY  V+WDG H TDAA K+    I +G++ DPP PL   CH
Sbjct  329   GRTVTVNGRQIFADSCKRPYVKVNWDGIHFTDAAAKIIFDKISTGAFSDPPLPLKQACH  387


 Score =   281 bits (719),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 156/356 (44%), Positives = 210/356 (59%), Gaps = 10/356 (3%)
 Frame = -1

Query  1200  FPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAFLS  1021
             FPAIFNFGDSN+DTGG  A+  S  PPYG TYF  PVGR +DGR+I+DFLA+ LG  FLS
Sbjct  875   FPAIFNFGDSNSDTGGLAASLLSPPPPYGETYFHIPVGRFSDGRLIIDFLARSLGHPFLS  934

Query  1020  PYLKSIGSDFRHGANFATVSSTVMPPHSSLFDS-RVSPFSLAIQFNQFKQFKVMVDEQEQ  844
              YL S+G++F +GANFAT  ST+  P   +  +   SPF L IQ+ QF Q K     + Q
Sbjct  935   AYLDSLGTNFSYGANFATGGSTIRLPDKLIPAAGGFSPFYLDIQYTQFMQLK----SRSQ  990

Query  843   EQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITKT  667
                H      + +P ++ F KALYTF IGQND     + +L +  VN S+P++++  +  
Sbjct  991   LIRHRGGIFASLMPKESYFSKALYTFDIGQNDLTEGFIGNLTVQQVNASVPDIISGFSAN  1050

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK IY LG R+F+I N  PIGC P  LA      +  D+ GC KSYN     +N+ LK+A
Sbjct  1051  IKKIYDLGARSFWIHNTGPIGCLPIILANFP---AQKDEAGCAKSYNEVAQHFNHKLKEA  1107

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
               Q R+D+    + YVD +S+   LF+ P  +G +    A CGY GG Y++     CG T
Sbjct  1108  TVQLRKDLPLVAITYVDVYSVKYSLFKEPKKYGFELPLVAYCGY-GGKYHYNTSSGCGGT  1166

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
               +NG  +   +C+DP   V+WDG H T+AA K     I +G++ DPP  L   CH
Sbjct  1167  ARVNGSQIFVGSCKDPSVRVNWDGCHYTEAAAKFISDKISNGAFSDPPLALKQACH  1222



>ref|XP_002307434.1| early nodulin 8 precursor family protein [Populus trichocarpa]
 gb|EEE94430.1| early nodulin 8 precursor family protein [Populus trichocarpa]
Length=387

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 157/358 (44%), Positives = 210/358 (59%), Gaps = 10/358 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGGF A+FP L  PYG TYF+ P GR +DGR+I+DF+A+ L L+F
Sbjct  27    CEFPAIFNFGDSNSDTGGFVASFPPLNSPYGETYFQMPAGRFSDGRLIIDFVAKSLNLSF  86

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSL-FDSRVSPFSLAIQFNQFKQFKVMVDEQ  850
             LS YL S+G++F  GANFAT SST+  P   +  ++  SPF   +Q+NQF Q K    + 
Sbjct  87    LSAYLDSLGTNFTVGANFATASSTITLPARIIPANNGFSPFFFLVQYNQFVQLKAR-SQL  145

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQIT  673
              ++Q   +      +P +  F KALYTF IGQND       ++ +  VN S+P +V    
Sbjct  146   IRKQGGVFAR---LMPKEEYFQKALYTFDIGQNDLGAGFFGNMSVEEVNASVPNIVNTFL  202

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               +K IY LG R+F+I N  PIGC    L      +++ D  GC KSYN     +N  LK
Sbjct  203   TNVKSIYNLGARSFWIHNTGPIGCLGYVLTNFP--SAEKDTVGCAKSYNEVAQYFNYELK  260

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             + + Q R+    A   YVD +S+   LF  P  HG +    ACCGY GG YN+     CG
Sbjct  261   ETVLQLRKVFPSAAFTYVDVYSVKYSLFSEPKKHGFELPLVACCGY-GGLYNYGSAG-CG  318

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
              T  +NG  +T  +C++P   V WDG H T+AANK   + I +G++ DPP PL   CH
Sbjct  319   ATITVNGTQITVGSCDNPSVRVVWDGIHYTEAANKFVFEQISTGAFSDPPIPLKMACH  376



>gb|KHN33852.1| Esterase [Glycine soja]
Length=394

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 156/359 (43%), Positives = 214/359 (60%), Gaps = 14/359 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVP--PYGMTYFKKPVGRATDGRVIVDFLAQGLGL  1033
             C FPAIFNFG SN DTGG  A+F    P  P G TYF +P GR +DGR+I+DFLA+  GL
Sbjct  41    CDFPAIFNFGASNADTGGLAASFFVAAPKSPNGETYFGRPAGRFSDGRLIIDFLAEKFGL  100

Query  1032  AFLSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDE  853
              +LSPYL S+G++F  GA+FAT  ST++P      + R SPFSL IQ++QF++FK    +
Sbjct  101   PYLSPYLDSLGTNFSSGASFATAGSTIIPQQ----NLRFSPFSLGIQYSQFQRFKPTT-K  155

Query  852   QEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQI  676
               ++Q   +      +P +  F +ALYTF IGQND     + ++ +  VN S+P+++   
Sbjct  156   FIRDQGGVF---AALMPKEEYFQEALYTFDIGQNDLTAGFSGNMTLLQVNASIPDIIKSF  212

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
             T  IK+IY +G R+F+I N  PIGC P  L      +++ D + C K+YN     +N+ L
Sbjct  213   TSNIKNIYNMGARSFWIHNTGPIGCLPLILVNFP--SAERDSYDCAKAYNEVAQSFNHNL  270

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K+AL Q R  +  A + YVD +S    LF+ P  +G +    ACCGY GG YNF   + C
Sbjct  271   KEALAQLRTKLPLAAITYVDIYSAKYLLFKKPQKYGFELPHVACCGY-GGKYNFSSSVGC  329

Query  315   GDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             G T  +NG  +   +CE P   V WDG H T+AANKV    I SG++ DPP PL   C 
Sbjct  330   GGTIKVNGNDIFVGSCERPSVRVVWDGTHYTEAANKVVFDLISSGTFTDPPIPLKRTCQ  388



>ref|XP_006446639.1| hypothetical protein CICLE_v10015574mg [Citrus clementina]
 gb|ESR59879.1| hypothetical protein CICLE_v10015574mg [Citrus clementina]
Length=385

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/357 (40%), Positives = 206/357 (58%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAI+NFGDSN+DTGG  AAF  +  PYG  +F KP GR +DGR+I+DF+A+ + L +
Sbjct  33    CEFPAIYNFGDSNSDTGGISAAFEPIRVPYGEGFFHKPAGRDSDGRLIIDFIAESVKLPY  92

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++FRHGANFAT  ST+  P+ ++++  +SPF L +Q  QF QFK    E  
Sbjct  93    LSAYLNSLGTNFRHGANFATGGSTIGKPNETIYEYGISPFFLGMQITQFNQFKARTKELY  152

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              E   + +    KLP +  F KALYTF IGQND       +    +  ++P++V Q+   
Sbjct  153   DEAKIASD--TDKLPRQEDFAKALYTFDIGQNDLSVGFRKMSFDQLRAAIPDIVNQLASA  210

Query  666   IKDIYLLGGRTFFILNLAPIGCYPS-FLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             +++IY  GGR F+I N  PIGC P+ F    +     LD+ GC+K  NN   ++N  LK+
Sbjct  211   VQNIYHQGGRAFWIHNTGPIGCLPTNFFYNHNPPPGYLDEHGCVKDQNNMAVEFNRQLKE  270

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R ++ +A + YVD ++   EL  +  + G     K CCGY    +     ++CG+
Sbjct  271   RIIKLRTELPEAAITYVDVYATKYELISNAKALGYADPFKVCCGY----HENYDHVWCGN  326

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +N   V   +C+DP   +SWDG H T AAN+        GS  DPP P+   CH
Sbjct  327   KATINNTEVYGASCKDPSKSISWDGVHYTQAANQWVANHTLYGSLTDPPLPITQACH  383



>ref|XP_009611346.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Nicotiana tomentosiformis]
Length=386

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 149/358 (42%), Positives = 210/358 (59%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP G TYF  P GR +DGR+++DF+A+ LGL  
Sbjct  32    CDFPAIFNFGDSNSDTGGLSAAFGQAGPPAGETYFGSPAGRYSDGRLVIDFIAESLGLPH  91

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS +L ++GS+F +GANFAT  ST+ P +++L  S  SP SL +QF +F  F      + 
Sbjct  92    LSAFLDALGSNFSYGANFATAGSTIRPQNTTLHQSGFSPISLNVQFYEFNDFH----RRS  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q      N  +  +P +  F   LYTF IGQND       ++    V   +P+++ Q T 
Sbjct  148   QIIRSKGNVFSQLMPKEKHFSHGLYTFDIGQNDLTAGYFLNMTTDQVRAYVPDLMDQFTT  207

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IKDIY  GGR F+I N   +GC P  L +L    + +D+ GC   +N     +N  LK+
Sbjct  208   VIKDIYDQGGRYFWIHNTGSVGCLPYILDRLQITAAQIDKAGCASPFNKVAQYFNTKLKE  267

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+D+  A + YVD +S   EL  H   HG ++  +ACCG+ GG YN+  +  CG 
Sbjct  268   AVFQLRKDLPLAALTYVDVYSAKYELISHANKHGFEHPLQACCGH-GGKYNYNMKHGCGS  326

Query  309   TNVLNGQTVT-AEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                + G+ +   ++C+DP   ++WDG H T+AAN+   + I +GSY DPP PL+  CH
Sbjct  327   KIKVKGKEIMLGKSCKDPSVRINWDGVHYTEAANRWVFEKIVNGSYSDPPLPLNMACH  384



>ref|XP_008464936.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X2 [Cucumis 
melo]
Length=382

 Score =   286 bits (732),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 209/356 (59%), Gaps = 9/356 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAI+NFGDSN+DTGG  AAF   + P G T+F K  GR  DGR+I+DF A+ L L +
Sbjct  29    CNFPAIYNFGDSNSDTGGISAAFYPTILPCGQTFFHKTAGRGCDGRLIIDFFAKHLELPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL SIG++FRHGANFAT  ST+   + S+F++ VSPF L IQ  QF+QFK    ++ 
Sbjct  89    LSAYLNSIGTNFRHGANFATGGSTIRRQNESVFENGVSPFPLDIQVVQFRQFKNRTIDRY  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              E         + LP    F KAL+T  IGQND       +      +++P+++ +    
Sbjct  149   VEDGSI----RSSLPVPEEFSKALFTIDIGQNDLSAGFRKMTNDQFQKAIPDIINEFATA  204

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSH-NTSDLDQFGCLKSYNNAVADYNNILKD  490
             ++D+Y  GGR F++ N  PIGC P  +  +S  N  DLDQ GC+K  NNA  ++N  LK+
Sbjct  205   VEDLYKEGGRAFWVHNTGPIGCIPVAIRSISKPNPGDLDQNGCVKYQNNAALEFNRQLKE  264

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R  + +A +VYVD ++  ++L  +    G       CCGY  G       ++CG+
Sbjct  265   RVVKLRAKLSNAFIVYVDVYAAKIKLIANAKEEGFMEKGAICCGYHEG----VDHVWCGN  320

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
               ++NG  V A +C+DP  ++SWDG H T+AAN+     I  GS+ DP  P+ H C
Sbjct  321   KKIINGSEVYAGSCKDPSKFISWDGVHYTEAANQWIANQIVDGSFSDPQVPIIHAC  376



>gb|KEH40535.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=388

 Score =   286 bits (732),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 159/356 (45%), Positives = 216/356 (61%), Gaps = 10/356 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIF+FG SN DTGG  AAF +   PYG TYF +  GR +DGR+I+DF+AQ  GL +
Sbjct  36    CDFPAIFSFGASNVDTGGLAAAFQAPPSPYGETYFHRSTGRFSDGRIILDFIAQSFGLPY  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL S+GS+F HGANFAT  ST+  P+S + +   SPFSL IQ+ QFK F +      
Sbjct  96    LSPYLNSLGSNFTHGANFATGGSTINIPNSIIPNGIFSPFSLQIQYIQFKDF-ISKTNLI  154

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             ++Q   +    T +P ++ F KALYTF IGQND I     +  I  VN ++P++V     
Sbjct  155   RDQGGVF---ATLIPKEDYFSKALYTFDIGQNDLIGGYFGNKTIKQVNATVPDIVNNFIV  211

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK+IY LG R+F+I +  P GC P+ LA     ++  D +GC K YN     +N  LK 
Sbjct  212   NIKNIYNLGARSFWIHSTVPSGCTPTILANFP--SAIKDSYGCAKQYNEVSQYFNLKLKK  269

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             AL Q R D+  A + YVD +S    LFQ+P  +G +    ACCGY GG YN +  + CG+
Sbjct  270   ALAQLRVDLPLAAITYVDIYSPKYSLFQNPKKYGFELPHVACCGY-GGKYNIR--VGCGE  326

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             T  +NG  + A +C++P   + WDG H T+AANK+    I +G++ DPP  L+  C
Sbjct  327   TININGTKIVAGSCKNPSTRIIWDGSHFTEAANKIVFDQISTGAFSDPPISLNRAC  382



>ref|XP_008340355.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Malus domestica]
Length=402

 Score =   286 bits (733),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 153/360 (43%), Positives = 206/360 (57%), Gaps = 11/360 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A F     P+G +YF  P GR  DGR+++DF+A  L L +
Sbjct  43    CKFPAIFNFGDSNSDTGGLSALFGQARLPHGESYFHSPAGRYCDGRLVIDFIANSLELPY  102

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +S Y  S+GS+F HGANFAT  ST+ P ++++  S  SP SL +Q+N+F  F      Q 
Sbjct  103   MSAYFDSVGSNFTHGANFATAGSTIRPQNTTIRQSGFSPVSLDVQYNEFYDF------QP  156

Query  846   QEQHHSYNHG--NTKLPPKNIFGKALYTFYIGQNDFIFDL-ASLGISGVNQSLPEVVAQI  676
             + Q      G     +P    F +ALYTF IGQND    L  ++ I+ V   +P+V+ Q 
Sbjct  157   RSQTARSRGGVFEQLMPKAEDFSRALYTFDIGQNDLTSGLFLNMSITQVKAYVPDVLNQF  216

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
                ++ +Y  GGR F+I N  PIGC P  L +L    + LD+ GC   YN     +N  L
Sbjct  217   NSIVQSVYNQGGRYFWIHNTGPIGCLPYVLDRLPIPAAQLDKAGCATPYNKLARFFNRGL  276

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K A+ Q R+++  A + YVD +S    L   P  HG K   +ACCG+ GG YNF K + C
Sbjct  277   KQAVVQLRKELPLAAITYVDVYSAKYSLISQPQKHGFKQPIRACCGH-GGKYNFNKHIGC  335

Query  315   GDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             G    ++G+ V   +AC+DP  +V+WDG H T+AANK     I  GS  DPP PL   CH
Sbjct  336   GGKIRVHGKDVLVGKACQDPSLWVNWDGVHFTEAANKRVFDQIVDGSLSDPPTPLKFACH  395



>ref|XP_002530042.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
 gb|EEF32342.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
Length=390

 Score =   286 bits (732),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 149/357 (42%), Positives = 209/357 (59%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP G T+F  P GR +DGR+I+DF+A+ LGL +
Sbjct  34    CHFPAIFNFGDSNSDTGGLSAAFGQAPPPNGHTFFHHPAGRFSDGRLIIDFIAESLGLPY  93

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F HGANFAT  ST+ P ++++  S  SPFSL +Q  Q+  F      + 
Sbjct  94    LSAYLDSVGSNFSHGANFATAGSTIRPQNTTMSQSGYSPFSLDVQLVQYLDFH----RRS  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             Q+  +      T LP  + F  ALYTF IGQND       +L +  V   +P++++  + 
Sbjct  150   QDYRNRGGVFETLLPGADYFSNALYTFDIGQNDLTAGYKLNLTVEQVKAFVPDIISHFSN  209

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             TIK +Y  GGR+F+I N  P+GC P  L +     + +D++GC   +N     +N  LK+
Sbjct  210   TIKVVYAQGGRSFWIHNTGPVGCLPYSLDRFLITAAQIDKYGCATPFNEVSQYFNKRLKE  269

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+D+  A + YVD +S+   L       G K    ACCG+ GG YN+     CG 
Sbjct  270   AVVQLRKDLSQAAITYVDVYSLKYTLITQGKKFGFKNPFIACCGH-GGKYNYNTYARCGA  328

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
               ++N  + + A +C+DP   V WDG H T+AAN+   Q + +GS  DPP PL+  C
Sbjct  329   KRIVNAKELIIANSCKDPSVSVIWDGVHFTEAANRWIFQQVVNGSVSDPPIPLNMAC  385



>ref|XP_010029090.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Eucalyptus grandis]
 ref|XP_010029091.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Eucalyptus grandis]
 gb|KCW55933.1| hypothetical protein EUGRSUZ_I01727 [Eucalyptus grandis]
Length=390

 Score =   286 bits (731),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 150/358 (42%), Positives = 210/358 (59%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAI+NFGDSN+DTGG  AAF  +  P G T+F +PVGRA++GR+I+DF+A+ LGL +
Sbjct  36    CEFPAIYNFGDSNSDTGGISAAFYPMGSPTGETFFHRPVGRASNGRLIIDFIAEHLGLPY  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G  FRHGANFAT  ST+   + S F++ VSPFSL IQ   + QF V      
Sbjct  96    LSAYLDSLGWSFRHGANFATGGSTIRRQNESFFENGVSPFSLDIQTAHYDQF-VARTSYL  154

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +   +     ++LP    F KALY F IGQND       +    +N S+P++V+Q+   
Sbjct  155   FKNARAEKFPRSRLPMPEDFSKALYVFDIGQNDLAAGFRKMTNEQLNASMPDIVSQLATA  214

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILKD  490
             ++ +Y  G RTF+I N  PIGC P  L  + +     LD+ GC+K  N   +++N  LK+
Sbjct  215   VQHLYQQGARTFWIHNTGPIGCLPITLRYIRNPMPGYLDEIGCVKDQNEMASEFNRQLKE  274

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R ++ +A + YVD ++    L  + T  G +   K CCGY   D    K ++CG 
Sbjct  275   MVMQLRGELPEAALTYVDVYTAKYSLIANSTRAGFERAGKMCCGYEWED----KHVWCGQ  330

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPP-FPLHHFCH  139
                +NG  V A +CEDP  +VSWDG H T+AAN+   + I SG   D P  P+ H C+
Sbjct  331   KASINGSEVVAGSCEDPSIFVSWDGVHYTEAANRWISEHIISGLLSDRPNVPITHACY  388



>ref|XP_004173555.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At5g14450-like 
[Cucumis sativus]
Length=377

 Score =   285 bits (730),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 148/357 (41%), Positives = 206/357 (58%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FP IFNFGDSN+DTG   AAF  +  PYG  +F KP GR +DGR+I+DF+A+ L L +
Sbjct  25    CNFPVIFNFGDSNSDTGAISAAFEPIRWPYGDVFFNKPSGRDSDGRLIIDFIAEKLRLPY  84

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++FRHGANFAT  STV  P+ ++++  +SPF L +Q  QF+QFK   ++  
Sbjct  85    LSAYLNSLGANFRHGANFATGGSTVRKPNETIYEYGISPFXLDMQVTQFEQFKARSNDLY  144

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +  + Y+    KL     + KALYTF IGQND       L I  +  +LP++  Q    
Sbjct  145   NQAKNPYDR--EKLTRPEDYSKALYTFDIGQNDLAVGFRKLSIDQLRAALPDIANQFASA  202

Query  666   IKDIYLLGGRTFFILNLAPIGCYP-SFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             I+ IY LGGR+F+I N  P GC P +    L+     LD+ GC+K+ N+   + NN LK 
Sbjct  203   IQRIYKLGGRSFWIHNTGPFGCLPVNQFYNLNPPPGILDEHGCIKAQNDISMELNNQLKA  262

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              L + R ++ DA + YVD ++    L  +  + G     K CCGY    +     ++CG 
Sbjct  263   KLDKLRAELPDAAITYVDVYAAKYALISNGKTQGFPEPLKVCCGY----HVRYDHVWCGT  318

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +NG  V  +ACE+   YVSWDG H ++AAN      I SGS   PP P+   CH
Sbjct  319   KAPINGSLVFGDACENRAQYVSWDGVHYSEAANHFVASHILSGSLSSPPIPITQACH  375



>ref|XP_003624763.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES80981.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=395

 Score =   286 bits (732),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 160/364 (44%), Positives = 216/364 (59%), Gaps = 14/364 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF     PYG ++F  PVGR  DGR++VDF+A+ LGL +
Sbjct  39    CEFPAIFNFGDSNSDTGGLSAAFGQPGYPYGESFFHHPVGRYCDGRLLVDFIAEKLGLPY  98

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDS-RVSPFSLAIQFNQFKQFKVMVDEQ  850
             L+ YL ++GS+F HGANFAT  ST+ P +++L  +   SPFSL +QF QF  F      Q
Sbjct  99    LNAYLDAVGSNFSHGANFATAGSTIRPQNTTLHQTGGFSPFSLDVQFTQFNDF------Q  152

Query  849   EQEQHHSYNHG--NTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQ  679
              + Q      G   T LP    F +ALYTF IGQND       ++ I+ V   +P+V+ Q
Sbjct  153   RRTQFFRNKGGIYKTLLPKAEYFSRALYTFDIGQNDLASGYFHNMSINQVKAYVPDVLDQ  212

Query  678   ITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNN  502
                TIK+IY  GGR+F+I N  P+GC P ++ +L   TSD +D+ GC   YN     +N+
Sbjct  213   FKNTIKNIYAHGGRSFWIHNTGPVGCLP-YIIELHKVTSDKVDKAGCAIPYNEVAKFFNH  271

Query  501   ILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKEL  322
              LK A+ Q R+ +  A + YVD +S    L      HG K   +ACCG+ GG YN+   +
Sbjct  272   ELKQAVVQLRKKLPSAAITYVDVYSAKYSLISQAYRHGFKEPLRACCGH-GGKYNYNLHI  330

Query  321   FCGDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHF  145
              CG    ++G+ +   + C+DP   V+WDG HLT AANK   + I  GS  DPP PL+  
Sbjct  331   GCGAKVKIDGKEILIGKPCKDPSVVVNWDGVHLTQAANKWVFEQIVDGSLSDPPIPLNMA  390

Query  144   CHIH  133
             C+ H
Sbjct  391   CYKH  394



>ref|XP_004304671.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Fragaria vesca 
subsp. vesca]
Length=383

 Score =   285 bits (730),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 141/357 (39%), Positives = 212/357 (59%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAI+NFGDSN+DTGG  AAF  +  PYG  +F+KP GR +DGR+I+DF+A+GL L +
Sbjct  31    CSFPAIYNFGDSNSDTGGISAAFEPIRTPYGEGFFRKPAGRDSDGRLIIDFIAEGLKLPY  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++++HGANFAT  ST+  P+ ++F++ +SPFSL +Q  QF QFK    +  
Sbjct  91    LSAYLNSLGTNYKHGANFATGGSTIRRPNETIFENGISPFSLDMQTAQFLQFKSRTADLF  150

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             ++  + Y    ++LP    F KALYTF IGQND       L    +   +P++V Q+   
Sbjct  151   RQAKNPYER--SRLPNPQDFAKALYTFDIGQNDLSAGFRKLSFDQLRAQIPDIVNQLATA  208

Query  666   IKDIYLLGGRTFFILNLAPIGCYP-SFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             ++ IY  GGR F+I N  PIGC P +    L+     +D+ GC+K  N+   ++N  LKD
Sbjct  209   VRRIYEQGGRAFWIHNTGPIGCLPINLFYNLNPAPGYVDEHGCVKGQNDMAIEFNRQLKD  268

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R ++  A + YVD ++    L  +  + G     K CCGY    +     ++CG+
Sbjct  269   RVIKLRAELPQAAITYVDAYAAKYGLISNAKNEGFVDPMKVCCGY----HVRYDHVWCGN  324

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
               ++NG+ V   +C +  + +SWDG H T AAN+     I +G+  +PP P+   CH
Sbjct  325   KAIVNGREVYGASCGNASSAISWDGVHYTQAANQWVANHILNGALSNPPIPITQACH  381



>ref|XP_007141047.1| hypothetical protein PHAVU_008G162800g [Phaseolus vulgaris]
 gb|ESW13041.1| hypothetical protein PHAVU_008G162800g [Phaseolus vulgaris]
Length=400

 Score =   286 bits (732),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 158/359 (44%), Positives = 214/359 (60%), Gaps = 11/359 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVP--PYGMTYFKKPVGRATDGRVIVDFLAQGLGL  1033
             C FPAIFN G SN DTGG  A+FP   P  P G T+F +P GR  DGR+I+DF+AQ  GL
Sbjct  43    CDFPAIFNLGASNADTGGLAASFPFAGPKAPSGDTFFHRPAGRFCDGRLIIDFIAQSFGL  102

Query  1032  AFLSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDE  853
              +LSPYL S+GS+F  GANFA+  ST+     S+   R SPF+L  Q+ QF++FK    +
Sbjct  103   PYLSPYLDSMGSNFSGGANFASAGSTIR-LQQSVGQFRSSPFNLGFQYLQFERFKP-TSK  160

Query  852   QEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQI  676
               ++Q   +    T +P +  F +ALYTF IGQND     L ++ +  V QS+P++V+  
Sbjct  161   FIRDQGGIF---ATLMPKEEYFDEALYTFDIGQNDLTVGFLGNMTLQQVIQSIPDIVSNF  217

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
             T  IK+IY LG R+F+I N  PIGC P  L      +++ D++GC K+YN     +N  L
Sbjct  218   TSNIKNIYNLGARSFWIHNTGPIGCVPMILTNF--ESAERDKYGCAKAYNEVAQSFNQNL  275

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K+AL   RQD+  A + YVD +S    LF +P  +G +    +CCGY GG YNF   + C
Sbjct  276   KEALVHLRQDLPLAAITYVDIYSAKYSLFSNPKKYGFELPLVSCCGY-GGKYNFSNSVGC  334

Query  315   GDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             G T  +    V   +CE P   V WDG H T+AANKV    I SG++ DPP PL+  C+
Sbjct  335   GGTIKVKDIDVFVGSCEKPSVRVIWDGIHYTEAANKVVFDQISSGAFTDPPIPLNMACN  393



>gb|ABK26504.1| unknown [Picea sitchensis]
Length=326

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 162/228 (71%), Gaps = 1/228 (0%)
 Frame = -1

Query  807  LPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKTIKDIYLLGGRTFF  628
            LP   +F +ALYT  IGQNDF   L  +GI GV Q LP+V +QI +T+K +Y  G RT F
Sbjct  100  LPTPEVFSQALYTLDIGQNDFTSRLGEIGIQGVKQFLPQVASQIGETVKALYGEGARTIF  159

Query  627  ILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDALRQTRQDIKDANV  448
            + NLAPIGC+PSFL +L HN SDLD +GC+ SYN+AV DYNN+L++ L + R+ + +A+V
Sbjct  160  VANLAPIGCFPSFLTELPHNQSDLDSYGCMISYNSAVVDYNNLLREKLEEVRKVLPNASV  219

Query  447  VYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDTNVLNGQTVTAEAC  268
            +YVD+H+I LE+F +PT HG KYGTKACCG  GGDYNF  ++FC  +  LNG  VTA AC
Sbjct  220  IYVDSHAIKLEIFTNPTKHGFKYGTKACCGT-GGDYNFSPQVFCSQSKKLNGTVVTASAC  278

Query  267  EDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHPIG  124
             DP +YVSWDG H TDAAN      I SG YF PPFPL   C + PIG
Sbjct  279  SDPSSYVSWDGVHNTDAANIYIANEILSGKYFQPPFPLSTLCDLQPIG  326



>ref|XP_004298997.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Fragaria vesca 
subsp. vesca]
Length=402

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 151/360 (42%), Positives = 199/360 (55%), Gaps = 8/360 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAI+NFGDSN+DTG   A F  L  PYG T+F KP GR +DGR+++DF+AQ LGL F
Sbjct  43    CHFPAIYNFGDSNSDTGALSAVFYRLPSPYGNTFFGKPSGRISDGRLMIDFIAQKLGLPF  102

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++FRHGANFA   ST++P    +F+ R SP SL IQF QF Q K  V E  
Sbjct  103   LSAYLDSVGANFRHGANFAIGGSTILPLDGRMFEGRFSPISLDIQFRQFAQLKARVKEVI  162

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +   SY   +  +P    F KALYT  IGQND    L    +  V  S+ ++ A++  T
Sbjct  163   SQDKSSYV--SATIPRPEDFSKALYTVDIGQNDIHAGLRWKTVDQVLASISDMTAKLALT  220

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             I+ +Y  GGR F+I N  P+GC P  LA      SDLDQ  CLKSYN    ++N  LK+ 
Sbjct  221   IEQLYQQGGRIFWIHNTGPLGCLPLVLAHTQPEPSDLDQSDCLKSYNEVAQEFNRQLKEK  280

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG-D  310
             +      + DA + YVD ++    L      +G       CCG  G   +      CG +
Sbjct  281   VLDLLAKLSDAVLTYVDIYTAKYTLISEAEKYGFIDPVGQCCGSQGDSPH-----HCGLN  335

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIHP  130
                 NG  V   +C +P  Y+SWD  H +DAAN+   + +  GS+ DPP  +   C  HP
Sbjct  336   ATTANGTEVFGGSCSNPSKYISWDSVHYSDAANEWVAKRVIEGSFSDPPVSITEACRKHP  395



>ref|XP_006470214.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Citrus sinensis]
Length=383

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/357 (40%), Positives = 205/357 (57%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAI+NFGDSN+DTGG  AAF  +  P+G  +F KP GR +DGR+IVDF+A+ + L +
Sbjct  31    CEFPAIYNFGDSNSDTGGISAAFEPIRAPHGEGFFHKPAGRDSDGRLIVDFIAESVKLPY  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L  YL S+G++FRHGANFAT  ST+  P+ ++++  +SPF L +Q  QF QFK    E  
Sbjct  91    LGAYLNSLGTNFRHGANFATGGSTIGKPNETIYEYGISPFFLGMQITQFNQFKARTKELY  150

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              E   + +    KLP +  F KA+YTF IGQND       +    +  ++P++V Q+   
Sbjct  151   DEAKIASDR--DKLPRQEDFAKAMYTFDIGQNDLSVGFRKMSFDQLRAAIPDIVNQLASA  208

Query  666   IKDIYLLGGRTFFILNLAPIGCYPS-FLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             +++IY  GGR F+I N  PIGC P+ F    +     LD+ GC+K  NN   ++N  LK+
Sbjct  209   VQNIYQQGGRAFWIHNTGPIGCLPTNFFYNHNPPPGFLDEHGCVKDQNNMAVEFNRQLKE  268

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R ++ +A + YVD ++   EL  +  + G     K CCGY    +     ++CG+
Sbjct  269   RVIKLRTELPEAAITYVDVYATKYELISNAKTLGYADPFKVCCGY----HENYHHVWCGN  324

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +N   V   +CEDP   +SWDG H T AAN+        GS  DPP P+   CH
Sbjct  325   KATINKTEVYGASCEDPSKSISWDGVHYTQAANQWVANHTLYGSLTDPPIPITQACH  381



>ref|XP_008353024.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Malus domestica]
Length=388

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 154/360 (43%), Positives = 204/360 (57%), Gaps = 11/360 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A F     P+G +YF  P GR  DGR+++DF+A  L L F
Sbjct  29    CKFPAIFNFGDSNSDTGGLSALFGQARLPHGESYFHSPAGRYCDGRLVIDFIANSLELPF  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F HGANFAT  ST+ P ++++  S  SP SL +Q+N+F  F      Q 
Sbjct  89    LSAYLDSVGSNFTHGANFATAGSTIRPQNTTIRQSGFSPVSLDVQYNEFYDF------QP  142

Query  846   QEQHHSYNHG--NTKLPPKNIFGKALYTFYIGQNDFIFDL-ASLGISGVNQSLPEVVAQI  676
             + Q      G     +P    F +ALY F IGQND    L  ++ I+ V   +P+V+ Q 
Sbjct  143   RSQTTRSRGGVFEQLMPKAEDFSRALYAFDIGQNDLTSGLFLNMSITQVKAYVPDVLNQF  202

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
                +  +Y  GGR F+I N  PIGC P  L +L    +  D+ GC   YN     +N  L
Sbjct  203   NSIVXXVYNQGGRYFWIHNTGPIGCLPYVLDRLPIPAAQXDKAGCATPYNKLARFFNRGL  262

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K A+ Q R+++  A + YVD +S    L   P  HG K   +ACCG+ GG YNF K + C
Sbjct  263   KQAVVQLRKELPLAAITYVDVYSAKYSLISQPQKHGFKQPIRACCGH-GGKYNFNKHIGC  321

Query  315   GDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             G    ++G+ V   +AC+DP  +V+WDG H T+AANK     I  GS  DPP PL   CH
Sbjct  322   GGKIRVHGKDVLVGKACQDPSLWVNWDGVHFTEAANKRVFDQIVDGSLSDPPTPLKFACH  381



>ref|XP_004141116.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Cucumis sativus]
 gb|KGN59716.1| hypothetical protein Csa_3G840420 [Cucumis sativus]
Length=377

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/357 (41%), Positives = 206/357 (58%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FP IFNFGDSN+DTG   AAF  +  PYG  +F KP GR +DGR+I+DF+A+ L L +
Sbjct  25    CNFPVIFNFGDSNSDTGAISAAFEPIRWPYGDVFFNKPSGRDSDGRLIIDFIAEKLRLPY  84

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++FRHGANFAT  STV  P+ ++++  +SPF L +Q  QF+QFK   ++  
Sbjct  85    LSAYLNSLGANFRHGANFATGGSTVRKPNETIYEYGISPFFLDMQVTQFEQFKARSNDLY  144

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +  + Y+    KL     + KALYTF IGQND       L I  +  +LP++  Q    
Sbjct  145   NQAKNPYDR--EKLTRPEDYSKALYTFDIGQNDLAVGFRKLSIDQLRAALPDIANQFASA  202

Query  666   IKDIYLLGGRTFFILNLAPIGCYP-SFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             I+ IY LGGR+F+I N  P GC P +    L+     LD+ GC+K+ N+   + NN LK 
Sbjct  203   IQRIYKLGGRSFWIHNTGPFGCLPVNQFYNLNPPPGILDEHGCIKAQNDISMELNNQLKA  262

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              L + R ++ DA + YVD ++    L  +  + G     K CCGY    +     ++CG 
Sbjct  263   KLDKLRAELPDAAITYVDVYAAKYALISNGKTQGFPEPLKVCCGY----HVRYDHVWCGT  318

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +NG  V  +ACE+   YVSWDG H ++AAN      I SGS   PP P+   CH
Sbjct  319   KAPINGSLVFGDACENRAQYVSWDGVHYSEAANHFVASHILSGSLSSPPIPITQACH  375



>ref|XP_006446637.1| hypothetical protein CICLE_v10015586mg [Citrus clementina]
 gb|ESR59877.1| hypothetical protein CICLE_v10015586mg [Citrus clementina]
Length=383

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/357 (40%), Positives = 205/357 (57%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAI+NFGDSN+DTGG  AAF  +  P+G  +F KP GR +DGR+I+DF+A+ + L +
Sbjct  31    CEFPAIYNFGDSNSDTGGISAAFEPIRAPHGEGFFHKPAGRDSDGRLIIDFIAESVKLPY  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++FRHGANFAT  ST+  P+ ++++  +SPF L +Q  QF QFK    E  
Sbjct  91    LSAYLNSLGTNFRHGANFATGGSTIGKPNETIYEYGISPFFLGMQITQFNQFKARTKELY  150

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              E   + +    KLP +  F KALYTF IGQND       +    +  ++P++V Q+   
Sbjct  151   DEAKIASD--TDKLPRQEDFAKALYTFDIGQNDLSVGFRKMSFDQLRAAIPDIVNQLASA  208

Query  666   IKDIYLLGGRTFFILNLAPIGCYPS-FLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             +++IY  GGR F+I N  PIGC P+ F    +     LD+ GC+K  NN   ++N  LK+
Sbjct  209   VQNIYQQGGRAFWIHNTGPIGCLPTNFFYNHNPPPGFLDEHGCVKDQNNMAVEFNRQLKE  268

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R ++ +A + YVD ++   EL  +  + G     K CCGY    +     ++CG+
Sbjct  269   RVIKLRTELPEAAITYVDVYATKYELISNAKTLGYADPFKVCCGY----HENYDHVWCGN  324

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +N   V   +CEDP   +SWDG H T A N+        GS  DPP P+   CH
Sbjct  325   KATINKTEVYGASCEDPSKSISWDGVHYTQAVNQWVANHTLYGSLTDPPIPITQACH  381



>ref|XP_008464934.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Cucumis melo]
Length=377

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/357 (41%), Positives = 208/357 (58%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FP IFNFGDSN+DTG   AAF  +  PYG  +F KP GR +DGR+I+DF+A+ L L +
Sbjct  25    CNFPVIFNFGDSNSDTGAISAAFEPIRWPYGDVFFNKPSGRDSDGRLIIDFIAEKLRLPY  84

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++FRHGANFAT  STV  P+ ++++  +SPF L +Q  QF+QFK   ++  
Sbjct  85    LSAYLNSLGANFRHGANFATGGSTVRKPNETIYEYGISPFFLDMQVTQFEQFKARSNDLY  144

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +  + Y+    KL     + KALYTF IGQND       L I  +  +LP++V Q    
Sbjct  145   NQAKNPYDR--EKLTRPEDYSKALYTFDIGQNDLAVGFRKLSIDQLRAALPDIVNQFASA  202

Query  666   IKDIYLLGGRTFFILNLAPIGCYP-SFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             I+ IY LGGR+F+I N  P GC P +    L+     LD+ GC+K+ N+   + NN LK 
Sbjct  203   IQRIYKLGGRSFWIHNTGPFGCLPVNQFYNLNPPPGILDEHGCIKAQNDISMELNNQLKA  262

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              L + R ++ DA + YVD ++    L  +  + G     K CCGY    +     ++CG 
Sbjct  263   KLDKLRAELPDAAITYVDVYAAKYALISNGKTQGFPEPLKVCCGY----HVRYDHVWCGT  318

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +NG+ V  +ACE+   YVSWDG H ++AAN      I +G+   PP P+   CH
Sbjct  319   KAPINGRLVFGDACENRAQYVSWDGVHYSEAANHFVANHILNGALSSPPIPITQACH  375



>ref|XP_003624771.1| GDSL esterase/lipase [Medicago truncatula]
Length=386

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 157/362 (43%), Positives = 215/362 (59%), Gaps = 19/362 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF     PYG ++F  PVGR  DGR++VDF+A+ LGL +
Sbjct  39    CEFPAIFNFGDSNSDTGGLSAAFGQPGYPYGESFFHHPVGRYCDGRLLVDFIAEKLGLPY  98

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDS-RVSPFSLAIQFNQFKQFKVMVDEQ  850
             L+ YL ++GS+F HGANFAT  ST+ P +++L  +   SPFSL +QF QF  F+  + + 
Sbjct  99    LNAYLDAVGSNFSHGANFATAGSTIRPQNTTLHQTGGFSPFSLDVQFTQFNDFQRGIYK-  157

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQIT  673
                         T LP    F +ALYTF IGQND       ++ I+ V   +P+V+ Q  
Sbjct  158   ------------TLLPKAEYFSRALYTFDIGQNDLASGYFHNMSINQVKAYVPDVLDQFK  205

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNIL  496
              TIK+IY  GGR+F+I N  P+GC P ++ +L   TSD +D+ GC   YN     +N+ L
Sbjct  206   NTIKNIYAHGGRSFWIHNTGPVGCLP-YIIELHKVTSDKVDKAGCAIPYNEVAKFFNHEL  264

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K A+ Q R+ +  A + YVD +S    L      HG K   +ACCG+ GG YN+   + C
Sbjct  265   KQAVVQLRKKLPSAAITYVDVYSAKYSLISQAYRHGFKEPLRACCGH-GGKYNYNLHIGC  323

Query  315   GDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             G    ++G+ +   + C+DP   V+WDG HLT AANK   + I  GS  DPP PL+  C+
Sbjct  324   GAKVKIDGKEILIGKPCKDPSVVVNWDGVHLTQAANKWVFEQIVDGSLSDPPIPLNMACY  383

Query  138   IH  133
              H
Sbjct  384   KH  385



>ref|XP_008804229.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Phoenix dactylifera]
Length=383

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 155/362 (43%), Positives = 204/362 (56%), Gaps = 17/362 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP G T+F  P GR +DGR+I+DF+AQ LGL +
Sbjct  28    CDFPAIFNFGDSNSDTGGLSAAFGPAPPPNGETFFGMPAGRYSDGRLIIDFIAQSLGLPY  87

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++F HGANFAT  ST+   + +LF    SPFSL +Q  QF QFK       
Sbjct  88    LSAYLDSVGTNFSHGANFATAGSTIRRQNKTLFQGGFSPFSLDVQSWQFSQFK-------  140

Query  846   QEQHHSYNHGNT---KLPPKNIFGKALYTFYIGQNDFI---FDLASLGISGVNQSLPEVV  685
                  +Y  G      LP ++ F +ALYTF IGQND     FD  ++    V   +P+V+
Sbjct  141   SRSQLAYKRGGVFKDLLPTEDYFSRALYTFDIGQNDLTSGYFD--NMTTEEVKAYVPDVL  198

Query  684   AQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYN  505
              + T  +K+IY  GGR F+I N  P GC P  L +L    + +D+ GC   +N     +N
Sbjct  199   NKFTIVVKNIYGQGGRFFWIHNTGPFGCLPYVLDRLLLTAAQVDRVGCGAPFNEVAKLFN  258

Query  504   NILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKE  325
               LK  + Q R+D+  A   YVD +S+  EL      HG ++    CCG+ GG YN+   
Sbjct  259   VKLKKTVNQLRKDLPLAVFTYVDVYSVKYELISQANKHGFEHPLVTCCGH-GGKYNYNAH  317

Query  324   LFC-GDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHH  148
             L C G   V N + +  ++CEDP     WDG H T+AANK     I  G++ DPP PL  
Sbjct  318   LGCGGKITVNNTEILVGKSCEDPSKRTCWDGVHYTEAANKWVFDQIVEGAFSDPPIPLRM  377

Query  147   FC  142
              C
Sbjct  378   AC  379



>ref|XP_002284695.1| PREDICTED: esterase [Vitis vinifera]
 emb|CBI36776.3| unnamed protein product [Vitis vinifera]
Length=390

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 150/357 (42%), Positives = 209/357 (59%), Gaps = 8/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNF DSN+DTGG+ AAF     PYG T+F+ P GR +DGR+++DF+A   GL F
Sbjct  36    CKFPAIFNFADSNSDTGGYAAAFSQPPWPYGRTFFRMPAGRFSDGRLMIDFIANSFGLPF  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS++ +GANFAT ++T+  P   +     SPF L +Q++QF QFK     + 
Sbjct  96    LSAYLNSLGSNYTNGANFATAAATIRLPTRIIPAGGFSPFYLGLQYDQFVQFKSRT-LKI  154

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             +++   Y      +P +  F KALYT  IGQND      A++ I  VN ++P+++   + 
Sbjct  155   RKRGGVYKD---LMPKEEYFPKALYTLDIGQNDLGEGFFANMSIQEVNATVPDIINGFST  211

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              ++ IY  G R+F+I N  PIGC P  LA      +  D  GC K +N     +N  LK+
Sbjct  212   NVRRIYKSGARSFWIHNTGPIGCLPYILANF--QAAQRDSAGCSKPHNEVAQYFNYKLKE  269

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+D   A + YVD +S+   LF  P  +G +    ACCGY GG+YN+  +  CG 
Sbjct  270   AVSQLRKDFPLAAITYVDVYSVKYSLFSQPKKYGFELPLVACCGY-GGEYNYGNDAGCGS  328

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T  +NG  +   +CE P   V+WDG H T+AANK     I SG++ DPP PL   CH
Sbjct  329   TITVNGSQIFVGSCERPSLRVNWDGIHYTEAANKFVFDQISSGAFSDPPLPLRMACH  385



>emb|CDX83618.1| BnaC07g23580D [Brassica napus]
Length=380

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 157/357 (44%), Positives = 210/357 (59%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAIFNFGDSN+DTGG  AAF     P G TYF  P GR +DGR+IVDF+A+ LGL +
Sbjct  27    CSFPAIFNFGDSNSDTGGLSAAFGQAPYPNGQTYFHSPSGRFSDGRLIVDFIAEELGLPY  86

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L+ +L SIGS+F HGANFAT  STV PP++++  S  SP SL +Q  QF  F V   +  
Sbjct  87    LNAFLDSIGSNFSHGANFATAGSTVRPPNTTISQSGASPISLDVQLVQFSDF-VTRSQLI  145

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             + +   + H    LP K  F +ALYTF IGQND    L  ++    +   +P+V+ Q++ 
Sbjct  146   RNRGGVFGH---LLPRKEYFSQALYTFDIGQNDLTTGLKLNMTTDQIKAYIPDVLDQLSN  202

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              I+ +Y  GGR F+I N APIGC P  L + S   S +D+ GC    N     YN+ LK 
Sbjct  203   AIRKVYKSGGRRFWIHNTAPIGCLPYVLDRWSVPASQIDKHGCAIPRNEIARYYNSELKK  262

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              +   R+++  A++ YVD +SI L L       G K    ACCG+ GG YNF K + CG 
Sbjct  263   RVVGLRKELSKASITYVDVYSIKLTLITQAKKLGFKDPLVACCGH-GGKYNFNKLIKCGV  321

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
               ++ G +TV A++C+D    ++WDG H T  AN+   Q I SG + DP  PL   C
Sbjct  322   KYMVKGKETVLAKSCDDVAVRINWDGVHFTGTANRWIFQQINSGVFSDPSIPLKFAC  378



>ref|XP_006434193.1| hypothetical protein CICLE_v10001435mg [Citrus clementina]
 gb|ESR47433.1| hypothetical protein CICLE_v10001435mg [Citrus clementina]
Length=391

 Score =   284 bits (727),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 150/357 (42%), Positives = 204/357 (57%), Gaps = 8/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFN GDSN+DTGG  AAF     PYG TYF  P GR +DGR+I+DF+AQ   L +
Sbjct  37    CDFPAIFNLGDSNSDTGGLAAAFSPPNSPYGETYFHMPAGRFSDGRLIIDFIAQSFDLPY  96

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             +S YL S+G++F HGANFAT +ST+  P   +     SPF L +Q  QF QFK     + 
Sbjct  97    ISAYLNSLGTNFSHGANFATAASTIRLPTRIIPGGGFSPFYLDVQLQQFSQFK----NRS  152

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q   +      + +P +  F KALYTF IGQND       ++ +  VN+S+P+++ + + 
Sbjct  153   QIIRNRGGIFASLMPREEYFSKALYTFDIGQNDLGAGFFGNMSVEEVNESIPDIINKFSA  212

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +K+IY LG R+F+I N  PIGC P  LA      S  D  GC K YN    ++N  LK+
Sbjct  213   NVKNIYNLGARSFWIHNTGPIGCLPYILANF---PSAKDFAGCAKPYNEVAKNFNLKLKE  269

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+D   A   YVD +S+   LF++P  +G +  T ACCGYG  +YN+     CG 
Sbjct  270   AVVQLRKDFPSAAFTYVDVYSVKYSLFRNPKRYGFELPTVACCGYGDNEYNYSGTAECGQ  329

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +NG      +C+ P   V+WDG H T+AA K     I +G++ DP  PL   C 
Sbjct  330   LATVNGTQFIVGSCDRPSVRVNWDGIHYTEAAAKFVFDRISTGAFSDPRIPLKMACR  386



>ref|XP_002513813.1| Esterase precursor, putative [Ricinus communis]
 gb|EEF48396.1| Esterase precursor, putative [Ricinus communis]
Length=381

 Score =   283 bits (725),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 152/360 (42%), Positives = 209/360 (58%), Gaps = 18/360 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGG  AAF     PYG TYF  P GR +DGR+I+DF+A+   L +
Sbjct  28    CEFSAIFNFGDSNSDTGGLAAAFTPPNSPYGQTYFHMPAGRYSDGRLIIDFIAKSFHLPY  87

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQF--KVMVDE  853
             LS YL S+G++F+HGANFAT +ST+  P S + +   SPF L +Q+ QF QF  +  +  
Sbjct  88    LSAYLNSLGTNFKHGANFATAASTIRLPTSIIPNGGFSPFYLDVQYQQFVQFIYRSKMIR  147

Query  852   QEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQI  676
             ++Q  H            K+ FG+ALYTF IGQND       +L +  VN S+P++V   
Sbjct  148   EKQLIHD-----------KDYFGRALYTFDIGQNDLGAGFFGNLSVEEVNASVPDIVNSF  196

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
             +  +K+IY LG R+F+I N  PIGC    L       ++ D  GC K+YN     +N  L
Sbjct  197   SVNVKNIYKLGARSFWIHNTGPIGCLAYILENFP--LAEKDSAGCAKAYNEVAQYFNFKL  254

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K+ + Q R+D+  A + +VD +S+   LF  P  +G +     CCGY GG YNF     C
Sbjct  255   KETIAQLRKDLPSAAITHVDIYSVKYSLFNEPKKYGFELPLVGCCGY-GGIYNFSDVAGC  313

Query  315   GDTNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             GD  ++NG Q +   +C+ P   V WDG H T+AAN+     I +G++ DPP PL   CH
Sbjct  314   GDRVIVNGSQIIVDSSCDRPSVRVEWDGIHYTEAANRFIFNQISTGAFSDPPIPLKMACH  373



>ref|NP_001060128.1| Os07g0586100 [Oryza sativa Japonica Group]
 dbj|BAC80099.1| putative early nodulin 8 precursor [Oryza sativa Japonica Group]
 dbj|BAF22042.1| Os07g0586100 [Oryza sativa Japonica Group]
 dbj|BAG92478.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67491.1| hypothetical protein OsJ_24919 [Oryza sativa Japonica Group]
Length=405

 Score =   284 bits (727),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/361 (41%), Positives = 206/361 (57%), Gaps = 11/361 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A    + PP+G TYF  P GR +DGR+ +DF+AQ LG+ +
Sbjct  45    CDFPAIFNFGDSNSDTGGLSALIAVVPPPFGRTYFGMPAGRFSDGRLTIDFMAQSLGIRY  104

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F  GANFAT ++++ P + S+F S +SP SL +Q +QF+QF        
Sbjct  105   LSAYLDSVGSNFSQGANFATAAASIRPANGSIFVSGISPISLDVQTSQFEQFI------N  158

Query  846   QEQHHSYNHG---NTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQ  679
             + Q    N G      LP    F +ALYTF IGQND       ++    V   +P+++ +
Sbjct  159   RSQFVYSNIGGIYREILPKAEYFSRALYTFDIGQNDLTMGYFDNMSTEQVEAYVPDLMER  218

Query  678   ITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNI  499
              +  I+ +Y LGGR F++ N AP+GC    +  L    +  D  GC  +YN A   +N  
Sbjct  219   FSAAIQKVYSLGGRYFWVHNTAPLGCLTYAVVLLPKLAAPRDDAGCSVAYNAAARFFNAR  278

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             L++ + + R  + DA + YVD +S    L       G       CCGYGGG+YNF +++ 
Sbjct  279   LRETVDRLRAALPDAALTYVDVYSAKYRLISQAKQLGFGDPLLVCCGYGGGEYNFDRDIR  338

Query  318   CGDTNVLNGQTVTA-EACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             CG    +NG +V A ++C+DP   VSWDG H T+AAN+   + I  G   DPP PL   C
Sbjct  339   CGGKVEVNGTSVLAGKSCDDPSRSVSWDGVHFTEAANRFVFELIVGGKLSDPPVPLRQAC  398

Query  141   H  139
              
Sbjct  399   R  399



>ref|XP_007140861.1| hypothetical protein PHAVU_008G147700g [Phaseolus vulgaris]
 gb|ESW12855.1| hypothetical protein PHAVU_008G147700g [Phaseolus vulgaris]
Length=389

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 150/364 (41%), Positives = 214/364 (59%), Gaps = 17/364 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTG   AAF   V PYG T+F +PVGRA+DGR+I+DF+AQ LG   
Sbjct  31    CDFRAIFNFGDSNSDTGCMAAAFYPEVSPYGETFFHQPVGRASDGRLIIDFIAQHLGFPL  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS Y+ SIG+ +RHGANFA  SST+   + ++F+   +PF+  IQ  QF QFK    +  
Sbjct  91    LSAYINSIGTSYRHGANFAAGSSTIRRQNRTVFEGG-TPFTFEIQTEQFNQFKQRTGKFF  149

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +   S   G+   P  + F KALYTF IGQND    +  +G    +  + ++V   +K 
Sbjct  150   NQARKSSFRGH--FPRPDDFAKALYTFDIGQNDIAAAINRVGTEDSHAVISDIVEHFSKQ  207

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD--------LDQFGCLKSYNNAVAD  511
             +++++ +G RTF+I N  PIGC P  +A   HN +         LDQ GC+   N+   +
Sbjct  208   VQNLHEVGARTFWIHNSGPIGCLP--VAMPVHNNATNHTPEAGYLDQNGCVNYENDMARE  265

Query  510   YNNILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFK  331
             +N  LK+ + + R    DA+++YVD  S   EL  +    G    ++ CCGY    Y+  
Sbjct  266   FNKKLKNMVVKLRAKFLDASLIYVDMFSTKYELISNANKEGFVEPSEICCGYHKDGYH--  323

Query  330   KELFCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLH  151
               L+CG+  ++NG+ + A +CEDP  Y+SWDG H T+AAN+  V  I +GS+ DPP P+ 
Sbjct  324   --LYCGNKGMINGKEILAGSCEDPSKYISWDGVHYTEAANRWIVNRILNGSFSDPPVPIT  381

Query  150   HFCH  139
             H C 
Sbjct  382   HSCR  385



>ref|XP_009771354.1| PREDICTED: GDSL esterase/lipase At5g14450 isoform X3 [Nicotiana 
sylvestris]
Length=394

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 143/357 (40%), Positives = 201/357 (56%), Gaps = 12/357 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAI+NFGDSN+DTGG  AAF  +  PYG ++F +P GR +DGR+++DF+A+ L L +
Sbjct  44    CNFPAIYNFGDSNSDTGGISAAFQPIQAPYGESFFHRPAGRLSDGRLLIDFIAEHLRLPY  103

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L  YL SIGS+FRHGANFAT  ST+   + ++F S +SPFSL +Q  QF +FK   +E  
Sbjct  104   LIAYLDSIGSNFRHGANFATGGSTIRRQNQTIFQSGISPFSLDVQIMQFHRFKARTEEL-  162

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                   Y     KLP    F KALYT  IGQ D       +    +  ++ +++ Q +  
Sbjct  163   ------YRQEKKKLPRPREFSKALYTLDIGQTDLAVGFRQMSNIQLRAAISDIINQFSAA  216

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSH-NTSDLDQFGCLKSYNNAVADYNNILKD  490
             +  +Y  G R F+I N  PIGC P+    L +     LD +GCLKS N    ++N  LK 
Sbjct  217   VMRLYQQGARAFWIHNTGPIGCLPTATLYLRNPKPGVLDNYGCLKSQNKMALEFNRQLKA  276

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              +R  R ++  A++ YVD ++   EL  +  S G     K CCG   G+      ++CG 
Sbjct  277   RIRTLRAELGHADITYVDVYAAKYELISNANSQGFMEPHKICCGLHEGN----THVWCGQ  332

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
               ++ G  V   AC +P  Y+SWDG H + AAN      I +GS+ DPP P+ H CH
Sbjct  333   KAIVRGAEVFGGACVNPSIYISWDGVHYSQAANHWIANQILNGSFSDPPIPITHACH  389



>emb|CBI16798.3| unnamed protein product [Vitis vinifera]
Length=384

 Score =   283 bits (725),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 152/356 (43%), Positives = 198/356 (56%), Gaps = 9/356 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAI+NFGDSN+DTG   A    +  P G   F KP GR +DGR+I+DF+A+ LGL +
Sbjct  30    CHFPAIYNFGDSNSDTGSVSAVLRRVPFPNGQN-FGKPSGRYSDGRLIIDFIAENLGLPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L+ YL SIG+ FRHGANFA   ST+ PPH  +F+    P SL IQ  QF QFK     Q 
Sbjct  89    LNAYLDSIGTSFRHGANFAATGSTIQPPHLRMFEEVCYPLSLNIQLLQFAQFKART-TQL  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
               Q  + +  NT LP    F KALYT   GQND      S+ +  V +S+P ++ Q ++ 
Sbjct  148   YPQVQNSDIKNT-LPRPEDFSKALYTMDTGQNDLHDGFTSMTVEQVQKSIPNIINQFSQA  206

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             I+ +Y  G + F+I N  PIGC P F+        ++DQ GC+KSYN    ++N  LKD 
Sbjct  207   IEQLYQQGAKIFWIHNTGPIGCLPFFVINYPPKPDNVDQTGCIKSYNEVAQEFNRQLKDM  266

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             + Q R  + DA + YVD +S    L      HG       CCG  G    F++   CG  
Sbjct  267   VSQLRSKLGDALLTYVDIYSAKYSLISEAKIHGFVDPFGQCCGQNG---KFRE---CGKK  320

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
              V+NG  V   +C +P  YVSWDG H TDAAN+     I +GS  DPP P+   CH
Sbjct  321   AVVNGTEVDGASCTNPSEYVSWDGVHYTDAANQWVAGHILNGSLSDPPLPISEACH  376



>ref|XP_011101808.1| PREDICTED: GDSL esterase/lipase At5g14450 [Sesamum indicum]
Length=398

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 147/368 (40%), Positives = 210/368 (57%), Gaps = 14/368 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAI+NFGDSN+DTGG  AAF  + PPYG++YF +P GR +DGR+I+DF+A+ LGL +
Sbjct  35    CDFPAIYNFGDSNSDTGGISAAFWPIPPPYGVSYFHRPAGRNSDGRLIIDFIAEHLGLPY  94

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL SIG++FRHGANFAT  ST+   + S+F++ +SPFSL IQ  QF QFK    E  
Sbjct  95    LSSYLDSIGTNFRHGANFATGGSTIRMQNESIFENGISPFSLDIQTMQFDQFKARTSELY  154

Query  846   QEQHHSYNHGN--------TKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPE  691
              +        N         KLP    F +ALYTF IGQND       L +  +  ++P+
Sbjct  155   HQSELKLMQDNIFLDPSSARKLPRPKEFSRALYTFDIGQNDIAAGFRKLTMPQLRAAIPD  214

Query  690   VVAQITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD--LDQFGCLKSYNNAV  517
             +V +    I  +Y  G R F+I N  PIGC P+ +  +S+ +     D++GC++S+N   
Sbjct  215   IVDKFGAAITRLYQHGARAFWIHNTGPIGCLPAAMFYVSNPSKPGFFDKYGCIRSHNAIA  274

Query  516   ADYNNILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYN  337
              ++N  LK  +   R ++  A + YVD +S    L  +   +G +   K CCG+   + +
Sbjct  275   LEFNRQLKARVNTLRAELPHAALTYVDIYSAKYHLISNTKIYGFRDPFKICCGHHKNNIH  334

Query  336   FKKELFCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFP  157
                 ++CG   V+NG  +   AC  P   +SWDG H + AAN      I +GS+ DPP P
Sbjct  335   ----VWCGQRVVINGSEIVGAACGSPAACISWDGVHYSQAANHWIANRIANGSFSDPPMP  390

Query  156   LHHFCHIH  133
             + H C  H
Sbjct  391   IAHACLKH  398



>ref|XP_009363153.1| PREDICTED: esterase-like isoform X1 [Pyrus x bretschneideri]
Length=390

 Score =   283 bits (725),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 208/357 (58%), Gaps = 8/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPA+FN GDSN+DTGG  ++  +  PPYG T+F  P GR +DGR+I+DFLA  +G  F
Sbjct  39    CQFPAVFNLGDSNSDTGGLASSLIAPTPPYGETFFGMPEGRFSDGRLIIDFLANSVGHPF  98

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++F +GANFAT +ST+  P+S +     SPF L IQ+ Q  + K       
Sbjct  99    LSAYLDSLGTNFSYGANFATAASTIRLPNSVIPSGGFSPFYLDIQYMQLMRLKFRSRLIR  158

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q          + LP    F KALYTF IGQND      A+  I  VN S+P+++ + + 
Sbjct  159   QRG----GIFASLLPKDEYFPKALYTFDIGQNDLGEGFFANKTIKEVNASVPDIITKFST  214

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              I+ IY LG R F+I N  PIGC P  LA     ++  D+ GC KSYN     +N+ LK+
Sbjct  215   NIQKIYDLGARLFWIHNTGPIGCLPYILANFP--SAQKDEVGCAKSYNEVAQYFNHQLKE  272

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A  Q R+ +  A   YVD +S+   L++ P  +G ++   ACCG+ GG YN+     CG 
Sbjct  273   ATVQLRKVLPSAAFTYVDIYSVKYSLYKEPKKYGFEFPLVACCGF-GGKYNYSSSAGCGT  331

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T  +NG  +   +C++P   V+WDG H T+AANK     I +G++ DPP PL H CH
Sbjct  332   TVTVNGSQIFVGSCKNPSVRVNWDGVHYTEAANKFVFDKISTGAFSDPPLPLKHACH  388



>ref|XP_002311760.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE89127.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=390

 Score =   283 bits (725),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 150/358 (42%), Positives = 208/358 (58%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF     P G TYF  P GR +DGR+I+DF+A+ LG+  
Sbjct  33    CDFPAIFNFGDSNSDTGGLSAAFGQAPSPNGETYFHHPAGRYSDGRLILDFIAESLGVPH  92

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F HGANFAT  ST+ P +++   S  SP SL +Q  Q+  FK    ++ 
Sbjct  93    LSAYLDSVGSNFSHGANFATAGSTIRPQNTTQSQSGYSPISLNVQSVQYSDFK----KRS  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             Q          T +P  + F KALYT  IGQND       +L    V  ++P+++ Q + 
Sbjct  149   QIVRSQGGIFETLMPKADYFSKALYTIDIGQNDLTAGYKLNLTTEQVKANVPDMLGQFSN  208

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +K IY +GGR+F+I N  P+GC P  L +     + +D++GC   +N     +N+ LK+
Sbjct  209   AVKQIYAVGGRSFWIHNTGPVGCLPYSLDRFLITAAQIDKYGCATPFNEVSQFFNHGLKE  268

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+D+  A + YVD +S+   L       G K    ACCG+ GG YN+  +  CG 
Sbjct  269   AVVQLRKDLPQAAITYVDIYSLKYTLTTQAKKFGFKQPFVACCGH-GGKYNYNSQRRCGA  327

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +NG + + A +C+DP   + WDG H T+AANK   Q I +GS+ DPP PL   CH
Sbjct  328   KITVNGTEVLIANSCKDPSVRIIWDGVHFTEAANKWIFQQIVNGSFSDPPVPLKMACH  385



>ref|XP_004298998.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Fragaria vesca 
subsp. vesca]
Length=385

 Score =   283 bits (725),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 147/363 (40%), Positives = 212/363 (58%), Gaps = 12/363 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAIFNFGDSN+DTGG  A F     P+G T+F  P GR  DGR+++DF+A+ LGL +
Sbjct  29    CNFPAIFNFGDSNSDTGGLSAVFGQARSPHGETFFHHPAGRYCDGRLVIDFIAKSLGLPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F HGANFAT  ST+ P +++L  S  SP SL +Q+N+F  F +   +  
Sbjct  89    LSAYLDSVGSNFTHGANFATAGSTIRPQNTTLQQSGFSPISLNVQYNEFYDF-LPRSQVA  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFI----FDLASLGISGVNQSLPEVVAQ  679
             + Q   +      +P    F + LYTF IGQND       +++   + G+   +P+V+ Q
Sbjct  148   RTQGGVFEQ---LMPKAEAFSRGLYTFDIGQNDLTAGLFMNMSVAQVKGI--VVPDVLDQ  202

Query  678   ITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNI  499
               K +K ++  GGR F+I N  P+GC P  L +L    S++D+ GC   +N     +N  
Sbjct  203   FKKVVKYVHSQGGRNFWIHNTGPVGCLPYVLDRLPVLVSEMDRHGCATPFNELAQFFNRG  262

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             LK A+ Q R+++  A + YVD +     L   P  HG++   + CCG+ GG YNF   L 
Sbjct  263   LKHAVVQLRKELPSAAITYVDVYKAKFNLISQPQKHGVEEPIRTCCGH-GGKYNFNVHLG  321

Query  318   CGDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             CG    ++G+ +  A+AC+DP  +V+WDG H T+A+NK     I  GS  +PP PL   C
Sbjct  322   CGGKIKVHGKEILVAKACKDPSVWVNWDGVHYTEASNKKIFDQIVDGSLSNPPVPLKMAC  381

Query  141   HIH  133
             H H
Sbjct  382   HKH  384



>gb|KDO49031.1| hypothetical protein CISIN_1g016659mg [Citrus sinensis]
Length=385

 Score =   283 bits (724),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/357 (40%), Positives = 204/357 (57%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAI+NFGDSN+DTGG  AAF  +  PYG  +F KP GR +DGR+I+DF+A+ + L +
Sbjct  33    CEFPAIYNFGDSNSDTGGISAAFEPIRVPYGEGFFHKPAGRDSDGRLIIDFIAESVKLPY  92

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++FRHGANFAT  ST+  P+ ++++  +SPF L +Q  QF QFK    E  
Sbjct  93    LSSYLNSLGTNFRHGANFATGGSTIGKPNETIYEYGISPFFLGMQITQFNQFKARTKELY  152

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              E   + +    KLP +  F KALYTF IGQND       +    +  +LP +V Q+   
Sbjct  153   DEAKIASDR--DKLPRQEDFAKALYTFDIGQNDLSVGFRKMSFDQLRVALPNIVNQLASA  210

Query  666   IKDIYLLGGRTFFILNLAPIGCYPS-FLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             +++IY  GGR F+I N  PIGC P+ F    +     LD  GC+K  NN   ++N  LK+
Sbjct  211   VQNIYQQGGRAFWIHNTGPIGCLPTNFFYNHNPPPGYLDDHGCVKDQNNMAVEFNRQLKE  270

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R ++ +A V YVD ++   +L  +  + G     K CCGY    +     ++CG+
Sbjct  271   RVIKLRTELPEAAVTYVDVYATKYDLIGNAKTLGYADPFKVCCGY----HENYDHVWCGN  326

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +N   V   +C+DP   +SWDG H T AAN+        GS  DPP P+   CH
Sbjct  327   KATINNTEVYGASCKDPSKSISWDGVHYTQAANQWVANHTLYGSLTDPPIPITQACH  383



>ref|XP_010682275.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Beta vulgaris 
subsp. vulgaris]
Length=400

 Score =   284 bits (726),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 151/359 (42%), Positives = 207/359 (58%), Gaps = 8/359 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A +    PPYG T+F  P GR  DGR+I+DFLA+ LGL +
Sbjct  44    CDFPAIFNFGDSNSDTGGLSAVYGQAPPPYGETFFGAPAGRYCDGRLIIDFLAKSLGLPY  103

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL SIG++F HGANFAT  STV P ++S   S  SP SL +QF ++  F+    ++ 
Sbjct  104   LSAYLDSIGTNFSHGANFATAGSTVRPQNTSKSQSGYSPISLDVQFAEYSNFR----KRS  159

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             Q            LP ++ F +ALYTF IGQND       ++    V   +P+V+ Q +K
Sbjct  160   QIVRKQGGVFTELLPKEDYFTRALYTFDIGQNDLTAGYKLNMTSEQVKAYIPDVLHQFSK  219

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +K +Y  GGR+F+I N  P+GC P  L + +   + +DQ GC    N     YN++LK+
Sbjct  220   VVKGVYGQGGRSFWIHNTGPLGCLPYMLDRFNLTAAQIDQSGCAIPLNEVSRYYNSMLKE  279

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R D+  A + YVD +S+   L      +G +    ACCG  GG YN+   + CG 
Sbjct  280   VVVQLRMDLPLAAITYVDIYSLKYTLITQAKKYGFEKPLVACCGI-GGRYNYNNTMRCGS  338

Query  309   TNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGS-YFDPPFPLHHFCH  139
             T ++ G+ +  A++C +P   V+WDG H T+AANK     I   S YFDPP  L   CH
Sbjct  339   TEMVGGKDILIAKSCNNPSARVNWDGIHYTEAANKWLFDQITRNSLYFDPPISLEMACH  397



>gb|EEC82351.1| hypothetical protein OsI_26660 [Oryza sativa Indica Group]
Length=405

 Score =   284 bits (726),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 147/361 (41%), Positives = 206/361 (57%), Gaps = 11/361 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A    + PP+G TYF  P GR +DGR+ +DF+AQ LG+ +
Sbjct  45    CDFPAIFNFGDSNSDTGGLSALIAVVPPPFGRTYFGMPAGRFSDGRLTIDFMAQSLGIRY  104

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F  GANFAT ++++ P + S+F S +SP SL +Q +QF+QF        
Sbjct  105   LSAYLDSVGSNFSQGANFATAAASIRPANGSIFVSGISPISLDVQTSQFEQFI------N  158

Query  846   QEQHHSYNHG---NTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQ  679
             + Q    N G      LP    F +ALYTF IGQND       ++    V   +P+++ +
Sbjct  159   RSQFVYSNIGGIYREILPKAEYFSRALYTFDIGQNDLTMGYFDNMSTEQVEAYVPDLMER  218

Query  678   ITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNI  499
              +  I+ +Y LGGR F++ N AP+GC    +  L    +  D  GC  +YN A   +N  
Sbjct  219   FSAAIQKVYSLGGRYFWVHNTAPLGCLTYAVVLLPKLAAPRDDAGCSVAYNAAARFFNAR  278

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             L++ + + R  + DA + YVD +S    L       G       CCGYGGG+YNF +++ 
Sbjct  279   LRETVDRLRAALPDAALTYVDVYSAKYRLISQAKQLGFGDPLLVCCGYGGGEYNFDRDIR  338

Query  318   CGDTNVLNGQTVTA-EACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             CG    +NG +V A ++C+DP   VSWDG H T+AAN+   + I  G   DPP PL   C
Sbjct  339   CGGKVEVNGTSVLAGKSCDDPSRSVSWDGVHFTEAANRFVFELIVGGKLSDPPVPLRQAC  398

Query  141   H  139
              
Sbjct  399   R  399



>ref|XP_011101807.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Sesamum indicum]
Length=380

 Score =   283 bits (724),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 146/357 (41%), Positives = 209/357 (59%), Gaps = 8/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C +PAI+NFGDSN+DTGG  AAF   V P G TYF +PVGRA+DGR+I+DF+A  LGL +
Sbjct  29    CVYPAIYNFGDSNSDTGGIAAAFYPPVLPCGQTYFHRPVGRASDGRLIIDFIAGHLGLPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL SIGS++RHGANFAT  +T+M P+ S FD+ VSPF L IQ   + QFK       
Sbjct  89    LSPYLDSIGSNYRHGANFATGGATIMRPNESWFDNGVSPFCLEIQVEHYTQFKEKTAYFY  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             + ++ S+      LP    F KAL+   IGQND    L        + +LP + +Q T  
Sbjct  149   KAKNKSF---KKMLPRPQDFSKALFIVDIGQNDVAAVLRKSSFELQSAALPNIASQFTAQ  205

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILKD  490
             ++++Y  G RTF+I N  PIGC P    K+       LD+ GC+ + N    ++N +LK+
Sbjct  206   VQNLYQRGARTFWIHNTGPIGCLPVATVKVQDPVPGYLDEHGCVMNQNEIAIEFNRLLKN  265

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R  + +A +++VD +    EL  +  + G +   K CCG+ G  Y    +++CG+
Sbjct  266   EIVELRLKLTEARIIHVDMYRAKHELITNAKNQGFEDPFKICCGHHGIGY----DVWCGN  321

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +NG  V A +C +P   +SWDG H ++AAN+     I  GS+ DPP P+   C 
Sbjct  322   KANVNGSEVFAGSCANPSKVISWDGVHYSEAANRWIANHIVDGSFSDPPIPISRACQ  378



>gb|KDP26685.1| hypothetical protein JCGZ_17843 [Jatropha curcas]
Length=380

 Score =   283 bits (723),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 153/361 (42%), Positives = 205/361 (57%), Gaps = 17/361 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF  L  P G ++F KP GR  DGR I+DFLA+ L L +
Sbjct  27    CHFPAIFNFGDSNSDTGGKSAAFHRLPYPNGYSFFNKPSGRYCDGRDIIDFLAEKLELPY  86

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL SIG++FRHGANFAT  ST+ P   ++F S  SP SL IQ +QF+QFK    E  
Sbjct  87    LSAYLDSIGTNFRHGANFATGGSTIQPADGNIFGSGFSPISLDIQLSQFEQFKERTLEL-  145

Query  846   QEQHHSYNHGNT-----KLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVA  682
                   YN G T     KLP    F KALYT  IGQND    +  +    V +SLP+++ 
Sbjct  146   ------YNQGRTLNVMNKLPRPEDFSKALYTLDIGQNDLHAWIKLMSEKQVVESLPKIIN  199

Query  681   QITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNN  502
             Q  + I+ +Y LG R F+I N  PIGC P  +        + D+ GC+KS+N+   ++N 
Sbjct  200   QFAQAIEKLYQLGARIFWIHNTGPIGCLPFAVIFYPPKPENRDENGCVKSHNDIAQEFNR  259

Query  501   ILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKEL  322
              LKD + Q R+ + +A + Y D ++    L      HG       CCG+  GDY     L
Sbjct  260   QLKDRVSQLRKQLPNAALTYTDIYTAKYSLISEAKKHGFADPLGYCCGH-YGDY----RL  314

Query  321   FCGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
              CG   ++NG  ++ + C +P  Y+SWDG H + AANK+   +I  GS  +PP  +   C
Sbjct  315   QCGRKAIVNGTEISGDPCSNPELYISWDGIHYSQAANKIIAHSILDGSLSEPPISISEAC  374

Query  141   H  139
             +
Sbjct  375   N  375



>ref|XP_002513811.1| Esterase precursor, putative [Ricinus communis]
 gb|EEF48394.1| Esterase precursor, putative [Ricinus communis]
Length=381

 Score =   283 bits (723),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 154/360 (43%), Positives = 212/360 (59%), Gaps = 11/360 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF S  PPYG T+F  P GR +DGR+I+DF+A+   L +
Sbjct  31    CDFPAIFNFGDSNSDTGGMPAAFISPNPPYGETHFHVPAGRYSDGRLIIDFIAESFNLPY  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++F +GANFAT  +T+  P S + +   SPF L +Q+ QF QF++    + 
Sbjct  91    LSAYLNSMGTNFTNGANFATGGATIRLPSSIIPNGLSSPFFLEVQYLQFMQFRL----KS  146

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD--LASLGISGVNQSLPEVVAQIT  673
             Q          T +P +  F KALYT  IG ND I D  L ++ I  VN S+P++V + +
Sbjct  147   QIIRKQGGVFATLMPKEEYFSKALYTVDIGHND-IGDGLLTNMSIEQVNASVPDMVNEFS  205

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               I ++Y LG R+F+I N  PIGC    L       ++ D+ GCLK +N     +N +L 
Sbjct  206   ANIWNLYNLGARSFWIHNTGPIGCLSYMLTNFP---AEKDEAGCLKPHNEVAQYFNFMLN  262

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
              ++ Q R+D   A  +YVD +S+   LF  P  +G +    ACCGYGG  YNF     CG
Sbjct  263   QSIVQLRKDFPLATFIYVDVYSVKYSLFTSPAKYGFELPLVACCGYGGM-YNFNNTAQCG  321

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
             DT  +NG  +   +C+ P   V WDG H T+AANK     I +G++ DPP PL+  C+ H
Sbjct  322   DTVTVNGTQIVVGSCDSPSVRVIWDGIHYTEAANKFVFHQISTGAFSDPPIPLNMSCNKH  381



>emb|CAN71345.1| hypothetical protein VITISV_024250 [Vitis vinifera]
Length=390

 Score =   283 bits (724),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 149/357 (42%), Positives = 209/357 (59%), Gaps = 8/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNF DSN+DTGG+ AAF     PYG T+F+ P GR +DGR+++DF+A   GL F
Sbjct  36    CKFPAIFNFADSNSDTGGYAAAFSQPPWPYGRTFFRMPAGRFSDGRLMIDFIANSFGLPF  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+ S++++GANFAT ++T+  P   +     SPF L +Q++QF QFK     + 
Sbjct  96    LSAYLNSLASNYKNGANFATAAATIRLPTRIIPAGGFSPFYLGLQYDQFVQFKSRT-LRI  154

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             +++   Y      +P +  F KALYT  IGQND      A++ I  VN ++P+++   + 
Sbjct  155   RKRGGVYKD---LMPKEEYFPKALYTLDIGQNDLGEGFFANMSIQEVNATVPDIINGFST  211

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              ++ IY  G R+F+I N  PIGC P  LA      +  D  GC K +N     +N  LK+
Sbjct  212   NVRRIYKSGARSFWIHNTGPIGCLPYILANF--QAAQRDSAGCSKPHNEVAQYFNYKLKE  269

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+D   A + YVD +S+   LF  P  +G +    ACCGY GG+YN+  +  CG 
Sbjct  270   AVAQLRKDFPLAAITYVDVYSVKYSLFSQPKKYGFELPLVACCGY-GGEYNYGNDAGCGS  328

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T  +NG  +   +CE P   V+WDG H T+AANK     I SG++ DPP PL   CH
Sbjct  329   TITVNGSQIFVGSCERPSFRVNWDGIHYTEAANKFVFYQISSGAFSDPPLPLRMACH  385



>ref|XP_007159696.1| hypothetical protein PHAVU_002G259500g [Phaseolus vulgaris]
 gb|ESW31690.1| hypothetical protein PHAVU_002G259500g [Phaseolus vulgaris]
Length=383

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/352 (42%), Positives = 209/352 (59%), Gaps = 7/352 (2%)
 Frame = -1

Query  1203  SFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAFL  1024
             +F AIFNFGDSN+DTGG  AAF    PP G+T+F  P GR +DGR+I+DF+A+  GL +L
Sbjct  30    NFRAIFNFGDSNSDTGGLSAAFGQAPPPNGITFFHSPNGRFSDGRLIIDFIAKSFGLPYL  89

Query  1023  SPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQEQ  844
             + YL S+GS+F HGANFAT  STV P +++   S  SP SL +QF QF+ FK    +  +
Sbjct  90    NAYLDSVGSNFSHGANFATAGSTVRPQNTTKSQSGYSPISLDVQFQQFRDFKTR-SKFVR  148

Query  843   EQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITKT  667
             E+   +      LP +  F  ALYTF IGQND       +     V   +P+V+ Q ++ 
Sbjct  149   ERGGVFKE---LLPKEEYFSGALYTFDIGQNDLTAGYKLNFTTEQVKAYIPDVLGQFSRV  205

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             IK ++  GGRTF+I N  P+GC P  L +   + + +D+FGC K +N     +N  LK++
Sbjct  206   IKGVHGEGGRTFWIHNTGPLGCLPYMLDRYPMSPAQMDEFGCAKPFNEVAQYFNKRLKES  265

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             + + R+++ DA + YVD + +   L  H   +G + G  ACCG+ GG YNF     CG +
Sbjct  266   VEKLREELPDAKITYVDVYRVKYRLISHAQKYGFEKGLIACCGH-GGKYNFNNRERCGAS  324

Query  306   NVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPL  154
               +NG + V A+AC+D    + WDG H T+AAN      I +GS+ DPP  L
Sbjct  325   KRMNGREVVIAKACKDASVRIIWDGIHYTEAANNWIFLQILNGSFSDPPTSL  376



>ref|XP_008230503.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X2 [Prunus 
mume]
Length=382

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/358 (40%), Positives = 208/358 (58%), Gaps = 8/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAI+NFGDSN+DTGG  AAF  +  PYG  +F KP GR +DGR+I+DF+A+ L L +
Sbjct  29    CSFPAIYNFGDSNSDTGGISAAFEPIRAPYGEAFFHKPAGRDSDGRLIIDFIAERLRLPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G+++RHGANFAT  ST+  P+ ++++  +SPFSL +Q  QF QFK    E  
Sbjct  89    LSAYLNSLGTNYRHGANFATGGSTIRRPNETIYEYGISPFSLDMQTTQFLQFKARSAELY  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             +E  +  +   + LP    F KALYTF IGQND       L    +  +LP+++ Q+   
Sbjct  149   REAKNPSDR--STLPNPQDFAKALYTFDIGQNDLSVGFRKLSFDQIRAALPDILNQLATA  206

Query  666   IKDIYLLGGRTFFILNLAPIGCYP-SFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             ++ IY  GGR+F+I N  PIGC P +    L+     LD  GC+K  N+   ++N  LKD
Sbjct  207   VRRIYEQGGRSFWIHNTGPIGCLPVNLFYNLNPPPGYLDDHGCVKGQNDIAIEFNRQLKD  266

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R ++  A + YVD ++    L     + G     K CCGY    +     ++CG+
Sbjct  267   RVIKLRAELPQAAITYVDVYAAKYGLISSAKTEGFADPMKVCCGY----HVKYDHVWCGN  322

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSY-FDPPFPLHHFCH  139
               ++NG  V   +C+ P +Y+SWDG H T  AN+     I +GS   +PP P+   CH
Sbjct  323   KGMVNGSEVYGPSCQTPSSYISWDGVHYTQGANQWVANHILNGSLSSNPPTPITQACH  380



>ref|XP_003589586.1| Enod8.3 [Medicago truncatula]
 gb|AES59837.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=392

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 207/358 (58%), Gaps = 9/358 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAIFNFGDSN+DTGG  AAF     PYG TYF +P GR++DGR+I+DF+A   GL F
Sbjct  38    CNFPAIFNFGDSNSDTGGMAAAFVQPPTPYGETYFNRPTGRSSDGRLIIDFIADSFGLPF  97

Query  1026  LSPYLKSIGSDFRHGANFATVSSTV-MPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQ  850
             LS YL S+G+++ HG NFAT SST+ + P      +  SPF L IQ+ QF QFKV     
Sbjct  98    LSAYLDSLGANYSHGGNFATASSTIKLTPIILPQLNGQSPFLLGIQYAQFAQFKVRTQFI  157

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDL-ASLGISGVNQSLPEVVAQIT  673
             +Q+         T +P K  F KALYT  IGQND        + I  V   +PE+V    
Sbjct  158   KQQG----GVFATLMPKKEYFHKALYTIDIGQNDLGGGFYRVMTIQQVTADVPEIVKIFK  213

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               +K +Y LG R+F+I N  PIGC P    K     ++ DQ+GC K YN     +N  LK
Sbjct  214   INVKALYNLGARSFWIHNTGPIGCLPYISLKFIF--AERDQYGCAKQYNEVAQHFNLKLK  271

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             +AL Q R+++  A + YVD +S+   LF +   +G +     CCG+ GG+YN+   + CG
Sbjct  272   EALDQLREELPQAAITYVDIYSVKYSLFSNSAKYGFEQPLVTCCGF-GGEYNYSTTVGCG  330

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
              T  +NG  +    CE+    V WDG H T+AANK     I +G++ DPP PL+  CH
Sbjct  331   QTIEVNGSQILVVPCENRPKRVVWDGIHYTEAANKFIFDQISTGAFSDPPIPLNMACH  388



>ref|XP_006470213.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Citrus sinensis]
Length=383

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/357 (40%), Positives = 203/357 (57%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAI+NFGDSN+DTGG  AAF  +  PYG  +F KP GR +DGR+IVDF+A+ + L +
Sbjct  31    CEFPAIYNFGDSNSDTGGISAAFEPIRVPYGEGFFHKPAGRDSDGRLIVDFIAESVKLPY  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L  YL S+G++FRHGANFAT  ST+  P+ ++++  +SPF L +Q  QF QFK    E  
Sbjct  91    LGAYLNSLGTNFRHGANFATGGSTIGKPNETIYEYGISPFFLGMQITQFNQFKARTKELY  150

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              E   + +    KLP +  F KALYTF IGQND       +    +  +LP +V Q+   
Sbjct  151   DEAKIASDR--DKLPRQEDFAKALYTFDIGQNDLSVGFRKMSFDQLRAALPSIVNQLASA  208

Query  666   IKDIYLLGGRTFFILNLAPIGCYPS-FLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             +++IY  GGR F+I N  PIGC P+ F    +     LD  GC+K  NN   ++N  LK+
Sbjct  209   VQNIYQQGGRAFWIHNTGPIGCLPTNFFYNHNPPPGYLDDHGCVKDQNNMAVEFNRQLKE  268

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R ++ +A + YVD ++   +L  +  + G     K CCGY    +     ++CG+
Sbjct  269   RVIKLRTELPEAAITYVDVYATKYDLIGNAKTLGYADPFKVCCGY----HENYDHVWCGN  324

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +N   V   +C+DP   +SWDG H T AAN+        GS  DPP P+   CH
Sbjct  325   KATINNTEVYGASCKDPSKSISWDGVHYTQAANQWVANHTLYGSLTDPPIPITQACH  381



>gb|KHG05491.1| hypothetical protein F383_30482 [Gossypium arboreum]
Length=376

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/359 (43%), Positives = 208/359 (58%), Gaps = 19/359 (5%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP GM+YF  P GR  DGR+++DFLA+ LGLA+
Sbjct  32    CQFPAIFNFGDSNSDTGGLSAAFGQAPPPNGMSYFGHPAGRYCDGRLVIDFLAESLGLAY  91

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS +L S+G++F HGANFAT  ST+ P +++L  S  SP SL +QF +F  F V    + 
Sbjct  92    LSAFLDSLGTNFTHGANFATAGSTIRPQNTTLHQSGFSPISLNVQFYEFHDFHV----RS  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISG--VNQSLPEVVAQIT  673
             Q          T LP +  F  ALYTF IGQND          SG  +N S+ EV A + 
Sbjct  148   QIVRKRGGVYETILPKEEDFSSALYTFDIGQNDL--------TSGYFLNMSVDEVKAYVP  199

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
                 DIY +GGR F++ N  P+GC P  + ++      +D++GC   +N     +N  LK
Sbjct  200   ---DDIYDVGGRYFWLHNTGPVGCLPYVMERIPVLAGQIDRYGCASPFNEVAQFFNQGLK  256

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
               ++Q R+D+  A + YVD +S+   L     +HG     + CCG+ GG YN+ K L CG
Sbjct  257   KTVQQLRKDLPHAAITYVDVYSVKYSLISQGRNHGFNQPLRTCCGH-GGKYNYNKNLGCG  315

Query  312   DTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                   G+ V  A  C+DP  +V+WDG H T+AAN+   + I  GS+ DPP PL+  C+
Sbjct  316   GKVHKQGKDVLVAAPCQDPSTHVNWDGVHFTEAANRYIFERIVDGSFSDPPRPLNMACY  374



>gb|EYU44799.1| hypothetical protein MIMGU_mgv1a008141mg [Erythranthe guttata]
Length=383

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 206/356 (58%), Gaps = 8/356 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C++PAI+NFGDSN+DTGG  AAF     P G TYF +P GRA+DGR+I+DF+A  LGL +
Sbjct  31    CNYPAIYNFGDSNSDTGGSAAAFYPPALPSGETYFHRPAGRASDGRLIIDFIAGDLGLPY  90

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL SIGS++RHGANFAT  +TVM P+ S F + VSPF+L IQ   + Q K       
Sbjct  91    LSPYLDSIGSNYRHGANFATGGATVMRPNESWFVNGVSPFNLEIQVEHYTQLKEKTFFFY  150

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             +++         ++P    F KALY   IGQND    +  L I     +LP++V Q    
Sbjct  151   KDKKKC---NRKRMPRPKDFSKALYVIDIGQNDVAAGIRKLSIELQKAALPQIVNQFKVQ  207

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILKD  490
             ++++Y  G R F++ N  PIGC P    K+ +     LD+ GC+KS N+   ++N  LKD
Sbjct  208   LQNLYNRGARNFWVHNTGPIGCLPVATVKVQNPVPGYLDKHGCVKSQNDVALEFNKQLKD  267

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              +   R  + +A ++YVD +S    L     + G +     CCGY G  Y    +++CG+
Sbjct  268   EIVNLRSQLSEAVIIYVDMYSAKYGLITDAKNQGFEDSFTICCGYHGIGY----DVWCGN  323

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
                +NG  VT  +C +P   +SWDG H T+AAN+     I SGS+ DPP P+   C
Sbjct  324   KGNVNGSEVTGGSCSNPSAVISWDGVHYTEAANRWIATRIVSGSFSDPPVPISRAC  379



>ref|XP_010492254.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Camelina sativa]
Length=389

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/357 (39%), Positives = 207/357 (58%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAI+NFGDSN+DTGG  AAF  +  PYG  +F +P GR +DGR+ +DF+A+ L L +
Sbjct  37    CSFPAIYNFGDSNSDTGGISAAFEPIRDPYGQGFFHRPAGRDSDGRLTIDFIAERLELPY  96

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+FRHGANFAT  ST+   + ++F   +SPFSL +Q  QF QFK    +  
Sbjct  97    LSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSAQLF  156

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +    Y+    KLP +  F KALYTF IGQND      ++ +  +  ++P++V+ +   
Sbjct  157   TQIKSRYDR--EKLPRQEEFAKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVSHLASA  214

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILKD  490
             +++IY  GG+TF++ N  P GC P  +  +       LD++GC+K+ N    ++N  LK+
Sbjct  215   VRNIYQQGGKTFWVHNTGPFGCLPVNMFYMGTPAPGYLDKYGCVKAQNEMAMEFNRKLKE  274

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              +   R+++  A + YVD ++   E+  +P   G     K CCGY    +     ++CG+
Sbjct  275   TVINLRKELTQAAITYVDVYAAKYEMMSNPKKLGFANPLKVCCGY----HEKYDHIWCGN  330

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +N   +   +C +P   VSWDG H T+AANK       SG   DPP P++  C+
Sbjct  331   KGKVNNTEIYGGSCPNPAMAVSWDGVHYTEAANKHVADRTLSGLLTDPPVPINRACY  387



>ref|XP_002282372.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Vitis vinifera]
Length=388

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/358 (41%), Positives = 206/358 (58%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPA+FNFGDSN+DTGG  AAF     P G TYF  P GR +DGR+I+DF+A+ LGL +
Sbjct  32    CSFPAVFNFGDSNSDTGGLSAAFGQAPSPNGETYFGAPAGRFSDGRLIIDFIAESLGLPY  91

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL ++GS+F HGANFAT  ST+ P ++++  S  SP SL +QF +F  F+     + 
Sbjct  92    LSAYLDALGSNFSHGANFATAGSTIRPQNTTMAQSGYSPISLNVQFVEFSDFR----NRS  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             Q   +        LP +  F  ALYTF IGQND       ++    V   +P+++  ++ 
Sbjct  148   QIFRNRGGVFQELLPKEEDFAAALYTFDIGQNDLTAGYKLNMTTEQVKAYVPDLLDSLSN  207

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK ++  G R+F+I N  P+GCYP  + +     + +D+ GC   YN     +N+ LK 
Sbjct  208   IIKYVHARGARSFWIHNTGPVGCYPYVMDRFPITAAQVDKHGCASPYNEVAQYFNSRLKG  267

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+D+ +A + YVD +S+   L       G     K CCG+ GG YN+ +   CG 
Sbjct  268   AVAQLRKDLPEAAITYVDVYSVKYRLISQARKQGFMDPFKVCCGH-GGKYNYNQAFKCGA  326

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                + G + V A++CE+P   +SWDG H T+AANK     I  GS+ DPP PL   CH
Sbjct  327   KIKVGGKEVVIAKSCENPRVRISWDGVHFTEAANKWIFDRIVDGSFSDPPIPLRMACH  384



>ref|XP_007223009.1| hypothetical protein PRUPE_ppa006817mg [Prunus persica]
 gb|EMJ24208.1| hypothetical protein PRUPE_ppa006817mg [Prunus persica]
Length=394

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/358 (42%), Positives = 212/358 (59%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPA+FNFGDSN+DTGG  AAF     P G TYF+ P GR +DGR+++DF+A+ L L  
Sbjct  36    CSFPAMFNFGDSNSDTGGLSAAFGQAPYPNGETYFRTPSGRYSDGRLLIDFIAESLRLPH  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS +L S+GS+F HGANFAT  ST+ PP++++    VSP SL +Q  QF  F+    +  
Sbjct  96    LSAFLDSVGSNFSHGANFATAGSTIRPPNTTISQIGVSPISLDVQLVQFLDFRTR-SQIY  154

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             Q++   +      LP K  F +ALYTF IGQND       +L    V   +P+V++Q++ 
Sbjct  155   QKKGEVFGK---LLPKKEYFSQALYTFDIGQNDLTAGYKLNLTTEQVKAYVPDVLSQLSH  211

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK +   GGR+++I N  P+GC P  L +   N + +D++GC   +N     +N  LK+
Sbjct  212   AIKIVDEQGGRSYWIHNTGPLGCLPYVLDRFLVNPAQIDKYGCADQFNEVAQYFNQRLKE  271

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             AL   ++D+  A + YVD +S+   L     ++G      ACCG+ GG YN+ +   CG 
Sbjct  272   ALLHLKKDLPLAAITYVDVYSVKRTLITQTKTYGFGNPLIACCGH-GGKYNYNRYAKCGT  330

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +NG +TV A++C DP   ++WDG H T+AANK   Q I  GS+ DPP PL   C 
Sbjct  331   KKTINGIETVIAKSCNDPTVQINWDGVHYTEAANKWIFQQIVKGSFSDPPNPLKMACR  388



>ref|XP_011097366.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X1 [Sesamum 
indicum]
Length=357

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/355 (41%), Positives = 210/355 (59%), Gaps = 13/355 (4%)
 Frame = -1

Query  1191  IFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAFLSPYL  1012
             ++NFGDSN+DTGG  AAF     P G TY+ +PVGRA+DGR+I+DF+A+ LGL +LSPYL
Sbjct  1     MYNFGDSNSDTGGIAAAFYPPASPSGETYYGRPVGRASDGRLIIDFIAENLGLPYLSPYL  60

Query  1011  KSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFK---VMVDEQEQE  841
              S+GS +++GANFAT  +T++ P+ S FDS +SPF+L IQ   F QFK     +  Q Q+
Sbjct  61    DSVGSSYQNGANFATGGATILRPNGSWFDSGLSPFNLEIQVEHFTQFKDRTAYLYGQAQD  120

Query  840   QHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKTIK  661
             +         +LP    F +AL+T  IGQND    + SL        +P +++Q    ++
Sbjct  121   ECT-----RKRLPRPENFSEALFTLDIGQNDVAVGIRSLSYELQQAVVPNILSQFITQVR  175

Query  660   DIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILKDAL  484
              +Y  G RTF++ N  PIGC P  +AK+       LD+ GC+KS N+    +N  LKD +
Sbjct  176   GLYERGARTFWVHNTGPIGCLPVAIAKVKDPAPGYLDENGCVKSQNDIALQFNEELKDEI  235

Query  483   RQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDTN  304
              + R ++ DA +VYVD ++   EL  +  + G +   + CCGY G  Y    +++CG+  
Sbjct  236   VKLRAELSDAAIVYVDMYAAKYELITNAKNQGFEDPFEICCGYHGIGY----DVWCGNKG  291

Query  303   VLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
              +NG  V A +CEDP   +SWDG H T+AAN      I +GS  DP  P+   CH
Sbjct  292   NVNGTEVYAGSCEDPSKIISWDGVHYTEAANHWIANRIVNGSMSDPSIPITSACH  346



>ref|XP_007216389.1| hypothetical protein PRUPE_ppa021457mg, partial [Prunus persica]
 gb|EMJ17588.1| hypothetical protein PRUPE_ppa021457mg, partial [Prunus persica]
Length=368

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/360 (40%), Positives = 211/360 (59%), Gaps = 15/360 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAI+NFGDSN+DTGG  AAF  +  P G T+F +P GR  DGR+++DF+A+ LGL +
Sbjct  15    CDFPAIYNFGDSNSDTGGISAAFYPMASPCGETFFHRPAGRGCDGRLMIDFIAKHLGLPY  74

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDE--  853
             LSPYL S+ S+FRHGANFAT  +T++  + S F + VSPFSL IQ  Q++Q K       
Sbjct  75    LSPYLDSLESNFRHGANFATGGATIIRYNESWFQNGVSPFSLDIQIAQYQQLKSRTTSLY  134

Query  852   -QEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQI  676
              + ++Q H       + P  + F KALY F IGQND    +  +        +P+++ Q+
Sbjct  135   NRAKKQPH-------RFPRVDDFSKALYIFDIGQNDVAAGIRKMSDEQFQAQIPDIINQL  187

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNI  499
                I+++Y  G RTF+I N  PIGC    L  L + + D +D+ GC+K  N+    +N  
Sbjct  188   ATAIRNLYDQGARTFWIHNTGPIGCLAVTLHYLHNPSPDYVDRRGCVKFQNDMARQFNRA  247

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             LK  + Q R+++  A + +V+  +   +L  +   HG    T+ CCGY    +     ++
Sbjct  248   LKQKVFQLRKELLLAAITHVNVFAAKYKLLSNAKKHGFLDKTRICCGY----HEDSNHVY  303

Query  318   CGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             CG+  ++NG  V A +CEDP  Y+SWDG H T+AAN      + SGS+ DPP P+ + CH
Sbjct  304   CGNKGIINGTQVYAGSCEDPSLYISWDGVHYTEAANHWIANQLISGSFSDPPLPITNSCH  363



>ref|XP_009779715.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Nicotiana sylvestris]
 ref|XP_009779716.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Nicotiana sylvestris]
Length=386

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/358 (41%), Positives = 208/358 (58%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP G TYF  P GR +DGR+++DF+A+ LGL  
Sbjct  32    CDFPAIFNFGDSNSDTGGLSAAFGQAGPPAGETYFGAPAGRYSDGRLVIDFIAESLGLPH  91

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS +L ++GS+F +GANFAT  ST+ P +++L  S  SP SL +Q  +F  F      + 
Sbjct  92    LSAFLDALGSNFSYGANFATAGSTIRPQNTTLHQSGFSPISLNVQIYEFNDFH----RRS  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q      N  +  +P +  F   LYTF IGQND       ++    V   +P+++ Q   
Sbjct  148   QIIRCKGNVFSQLMPKEKHFSHGLYTFDIGQNDLTAGYFLNMTTDQVRAYVPDLMDQFKT  207

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +KDIY  GGR F+I N  P+GC P  L +L    + +D+ GC   +N     +N  LK+
Sbjct  208   VMKDIYDQGGRYFWIHNTGPVGCLPYILDRLLITAAQVDKAGCASPFNKVAQYFNAKLKE  267

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R+D+  A + YVD +S   EL  H   HG ++  +ACCG+ GG YN+  +  CG 
Sbjct  268   TVVQLRKDLPLAALTYVDVYSAKYELISHANKHGFEHPLRACCGH-GGKYNYNMKHGCGS  326

Query  309   TNVLNGQTVT-AEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                + G+ +   ++C+DP   ++WDG H T+AAN+   + I +GSY DPP PL+  CH
Sbjct  327   KIKVKGKEIMLGKSCKDPTVRINWDGVHYTEAANRWVFEKIVNGSYSDPPLPLNMACH  384



>ref|XP_002521491.1| Esterase precursor, putative [Ricinus communis]
 gb|EEF40981.1| Esterase precursor, putative [Ricinus communis]
Length=411

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/357 (40%), Positives = 208/357 (58%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAI+NFGDSN+DTGG  AAF  +  PYG  +F KP GR +DGR+I+DF+A+ L L +
Sbjct  59    CEFPAIYNFGDSNSDTGGISAAFEPIRAPYGEAFFHKPAGRDSDGRLIIDFIAERLKLPY  118

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL SIG+++RHGANFAT  ST+   + ++++  +SPF+L +Q  QF QFK    +  
Sbjct  119   LSAYLNSIGTNYRHGANFATGGSTIRRQNETIYEYGISPFALDMQIVQFDQFKSRTADLY  178

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +   +      KLP    F KALYTF IGQND       +    +  ++P+++ Q+   
Sbjct  179   NQVKGTPE--AEKLPRPEEFAKALYTFDIGQNDLSVGFRKMSFDQLRAAMPDIINQLATA  236

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILKD  490
             ++ IY  GGR F+I N  PIGC P  L  +S+     LD+ GC+K+ N    ++N+ LK+
Sbjct  237   VQHIYQQGGRAFWIHNTGPIGCLPVNLFYVSNPPPGYLDELGCVKAQNEMAVEFNSKLKE  296

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R ++ +A + YVD H+   EL +   + GL    K CCGY      F   ++CG+
Sbjct  297   RVTRLRAELPEAAITYVDVHAAKYELIRDAKTLGLADPLKVCCGY---HVKF-DHIWCGN  352

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
               V+N   V    C+DP  +VSWDG H +  AN+       +GS  DPP P+ H CH
Sbjct  353   KGVVNNTDVYGAPCKDPSVFVSWDGVHYSQFANQWVADHTQNGSLADPPIPIIHACH  409



>ref|XP_008230934.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Prunus mume]
Length=387

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/360 (40%), Positives = 211/360 (59%), Gaps = 15/360 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAI+NFGDSN+DTGG  AAF  +  P G T+F +P GR  DGR+++DF+A+ LGL +
Sbjct  34    CDFPAIYNFGDSNSDTGGISAAFYPMASPCGETFFHRPAGRGCDGRLMIDFIAKHLGLPY  93

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDE--  853
             LSPYL S+ S+FRHGANFAT  +T++  + S F + VSPFSL IQ  Q++Q K       
Sbjct  94    LSPYLDSLESNFRHGANFATGGATIIRYNESWFQNGVSPFSLDIQIAQYQQLKSRTTSLY  153

Query  852   -QEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQI  676
              + ++Q H       + P  + F KALY F IGQND    +  +        +P+++ Q+
Sbjct  154   NRAKKQPH-------RFPRVDDFSKALYIFDIGQNDVAAGIRKMSDEQFQAQIPDIINQL  206

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNI  499
                I+++Y  G RTF+I N  PIGC    L  L + + D +D+ GC+K  N+    +N  
Sbjct  207   ATAIRNLYDQGARTFWIHNTGPIGCLAVTLHYLHNPSPDYVDRRGCVKFQNDMARQFNRA  266

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             LK  + Q R+++  A + +V+  +   +L  +   HG    T+ CCGY    +     ++
Sbjct  267   LKQKVFQLRKELLLAAITHVNVFAAKYKLLSNAKKHGFLDKTRICCGY----HEDSNHVY  322

Query  318   CGDTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             CG+  ++NG  V A +CEDP  Y+SWDG H T+AAN      + SGS+ DPP P+ + CH
Sbjct  323   CGNKGIINGTQVYAGSCEDPSLYISWDGVHYTEAANHWIANQLISGSFSDPPLPITNSCH  382



>gb|EYU34754.1| hypothetical protein MIMGU_mgv11b006645mg [Erythranthe guttata]
Length=385

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/359 (39%), Positives = 212/359 (59%), Gaps = 7/359 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAI+NFGDSN+DTGG  AAF  + PPYG  +F  P GR +DGR+I+DF+A+ LGL +
Sbjct  33    CNFPAIYNFGDSNSDTGGMSAAFGPIPPPYGQDFFHGPAGRESDGRLIIDFIAEYLGLPY  92

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++FRHGANFA   ST+   + +++++ +SPFSL IQ   F QFK    E  
Sbjct  93    LSAYLDSLGTNFRHGANFAAGGSTIRRQNETIYENGISPFSLDIQVTNFDQFKSRTSELY  152

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                   ++   ++LP    F +ALYTF IGQND +     L +  +  +LP++V     +
Sbjct  153   HRAKKPFD--KSQLPRPREFSRALYTFDIGQNDILDGFRKLTMPQLKAALPDIVEHFASS  210

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILKD  490
             I  +Y  G R F+I N  P+GC P+    +++      D +GC+KS+N+ V ++N  LK 
Sbjct  211   IIHLYEKGARNFWIHNTGPLGCLPAATLYITNPKPGFFDNYGCIKSHNSMVIEFNKQLKS  270

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R+ ++ A+++YVD +S    L  +   +G     K CCG    ++    +++CG 
Sbjct  271   RIDKLRKQLRRASIIYVDVYSAKYHLISNTKYYGFTDPLKICCGRHENNF----DVWCGQ  326

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
             T ++NG  +   +C  P +Y+SWDG H + AAN+     I +GS  DP F + H C  H
Sbjct  327   TMIINGSEIIGVSCSSPASYISWDGVHYSQAANQWVANHILNGSLSDPLFDVTHACLNH  385



>ref|XP_010453569.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Camelina sativa]
Length=391

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/357 (39%), Positives = 206/357 (58%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAI+NFGDSN+DTGG  AAF  +  PYG  +F +P GR +DGR+ +DF+A+ L L +
Sbjct  39    CSFPAIYNFGDSNSDTGGISAAFEPIRDPYGQGFFHRPAGRDSDGRLTIDFIAERLELPY  98

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+FRHGANFAT  ST+   + ++F   +SPFSL +Q  QF QFK    +  
Sbjct  99    LSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSAQLF  158

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +    Y+    KLP +  F KALYTF IGQND      ++ +  +  ++P++V+ +   
Sbjct  159   TQIKSRYDR--EKLPRQEEFAKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVSHLASA  216

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILKD  490
             +++IY  GGRTF++ N  P+GC P  +  +       LD+ GC+K+ N    ++N  LK+
Sbjct  217   VRNIYQQGGRTFWVHNTGPLGCLPVNMFYMGTPAPGYLDKSGCVKAQNEMAMEFNRKLKE  276

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              +   R+++  A + YVD ++   E+  +P   G     K CCGY    +     ++CG+
Sbjct  277   TVINLRKELTQAAITYVDVYAAKYEMMSNPKKLGFANPLKVCCGY----HEKYDHIWCGN  332

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +N   +   +C +P   VSWDG H T+AANK       SG   DPP P+   C+
Sbjct  333   KGKVNNTEIYGGSCPNPAMAVSWDGVHYTEAANKHVADRTLSGLLTDPPVPIIRACY  389



>ref|XP_010110055.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXC25090.1| GDSL esterase/lipase [Morus notabilis]
Length=421

 Score =   283 bits (723),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 150/407 (37%), Positives = 221/407 (54%), Gaps = 55/407 (14%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPA++NFGDSN+DTGG  AAF  +  PYG  +F KP GR +DGR+I+DF+A+ LGL +
Sbjct  21    CSFPALYNFGDSNSDTGGISAAFEPIQAPYGEAFFHKPSGRDSDGRLIIDFIAERLGLPY  80

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G+ ++HGANFAT  ST+   + ++F++ +SPFSL +Q  QF QFK    +  
Sbjct  81    LSAYLNSLGTSYKHGANFATGGSTIRRQNETIFENGISPFSLDMQIAQFNQFKARTRDLY  140

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             Q+   SY    ++LP +  F KALYTF IGQND       L    +  ++P++V Q+ K 
Sbjct  141   QQAKTSYE--KSRLPNQEDFAKALYTFDIGQNDLSVGFRRLSSDQLLAAIPDIVNQLAKA  198

Query  666   IKDIYLLGGRTFFILNLAPIGCYP-SFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             +++IY  GGR+F+I N +PIGC P +F   L+   S +DQ+GC+K+ N+   ++N  LKD
Sbjct  199   VQNIYQQGGRSFWIHNTSPIGCMPVNFFYNLNPPPSYVDQYGCVKTQNDMAVEFNRQLKD  258

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQ--------------------------------  406
              + + + ++ +A + YVD ++  + +                                  
Sbjct  259   RVIKLKSELPEAAITYVDVYAAKIRMIGNAKAEDVYGYLVRGIRRDREWLGEGFKILHMT  318

Query  405   ---------------HPT-SHGLKYGTKACCGYGGGDYNFKKELFCGDTNVLNGQTVTAE  274
                            HP    G     K CCGY    +     ++CG   ++NG  V   
Sbjct  319   TILIFPKLEGLEERIHPKHKKGFSDPLKVCCGY----HVKYDHVWCGTKALVNGSAVFGA  374

Query  273   ACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
             +CE+P   +SWDG H T AAN+     I +GS  DPP P+   CH H
Sbjct  375   SCENPATSISWDGVHYTQAANQWVANHILNGSLSDPPTPITQACHRH  421



>ref|XP_006852383.1| hypothetical protein AMTR_s00049p00230810 [Amborella trichopoda]
 gb|ERN13850.1| hypothetical protein AMTR_s00049p00230810 [Amborella trichopoda]
Length=379

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/355 (41%), Positives = 203/355 (57%), Gaps = 9/355 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTG   A+F  + PP G T+F+KP GR  DGR+++DF+A+ LGL +
Sbjct  29    CEFPAIFNFGDSNSDTGAISASFFEVPPPNGETFFRKPSGRVCDGRLMIDFIAENLGLPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L+ YL S+G  FRHGANFAT  ST+ P + +LF+  VSPFSL IQ  QF QFK     + 
Sbjct  89    LTAYLDSLGEGFRHGANFATGGSTIRPQNVTLFEGGVSPFSLDIQILQFDQFK----SRS  144

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                +   N     +P    F KALYTF IGQND +    ++   GV  S+P+++  +++ 
Sbjct  145   NALYVKENALKANVPKPEDFCKALYTFDIGQNDLVAGFRTMSDDGVRASIPKILVGLSQV  204

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             I+ +Y  G R+F+I N  PIGC P  +        ++D++GC+ + N+   ++N  LK  
Sbjct  205   IQLLYGQGARSFWIHNTGPIGCLPLSVIYYPLKPRNIDKYGCVYTQNDVAQEFNRQLKVM  264

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             + Q R+ +  A + YVD +S    L  H    G     K CCG+  GDY       CG  
Sbjct  265   VSQLRKQLPLAALTYVDVYSAKFNLITHAKEQGFGDPMKFCCGH-AGDYTVG----CGRK  319

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
              V+NG  +   +C +P  YVSWDG H + AAN+     I +G   +PP PL   C
Sbjct  320   AVVNGTEIYGSSCGNPSMYVSWDGVHYSHAANQWIANHILNGQLSEPPLPLPQAC  374



>ref|XP_008340092.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Malus domestica]
Length=444

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/358 (42%), Positives = 210/358 (59%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAIFNFGDSN+DTGG  AAF     P G TYF  P GR +DGR+++DF+A+ LGL  
Sbjct  90    CSFPAIFNFGDSNSDTGGLSAAFGQAPYPNGETYFHVPSGRFSDGRLVIDFIAESLGLPH  149

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS +L S+GS+F HGANFAT  STV+PP++++     SP SL +Q  QF  F+     + 
Sbjct  150   LSAFLDSMGSNFSHGANFATAGSTVIPPNTTISQGGASPISLDVQLLQFSDFRT----RS  205

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             Q            LP +  F +ALYTF IGQND       +     V   LP V+ Q++ 
Sbjct  206   QIYRTKSELFEKSLPKEEYFSQALYTFDIGQNDITAGYKLNWTAEQVKAYLPYVLTQLSN  265

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK +Y  GGR+F+I N  P+GC P  L +   + + ++++GC    +     +N  LK+
Sbjct  266   AIKSVYDQGGRSFWIHNTGPLGCLPYVLVRFVTDPAQINKYGCADQIDEVAKFFNQRLKE  325

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q ++D+  A + YVD +S+   L      +G +    ACCG+ GG YNF +   CG 
Sbjct  326   AVVQLKKDLPLAAITYVDVYSVKYTLITQAKKYGFENPLIACCGH-GGKYNFDRYAKCGA  384

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
               ++NG +T+ A++C+DP   ++WDG H T+AANK   Q I +GS+ DPP PL   C 
Sbjct  385   KKMINGTETLIAKSCDDPTVRINWDGTHFTEAANKWIFQQIVNGSFSDPPNPLKTACR  442



>ref|XP_009771353.1| PREDICTED: GDSL esterase/lipase At5g14450 isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/357 (40%), Positives = 202/357 (57%), Gaps = 9/357 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAI+NFGDSN+DTGG  AAF  +  PYG ++F +P GR +DGR+++DF+A+ L L +
Sbjct  44    CNFPAIYNFGDSNSDTGGISAAFQPIQAPYGESFFHRPAGRLSDGRLLIDFIAEHLRLPY  103

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L  YL SIGS+FRHGANFAT  ST+   + ++F S +SPFSL +Q  QF +FK   +E  
Sbjct  104   LIAYLDSIGSNFRHGANFATGGSTIRRQNQTIFQSGISPFSLDVQIMQFHRFKARTEELY  163

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             ++          KLP    F KALYT  IGQ D       +    +  ++ +++ Q +  
Sbjct  164   RQDLSE----KKKLPRPREFSKALYTLDIGQTDLAVGFRQMSNIQLRAAISDIINQFSAA  219

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSH-NTSDLDQFGCLKSYNNAVADYNNILKD  490
             +  +Y  G R F+I N  PIGC P+    L +     LD +GCLKS N    ++N  LK 
Sbjct  220   VMRLYQQGARAFWIHNTGPIGCLPTATLYLRNPKPGVLDNYGCLKSQNKMALEFNRQLKA  279

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              +R  R ++  A++ YVD ++   EL  +  S G     K CCG   G+      ++CG 
Sbjct  280   RIRTLRAELGHADITYVDVYAAKYELISNANSQGFMEPHKICCGLHEGN----THVWCGQ  335

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
               ++ G  V   AC +P  Y+SWDG H + AAN      I +GS+ DPP P+ H CH
Sbjct  336   KAIVRGAEVFGGACVNPSIYISWDGVHYSQAANHWIANQILNGSFSDPPIPITHACH  392



>ref|XP_009121660.1| PREDICTED: GDSL esterase/lipase At5g14450 [Brassica rapa]
Length=389

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 142/358 (40%), Positives = 203/358 (57%), Gaps = 9/358 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAI+NFGDSN+DTGG  AAF  +  PYG  +F KP GR +DGR+ +DF+A+ +GL +
Sbjct  37    CTFPAIYNFGDSNSDTGGISAAFEPIRAPYGQGFFHKPAGRDSDGRLTIDFIAERVGLPY  96

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQ-  850
             LS YL S+GS+FRHGANFAT  ST+   + ++F   +SPFSL +Q  QF QFK    E  
Sbjct  97    LSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSAELF  156

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITK  670
              Q +  S      KLP +  F KALYTF IGQND      ++ +  +  ++P++V+ +  
Sbjct  157   SQIKIRSERE---KLPRQEEFAKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVSHLAS  213

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILK  493
              +++IY  GGRTF+I N  P GC P  +  +       LD+ GC+K+ N    ++N  LK
Sbjct  214   AVRNIYQQGGRTFWIHNTGPFGCLPVNMFYMGTPAPGYLDKSGCVKAQNEMAMEFNRKLK  273

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             + +   R+++  A + YVD +S   E+  +P   G     K CCGY    +     ++CG
Sbjct  274   ETVINLRKELTRAAITYVDVYSAKYEMMSNPKKLGFANPLKVCCGY----HEKYDHIWCG  329

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                 +N   +    C +P   VSWDG H T+AANK        G   DPP P+   C+
Sbjct  330   TKGKVNNTEIYGAPCRNPATAVSWDGVHYTEAANKHVADRTLGGFLTDPPVPITRACY  387



>ref|XP_010420084.1| PREDICTED: GDSL esterase/lipase At5g14450 [Camelina sativa]
Length=389

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/357 (39%), Positives = 206/357 (58%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAI+NFGDSN+DTGG  AAF  +  PYG  +F +P GR +DGR+ +DF+A+ L L +
Sbjct  37    CSFPAIYNFGDSNSDTGGISAAFEPVRDPYGQGFFHRPAGRDSDGRLTIDFIAERLELPY  96

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+FRHGANFAT  ST+   + ++F   +SPFSL +Q  QF QFK    +  
Sbjct  97    LSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSAQLF  156

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +    Y+    KLP +  F KALYTF IGQND      ++ +  +  ++P++V+ +   
Sbjct  157   TQIKSRYDR--EKLPRQEEFAKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVSHLASA  214

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILKD  490
             +++IY  GGRTF++ N  P+GC P  +  +       LD+ GC+K+ N    ++N  LK+
Sbjct  215   VRNIYQQGGRTFWVHNTGPLGCLPVNMFYMGTPAPGYLDKSGCVKAQNEMAMEFNRKLKE  274

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              +   R+++  A + YVD ++   E+  +P   G     K CCGY    +     ++CG+
Sbjct  275   TVINLRKELTQAAITYVDVYAAKYEMMSNPKKLGFANPLKVCCGY----HQKYDHIWCGN  330

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +N   +   +C +P   VSWDG H T+AANK       SG   DPP P+   C+
Sbjct  331   KGKVNNTEIYGGSCPNPAMAVSWDGVHYTEAANKHVADRTLSGLLTDPPVPVIRACY  387



>ref|XP_006438239.1| hypothetical protein CICLE_v10031753mg [Citrus clementina]
 ref|XP_006483958.1| PREDICTED: GDSL esterase/lipase At3g26430-like isoform X1 [Citrus 
sinensis]
 gb|ESR51479.1| hypothetical protein CICLE_v10031753mg [Citrus clementina]
Length=394

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 149/360 (41%), Positives = 210/360 (58%), Gaps = 9/360 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAIFNFGDSN+DTGG  AAF     P G T+F  P GR +DGR+I+DF+AQGLGL +
Sbjct  38    CNFPAIFNFGDSNSDTGGLSAAFGQAPYPNGETFFHSPAGRFSDGRLIIDFIAQGLGLPY  97

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LSPYL S+GS+F HGANFAT  STV P ++++  S  SP S+ +QF Q+  F+     + 
Sbjct  98    LSPYLDSVGSNFSHGANFATAGSTVRPQNTTMSQSGYSPISIDVQFVQYSDFR-----RR  152

Query  846   QEQHHSYNHGNTKLPPKN-IFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQIT  673
                         KL P +  F KALYTF IGQND       ++    V   +P+V+ Q +
Sbjct  153   SSVFRKRGGVYEKLLPMDYYFAKALYTFDIGQNDLTSGFKQNMTFDQVKAYIPDVLRQFS  212

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               IK++Y  GGR+F++ N  P+GC P  L +     + +D  GC   +N+    +N+ LK
Sbjct  213   NVIKNVYAQGGRSFWVHNTGPLGCLPYTLDRFPIMAARIDNHGCATPFNDVARFFNSRLK  272

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             +A+ + R+D+  A + YVD +S+   L       G +    ACCG+ GG YN+ K   CG
Sbjct  273   EAVVRLRKDLPLAAITYVDIYSVKHSLITQAKKLGFENPLLACCGH-GGKYNYDKNRKCG  331

Query  312   DTNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHI  136
                 +NG + V A++C+ P   ++WDG H T+AAN      I +GSY DPP P+   C +
Sbjct  332   SKVTVNGKEIVVAKSCKVPSVRINWDGVHYTEAANNWVYDQIINGSYSDPPIPMKMACRV  391



>ref|XP_004290869.1| PREDICTED: esterase-like [Fragaria vesca subsp. vesca]
Length=385

 Score =   281 bits (718),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 156/358 (44%), Positives = 205/358 (57%), Gaps = 11/358 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF  L  PYG TYF    GR +DGR+I+DFLA+ LG  +
Sbjct  35    CEFPAIFNFGDSNSDTGGLAAAFLPLPAPYGETYFHMSAGRYSDGRLIIDFLAKSLGHPY  94

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++F +GANFAT +ST+  PH  L  +  SPF L IQ++QF Q K     + 
Sbjct  95    LSAYLDSLGTNFSYGANFATAASTIRLPHLILPQAGFSPFYLDIQYSQFLQLK----SRS  150

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLAS--LGISGVNQSLPEVVAQIT  673
             Q          + +P +  F KALYTF IGQND    + S  + I  VN S+P+++   +
Sbjct  151   QLIRQRGGIFASLMPMEEYFSKALYTFDIGQNDLGEAILSRNMPIQEVNASVPDIITGFS  210

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               IK IY LG R+F+I N  PIGC    L +    ++  D+ GC K+YN      N+ LK
Sbjct  211   TNIKKIYDLGARSFWIHNTGPIGCLAYILVRFP--SAQKDEAGCAKAYNEVAQHLNHKLK  268

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
              A+ Q R+++  A   YVD +S+   LF+ P   G +    ACCGY GG+YN      CG
Sbjct  269   QAVVQLRKELPLAAFTYVDVYSVKYSLFKEPAKFGFELPLVACCGY-GGEYN--SSAGCG  325

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
              T  +NG  +   +C+ P   V WDG H TDAA K     I +G+Y DP   L   CH
Sbjct  326   TTISINGSQIFVGSCKTPSTRVVWDGIHYTDAAAKFVFNKISTGAYSDPSLSLKQACH  383



>ref|XP_004135278.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Cucumis sativus]
 ref|XP_004167368.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Cucumis sativus]
 gb|KGN51744.1| hypothetical protein Csa_5G598030 [Cucumis sativus]
Length=384

 Score =   281 bits (718),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 208/358 (58%), Gaps = 6/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPA+FNFGDSN+DTGG  A F    PP G +YF  P GR +DGR+IVDF+A+  GL  
Sbjct  29    CNFPAVFNFGDSNSDTGGLSAVFGQAPPPNGRSYFPGPAGRYSDGRLIVDFIAESFGLPH  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL ++G++F HGANFAT  ST+   + +L  S  SP SL +Q+N+F  F+       
Sbjct  89    LSAYLDALGANFSHGANFATAGSTIRLQNRTLQQSGFSPISLNVQYNEFYDFRRRSQTLR  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
                   +      LP +  F +ALYTF IGQND      A++ +  V   +P+V+ Q ++
Sbjct  149   NGLGGIFKQ---LLPKEESFSRALYTFDIGQNDLTSGYFANMTLHQVKLYVPDVLHQFSE  205

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +K ++  GGR F+I N  P+GC P  L +     SD DQ+GC   +N+    +N  LK 
Sbjct  206   IVKWVHSQGGRFFWIHNTGPVGCLPYVLDREHVPASDYDQYGCATPFNDLAQYFNRGLKQ  265

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ + R+ + D+ + YVD +S+   L      +G +Y  + CCG+ GG YNF   L CG 
Sbjct  266   AVVELRKALPDSAITYVDVYSLKYALVSQHKKYGFEYPLRTCCGH-GGKYNFNVNLGCGG  324

Query  309   TNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +NG+ V   ++C++P  YV+WDG H T AANK     I  GSY DPP PL+  CH
Sbjct  325   KKEINGKEVLIGKSCKNPEVYVNWDGVHYTQAANKWIFNQIKDGSYSDPPIPLNKACH  382



>gb|KDO80652.1| hypothetical protein CISIN_1g015153mg [Citrus sinensis]
Length=412

 Score =   282 bits (721),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 159/363 (44%), Positives = 211/363 (58%), Gaps = 12/363 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAIFNFGDSN+DTGG  AA   +  PYG TYF  P GR +DGR+I+DF+A+  GL +
Sbjct  38    CNFPAIFNFGDSNSDTGGISAALYPINWPYGQTYFHMPAGRFSDGRLIIDFIAESFGLPY  97

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSR---VSPFSLAIQFNQFKQFKVMVD  856
             LS YL S+G++F HGANFAT  ST+  P   L  +     SPF L IQ +QF  FK    
Sbjct  98    LSAYLDSVGTNFSHGANFATGGSTIRVPDRILPTNEGFGFSPFYLDIQLSQFMLFK----  153

Query  855   EQEQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDL-ASLGISGVNQSLPEVVAQ  679
              + Q          + +P +  F +ALYTF IGQNDF  DL A + I  +  S+P+V+  
Sbjct  154   SRSQMIRQRGGIYASLMPQEEYFSQALYTFDIGQNDFTADLFADMPIEKIYASVPDVINS  213

Query  678   ITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDL-DQFGCLKSYNNAVADYNN  502
                 +K IY  GGR+F+I N  P+GCY +F+   S +   L D  GC+K YN     +N 
Sbjct  214   FAYNVKSIYNSGGRSFWIHNTGPLGCY-AFVFLYSPSAPALKDSAGCVKPYNELAQYFNL  272

Query  501   ILKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGD-YNFKKE  325
              LK+A+ Q R+    A   YVD +SI   LF+ P  +G +    ACCGYGG D YNF   
Sbjct  273   KLKEAVVQLRKAFPSAAFTYVDVYSIKYSLFKEPEKYGFELPLVACCGYGGIDKYNFSLN  332

Query  324   LFCGDTNVLNGQTVTAE-ACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHH  148
               CG + ++NG  +  + +C+ P   VSWDG H T+AANK     I +G + DPP P + 
Sbjct  333   AVCGASGLVNGTKIVVDSSCDRPSARVSWDGVHFTEAANKFIFDQISTGDFSDPPIPPNM  392

Query  147   FCH  139
              CH
Sbjct  393   ACH  395



>ref|XP_002871620.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47879.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=386

 Score =   281 bits (718),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/357 (39%), Positives = 206/357 (58%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAI+NFGDSN+DTGG  AAF  +  PYG  +F +P GR +DGR+ +DF+A+ L L +
Sbjct  34    CTFPAIYNFGDSNSDTGGISAAFEPIRDPYGQGFFHRPAGRDSDGRLTIDFIAERLELPY  93

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+FRHGANFAT  ST+   + ++F   +SPFSL +Q  QF QFK    +  
Sbjct  94    LSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSAQLF  153

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +    Y+    KLP +  F KALYTF IGQND      ++ +  +  ++P++V+ +   
Sbjct  154   SQIKSRYDR--EKLPRQEEFAKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVSHLASA  211

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILKD  490
             +++IY  GGRTF++ N  P GC P  +  +       LD+ GC+K+ N    ++N  LK+
Sbjct  212   VRNIYQQGGRTFWVHNTGPFGCLPVNMFYMGTPAPGYLDKSGCVKAQNEMAMEFNRKLKE  271

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              +   R+++  A ++YVD ++   E+  +P   G     K CCGY    +     ++CG+
Sbjct  272   TVINLRKELTQAAIIYVDVYTAKYEMMSNPKKLGFANPLKVCCGY----HEKYDHIWCGN  327

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +N   +   +C +P   VSWDG H T+AANK       SG   DPP P+   C+
Sbjct  328   KGKVNNTEIYGGSCPNPAMAVSWDGVHYTEAANKHVADRTLSGLLTDPPVPIIRACY  384



>ref|XP_010248682.1| PREDICTED: GDSL esterase/lipase At5g14450 [Nelumbo nucifera]
Length=385

 Score =   281 bits (718),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 141/357 (39%), Positives = 201/357 (56%), Gaps = 11/357 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAI+NFGDSN+DTGG  AAF    PP G ++F KP GR  DGR+I+DF+A+ LGL +
Sbjct  33    CNFPAIYNFGDSNSDTGGISAAFQRTPPPNGQSFFGKPSGRVCDGRLIIDFIAENLGLPY  92

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL SIG++FRHGANFAT  ST+   + ++F++ +SPFSL +Q   F QF+    E  
Sbjct  93    LSAYLDSIGTNFRHGANFATGGSTIRRQNETIFEAGISPFSLDVQLWHFDQFQERTSEAR  152

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
                  S      KLP    F KALY   IGQND       +  S +  S+P+++   +  
Sbjct  153   NTSEDS-----GKLPKPEEFSKALYILDIGQNDLSVGFRKMTDSQIRASIPDILDHFSAA  207

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSF-LAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             ++ +Y  G R+F+I N  PIGC P + +     +   +D +GC+KS+N+   ++N +LKD
Sbjct  208   VQQLYERGARSFWIHNTGPIGCLPIYRIYSPPPDPGLVDPYGCIKSHNDIAMEFNRLLKD  267

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R ++  A + YVD ++    L     S G     K CCG     ++    ++CG 
Sbjct  268   KVMKLRSELSHAALTYVDVYAAKYGLISRSNSQGFVDPQKICCG-----HHESYHVWCGQ  322

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
               ++NG  V    C DP  Y+SWD  H T+AAN      I  GS  DPP P+   CH
Sbjct  323   NAMINGSEVYGAPCGDPSIYISWDSIHYTEAANHWVANHILDGSLSDPPLPITQACH  379



>emb|CDP13237.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   281 bits (718),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 206/358 (58%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP+G ++F  P GR  DGR+I+DF+A+ LGL +
Sbjct  32    CEFPAIFNFGDSNSDTGGLSAAFGQAGPPHGESFFHGPAGRYCDGRLIIDFIAESLGLPY  91

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS +L ++GS+F HGANFAT  ST+ P +++L  S  SP SL +QF QF  F      + 
Sbjct  92    LSAFLDALGSNFTHGANFATAGSTIRPQNTTLQQSGFSPISLNVQFYQFNDFH----RRS  147

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q            +P    F +ALYTF IGQND       ++    V   +PE++ Q   
Sbjct  148   QIIRSQGGVFGGLMPKAEDFSRALYTFDIGQNDLTSGYFLNMTTDEVRAYVPELLDQFKT  207

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK IY  GGR+F+I N  P+GC P  + +L    + +D+ GC   +N+    +N  LK+
Sbjct  208   IIKGIYDQGGRSFWIHNTGPVGCLPYVMDRLLITAAQVDKTGCATPFNDVAQYFNWKLKE  267

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+++  A + YVD +++  +L  H   HG ++  +ACCG+ GG YNF     CG 
Sbjct  268   AVFQLRKELPKAALTYVDIYTLKYDLISHAKKHGFEHPLRACCGH-GGKYNFNAHFGCGS  326

Query  309   TNVLNGQTVT-AEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                + G+ +  A +C+DP   ++WDG H T AANK     I  GSY DP  PL   CH
Sbjct  327   KIKVKGKEIMIAGSCKDPSVMINWDGVHYTQAANKWVFDRIVDGSYSDPVIPLTMACH  384



>ref|XP_007225083.1| hypothetical protein PRUPE_ppa017577mg [Prunus persica]
 gb|EMJ26282.1| hypothetical protein PRUPE_ppa017577mg [Prunus persica]
Length=389

 Score =   281 bits (718),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 159/358 (44%), Positives = 209/358 (58%), Gaps = 10/358 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A+     PPYG TYF  PVGR +DGR+I+DFLA+ LG  F
Sbjct  36    CEFPAIFNFGDSNSDTGGLAASLSPPPPPYGETYFHMPVGRFSDGRLIIDFLAKSLGHPF  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTV-MPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQ  850
             LS YL S+GS+F +GANFAT +ST+ +P          SPF L IQ+ QF Q K     +
Sbjct  96    LSAYLDSLGSNFSYGANFATANSTIRLPNVVQPAAGGFSPFYLNIQYMQFMQLK----SR  151

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQIT  673
              Q   H        +P +  F KALYTF IGQND     + +L +  VN S+P +++  +
Sbjct  152   SQLIRHRGGIFENLMPKEEYFSKALYTFDIGQNDLAEGFIGNLTVQEVNASVPNIISGFS  211

Query  672   KTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILK  493
               IK IY LG R+F+I N  PIGC    LA      +  D+ GC KSYN     +N+ LK
Sbjct  212   ANIKKIYNLGARSFWIHNTGPIGCLAYILANF---PAQKDEAGCAKSYNEVAQHFNHKLK  268

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             +A  Q R+D+  A + YVD +S+   LF+ P  +G +    ACCGY GG YN+ +   CG
Sbjct  269   EATVQLRKDLPLAAITYVDVYSVKHFLFKEPQKYGFELPLIACCGY-GGKYNYNRSSGCG  327

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
              T  +NG  +   +C+DP   V+WDG H T+AA K     I +G++ DPP  L   CH
Sbjct  328   GTARVNGSQLFVGSCKDPSVRVNWDGIHYTEAAAKFISDKISTGAFSDPPLALKQACH  385



>ref|XP_009359342.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At3g26430-like 
[Pyrus x bretschneideri]
Length=467

 Score =   283 bits (724),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 151/358 (42%), Positives = 209/358 (58%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAIFNFGDSN+DTGG  AAF     P G TYF  P GR +DGR+++DF+A+GLGL  
Sbjct  113   CSFPAIFNFGDSNSDTGGLSAAFGQAPYPNGETYFHVPSGRFSDGRLVIDFIAEGLGLPH  172

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS +L SIGS+F HGANFAT  STV+ P++++  S  SP SL +Q  QF  F      + 
Sbjct  173   LSAFLDSIGSNFSHGANFATAGSTVIFPNTTISQSGASPISLDVQLLQFSDFHT----RS  228

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             Q            LP +  F +ALYTF I QND       +     V   LP V+ Q++ 
Sbjct  229   QIYRTKGELFEKSLPKEEYFSQALYTFDIAQNDITAGYKLNWTAEQVKAYLPYVLTQLSN  288

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK +Y  GGR+F+I N  P+GC P  L +   + + ++++GC    N     +N  LK+
Sbjct  289   AIKSVYGQGGRSFWIHNTGPLGCLPYVLVRFVTDPAQINKYGCADQINEVAQFFNQRLKE  348

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q ++D+  A + YVD +S+   L      +G +    ACCG+ GG YNF +   CG 
Sbjct  349   AVVQLKKDLPLAAITYVDVYSVKYTLITQAKKYGFENPLIACCGH-GGKYNFDRYAKCGA  407

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
               ++NG +T+ A++C+DP   ++WDG H T+AANK   Q I +GS+ DPP PL   C 
Sbjct  408   KKIINGTETLIAKSCDDPTVRINWDGTHFTEAANKCIFQQIVNGSFSDPPNPLKTACR  465



>ref|XP_006852380.1| hypothetical protein AMTR_s00049p00229270 [Amborella trichopoda]
 gb|ERN13847.1| hypothetical protein AMTR_s00049p00229270 [Amborella trichopoda]
Length=388

 Score =   280 bits (717),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 146/360 (41%), Positives = 206/360 (57%), Gaps = 7/360 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP G ++F  P GR +DGR+++DF AQ  GL +
Sbjct  32    CHFPAIFNFGDSNSDTGGLSAAFGQAPPPNGESFFHHPAGRYSDGRLVIDFAAQSFGLPY  91

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G++F HGANFAT  ST+ P +++L  +  SP SL +Q  QF+QFK       
Sbjct  92    LSAYLDSVGTNFSHGANFATAGSTIRPQNTTLTQTGYSPISLDVQLFQFEQFKSRSGYFR  151

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDL-ASLGISGVNQSLPEVVAQITK  670
             Q+           LP ++ F +ALYTF IGQND    L  +L +  V  S+P+++ + + 
Sbjct  152   QQG----GVFEELLPKQSYFSEALYTFDIGQNDLTAGLFQNLTVEQVKASVPDILEKFST  207

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK++Y  GGR F+I N  P+GC    + +L      +D  GC   +N+    +N +LK+
Sbjct  208   AIKNVYWQGGRYFWIHNTGPVGCLAYVIDRLPILVPQVDMAGCATPFNHLAQYFNQLLKE  267

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R D+ DA   YVD +S+  +L      +G     +ACCG+ GG YN+ +   CG 
Sbjct  268   TVIQLRSDLPDATFTYVDVYSVKYQLISGARKYGFGNPLRACCGH-GGKYNYNRYFGCGS  326

Query  309   TNVLNGQTVT-AEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
                 +GQ V   ++C +P   + WDG H T AAN+     I  G++ DPP PL   CH H
Sbjct  327   AIYKDGQKVVIGKSCNNPSKAIIWDGVHYTQAANQWVFNKIVDGTFSDPPTPLSQACHGH  386



>sp|Q7Y1X1.1|EST_HEVBR RecName: Full=Esterase; AltName: Full=Early nodule-specific protein 
homolog; AltName: Full=Latex allergen Hev b 13; AltName: 
Allergen=Hev b 13; Flags: Precursor [Hevea brasiliensis]
 gb|AAP37470.1| ENSP-like protein [Hevea brasiliensis]
Length=391

 Score =   280 bits (717),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 153/358 (43%), Positives = 210/358 (59%), Gaps = 9/358 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF  L PPYG T+F +  GR +DGR+I+DF+A+   L +
Sbjct  30    CDFPAIFNFGDSNSDTGGKAAAFYPLNPPYGETFFHRSTGRYSDGRLIIDFIAESFNLPY  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSL-FDSRVSPFSLAIQFNQFKQFKVMVDEQ  850
             LSPYL S+GS+F+HGA+FAT  ST+  P + +      SPF L +Q++QF+QF      +
Sbjct  90    LSPYLSSLGSNFKHGADFATAGSTIKLPTTIIPAHGGFSPFYLDVQYSQFRQFI----PR  145

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITK  670
              Q    +       +P +  F KALYTF IGQND      +L +  VN ++P++V   + 
Sbjct  146   SQFIRETGGIFAELVPEEYYFEKALYTFDIGQNDLTEGFLNLTVEEVNATVPDLVNSFSA  205

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              +K IY LG RTF+I N  PIGC    L       ++ D  GC K+YN     +N+ LK+
Sbjct  206   NVKKIYDLGARTFWIHNTGPIGCLSFILTYFPW--AEKDSAGCAKAYNEVAQHFNHKLKE  263

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R+D+  A  V+VD +S+   LF  P  HG ++    CCGY GG YNF     CGD
Sbjct  264   IVAQLRKDLPLATFVHVDIYSVKYSLFSEPEKHGFEFPLITCCGY-GGKYNFSVTAPCGD  322

Query  309   T-NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             T    +G  +   +C  P   V+WDG H T+AAN+     I +G++ DPP PL+  CH
Sbjct  323   TVTADDGTKIVVGSCACPSVRVNWDGAHYTEAANEYFFDQISTGAFSDPPVPLNMACH  380



>emb|CDY09855.1| BnaC09g43060D [Brassica napus]
Length=390

 Score =   280 bits (717),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 142/358 (40%), Positives = 203/358 (57%), Gaps = 9/358 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAI+NFGDSN+DTGG  AAF  +  PYG  +F KP GR +DGR+ +DF+A+ +GL +
Sbjct  38    CAFPAIYNFGDSNSDTGGISAAFEPIRAPYGQGFFHKPAGRDSDGRLTIDFIAERVGLPY  97

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQ-  850
             LS YL S+GS+FRHGANFAT  ST+   + ++F   +SPFSL +Q  QF QFK    E  
Sbjct  98    LSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSAELF  157

Query  849   EQEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITK  670
              Q +  S      KLP +  F KALYTF IGQND      ++ +  +  ++P++V+ +  
Sbjct  158   SQIKIRSERE---KLPRQEEFAKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVSHLAS  214

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILK  493
              +++IY  GGRTF+I N  P GC P  +  +       LD+ GC+K+ N    ++N  LK
Sbjct  215   AVRNIYQQGGRTFWIHNTGPFGCLPVNMFYMGTPAPGYLDKSGCVKAQNEMAMEFNRKLK  274

Query  492   DALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCG  313
             + +   R+++  A + YVD +S   E+  +P   G     K CCGY    +     ++CG
Sbjct  275   ETIINLRKELTRAAITYVDVYSAKYEMMSNPKRLGFANPLKVCCGY----HEKYDHIWCG  330

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                 +N   +    C +P   VSWDG H T+AANK        G   DPP P+   C+
Sbjct  331   TKGKVNNTEIYGAPCRNPATAVSWDGVHYTEAANKHVADRTHGGLLTDPPVPITRACY  388



>ref|XP_010425337.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Camelina sativa]
Length=382

 Score =   280 bits (716),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 153/357 (43%), Positives = 205/357 (57%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAIFNFGDSN+DTGG  AAF     P G T+F  P GR +DGR+I+DF+A+ LGL +
Sbjct  28    CSFPAIFNFGDSNSDTGGLSAAFGQAPFPNGQTFFHSPSGRFSDGRLIIDFIAEELGLPY  87

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L+ +L S+GS+F HGANFAT  STV PP++++     SP SL +Q  QF  F +   +  
Sbjct  88    LNAFLDSMGSNFSHGANFATAGSTVRPPNTTISQGGASPISLDVQLVQFSDF-LTRSQLI  146

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             + Q   +      LP K  F +ALYTF +GQND    L  ++    +   +PEVV Q + 
Sbjct  147   RNQGGVFKQ---LLPRKEYFSEALYTFDMGQNDLTAGLKLNMTTEQIKAYIPEVVDQFSN  203

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              I+ +Y  GGR F+I N AP+GC P  L +     S++D  GC  + N     YN+ LK 
Sbjct  204   AIRKVYSKGGRRFWIHNTAPLGCLPYVLDRFPVPASEMDIHGCAIARNEIARFYNSELKR  263

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              +   R++   A   YVD +SI L L       G +Y   ACCGY GG YNF   + CG 
Sbjct  264   RVIGLRKEFSKATFTYVDVYSIKLTLITQAKKLGFRYPLIACCGY-GGKYNFSNNIRCGA  322

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
               ++ G + V A++C D    VSWDG H T+ ANK   Q I SG++ DPP P+   C
Sbjct  323   KVMVKGKEVVLAKSCNDVSFRVSWDGIHFTETANKWIFQQINSGAFSDPPLPVKFAC  379



>ref|XP_010029093.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Eucalyptus grandis]
 gb|KCW55935.1| hypothetical protein EUGRSUZ_I01728 [Eucalyptus grandis]
Length=388

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/359 (40%), Positives = 208/359 (58%), Gaps = 7/359 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPA++NFGDSN+DTGG  AAF  +  PYG  +F KP GR  DGR+IVDF+A+ L L +
Sbjct  36    CRFPAMYNFGDSNSDTGGISAAFDPIPSPYGAGFFHKPAGRDCDGRLIVDFIAEKLKLPY  95

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G+++RHGANFAT  ST+   + ++F+  +SPFSL +Q  Q+ QFK    E  
Sbjct  96    LSAYLNSLGTNYRHGANFATGGSTIRRQNETIFEFGISPFSLDMQIVQYDQFKRRTAELY  155

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +   +     +KLP +  F +ALYTF IGQND       L    +  +LP++V ++   
Sbjct  156   SQAKDASE--KSKLPVQEEFAQALYTFDIGQNDLSVGFRKLSSDQLKAALPDIVNKLASA  213

Query  666   IKDIYLLGGRTFFILNLAPIGCYP-SFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             +++IY  GGR+F+I N  PIGC P +F    +     LD  GC+K+ N    ++N  LK+
Sbjct  214   VQNIYRNGGRSFWIHNTGPIGCLPVNFFYNHNPPAGYLDDHGCVKTQNEMAVEFNRQLKE  273

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + RQ++ +A + YVD ++    L  +  S G     K CCGY    +     ++CG+
Sbjct  274   RVIKLRQELPEAAITYVDVYAAKFGLIGNYKSEGFVDPFKVCCGY----HENYDHIWCGN  329

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
                +NG  V   +C+DP   +SWDG H ++A N      I +GS  DPP P+   CH H
Sbjct  330   KGSVNGTDVFGGSCKDPATSISWDGVHYSEATNHWVANRILNGSLSDPPIPVTQACHRH  388



>ref|XP_002875320.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH51579.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=379

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 153/357 (43%), Positives = 205/357 (57%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAIFNFGDSN+DTGG  AAF     P G T+F  P GR  DGR+I+DF+A+ LGL +
Sbjct  26    CNFPAIFNFGDSNSDTGGLSAAFGQAPYPNGQTFFHSPSGRFADGRLIIDFIAEELGLPY  85

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L+ +L SIGS+F HGANFAT  ST+ PP+S++     SP SL +Q  QF  F +   +  
Sbjct  86    LNAFLDSIGSNFSHGANFATAGSTIRPPNSTISQGGSSPISLDVQLVQFSDF-ITRSQLI  144

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             + Q   +      LP K  F +ALYTF IGQND    L  ++    +   +P+V+ Q + 
Sbjct  145   RNQGGVFKK---LLPKKEYFSQALYTFDIGQNDLTSGLKLNMTTDQIKAYIPDVLDQFSN  201

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              I+ +Y  GGR F+I N AP+GC P  L +     S +D  GC    N     YN+ LK 
Sbjct  202   AIRKVYSKGGRRFWIHNTAPLGCLPYVLDRFPVPASQIDNHGCAIPRNEIARYYNSELKR  261

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              +   R+++ DA   YVD +SI L L  HP   G +Y   ACCG+ GG YN+ K + CG 
Sbjct  262   RVIGLRKELSDAAFTYVDIYSIKLTLITHPKKLGFRYPLVACCGH-GGKYNYNKLIKCGA  320

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
               ++ G + V A++C D    VSWDG H T+ AN    Q I  G++ DPP PL   C
Sbjct  321   KVMVEGKEIVLAKSCNDVSFRVSWDGIHFTETANSWIFQKINGGAFSDPPIPLKFAC  377



>ref|XP_009771352.1| PREDICTED: GDSL esterase/lipase At5g14450 isoform X1 [Nicotiana 
sylvestris]
Length=399

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/357 (40%), Positives = 202/357 (57%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAI+NFGDSN+DTGG  AAF  +  PYG ++F +P GR +DGR+++DF+A+ L L +
Sbjct  44    CNFPAIYNFGDSNSDTGGISAAFQPIQAPYGESFFHRPAGRLSDGRLLIDFIAEHLRLPY  103

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L  YL SIGS+FRHGANFAT  ST+   + ++F S +SPFSL +Q  QF +FK   +E  
Sbjct  104   LIAYLDSIGSNFRHGANFATGGSTIRRQNQTIFQSGISPFSLDVQIMQFHRFKARTEELY  163

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             ++          KLP    F KALYT  IGQ D       +    +  ++ +++ Q +  
Sbjct  164   RQAIDLSE--KKKLPRPREFSKALYTLDIGQTDLAVGFRQMSNIQLRAAISDIINQFSAA  221

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSH-NTSDLDQFGCLKSYNNAVADYNNILKD  490
             +  +Y  G R F+I N  PIGC P+    L +     LD +GCLKS N    ++N  LK 
Sbjct  222   VMRLYQQGARAFWIHNTGPIGCLPTATLYLRNPKPGVLDNYGCLKSQNKMALEFNRQLKA  281

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              +R  R ++  A++ YVD ++   EL  +  S G     K CCG   G+      ++CG 
Sbjct  282   RIRTLRAELGHADITYVDVYAAKYELISNANSQGFMEPHKICCGLHEGN----THVWCGQ  337

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
               ++ G  V   AC +P  Y+SWDG H + AAN      I +GS+ DPP P+ H CH
Sbjct  338   KAIVRGAEVFGGACVNPSIYISWDGVHYSQAANHWIANQILNGSFSDPPIPITHACH  394



>emb|CBI16795.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/358 (41%), Positives = 206/358 (58%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPA+FNFGDSN+DTGG  AAF     P G TYF  P GR +DGR+I+DF+A+ LGL +
Sbjct  93    CSFPAVFNFGDSNSDTGGLSAAFGQAPSPNGETYFGAPAGRFSDGRLIIDFIAESLGLPY  152

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL ++GS+F HGANFAT  ST+ P ++++  S  SP SL +QF +F  F+     + 
Sbjct  153   LSAYLDALGSNFSHGANFATAGSTIRPQNTTMAQSGYSPISLNVQFVEFSDFR----NRS  208

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             Q   +        LP +  F  ALYTF IGQND       ++    V   +P+++  ++ 
Sbjct  209   QIFRNRGGVFQELLPKEEDFAAALYTFDIGQNDLTAGYKLNMTTEQVKAYVPDLLDSLSN  268

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK ++  G R+F+I N  P+GCYP  + +     + +D+ GC   YN     +N+ LK 
Sbjct  269   IIKYVHARGARSFWIHNTGPVGCYPYVMDRFPITAAQVDKHGCASPYNEVAQYFNSRLKG  328

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ Q R+D+ +A + YVD +S+   L       G     K CCG+ GG YN+ +   CG 
Sbjct  329   AVAQLRKDLPEAAITYVDVYSVKYRLISQARKQGFMDPFKVCCGH-GGKYNYNQAFKCGA  387

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                + G + V A++CE+P   +SWDG H T+AANK     I  GS+ DPP PL   CH
Sbjct  388   KIKVGGKEVVIAKSCENPRVRISWDGVHFTEAANKWIFDRIVDGSFSDPPIPLRMACH  445



>ref|XP_010556209.1| PREDICTED: alpha-L-fucosidase 3 [Tarenaya hassleriana]
Length=380

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/361 (41%), Positives = 203/361 (56%), Gaps = 13/361 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAIFNFGDSN+DTGG  AAF    PP+G ++F  P GR  DGR+++DF+A+ L L +
Sbjct  26    CNFPAIFNFGDSNSDTGGLSAAFGQAGPPHGESFFGGPAGRYCDGRLVIDFIAERLRLPY  85

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L+ +L ++GS+F HGANFAT  S +   +++L  S  SPFSL +QF QF  F        
Sbjct  86    LNAFLDAVGSNFSHGANFATAGSPIRQLNTTLRQSGFSPFSLDVQFTQFSNF-------H  138

Query  846   QEQHHSYNHGNTK---LPPKNIFGKALYTFYIGQNDFIFDL-ASLGISGVNQSLPEVVAQ  679
                    NHG      LP  + F   LYTF IGQND    L A+  +  V   +PE++ Q
Sbjct  139   NRSQIFRNHGEVYRALLPEADSFSLGLYTFDIGQNDLTAGLFANKTVQEVRADVPEIITQ  198

Query  678   ITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNI  499
                 IK IY  GGR F+I N  P GC    +       SD D+ GC+  +N     +N +
Sbjct  199   FKNVIKYIYGQGGRYFWIHNTGPFGCLAYAIDHFPVKASDFDEHGCVAPFNELAQHFNKL  258

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             LK+++ + R  + +A V YVD +S+  ELF H   HG      +CCG+ GG YN+ K ++
Sbjct  259   LKESVTELRNMLPEAAVTYVDVYSVKHELFLHAQGHGFTRSLVSCCGH-GGKYNYNKNIW  317

Query  318   CGDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             CG   ++ G+ +   + CEDP   V WDG H T AANK   + I  G + DPP  L+  C
Sbjct  318   CGKKKMVRGKEIYIGKPCEDPSRAVIWDGVHYTQAANKFIFEKISIGKFSDPPVGLNMAC  377

Query  141   H  139
             H
Sbjct  378   H  378



>ref|XP_002530044.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
 gb|EEF32344.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
Length=397

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/358 (42%), Positives = 202/358 (56%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAIFNFGDSN+DTGG  AAF  L  P G + FKKP GR  DGR I+DF+A+ LGL +
Sbjct  46    CNFPAIFNFGDSNSDTGGKSAAFHRLPYPNGYSLFKKPSGRYCDGRDIIDFIAERLGLPY  105

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             L+ YL SIG++FRHGANFAT  ST+ P  S +F+   SP SL IQ  QF+QFK    E  
Sbjct  106   LNAYLDSIGTNFRHGANFATGGSTIQPVDSRIFEGGFSPISLDIQLLQFEQFKERTLELY  165

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +   SY      LP    F KALYT  IGQND      S+    V +S+P ++    + 
Sbjct  166   NQGRSSYVV--NSLPRPEDFSKALYTLDIGQNDLHSGFGSMTEKQVLESIPGIINHFAQA  223

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKDA  487
             ++ +Y LG RTF+I N  PIGC P  + K      ++DQ GC+ S+NN   D+N  LKD 
Sbjct  224   VEKLYQLGARTFWIHNTGPIGCLPYAVIKYPPEPGNMDQIGCVNSHNNISQDFNRQLKDR  283

Query  486   LRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGDT  307
             + + R+ + DA + Y D ++    L     + G       CCG+  GDY  +    CG  
Sbjct  284   VSRLRKQLPDAALTYTDIYTAKYSLISESKNQGFADPFGYCCGH-YGDYRVQ----CGGK  338

Query  306   NVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCHIH  133
               +NG  ++ + C +P  Y+SWDG H + AAN++    I  G   DPP  ++  C  H
Sbjct  339   ATVNGTEISGDPCSNPELYISWDGIHYSQAANQIVANRILDGFLSDPPLFINETCGNH  396



>ref|XP_011042393.1| PREDICTED: alpha-L-fucosidase 3-like [Populus euphratica]
Length=387

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/364 (41%), Positives = 204/364 (56%), Gaps = 11/364 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  A F    PP+G +YF  P GR  DGR+I+DF+A+  GL +
Sbjct  30    CHFPAIFNFGDSNSDTGGLSAVFGQAPPPHGESYFHHPAGRYCDGRLIIDFIAKSFGLPY  89

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+F HGAN AT  ST+ P +S+L  S  SP SL +Q+N+F  F        
Sbjct  90    LSAYLDSVGSNFTHGANIATAGSTIRPQNSTLHQSGFSPISLDVQWNEFYDF------HR  143

Query  846   QEQHHSYNHGNTK--LPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQI  676
             + Q      G  K  LP    F  ALYTF IGQND      +++  S V   +P+V+ Q 
Sbjct  144   RSQIIRSQGGVYKKLLPKAEDFSHALYTFDIGQNDLTSGYFSNMTSSEVKAYVPDVLDQF  203

Query  675   TKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNIL  496
                +  IY  GGR F+I N  P GC    L ++  + +++D+ GC   +N     +N  L
Sbjct  204   KNIVSYIYGQGGRNFWIHNTGPFGCLAYVLERIPISAAEVDRSGCGTPFNEVAQYFNRGL  263

Query  495   KDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFC  316
             K  + Q R+ +  A + YVD +S+  +L      HG     +ACCG+ GG YN+ ++L C
Sbjct  264   KRVVFQLRKKLPLAAITYVDVYSVKYKLVSQARKHGFNESLRACCGH-GGKYNYNRQLGC  322

Query  315   GDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
             G    + G+ +   ++C+DP  ++SWDG H T AANK     I  GS+ DPP PL   C 
Sbjct  323   GAKRTVGGREILVGKSCKDPSEWISWDGVHYTQAANKWIFDQIVDGSFSDPPVPLKMACQ  382

Query  138   IHPI  127
               P+
Sbjct  383   RQPV  386



>ref|XP_006289899.1| hypothetical protein CARUB_v10003515mg [Capsella rubella]
 gb|EOA22797.1| hypothetical protein CARUB_v10003515mg [Capsella rubella]
Length=394

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/357 (39%), Positives = 205/357 (57%), Gaps = 7/357 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+FPAI+NFGDSN+DTGG  AAF  +  PYG  +F +P GR +DGR+ +DF+A+ L L +
Sbjct  42    CTFPAIYNFGDSNSDTGGISAAFEPIRDPYGQGFFHRPAGRDSDGRLTIDFIAERLELPY  101

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+GS+FRHGANFAT  ST+   + ++F   +SPFSL +Q  QF QFK    +  
Sbjct  102   LSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSAQIF  161

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
              +    Y+    KLP +  F KALYTF IGQND      ++ +  +  ++P++V+ +   
Sbjct  162   TQIKSRYDR--EKLPRQEEFSKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVSHLASA  219

Query  666   IKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSD-LDQFGCLKSYNNAVADYNNILKD  490
             +++IY  GGRTF++ N  P+GC P  +  +       LD  GC+K+ N    ++N  LK+
Sbjct  220   VQNIYQQGGRTFWVHNTGPLGCLPVNMFYMGTPAPGYLDNSGCVKAQNEMAMEFNRKLKE  279

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              +   R+++  A + YVD ++   E+  +P   G     K CCGY    +     ++CG+
Sbjct  280   TVINLRKELTQAAITYVDVYAAKYEMMNNPKKLGFANPLKVCCGY----HEKYDHIWCGN  335

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
                +N   +   +C +P   VSWDG H T+AANK       SG   DPP P+   C+
Sbjct  336   KGKVNNTEIYGGSCPNPAMAVSWDGVHYTEAANKHVADRTLSGLLTDPPVPITRACY  392



>ref|XP_004239139.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Solanum lycopersicum]
Length=386

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/361 (42%), Positives = 207/361 (57%), Gaps = 13/361 (4%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPA+FNFGDSN+DTGG  AAF    PP G TYF  P GR  DGR++VDF+A+ LGL +
Sbjct  32    CHFPAVFNFGDSNSDTGGLSAAFGQAGPPAGETYFGAPAGRYCDGRLVVDFIAENLGLPY  91

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS +L ++GS+F HGANFAT  ST+ P +++L  S  SP SL +Q  +F  F        
Sbjct  92    LSAFLDALGSNFSHGANFATAGSTIRPQNTTLHQSGFSPISLNVQSYEFNDFL-------  144

Query  846   QEQHHSYNHGNT--KLPPKNI-FGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQ  679
                    N G+   KL PK   F + LYTF IGQND      +++    V   +P+V+ Q
Sbjct  145   HRSQIIRNKGDVFCKLMPKEKHFSEGLYTFDIGQNDLTAGYFSNMSTDQVRAYVPDVIDQ  204

Query  678   ITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNI  499
                 I+ IY  GGR F+I N  P+GC P  L +L      +D+ GC   +N     +N  
Sbjct  205   FKTVIQGIYSRGGRYFWIHNTGPVGCLPYVLDRLLITAGQVDKAGCAAPFNEVAQYFNAK  264

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             LK+A+ + R+D+  A + YVD +S+  EL  H   HG ++  +ACCG+ GG YN+     
Sbjct  265   LKEAVIELRKDLPLAALTYVDVYSVKYELIYHANKHGFEHPLQACCGH-GGKYNYNINHG  323

Query  318   CGDTNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             CG    + G + +  ++C+ P   ++WDG H T+AANK   Q I +G Y DPP PL+  C
Sbjct  324   CGSKIKVKGKEIILGKSCKSPSKRINWDGVHFTEAANKWVFQQIVNGLYSDPPLPLNMAC  383

Query  141   H  139
             H
Sbjct  384   H  384



>ref|XP_006357594.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Solanum tuberosum]
Length=379

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 210/358 (59%), Gaps = 7/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C+F AIFNFGDSN+DTGG  AAF     P G+T F  P GR +DGR+++DF+A+GL L +
Sbjct  23    CNFAAIFNFGDSNSDTGGLSAAFGQAPYPNGVTSFHAPAGRFSDGRLLIDFIAEGLDLPY  82

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS +L SIGS+F HGANFAT  ST+ P ++++  S  SP SL +Q  QF  F      + 
Sbjct  83    LSAFLDSIGSNFSHGANFATAGSTIRPQNTTMGQSGYSPISLDVQGVQFSDFHT----RS  138

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQITK  670
             Q      N     LP +  F +ALYTF IGQND       ++    V   +P++++Q++ 
Sbjct  139   QIIRQKGNIFGQLLPKEEDFSQALYTFDIGQNDLTAGYKLNMSTDQVKAYVPDLLSQLSN  198

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK +Y  GGR+F+I N  P+GC P  + +     + +D++GC   +N     +N +LK 
Sbjct  199   VIKKVYARGGRSFWIHNTGPVGCLPYVMDRFMITAAQVDKYGCANPFNEVSKYFNLLLKK  258

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + Q R+++  A   YVD +S+   L  H    G +    ACCG+ GG YN+ + + CG 
Sbjct  259   TVVQLRKELPLAAFTYVDVYSVKYSLIGHAKKLGFENPFLACCGH-GGKYNYNRFIKCGS  317

Query  309   TNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFCH  139
               V+NG + V A +C+DP   VSWDG H T+AANK     I +GS+ DPP PLH  C+
Sbjct  318   KKVVNGKEIVIASSCKDPSVRVSWDGTHFTEAANKWIFDQIVNGSFSDPPIPLHLACN  375



>ref|XP_007215529.1| hypothetical protein PRUPE_ppa007107mg [Prunus persica]
 gb|EMJ16728.1| hypothetical protein PRUPE_ppa007107mg [Prunus persica]
Length=382

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/358 (40%), Positives = 206/358 (58%), Gaps = 8/358 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAI+NFGDSN+DTGG  AAF  +  PYG  +F KP GR +DGR+I+DF+A+ L L +
Sbjct  29    CSFPAIYNFGDSNSDTGGISAAFEPIRAPYGEAFFHKPAGRDSDGRLIIDFIAERLRLPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G+++RHGANFAT  ST+  P+ ++++  +SPFSL +Q  QF QFK    E  
Sbjct  89    LSAYLNSLGTNYRHGANFATGGSTIRRPNETIYEYGISPFSLDMQTTQFLQFKARSAELY  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             ++     +   + LP    F KALYTF IGQND       L    +  +LP++++Q+   
Sbjct  149   RQAKDPSDR--STLPNPQDFAKALYTFDIGQNDLSVGFRKLSFDQIRAALPDILSQLATA  206

Query  666   IKDIYLLGGRTFFILNLAPIGCYP-SFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             ++ IY  GGR+F+I N  PIGC P +    L+     LD  GC+K  N+   ++N  LKD
Sbjct  207   VRRIYEQGGRSFWIHNTGPIGCLPVNLFYNLNPPPGYLDDHGCVKGQNDMAIEFNRQLKD  266

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
              + + R ++  A + YVD ++    L  +  + G     K CCGY    +     ++CG+
Sbjct  267   RVIKLRAELPQAAITYVDVYAAKYGLISNAKTEGFADPMKVCCGY----HVKYDHVWCGN  322

Query  309   TNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFD-PPFPLHHFCH  139
               ++NG  V   +C+ P +Y+SWDG H T  AN+     I  GS    PP P+   C 
Sbjct  323   KGMVNGSEVYGPSCQTPSSYISWDGVHYTQGANQWVANHILDGSLSSTPPTPITQACQ  380



>ref|XP_007161910.1| hypothetical protein PHAVU_001G107900g [Phaseolus vulgaris]
 gb|ESW33904.1| hypothetical protein PHAVU_001G107900g [Phaseolus vulgaris]
Length=390

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/363 (41%), Positives = 209/363 (58%), Gaps = 12/363 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP G +YF  P GR  DGR+IVDF+A+ LG  +
Sbjct  34    CHFPAIFNFGDSNSDTGGLSAAFGQPGPPQGDSYFHHPAGRYCDGRLIVDFIAKKLGKPY  93

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDS-RVSPFSLAIQFNQFKQFKVMVDEQ  850
             L+ +L S+GS++ HGANFAT  ST+ P +++L  +   SPFSL +QFNQF  F      Q
Sbjct  94    LNAFLDSVGSNYSHGANFATAGSTIRPQNTTLHQTGGFSPFSLDVQFNQFSDF------Q  147

Query  849   EQEQHHSYNHG--NTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQ  679
              + Q      G   T LP    F +ALYTF IGQND       ++    V   +P+V+ Q
Sbjct  148   RRSQFFRNKGGVYKTLLPKAEDFSQALYTFDIGQNDLTSGYFHNMSTDQVKAYVPDVLDQ  207

Query  678   ITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNI  499
                 IK +Y  GGR+F++ N  P+GC P  +       S +D+ GC   YN     +N  
Sbjct  208   FKNVIKYVYNHGGRSFWVHNTGPVGCLPYIMDLHPVKPSLVDKAGCSTPYNEVAKFFNRE  267

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             LK+ + + R+++  A + YVD +++   L  HP  HG +   +ACCG+ GG YN+     
Sbjct  268   LKEVVVKLRKELPLAAITYVDVYAVKYSLISHPKKHGFEEPLRACCGH-GGKYNYNLHTG  326

Query  318   CGDTNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             CG    + G+ +   + C+DP  +V+WDG H T AANK  ++ I  G++ DPP PL+  C
Sbjct  327   CGAKIKIRGKEILVGKPCKDPSVWVNWDGVHYTQAANKWVLEQIVDGAFSDPPIPLNMAC  386

Query  141   HIH  133
             H H
Sbjct  387   HKH  389



>ref|XP_010320940.1| PREDICTED: GDSL esterase/lipase At3g26430-like isoform X1 [Solanum 
lycopersicum]
Length=384

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 149/361 (41%), Positives = 210/361 (58%), Gaps = 6/361 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C F AIFNFGDSN+DTGG  AAF     P G T+F  P GR +DGR+++DF+A+GL L +
Sbjct  21    CKFAAIFNFGDSNSDTGGLSAAFGQAPYPNGETFFHAPAGRFSDGRLLIDFIAEGLDLPY  80

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS +L SIGS+F HGANFAT  ST+ P ++++  S  SP SL +Q  QF  F        
Sbjct  81    LSAFLDSIGSNFSHGANFATAGSTIRPQNTTMAQSGYSPISLDVQGVQFSDFHTRSQIIR  140

Query  846   QEQHHSYNHGNT---KLPPKNIFGKALYTFYIGQNDFIFDLA-SLGISGVNQSLPEVVAQ  679
             Q+     N GN     LP K  F +ALYTF IGQND       ++    V   +P++++Q
Sbjct  141   QKGFVISNTGNVFGQLLPNKEDFSQALYTFDIGQNDLTAGYKLNMSTDQVKAYVPDLLSQ  200

Query  678   ITKTIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNI  499
             ++  IK +Y  GGR+F+I N  P+GC P  + +     + +D++GC   +N     +N +
Sbjct  201   LSNVIKKVYAKGGRSFWIHNTGPVGCLPYVIDRFMITAAQVDKYGCANPFNEVSKYFNLL  260

Query  498   LKDALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELF  319
             LK  + Q R+++  A   YVD +S+   L  H    G +    ACCG+ GG YN+ + + 
Sbjct  261   LKKTVVQLRKELPLAAFTYVDVYSVKYSLIGHAKKLGFENPFLACCGH-GGKYNYNRFIK  319

Query  318   CGDTNVLNG-QTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSYFDPPFPLHHFC  142
             CG   V+NG + V A +C+DP   V+WDG H T+AANK     I +GS+ DPP PL   C
Sbjct  320   CGSKKVVNGKEIVIASSCKDPSVRVNWDGTHFTEAANKWIFDQIVNGSFSDPPIPLSLAC  379

Query  141   H  139
             +
Sbjct  380   N  380



>ref|XP_008230502.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X1 [Prunus 
mume]
Length=383

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/359 (40%), Positives = 208/359 (58%), Gaps = 9/359 (3%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             CSFPAI+NFGDSN+DTGG  AAF  +  PYG  +F KP GR +DGR+I+DF+A+ L L +
Sbjct  29    CSFPAIYNFGDSNSDTGGISAAFEPIRAPYGEAFFHKPAGRDSDGRLIIDFIAERLRLPY  88

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS YL S+G+++RHGANFAT  ST+  P+ ++++  +SPFSL +Q  QF QFK    E  
Sbjct  89    LSAYLNSLGTNYRHGANFATGGSTIRRPNETIYEYGISPFSLDMQTTQFLQFKARSAELY  148

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFDLASLGISGVNQSLPEVVAQITKT  667
             +E  +  +   + LP    F KALYTF IGQND       L    +  +LP+++ Q+   
Sbjct  149   REAKNPSDR--STLPNPQDFAKALYTFDIGQNDLSVGFRKLSFDQIRAALPDILNQLATA  206

Query  666   IKDIYLLGGRTFFILNLAPIGCYP-SFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
             ++ IY  GGR+F+I N  PIGC P +    L+     LD  GC+K  N+   ++N  LKD
Sbjct  207   VRRIYEQGGRSFWIHNTGPIGCLPVNLFYNLNPPPGYLDDHGCVKGQNDIAIEFNRQLKD  266

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHP-TSHGLKYGTKACCGYGGGDYNFKKELFCG  313
              + + R ++  A + YVD ++    L     T  G     K CCGY    +     ++CG
Sbjct  267   RVIKLRAELPQAAITYVDVYAAKYGLISSAKTEAGFADPMKVCCGY----HVKYDHVWCG  322

Query  312   DTNVLNGQTVTAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSGSY-FDPPFPLHHFCH  139
             +  ++NG  V   +C+ P +Y+SWDG H T  AN+     I +GS   +PP P+   CH
Sbjct  323   NKGMVNGSEVYGPSCQTPSSYISWDGVHYTQGANQWVANHILNGSLSSNPPTPITQACH  381



>dbj|BAD43265.1| ENOD8-like protein [Arabidopsis thaliana]
Length=364

 Score =   278 bits (711),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 147/344 (43%), Positives = 198/344 (58%), Gaps = 7/344 (2%)
 Frame = -1

Query  1206  CSFPAIFNFGDSNTDTGGFFAAFPSLVPPYGMTYFKKPVGRATDGRVIVDFLAQGLGLAF  1027
             C FPAIFNFGDSN+DTGG  AAF    PP+G ++F  P GR  DGR+++DF+A+ LGL +
Sbjct  18    CHFPAIFNFGDSNSDTGGLSAAFGQAGPPHGSSFFGSPAGRYCDGRLVIDFIAESLGLPY  77

Query  1026  LSPYLKSIGSDFRHGANFATVSSTVMPPHSSLFDSRVSPFSLAIQFNQFKQFKVMVDEQE  847
             LS +L S+GS+F HGANFAT  S +   +S+L  S  SPFSL +QF QF  F      + 
Sbjct  78    LSAFLDSVGSNFSHGANFATAGSPIRALNSTLRQSGFSPFSLDVQFVQFYNFH----NRS  133

Query  846   QEQHHSYNHGNTKLPPKNIFGKALYTFYIGQNDFIFD-LASLGISGVNQSLPEVVAQITK  670
             Q          T LP  + F KALYTF IGQND      A+  +  V   +PE+++Q   
Sbjct  134   QTVRSRGGVYKTMLPESDSFSKALYTFDIGQNDLTAGYFANKTVEQVETEVPEIISQFMN  193

Query  669   TIKDIYLLGGRTFFILNLAPIGCYPSFLAKLSHNTSDLDQFGCLKSYNNAVADYNNILKD  490
              IK+IY  GGR F+I N  PIGC    + +  +  SD D  GC+   N+    +N+ LK 
Sbjct  194   AIKNIYGQGGRYFWIHNTGPIGCLAYVIERFPNKASDFDSHGCVSPLNHLAQQFNHALKQ  253

Query  489   ALRQTRQDIKDANVVYVDTHSIILELFQHPTSHGLKYGTKACCGYGGGDYNFKKELFCGD  310
             A+ + R  + +A + YVD +S+  ELF H   HG K    +CCG+ GG YN+ K + CG 
Sbjct  254   AVIELRSSLSEAAITYVDVYSLKHELFVHAQGHGFKGSLVSCCGH-GGKYNYNKGIGCGM  312

Query  309   TNVLNGQTV-TAEACEDPYNYVSWDGFHLTDAANKVTVQAIFSG  181
               ++ G+ V   + C++P   V WDG H T AANK     I  G
Sbjct  313   KKIVKGKEVYIGKPCDEPDKAVVWDGVHFTQAANKFIFDKIAPG  356



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3013129232434