BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25410_g2_i2 len=619 path=[53:0-46 100:47-618]

Length=619
                                                                      Score     E

ref|XP_009787476.1|  PREDICTED: flowering time control protein FP...    131   3e-31   
ref|XP_009787474.1|  PREDICTED: flowering time control protein FP...    131   3e-31   
ref|XP_009589187.1|  PREDICTED: flowering time control protein FP...    130   6e-31   
ref|XP_009589185.1|  PREDICTED: flowering time control protein FP...    130   7e-31   
gb|KDP43886.1|  hypothetical protein JCGZ_20896                         129   1e-30   
ref|XP_002529477.1|  RNA recognition motif-containing protein, pu...    127   4e-30   Ricinus communis
ref|XP_004240984.1|  PREDICTED: flowering time control protein FPA      124   8e-29   
ref|XP_006350716.1|  PREDICTED: flowering time control protein FP...    124   9e-29   
ref|XP_007131937.1|  hypothetical protein PHAVU_011G053300g             124   1e-28   
gb|EPS72608.1|  hypothetical protein M569_02152                         115   1e-28   
ref|XP_010086699.1|  Flowering time control protein FPA                 123   2e-28   
emb|CDP03488.1|  unnamed protein product                                122   4e-28   
ref|XP_011091635.1|  PREDICTED: flowering time control protein FPA      122   5e-28   
dbj|BAD95007.1|  hypothetical protein                                   111   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006592142.1|  PREDICTED: flowering time control protein FP...    119   4e-27   
ref|XP_006592144.1|  PREDICTED: flowering time control protein FP...    119   4e-27   
ref|XP_006590932.1|  PREDICTED: flowering time control protein FP...    118   1e-26   
ref|XP_008369175.1|  PREDICTED: flowering time control protein FPA      117   2e-26   
ref|XP_004507346.1|  PREDICTED: flowering time control protein FP...    117   2e-26   
ref|XP_009350523.1|  PREDICTED: flowering time control protein FP...    117   2e-26   
ref|XP_010268270.1|  PREDICTED: flowering time control protein FP...    116   5e-26   
ref|XP_009341170.1|  PREDICTED: flowering time control protein FPA      116   5e-26   
ref|XP_007225369.1|  hypothetical protein PRUPE_ppa000835mg             115   1e-25   
ref|XP_008222429.1|  PREDICTED: flowering time control protein FPA      115   1e-25   
ref|XP_011007413.1|  PREDICTED: flowering time control protein FP...    113   4e-25   
emb|CDY17927.1|  BnaC04g02920D                                          113   9e-25   
ref|XP_002309788.2|  hypothetical protein POPTR_0007s01730g             112   1e-24   Populus trichocarpa [western balsam poplar]
gb|KDO42852.1|  hypothetical protein CISIN_1g002168mg                   112   2e-24   
ref|XP_006442983.1|  hypothetical protein CICLE_v10018733mg             111   2e-24   
gb|KDO42853.1|  hypothetical protein CISIN_1g002168mg                   111   2e-24   
ref|XP_007033897.1|  RNA recognition motif-containing protein, pu...    111   3e-24   
ref|XP_007033896.1|  RNA recognition motif-containing protein, pu...    111   3e-24   
ref|XP_010672253.1|  PREDICTED: flowering time control protein FPA      110   5e-24   
ref|XP_010258515.1|  PREDICTED: flowering time control protein FPA      110   5e-24   
ref|XP_011037125.1|  PREDICTED: flowering time control protein FPA      108   2e-23   
ref|XP_006397509.1|  hypothetical protein EUTSA_v10001307mg             108   3e-23   
ref|XP_003606822.1|  Flowering time control protein FPA                 108   3e-23   
ref|XP_011011513.1|  PREDICTED: flowering time control protein FP...    107   8e-23   
gb|KHN33296.1|  Flowering time control protein FPA                      105   8e-23   
gb|EYU41080.1|  hypothetical protein MIMGU_mgv1a000924mg                106   1e-22   
gb|KFK35180.1|  hypothetical protein AALP_AA5G250300                    105   3e-22   
ref|XP_006597219.1|  PREDICTED: flowering time control protein FP...    105   3e-22   
emb|CDX79825.1|  BnaA05g03310D                                          105   3e-22   
ref|XP_004145033.1|  PREDICTED: flowering time control protein FP...    104   7e-22   
ref|XP_004153439.1|  PREDICTED: flowering time control protein FP...    104   7e-22   
ref|XP_009142931.1|  PREDICTED: flowering time control protein FPA      103   7e-22   
ref|NP_181869.2|  Flowering time control protein FPA                    103   9e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAM19833.1|  At2g43410/T1O24.15                                      103   9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078046.1|  Flowering time control protein FPA                 103   9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881902.1|  hypothetical protein ARALYDRAFT_483451             103   9e-22   
dbj|BAH19726.1|  AT2G43410                                              103   9e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37173.1|  flowering time control protein fpa                      103   1e-21   
ref|XP_010527796.1|  PREDICTED: flowering time control protein FP...    103   1e-21   
gb|AHZ89702.1|  flowering time control protein FPA2                     103   2e-21   
ref|XP_008460035.1|  PREDICTED: flowering time control protein FPA      103   2e-21   
gb|KHF99673.1|  Flowering time control FPA -like protein                103   2e-21   
ref|XP_007150444.1|  hypothetical protein PHAVU_005G154000g             101   5e-21   
ref|XP_006293654.1|  hypothetical protein CARUB_v10022611mg             100   1e-20   
ref|XP_006595068.1|  PREDICTED: flowering time control protein FP...    100   2e-20   
ref|XP_010526143.1|  PREDICTED: flowering time control protein FP...    100   2e-20   
ref|XP_006595066.1|  PREDICTED: flowering time control protein FP...    100   2e-20   
gb|KHN30092.1|  Flowering time control protein FPA                      100   2e-20   
emb|CDX71900.1|  BnaC08g29740D                                        99.0    4e-20   
ref|XP_010508436.1|  PREDICTED: flowering time control protein FP...  99.0    4e-20   
ref|XP_010506210.1|  PREDICTED: flowering time control protein FP...  98.6    6e-20   
ref|XP_010517900.1|  PREDICTED: flowering time control protein FPA    98.2    8e-20   
ref|XP_010469306.1|  PREDICTED: flowering time control protein FP...  98.2    8e-20   
emb|CAN74982.1|  hypothetical protein VITISV_007871                   98.6    9e-20   Vitis vinifera
ref|XP_010908978.1|  PREDICTED: flowering time control protein FP...  98.2    9e-20   
ref|XP_010908991.1|  PREDICTED: flowering time control protein FP...  98.2    9e-20   
emb|CDY05992.1|  BnaA09g37880D                                        97.4    1e-19   
gb|EYU36725.1|  hypothetical protein MIMGU_mgv1a021744mg              96.3    1e-19   
emb|CBI36724.3|  unnamed protein product                              95.9    2e-19   
ref|XP_002878276.1|  hypothetical protein ARALYDRAFT_907458           96.7    2e-19   
ref|XP_010512218.1|  PREDICTED: flowering time control protein FP...  96.3    3e-19   
ref|XP_010413682.1|  PREDICTED: flowering time control protein FP...  95.9    4e-19   
ref|XP_008788213.1|  PREDICTED: flowering time control protein FP...  95.5    7e-19   
ref|XP_010650623.1|  PREDICTED: flowering time control protein FPA    95.5    7e-19   
ref|XP_009116618.1|  PREDICTED: flowering time control protein FP...  94.7    9e-19   
ref|XP_010321974.1|  PREDICTED: flowering time control protein FP...  92.0    1e-18   
ref|XP_009414659.1|  PREDICTED: flowering time control protein FP...  94.4    2e-18   
ref|XP_001771278.1|  predicted protein                                87.0    2e-18   
ref|XP_009414660.1|  PREDICTED: flowering time control protein FP...  94.4    2e-18   
gb|ABR16173.1|  unknown                                               92.0    1e-17   Picea sitchensis
gb|AAX51263.1|  FPA                                                   91.7    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AAB64314.1|  hypothetical protein                                  91.7    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286323.1|  hypothetical protein CARUB_v100073761mg          85.1    4e-17   
ref|XP_004308182.1|  PREDICTED: flowering time control protein FP...  89.4    7e-17   
ref|XP_008790591.1|  PREDICTED: flowering time control protein FP...  87.4    4e-16   
ref|XP_010927889.1|  PREDICTED: flowering time control protein FP...  86.7    7e-16   
gb|KCW47627.1|  hypothetical protein EUGRSUZ_K01370                   82.8    7e-16   
ref|XP_010927888.1|  PREDICTED: flowering time control protein FP...  86.3    9e-16   
gb|ABK93989.1|  unknown                                               80.9    1e-15   Populus trichocarpa [western balsam poplar]
ref|XP_011074230.1|  PREDICTED: flowering time control protein FP...  85.5    1e-15   
ref|XP_006447878.1|  hypothetical protein CICLE_v10018231mg           81.6    1e-15   
ref|XP_011074231.1|  PREDICTED: flowering time control protein FP...  84.7    3e-15   
emb|CDP06136.1|  unnamed protein product                              80.5    3e-15   
emb|CDY67811.1|  BnaA06g38360D                                        83.2    7e-15   
gb|KDO51063.1|  hypothetical protein CISIN_1g036554mg                 77.8    7e-15   
ref|XP_009149084.1|  PREDICTED: uncharacterized protein LOC103872442  83.2    8e-15   
ref|XP_011073880.1|  PREDICTED: flowering time control protein FP...  83.2    8e-15   
gb|KHM98707.1|  Flowering time control protein FPA                    79.0    9e-15   
ref|XP_010046755.1|  PREDICTED: flowering time control protein FPA    82.8    1e-14   
ref|XP_007146063.1|  hypothetical protein PHAVU_006G009600g           77.0    2e-14   
ref|XP_006858855.1|  hypothetical protein AMTR_s00066p00188130        81.6    3e-14   
emb|CAB53756.1|  putative protein                                     75.9    3e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAT41832.1|  At4g12630                                             75.9    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009386963.1|  PREDICTED: flowering time control protein FP...  81.3    4e-14   
ref|XP_007216722.1|  hypothetical protein PRUPE_ppa026096mg           75.5    6e-14   
gb|EPS65670.1|  hypothetical protein M569_09107                       74.3    8e-14   
gb|KFK23627.1|  hypothetical protein AALP_AAs74839U000100             79.7    1e-13   
ref|XP_010036110.1|  PREDICTED: flowering time control protein FPA    79.3    2e-13   
gb|EYU26221.1|  hypothetical protein MIMGU_mgv11b020481mg             73.6    2e-13   
ref|XP_010542059.1|  PREDICTED: flowering time control protein FP...  78.6    2e-13   
ref|XP_010542058.1|  PREDICTED: flowering time control protein FP...  78.6    2e-13   
ref|XP_001758250.1|  predicted protein                                78.6    3e-13   
ref|XP_003601310.1|  Splicing factor, arginine/serine-rich            74.3    4e-13   
ref|XP_011008186.1|  PREDICTED: flowering time control protein FPA    78.2    4e-13   
ref|XP_006469393.1|  PREDICTED: flowering time control protein FP...  77.8    5e-13   
ref|XP_006391711.1|  hypothetical protein EUTSA_v10023280mg           77.4    6e-13   
ref|XP_002320541.2|  RNA recognition motif containing family protein  77.4    6e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010112891.1|  Flowering time control protein FPA               77.0    1e-12   
ref|XP_007049464.1|  RNA binding protein, putative                    77.0    1e-12   
ref|XP_008448142.1|  PREDICTED: flowering time control protein FPA    76.6    1e-12   
ref|XP_002524560.1|  RNA binding protein, putative                    76.6    1e-12   Ricinus communis
ref|XP_004154577.1|  PREDICTED: uncharacterized protein LOC101229209  76.3    1e-12   
ref|XP_004140066.1|  PREDICTED: uncharacterized protein LOC101216073  76.3    1e-12   
ref|XP_010252942.1|  PREDICTED: flowering time control protein FPA    76.3    2e-12   
ref|XP_004303911.1|  PREDICTED: uncharacterized protein LOC101296020  75.5    3e-12   
ref|XP_003543235.1|  PREDICTED: flowering time control protein FP...  75.1    3e-12   
gb|KHN40233.1|  Flowering time control protein FPA                    75.1    4e-12   
ref|XP_003556809.1|  PREDICTED: flowering time control protein FP...  75.1    4e-12   
ref|XP_010238377.1|  PREDICTED: flowering time control protein FP...  74.7    4e-12   
ref|XP_010238374.1|  PREDICTED: flowering time control protein FP...  74.7    5e-12   
gb|KDP45161.1|  hypothetical protein JCGZ_15026                       74.7    5e-12   
ref|XP_010238376.1|  PREDICTED: flowering time control protein FP...  74.7    5e-12   
ref|XP_002863230.1|  RNA recognition motif-containing protein         74.3    7e-12   
dbj|BAJ93493.1|  predicted protein                                    73.9    8e-12   
ref|NP_001062811.1|  Os09g0298700                                     73.9    9e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84885.1|  hypothetical protein OsI_32043                        73.9    9e-12   Oryza sativa Indica Group [Indian rice]
gb|EEC84301.1|  hypothetical protein OsI_30787                        73.9    9e-12   Oryza sativa Indica Group [Indian rice]
tpg|DAA62331.1|  TPA: hypothetical protein ZEAMMB73_716132            73.6    1e-11   
emb|CCM44540.1|  spen-like protein                                    73.6    1e-11   
ref|NP_001063671.1|  Os09g0516300                                     73.6    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008380039.1|  PREDICTED: flowering time control protein FP...  73.2    2e-11   
ref|XP_006661434.1|  PREDICTED: flowering time control protein FP...  73.2    2e-11   
dbj|BAF01596.1|  hypothetical protein                                 72.8    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193001.2|  RNA recognition motif (RRM)-containing protein      72.8    2e-11   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01027.1|  hypothetical protein                                 72.8    2e-11   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ91078.1|  predicted protein                                    72.8    2e-11   
emb|CAF93650.1|  unnamed protein product                              72.4    2e-11   Tetraodon nigroviridis
ref|XP_002462663.1|  hypothetical protein SORBIDRAFT_02g029880        72.8    2e-11   Sorghum bicolor [broomcorn]
gb|AHZ89701.1|  flowering time control protein FPA1                   72.8    2e-11   
emb|CBI28491.3|  unnamed protein product                              72.0    4e-11   
ref|XP_008229757.1|  PREDICTED: flowering time control protein FPA    72.0    4e-11   
ref|XP_010532945.1|  PREDICTED: flowering time control protein FPA    71.6    4e-11   
ref|XP_010450326.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  71.6    5e-11   
ref|XP_010942508.1|  PREDICTED: flowering time control protein FP...  71.6    5e-11   
ref|XP_010942509.1|  PREDICTED: flowering time control protein FP...  71.6    5e-11   
ref|XP_008794728.1|  PREDICTED: flowering time control protein FP...  71.6    6e-11   
ref|XP_008794727.1|  PREDICTED: flowering time control protein FP...  71.6    6e-11   
ref|XP_007574995.1|  PREDICTED: putative RNA-binding protein 15B      71.2    6e-11   
gb|KHG15134.1|  Flowering time control FPA -like protein              71.2    6e-11   
ref|XP_008318999.1|  PREDICTED: putative RNA-binding protein 15B      70.9    8e-11   
ref|XP_010657507.1|  PREDICTED: flowering time control protein FPA    70.9    8e-11   
tpg|DAA60948.1|  TPA: hypothetical protein ZEAMMB73_205486            67.0    8e-11   
ref|XP_010752148.1|  PREDICTED: putative RNA-binding protein 15B      70.9    9e-11   
ref|XP_005802588.1|  PREDICTED: putative RNA-binding protein 15B-...  70.9    9e-11   
ref|XP_008406480.1|  PREDICTED: putative RNA-binding protein 15B      70.9    9e-11   
gb|KFM29333.1|  Flowering time control protein FPA                    67.4    9e-11   
ref|XP_003291310.1|  hypothetical protein DICPUDRAFT_38760            70.5    9e-11   
ref|XP_008278691.1|  PREDICTED: putative RNA-binding protein 15B      70.9    1e-10   
gb|AES71563.2|  RNA recognition motif (RRM) containing protein        70.9    1e-10   
ref|XP_008652945.1|  PREDICTED: flowering time control protein FPA    70.9    1e-10   
ref|XP_006661092.1|  PREDICTED: flowering time control protein FP...  70.9    1e-10   
tpg|DAA60946.1|  TPA: hypothetical protein ZEAMMB73_205486            67.4    1e-10   
tpg|DAA60945.1|  TPA: hypothetical protein ZEAMMB73_205486            67.0    1e-10   
emb|CDQ91237.1|  unnamed protein product                              70.1    1e-10   
ref|NP_001108062.1|  putative RNA-binding protein 15B                 69.3    1e-10   Danio rerio [leopard danio]
ref|XP_004957358.1|  PREDICTED: flowering time control protein FP...  70.1    1e-10   
ref|XP_004957356.1|  PREDICTED: flowering time control protein FP...  70.1    1e-10   
ref|XP_004956511.1|  PREDICTED: flowering time control protein FP...  70.1    2e-10   
ref|XP_006857606.1|  hypothetical protein AMTR_s00061p00106080        69.7    2e-10   
ref|XP_010864934.1|  PREDICTED: putative RNA-binding protein 15B      69.7    2e-10   
ref|XP_010689354.1|  PREDICTED: flowering time control protein FPA    69.7    2e-10   
ref|XP_629218.1|  hypothetical protein DDB_G0293252                   68.9    3e-10   Dictyostelium discoideum AX4
ref|XP_010238038.1|  PREDICTED: flowering time control protein FPA    69.3    3e-10   
ref|XP_004251817.1|  PREDICTED: flowering time control protein FPA    69.3    3e-10   
ref|XP_004501989.1|  PREDICTED: flowering time control protein FP...  69.3    3e-10   
ref|XP_005469809.1|  PREDICTED: putative RNA-binding protein 15B-...  68.9    4e-10   
ref|XP_006801942.1|  PREDICTED: putative RNA-binding protein 15B-...  68.6    4e-10   
ref|XP_005928999.1|  PREDICTED: putative RNA-binding protein 15B-...  68.6    4e-10   
ref|XP_005740940.1|  PREDICTED: putative RNA-binding protein 15B-...  68.6    4e-10   
ref|XP_009775910.1|  PREDICTED: flowering time control protein FPA    68.6    5e-10   
ref|XP_004559039.1|  PREDICTED: putative RNA-binding protein 15B-...  68.6    5e-10   
ref|XP_009621299.1|  PREDICTED: flowering time control protein FP...  68.6    5e-10   
emb|CDQ91294.1|  unnamed protein product                              68.6    5e-10   
ref|XP_009407917.1|  PREDICTED: flowering time control protein FP...  68.6    5e-10   
ref|XP_009407922.1|  PREDICTED: flowering time control protein FP...  68.6    5e-10   
ref|XP_006350011.1|  PREDICTED: flowering time control protein FP...  68.2    7e-10   
ref|XP_007251604.1|  PREDICTED: putative RNA-binding protein 15B      67.8    8e-10   
ref|XP_010929002.1|  PREDICTED: flowering time control protein FP...  67.8    9e-10   
ref|XP_010928998.1|  PREDICTED: flowering time control protein FP...  67.8    9e-10   
ref|WP_004039180.1|  RNP-1 like RNA-binding protein                   62.8    9e-10   
ref|XP_005696154.1|  PREDICTED: putative RNA-binding protein 15B      67.4    1e-09   
ref|XP_011145506.1|  PREDICTED: hrp65 protein isoform X2              66.6    1e-09   
ref|XP_011145504.1|  PREDICTED: hrp65 protein isoform X1              66.6    1e-09   
gb|AHF96528.1|  RNP-1 like RNA-binding protein                        62.4    2e-09   
ref|WP_021327387.1|  RNP-1 like protein RNA-binding protein           62.4    2e-09   
gb|EFN80529.1|  Hrp65 protein                                         66.2    2e-09   
ref|WP_026308251.1|  MULTISPECIES: RNA-binding protein                61.6    2e-09   
ref|WP_014868175.1|  RNA recognition motif-containing protein         61.2    3e-09   
ref|XP_008078096.1|  RNA-binding, RBD                                 64.7    3e-09   
gb|EFN71412.1|  Hrp65 protein                                         65.5    4e-09   
gb|KFY43057.1|  hypothetical protein V495_04193                       63.2    4e-09   
ref|XP_011065115.1|  PREDICTED: protein no-on-transient A-like is...  65.1    4e-09   
ref|XP_011065114.1|  PREDICTED: protein no-on-transient A-like is...  65.1    4e-09   
gb|EGI58932.1|  Hrp65 protein                                         65.1    5e-09   
gb|KGL84141.1|  Putative RNA-binding protein 15B                      64.7    5e-09   
ref|XP_007288071.1|  RNA recognition domain-containing protein        64.3    5e-09   
ref|XP_003528518.1|  PREDICTED: glycine-rich RNA-binding protein ...  61.6    6e-09   
ref|XP_010222941.1|  PREDICTED: putative RNA-binding protein 15B      64.7    6e-09   
gb|KFV49859.1|  Putative RNA-binding protein 15B                      64.7    6e-09   
ref|XP_009805490.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  64.7    7e-09   
emb|CDS05703.1|  hypothetical protein LRAMOSA08231                    63.9    7e-09   
ref|XP_007617615.1|  PREDICTED: putative RNA-binding protein 15B      64.7    7e-09   
ref|XP_004715246.1|  PREDICTED: putative RNA-binding protein 15B      64.3    8e-09   
ref|XP_008652528.1|  PREDICTED: flowering time control protein FPA    64.7    8e-09   
ref|XP_003436621.1|  AGAP003794-PB                                    64.3    9e-09   
ref|XP_007061908.1|  PREDICTED: putative RNA-binding protein 15B ...  64.3    9e-09   
ref|XP_310351.7|  AGAP003794-PA                                       64.3    1e-08   Anopheles gambiae str. PEST
gb|EZA57672.1|  Hrp65 protein                                         63.9    1e-08   
ref|XP_004581822.1|  PREDICTED: putative RNA-binding protein 15B      64.3    1e-08   
ref|XP_009956627.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_009995230.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
gb|KFQ75625.1|  Putative RNA-binding protein 15B                      63.9    1e-08   
ref|XP_003706377.1|  PREDICTED: hrp65 protein-like                    63.9    1e-08   
ref|XP_009679042.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
gb|KFP57133.1|  Putative RNA-binding protein 15B                      63.9    1e-08   
ref|XP_006607185.1|  PREDICTED: hrp65 protein-like isoform X4         63.9    1e-08   
ref|XP_009889561.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_009868987.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_006607186.1|  PREDICTED: hrp65 protein-like isoform X5         63.9    1e-08   
ref|XP_009637663.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_009279337.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_006909243.1|  PREDICTED: putative RNA-binding protein 15B      64.3    1e-08   
gb|KFQ79672.1|  Putative RNA-binding protein 15B                      63.9    1e-08   
ref|XP_008497177.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
gb|KFW95248.1|  Putative RNA-binding protein 15B                      63.9    1e-08   
ref|XP_005422468.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_010126409.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_009558939.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_006607184.1|  PREDICTED: hrp65 protein-like isoform X3         63.5    1e-08   
ref|XP_008944862.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
gb|KFQ90777.1|  Putative RNA-binding protein 15B                      63.9    1e-08   
ref|XP_009089254.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_002462146.1|  hypothetical protein SORBIDRAFT_02g020460        64.3    1e-08   Sorghum bicolor [broomcorn]
ref|XP_008630370.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_009898973.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_009937995.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_006607182.1|  PREDICTED: hrp65 protein-like isoform X1         63.9    1e-08   
ref|XP_003642020.2|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_010388221.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
gb|EHB14850.1|  Putative RNA-binding protein 15B                      63.9    1e-08   
ref|XP_008921702.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_006607183.1|  PREDICTED: hrp65 protein-like isoform X2         63.5    1e-08   
ref|XP_006978438.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
gb|KFO32669.1|  Putative RNA-binding protein 15B                      63.9    1e-08   
gb|ELK25063.1|  Putative RNA-binding protein 15B                      63.9    1e-08   
ref|XP_003500437.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_009510936.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_010345393.1|  PREDICTED: putative RNA-binding protein 15B      63.5    1e-08   
gb|EMP33890.1|  Putative RNA-binding protein 15B                      63.9    1e-08   
gb|EDL77269.1|  rCG25263                                              63.5    1e-08   Rattus norvegicus [brown rat]
ref|XP_010977193.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
emb|CAD38547.2|  hypothetical protein                                 63.5    1e-08   
gb|AAI39837.1|  RBM15B protein                                        63.5    1e-08   Homo sapiens [man]
gb|AAH52180.1|  RNA binding motif protein 15B                         63.5    1e-08   
ref|XP_004780182.1|  PREDICTED: putative RNA-binding protein 15B      63.9    1e-08   
ref|XP_010290131.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  63.5    1e-08   
ref|XP_008258941.1|  PREDICTED: putative RNA-binding protein 15B      63.5    1e-08   
ref|XP_004664346.1|  PREDICTED: putative RNA-binding protein 15B      63.5    1e-08   
ref|XP_006571564.1|  PREDICTED: hrp65 protein-like isoform X3         63.5    1e-08   
ref|XP_008067660.1|  PREDICTED: putative RNA-binding protein 15B      63.5    1e-08   
ref|XP_004903641.1|  PREDICTED: putative RNA-binding protein 15B      63.5    1e-08   
ref|XP_007168715.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_008566342.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_006731814.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_006770678.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_010967413.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_006169417.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_010623895.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_006571566.1|  PREDICTED: hrp65 protein-like isoform X5         63.5    2e-08   
ref|XP_008534167.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_006571563.1|  PREDICTED: hrp65 protein-like isoform X2         63.5    2e-08   
ref|XP_001121935.2|  PREDICTED: hrp65 protein-like isoform X1         63.5    2e-08   
ref|XP_005347890.1|  PREDICTED: putative RNA-binding protein 15B      63.9    2e-08   
gb|EPQ17480.1|  Putative RNA-binding protein 15B                      63.5    2e-08   
ref|XP_006571568.1|  PREDICTED: hrp65 protein-like isoform X7         63.5    2e-08   
ref|XP_006174140.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_008970526.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  63.9    2e-08   
gb|ELK15143.1|  Putative RNA-binding protein 15B                      63.5    2e-08   
ref|XP_003476753.1|  PREDICTED: putative RNA-binding protein 15B      63.9    2e-08   
gb|KFY34823.1|  hypothetical protein V494_06442                       61.2    2e-08   
ref|XP_007005560.1|  hypothetical protein TREMEDRAFT_71869            63.2    2e-08   
ref|XP_005992729.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_006220380.1|  PREDICTED: LOW QUALITY PROTEIN: RNA binding ...  63.5    2e-08   
ref|XP_004451824.1|  PREDICTED: putative RNA-binding protein 15B ...  63.5    2e-08   
ref|XP_005410373.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_005141655.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_969645.1|  PREDICTED: hrp65 protein                            63.2    2e-08   
gb|EDL21171.1|  mCG19533                                              63.5    2e-08   
ref|XP_004093062.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  63.5    2e-08   
ref|XP_006031731.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_008103281.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  63.5    2e-08   
ref|NP_780611.3|  putative RNA-binding protein 15B                    63.5    2e-08   
ref|XP_006122334.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_008979983.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_006275212.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
gb|EHH51285.1|  hypothetical protein EGM_10631                        63.5    2e-08   
ref|XP_005522345.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_005881996.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|XP_005485588.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_004615170.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
pdb|2CPJ|A  Chain A, Solution Structure Of The N-Terminal Rna Rec...  59.3    2e-08   
ref|XP_008702329.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|XP_005516168.1|  PREDICTED: LOW QUALITY PROTEIN: RNA binding ...  63.5    2e-08   
ref|XP_009475062.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_007950210.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_010559926.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_004818091.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_003695527.1|  PREDICTED: hrp65 protein-like                    63.2    2e-08   
ref|XP_008153464.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_004368791.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_006104909.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  63.5    2e-08   
ref|XP_004834221.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
gb|EFB13647.1|  hypothetical protein PANDA_007613                     63.2    2e-08   
ref|XP_005315655.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  63.5    2e-08   
ref|XP_006892332.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|WP_038960474.1|  RNA-binding protein                              58.9    2e-08   
ref|XP_005327118.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|XP_005052970.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|NP_037418.3|  putative RNA-binding protein 15B                    63.5    2e-08   
ref|XP_010588069.1|  PREDICTED: putative RNA-binding protein 15B      63.5    2e-08   
ref|XP_006928927.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
gb|KFY03195.1|  hypothetical protein O988_01652                       62.4    2e-08   
ref|XP_009237242.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  63.2    2e-08   
ref|XP_007500609.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|XP_007982586.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|XP_005547319.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|XP_003894405.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|NP_001252598.1|  putative RNA-binding protein 15B                 63.2    2e-08   
ref|XP_003132286.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
emb|CDJ02428.1|  RNA binding protein                                  63.2    2e-08   
ref|XP_236613.6|  PREDICTED: putative RNA-binding protein 15B iso...  63.2    2e-08   
ref|XP_003789398.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|XP_004411576.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|XP_010379965.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
emb|CDS24177.1|  RNA binding protein                                  63.2    2e-08   
ref|XP_007117256.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|XP_004676172.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|XP_004419815.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|XP_004520076.1|  PREDICTED: protein no-on-transient A-like is...  63.2    2e-08   
ref|XP_003639807.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
ref|XP_004520068.1|  PREDICTED: protein no-on-transient A-like is...  63.2    2e-08   
ref|XP_001937600.1|  alternative splicing regulator                   62.0    2e-08   
ref|XP_008847812.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  63.2    2e-08   
ref|XP_004520075.1|  PREDICTED: protein no-on-transient A-like is...  63.2    2e-08   
ref|XP_004329188.1|  PREDICTED: putative RNA-binding protein 15B      63.2    2e-08   
gb|EUB56438.1|  Putative RNA-binding protein                          63.2    3e-08   
ref|XP_002919030.1|  PREDICTED: putative RNA-binding protein 15B-...  63.2    3e-08   
ref|XP_005098672.1|  PREDICTED: splicing factor, proline- and glu...  62.0    3e-08   
ref|XP_003762652.1|  PREDICTED: putative RNA-binding protein 15B      63.2    3e-08   
ref|XP_005447499.1|  PREDICTED: LOW QUALITY PROTEIN: RNA binding ...  63.2    3e-08   
ref|WP_011449414.1|  RNA recognition motif-containing protein         58.9    3e-08   
ref|XP_006226712.1|  PREDICTED: putative RNA-binding protein 15B ...  63.2    3e-08   
ref|XP_007527359.1|  PREDICTED: putative RNA-binding protein 15B      62.8    3e-08   
ref|XP_004625201.1|  PREDICTED: putative RNA-binding protein 15B      63.2    3e-08   
ref|XP_004267902.1|  PREDICTED: putative RNA-binding protein 15B      63.2    3e-08   
ref|XP_005230003.1|  PREDICTED: putative RNA-binding protein 15B      63.2    3e-08   
gb|ETE70376.1|  putative RNA-binding protein 15B                      63.2    3e-08   
ref|XP_003837957.1|  hypothetical protein LEMA_P120040.1              63.2    3e-08   
ref|XP_007451946.1|  PREDICTED: putative RNA-binding protein 15B      63.2    3e-08   
ref|XP_010716613.1|  PREDICTED: putative RNA-binding protein 15B      62.8    3e-08   
ref|WP_016545701.1|  hypothetical protein                             58.5    3e-08   
ref|XP_005615009.1|  PREDICTED: LOW QUALITY PROTEIN: RNA binding ...  62.8    3e-08   
ref|XP_003736389.1|  GA27079, isoform B                               62.8    3e-08   
ref|XP_007432463.1|  PREDICTED: putative RNA-binding protein 15B      63.2    3e-08   
ref|XP_002190221.1|  PREDICTED: putative RNA-binding protein 15B      62.8    3e-08   
gb|ELW48749.1|  Non-POU domain-containing octamer-binding protein     60.5    3e-08   
gb|KFY25758.1|  hypothetical protein V493_04478                       62.0    3e-08   
ref|WP_018205773.1|  MULTISPECIES: hypothetical protein               58.5    3e-08   
ref|XP_002137212.1|  GA27079, isoform A                               62.8    3e-08   
ref|XP_001847990.1|  NONA protein                                     62.4    3e-08   
ref|XP_002012927.1|  GL23854                                          62.8    3e-08   
ref|XP_004305987.1|  PREDICTED: glycine-rich RNA-binding protein ...  59.3    4e-08   
gb|EUT79591.1|  hypothetical protein PFAG_05084                       62.4    4e-08   
ref|XP_006631056.1|  PREDICTED: putative RNA-binding protein 15B-...  62.8    4e-08   
gb|ETW34289.1|  hypothetical protein PFTANZ_04969                     62.4    4e-08   
ref|XP_001847991.1|  splicing factor                                  62.4    4e-08   
ref|XP_004350309.1|  hypothetical protein DFA_11366                   62.4    4e-08   
ref|XP_002265629.1|  PREDICTED: 30S ribosomal protein 2, chloropl...  60.8    4e-08   
gb|ETW16380.1|  hypothetical protein PFFVO_04637                      62.4    4e-08   
gb|EQB77026.1|  hypothetical protein CB1_000145010                    62.8    4e-08   
gb|EWC86126.1|  hypothetical protein PFNF54_04857                     62.4    4e-08   
ref|WP_018205442.1|  MULTISPECIES: hypothetical protein               58.2    4e-08   
ref|XP_005969412.1|  PREDICTED: putative RNA-binding protein 15B      62.0    5e-08   
gb|EIE81026.1|  hypothetical protein RO3G_05731                       62.4    5e-08   
ref|XP_004018692.1|  PREDICTED: putative RNA-binding protein 15B      62.0    5e-08   
ref|XP_011158554.1|  PREDICTED: protein no-on-transient A-like        62.0    5e-08   
gb|ETW53655.1|  hypothetical protein PFUGPA_03529                     61.6    5e-08   
gb|KFZ66759.1|  Putative RNA-binding protein 15B                      62.0    5e-08   
gb|KEQ65276.1|  putative transformer-SR ribonucleo protein            58.2    5e-08   
ref|XP_005286103.1|  PREDICTED: non-POU domain-containing octamer...  61.6    6e-08   
gb|EMD89685.1|  hypothetical protein COCHEDRAFT_1177492               60.8    6e-08   
ref|XP_010850251.1|  PREDICTED: putative RNA-binding protein 15B      62.0    6e-08   
ref|XP_007698810.1|  hypothetical protein COCSADRAFT_170220           60.8    6e-08   
ref|XP_003300959.1|  hypothetical protein PTT_12345                   60.8    6e-08   
gb|EMF16729.1|  RRM_1-domain-containing protein                       59.3    6e-08   
gb|KFV07816.1|  Putative RNA-binding protein 15B                      61.6    6e-08   
ref|XP_006119252.1|  PREDICTED: non-POU domain-containing octamer...  61.6    6e-08   
ref|XP_004701924.1|  PREDICTED: RNA-binding protein 44                61.6    6e-08   
ref|XP_009189872.1|  PREDICTED: paraspeckle component 1               60.5    6e-08   
ref|XP_008982085.1|  PREDICTED: LOW QUALITY PROTEIN: non-POU doma...  61.6    7e-08   
ref|XP_004520073.1|  PREDICTED: protein no-on-transient A-like is...  61.6    7e-08   
ref|XP_003343767.1|  hypothetical protein SMAC_04425                  61.2    7e-08   
gb|KGO75787.1|  Nucleotide-binding, alpha-beta plait                  60.8    8e-08   
ref|XP_007686407.1|  hypothetical protein COCMIDRAFT_25014            60.5    8e-08   
ref|NP_001193510.1|  putative RNA-binding protein 15B                 61.6    8e-08   
ref|XP_007082058.1|  PREDICTED: putative RNA-binding protein 15B      61.2    8e-08   
ref|XP_006045086.1|  PREDICTED: putative RNA-binding protein 15B      61.6    8e-08   
ref|XP_004520074.1|  PREDICTED: protein no-on-transient A-like is...  61.6    8e-08   
gb|KFY50090.1|  hypothetical protein V496_09596                       60.5    9e-08   
pdb|3SDE|B  Chain B, Crystal Structure Of A Paraspeckle-Protein H...  60.1    9e-08   
ref|XP_008159758.1|  PREDICTED: paraspeckle component 1               59.7    9e-08   
ref|XP_007056178.1|  PREDICTED: non-POU domain-containing octamer...  61.2    9e-08   
gb|KFY75458.1|  hypothetical protein V499_04583                       60.5    9e-08   
pdb|3SDE|A  Chain A, Crystal Structure Of A Paraspeckle-Protein H...  60.1    9e-08   
ref|XP_010727350.1|  PREDICTED: paraspeckle component 1               59.3    9e-08   
dbj|BAB23598.1|  unnamed protein product                              60.1    1e-07   
gb|EHB09925.1|  Paraspeckle component 1                               60.5    1e-07   
ref|XP_002011917.1|  GI14459                                          61.2    1e-07   
ref|XP_005347742.1|  PREDICTED: non-POU domain-containing octamer...  59.3    1e-07   
emb|CCW61681.1|  unnamed protein product                              61.2    1e-07   
gb|AAC37578.1|  unnamed protein product                               60.8    1e-07   
ref|XP_004064412.1|  PREDICTED: non-POU domain-containing octamer...  59.3    1e-07   
gb|KFO92640.1|  Putative RNA-binding protein 15B                      60.8    1e-07   
gb|ELR06000.1|  hypothetical protein GMDG_01961                       60.5    1e-07   
gb|KFZ02816.1|  hypothetical protein V502_11471                       60.5    1e-07   
ref|XP_006024479.1|  PREDICTED: non-POU domain-containing octamer...  60.8    1e-07   
emb|CDO66510.1|  pre-mRNA splicing factor, putative                   61.2    1e-07   
gb|ETW40385.1|  hypothetical protein PFNF135_05212                    61.2    1e-07   
ref|XP_001348201.1|  pre-mRNA splicing factor, putative               61.2    1e-07   
ref|XP_007991469.1|  PREDICTED: non-POU domain-containing octamer...  60.8    1e-07   
ref|XP_011205147.1|  PREDICTED: protein no-on-transient A-like is...  61.2    1e-07   
ref|XP_008508216.1|  PREDICTED: LOW QUALITY PROTEIN: non-POU doma...  59.3    1e-07   
ref|XP_001684706.1|  putative RNA-binding protein                     60.8    1e-07   
gb|KFP49216.1|  Non-POU domain-containing octamer-binding protein     60.1    1e-07   
gb|KFY85329.1|  hypothetical protein V500_08518                       60.1    1e-07   
ref|XP_008030866.1|  hypothetical protein SETTUDRAFT_99605            57.4    1e-07   
ref|XP_006846342.1|  hypothetical protein AMTR_s00012p00258090        57.8    1e-07   
ref|XP_003652233.1|  hypothetical protein THITE_2113488               60.8    1e-07   
ref|XP_010139123.1|  PREDICTED: putative RNA-binding protein 15B      60.8    1e-07   
ref|XP_003877262.1|  putative RNA-binding protein                     60.8    1e-07   
ref|XP_011205146.1|  PREDICTED: protein no-on-transient A-like is...  60.8    1e-07   
ref|XP_011205145.1|  PREDICTED: protein no-on-transient A-like is...  60.8    1e-07   
ref|XP_001466961.1|  putative RNA-binding protein                     60.8    1e-07   
ref|XP_011205148.1|  PREDICTED: protein no-on-transient A-like is...  60.8    1e-07   
ref|XP_003025833.1|  transformer-SR ribonucleoprotein, putative       57.4    1e-07   
gb|EKG05754.1|  RNA-binding protein, putative                         60.8    1e-07   
gb|KIM95076.1|  hypothetical protein OIDMADRAFT_135085                60.1    1e-07   
ref|XP_820235.1|  RNA-binding protein                                 60.8    1e-07   
gb|KFG83369.1|  putative transformer-SR ribonucleoprotein             60.5    1e-07   
dbj|BAB28857.1|  unnamed protein product                              58.9    1e-07   
ref|WP_029151559.1|  RNA-binding protein                              56.6    1e-07   
ref|XP_005954891.1|  PREDICTED: non-POU domain-containing octamer...  60.5    1e-07   
ref|XP_003279199.2|  PREDICTED: LOW QUALITY PROTEIN: paraspeckle ...  60.5    1e-07   
ref|XP_008545018.1|  PREDICTED: protein no-on-transient A-like        60.5    1e-07   
ref|XP_004065438.1|  PREDICTED: LOW QUALITY PROTEIN: non-POU doma...  60.5    2e-07   
ref|XP_007904611.1|  PREDICTED: splicing factor, proline- and glu...  60.5    2e-07   
ref|XP_004639465.1|  PREDICTED: paraspeckle component 1               60.5    2e-07   
ref|XP_003852851.1|  hypothetical protein MYCGRDRAFT_70735            58.5    2e-07   
gb|AAA03215.1|  no-on-transient A product form II                     60.5    2e-07   
ref|NP_001014747.1|  no on or off transient A, isoform C              60.5    2e-07   
gb|KGQ05847.1|  putative RNA-binding protein C25G10.01                60.1    2e-07   
ref|XP_004661000.1|  PREDICTED: non-POU domain-containing octamer...  60.5    2e-07   
ref|XP_004895542.1|  PREDICTED: LOW QUALITY PROTEIN: paraspeckle ...  60.1    2e-07   
gb|KFZ48698.1|  Non-POU domain-containing octamer-binding protein     60.1    2e-07   
ref|NP_727962.1|  no on or off transient A, isoform B                 60.5    2e-07   
ref|XP_006146215.1|  PREDICTED: non-POU domain-containing octamer...  60.1    2e-07   
ref|XP_002590279.1|  hypothetical protein BRAFLDRAFT_216286           60.1    2e-07   
gb|AGD79327.1|  RH34608p1                                             60.5    2e-07   
ref|XP_002055430.1|  nonA                                             60.5    2e-07   
ref|NP_523367.2|  no on or off transient A, isoform A                 60.5    2e-07   
ref|XP_005200723.2|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  60.5    2e-07   
ref|XP_004646871.1|  PREDICTED: non-POU domain-containing octamer...  60.1    2e-07   
gb|AAA03214.1|  no-on-transient A product form I                      60.5    2e-07   
ref|XP_001991499.1|  GH12694                                          60.5    2e-07   
gb|EDL95894.1|  rCG36231, isoform CRA_c                               60.1    2e-07   
emb|CCD78551.1|  putative RNA-binding protein                         60.5    2e-07   



>ref|XP_009787476.1| PREDICTED: flowering time control protein FPA isoform X2 [Nicotiana 
sylvestris]
Length=910

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  288  PESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAK  109
            P  +  +NNLWVGNLTPDVTEA+LTALF+KYG VDS+TSYSAR +AFLYF+++ DAK AK
Sbjct  3    PPGEMPSNNLWVGNLTPDVTEADLTALFQKYGPVDSVTSYSARGFAFLYFKNINDAKEAK  62

Query  108  DALQGTVLRGNPLKIEFAKPV  46
            DALQG+   GNPL+IEFAKP 
Sbjct  63   DALQGSFFHGNPLRIEFAKPA  83



>ref|XP_009787474.1| PREDICTED: flowering time control protein FPA isoform X1 [Nicotiana 
sylvestris]
Length=957

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  288  PESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAK  109
            P  +  +NNLWVGNLTPDVTEA+LTALF+KYG VDS+TSYSAR +AFLYF+++ DAK AK
Sbjct  3    PPGEMPSNNLWVGNLTPDVTEADLTALFQKYGPVDSVTSYSARGFAFLYFKNINDAKEAK  62

Query  108  DALQGTVLRGNPLKIEFAKPV  46
            DALQG+   GNPL+IEFAKP 
Sbjct  63   DALQGSFFHGNPLRIEFAKPA  83



>ref|XP_009589187.1| PREDICTED: flowering time control protein FPA isoform X2 [Nicotiana 
tomentosiformis]
Length=910

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  288  PESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAK  109
            P  +  +NNLWVGNLTPDVTEA+LT LF+KYG VDS+TSYSAR +AFLYF+++ DAK AK
Sbjct  3    PPGEMPSNNLWVGNLTPDVTEADLTGLFQKYGPVDSVTSYSARGFAFLYFKNINDAKEAK  62

Query  108  DALQGTVLRGNPLKIEFAKPV  46
            DALQG+   GNPL+IEFAKP 
Sbjct  63   DALQGSFFHGNPLRIEFAKPA  83



>ref|XP_009589185.1| PREDICTED: flowering time control protein FPA isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009589186.1| PREDICTED: flowering time control protein FPA isoform X1 [Nicotiana 
tomentosiformis]
Length=957

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  288  PESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAK  109
            P  +  +NNLWVGNLTPDVTEA+LT LF+KYG VDS+TSYSAR +AFLYF+++ DAK AK
Sbjct  3    PPGEMPSNNLWVGNLTPDVTEADLTGLFQKYGPVDSVTSYSARGFAFLYFKNINDAKEAK  62

Query  108  DALQGTVLRGNPLKIEFAKPV  46
            DALQG+   GNPL+IEFAKP 
Sbjct  63   DALQGSFFHGNPLRIEFAKPA  83



>gb|KDP43886.1| hypothetical protein JCGZ_20896 [Jatropha curcas]
Length=992

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = -2

Query  318  MVPPFRSS--AKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFL  145
            M PP +SS     ESD  +NNLWVGNL  DVT+A+L  LF KYG +DS+ +YS+RSYAFL
Sbjct  1    MAPPIKSSKVGHDESDPPSNNLWVGNLAADVTDADLMDLFAKYGALDSVNTYSSRSYAFL  60

Query  144  YFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            YF+ +EDA AAKDALQG VLRG+PLKIEFA+P 
Sbjct  61   YFKRVEDAAAAKDALQGAVLRGSPLKIEFARPA  93


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 48/89 (54%), Gaps = 5/89 (6%)
 Frame = -2

Query  306  FRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLE  127
            F   AKP     + NLWVG ++P V++ +L   F K+G+++       R+ AF+ F  LE
Sbjct  89   FARPAKP-----SKNLWVGGISPAVSKEQLEEEFLKFGKIEEFKFLRDRNTAFVEFFKLE  143

Query  126  DAKAAKDALQGTVLRGNPLKIEFAKPVCI  40
            DA  A   + G  + G+ ++++F +   +
Sbjct  144  DALEAMRNMNGKRIGGDQIRVDFLRSQAV  172



>ref|XP_002529477.1| RNA recognition motif-containing protein, putative [Ricinus communis]
 gb|EEF32887.1| RNA recognition motif-containing protein, putative [Ricinus communis]
Length=902

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 75/95 (79%), Gaps = 4/95 (4%)
 Frame = -2

Query  318  MVPPFR-SSAKPESD---TATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYA  151
            M PP + S    ESD     +NNLWVGNL PDVT+++L  LF KYG +DS+T+YS+RSYA
Sbjct  1    MAPPMKFSRVHKESDEPEAPSNNLWVGNLAPDVTDSDLMDLFAKYGALDSVTTYSSRSYA  60

Query  150  FLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            FLYF+ +EDA AAKDALQGT+LRGNP+KIEFA+P 
Sbjct  61   FLYFKHVEDAAAAKDALQGTLLRGNPVKIEFARPA  95


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = -2

Query  306  FRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLE  127
            F   AKP     + NLWVG ++P V++ +L   F K+G+++       R+ AF+ +  LE
Sbjct  91   FARPAKP-----SKNLWVGGISPAVSKEQLEEEFLKFGKIEEFKFLRDRNTAFIEYVKLE  145

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
            DA  A  ++ G  L G+ ++++F +
Sbjct  146  DALEAMRSMNGKRLGGDQIRVDFLR  170



>ref|XP_004240984.1| PREDICTED: flowering time control protein FPA [Solanum lycopersicum]
Length=991

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  288  PESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAK  109
            P  +  +NNLWVGN+ PDVT+A+LT+LF+KYGQ+DS+T+YS+R + FLYF+++ D+K AK
Sbjct  3    PPGEIPSNNLWVGNIAPDVTDADLTSLFQKYGQLDSVTAYSSRGFGFLYFKNINDSKEAK  62

Query  108  DALQGTVLRGNPLKIEFAKPV  46
            DALQG++  GNPL+IEFAKP 
Sbjct  63   DALQGSLFHGNPLRIEFAKPA  83



>ref|XP_006350716.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Solanum tuberosum]
 ref|XP_006350717.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Solanum tuberosum]
Length=994

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  288  PESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAK  109
            P  +  +NNLWVGNL PDVT+A+LT+LF+KYGQ+DS+T+YS+R + FLYF+++ D+K AK
Sbjct  3    PPGEIPSNNLWVGNLAPDVTDADLTSLFQKYGQLDSVTAYSSRGFGFLYFKNINDSKEAK  62

Query  108  DALQGTVLRGNPLKIEFAKPV  46
            DALQG+   GNPL+IEFAKP 
Sbjct  63   DALQGSFFHGNPLRIEFAKPA  83



>ref|XP_007131937.1| hypothetical protein PHAVU_011G053300g [Phaseolus vulgaris]
 gb|ESW03931.1| hypothetical protein PHAVU_011G053300g [Phaseolus vulgaris]
Length=999

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 2/88 (2%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            P R S   ES + +NNLWVGNL PDVT+A+L  LF KYG +DS+TSYSARSYAF++F+ +
Sbjct  7    PMRDSD--ESSSPSNNLWVGNLAPDVTDADLMELFAKYGALDSVTSYSARSYAFVFFKRV  64

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            EDAKAAK+ALQGT LRG+ LKIEFA+P 
Sbjct  65   EDAKAAKNALQGTSLRGSSLKIEFARPA  92



>gb|EPS72608.1| hypothetical protein M569_02152, partial [Genlisea aurea]
Length=161

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -2

Query  264  NLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            NLW+GNL+PDV+E EL AL EKYG+V SITSY++R+YAF+YF S+EDAK+AK+ LQG +L
Sbjct  8    NLWIGNLSPDVSEPELKALLEKYGKVYSITSYASRNYAFVYFNSVEDAKSAKEGLQGHLL  67

Query  84   RGNPLKIEFAKP  49
            RG PLKIEFAKP
Sbjct  68   RGIPLKIEFAKP  79



>ref|XP_010086699.1| Flowering time control protein FPA [Morus notabilis]
 gb|EXB23115.1| Flowering time control protein FPA [Morus notabilis]
Length=996

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 75/95 (79%), Gaps = 4/95 (4%)
 Frame = -2

Query  318  MVPPFRSSAK----PESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYA  151
            M PP  SS +     +S+T +NNLWVGNL  D+T+++L  LF +YG +DS+TSYS+RSYA
Sbjct  1    MAPPAMSSKQQGGGDDSETPSNNLWVGNLAVDITDSDLMDLFAQYGALDSVTSYSSRSYA  60

Query  150  FLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            F++F+ +EDAKAAKDALQGT  RGNPLKIEFA+P 
Sbjct  61   FVFFKRMEDAKAAKDALQGTNFRGNPLKIEFARPA  95



>emb|CDP03488.1| unnamed protein product [Coffea canephora]
Length=964

 Score =   122 bits (306),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A+NNLW+GNL+P+VT++ELTALFEK+G VDSIT+Y++RSY F+Y++ +EDAK+AK+ LQG
Sbjct  20   ASNNLWIGNLSPEVTDSELTALFEKHGPVDSITNYASRSYGFVYYKKIEDAKSAKEKLQG  79

Query  93   TVLRGNPLKIEFAKP  49
            T+L GNP+KIEFAKP
Sbjct  80   TILHGNPIKIEFAKP  94



>ref|XP_011091635.1| PREDICTED: flowering time control protein FPA [Sesamum indicum]
 ref|XP_011091636.1| PREDICTED: flowering time control protein FPA [Sesamum indicum]
Length=966

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 72/102 (71%), Gaps = 11/102 (11%)
 Frame = -2

Query  318  MVPPFRSSAKP-----------ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITS  172
            M PP +S+A P             +  +NNLW+GNL+PDV+  EL ALFEK+G+VDS+ S
Sbjct  1    MAPPVKSAANPILSQGGGAYPPRENPPSNNLWIGNLSPDVSNTELKALFEKHGKVDSVIS  60

Query  171  YSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            Y +R+YAF+YF+ +E A +AK  LQG VLRGNPL+IEFAKP 
Sbjct  61   YPSRNYAFIYFKEIEGADSAKQGLQGHVLRGNPLRIEFAKPA  102



>dbj|BAD95007.1| hypothetical protein [Arabidopsis thaliana]
Length=130

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 79/111 (71%), Gaps = 9/111 (8%)
 Frame = -2

Query  315  VPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFR  136
            + PFR+    +S   +NNLWVG+LTP+ TE++LT LF +YG +D IT YS+R +AF+Y+R
Sbjct  5    MKPFRAD---DSGFQSNNLWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGFAFIYYR  61

Query  135  SLEDAKAAKDALQGTVLRGNPLKIEFAKPVC------IFVSRHCLMMMMMM  1
             +E+A AAK+ALQG  L G+ +KIE+A+PVC      +F +  CL+  +++
Sbjct  62   HVEEAVAAKEALQGANLNGSQIKIEYARPVCSYLYLRLFSNFDCLLSTIIL  112



>ref|XP_006592142.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Glycine max]
 ref|XP_006592143.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Glycine max]
Length=1033

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            ES + +NNLWVGNL  DVT+A+L  LF KYG +DS+TSYSARSYAF++F+ +EDAKAAK+
Sbjct  13   ESASPSNNLWVGNLAADVTDADLMELFAKYGALDSVTSYSARSYAFVFFKRVEDAKAAKN  72

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQGT LRG+ LKIEFA+P 
Sbjct  73   ALQGTSLRGSSLKIEFARPA  92


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A   LWVG ++  VT+ +L A F+K+G+++    +  R+ A + F +LEDA  A   + G
Sbjct  94   ACKQLWVGGISQAVTKEDLEAEFQKFGKIEDFKFFRDRNTACVEFFNLEDATQAMKIMNG  153

Query  93   TVLRGNPLKIEFAK  52
              + G  ++++F +
Sbjct  154  KRIGGEHIRVDFLR  167



>ref|XP_006592144.1| PREDICTED: flowering time control protein FPA-like isoform X3 
[Glycine max]
Length=1023

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            ES + +NNLWVGNL  DVT+A+L  LF KYG +DS+TSYSARSYAF++F+ +EDAKAAK+
Sbjct  13   ESASPSNNLWVGNLAADVTDADLMELFAKYGALDSVTSYSARSYAFVFFKRVEDAKAAKN  72

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQGT LRG+ LKIEFA+P 
Sbjct  73   ALQGTSLRGSSLKIEFARPA  92


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A   LWVG ++  VT+ +L A F+K+G+++    +  R+ A + F +LEDA  A   + G
Sbjct  94   ACKQLWVGGISQAVTKEDLEAEFQKFGKIEDFKFFRDRNTACVEFFNLEDATQAMKIMNG  153

Query  93   TVLRGNPLKIEFAK  52
              + G  ++++F +
Sbjct  154  KRIGGEHIRVDFLR  167



>ref|XP_006590932.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Glycine max]
 ref|XP_006590933.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Glycine max]
 gb|KHN06195.1| Flowering time control protein FPA [Glycine soja]
Length=998

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            ES   +NNLWVGNL  DVT+A+L  LF KYG +DS+TSYSARSYAF++F+ +EDAKAAK+
Sbjct  13   ESAPPSNNLWVGNLAADVTDADLMELFAKYGALDSVTSYSARSYAFVFFKRVEDAKAAKN  72

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQGT LRG+ LKIEFA+P 
Sbjct  73   ALQGTSLRGSSLKIEFARPA  92



>ref|XP_008369175.1| PREDICTED: flowering time control protein FPA [Malus domestica]
Length=993

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            +S+T +NNLWVGNL  DVT+A+L  LF ++G +DS+TSYS+RSYAF++F+ +EDA AAK+
Sbjct  14   DSETPSNNLWVGNLASDVTDADLMDLFAQFGALDSVTSYSSRSYAFVFFKRVEDAAAAKE  73

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQG +LRGNP+KIEFA+P 
Sbjct  74   ALQGALLRGNPVKIEFARPA  93



>ref|XP_004507346.1| PREDICTED: flowering time control protein FPA-like [Cicer arietinum]
Length=1014

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            ES T +NNLWVGNL+PDVT+++L  LF +YG +DS+TSYSARSYAF++F+ +EDAKAAK+
Sbjct  20   ESSTPSNNLWVGNLSPDVTDSDLMNLFAQYGALDSVTSYSARSYAFVFFKRVEDAKAAKN  79

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQ    RGN LKIEFA+P 
Sbjct  80   ALQAFSFRGNSLKIEFARPA  99


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -2

Query  261  LWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVLR  82
            LWVG ++P VT+ +L A F K+G+++    +  R+ A + F +L+DA  A   + G  + 
Sbjct  105  LWVGGISPAVTKEDLEADFRKFGKIEDYKFFRDRNTACVEFFNLDDATQAMKIMNGKRIG  164

Query  81   GNPLKIEFAK  52
            G  ++++F +
Sbjct  165  GENIRVDFLR  174



>ref|XP_009350523.1| PREDICTED: flowering time control protein FPA-like [Pyrus x bretschneideri]
 ref|XP_009350524.1| PREDICTED: flowering time control protein FPA-like [Pyrus x bretschneideri]
 ref|XP_009350525.1| PREDICTED: flowering time control protein FPA-like [Pyrus x bretschneideri]
Length=991

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 75/93 (81%), Gaps = 2/93 (2%)
 Frame = -2

Query  318  MVPPFRSS--AKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFL  145
            M PP + +  A  +S+T +NNLWVGNL  DVT+A+L  LF ++G +DS+T+YS+RSYAF+
Sbjct  1    MAPPTKPNNLATDDSETPSNNLWVGNLASDVTDADLMDLFAQFGALDSVTTYSSRSYAFV  60

Query  144  YFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            +F+ +ED+ AAK+ALQG +LRGNP+KIEFA+P 
Sbjct  61   FFKRVEDSAAAKEALQGALLRGNPVKIEFARPA  93


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = -2

Query  264  NLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            NLWVG ++P V++ EL   F K+G+++       R+ AF+ +  LEDA  A   + G  L
Sbjct  98   NLWVGGISPSVSKEELEEEFCKFGKMEDFKFLRDRNTAFVEYFKLEDASQAMRNMNGKRL  157

Query  84   RGNPLKIEFAK  52
             G+ +++++ +
Sbjct  158  GGDHIRVDYLR  168



>ref|XP_010268270.1| PREDICTED: flowering time control protein FPA-like [Nelumbo nucifera]
 ref|XP_010268272.1| PREDICTED: flowering time control protein FPA-like [Nelumbo nucifera]
 ref|XP_010268273.1| PREDICTED: flowering time control protein FPA-like [Nelumbo nucifera]
 ref|XP_010268274.1| PREDICTED: flowering time control protein FPA-like [Nelumbo nucifera]
 ref|XP_010268275.1| PREDICTED: flowering time control protein FPA-like [Nelumbo nucifera]
Length=1005

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            E +T ++NLWVGNL+ D T+ EL  +F KYG +DS+T+Y++R+YAF+YF+ LEDAK+AKD
Sbjct  26   EEETPSHNLWVGNLSNDTTDTELMDVFTKYGALDSVTTYASRNYAFVYFKRLEDAKSAKD  85

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQG ++RGNP+KIEFA+P 
Sbjct  86   ALQGFIVRGNPIKIEFARPA  105



>ref|XP_009341170.1| PREDICTED: flowering time control protein FPA [Pyrus x bretschneideri]
 ref|XP_009341171.1| PREDICTED: flowering time control protein FPA [Pyrus x bretschneideri]
Length=994

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            +S+T +NNLWVGNL  DVT+ +L  LF ++G +DS+TSYS+RSYAF++F+ +EDA AAK+
Sbjct  14   DSETPSNNLWVGNLASDVTDGDLMDLFAQFGALDSVTSYSSRSYAFVFFKRVEDAAAAKE  73

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQG +LRGNP+KIEFA+P 
Sbjct  74   ALQGALLRGNPVKIEFARPA  93


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = -2

Query  264  NLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            NLWVG ++P V++ EL   F K+G+++       R+ AF+ +  LEDA  A   + G  L
Sbjct  98   NLWVGGISPSVSKEELEEEFCKFGKMEDFKFLRDRNTAFVEYFKLEDASQAMRNMNGKRL  157

Query  84   RGNPLKIEFAK  52
             G+ +++++ +
Sbjct  158  GGDQIRVDYLR  168



>ref|XP_007225369.1| hypothetical protein PRUPE_ppa000835mg [Prunus persica]
 gb|EMJ26568.1| hypothetical protein PRUPE_ppa000835mg [Prunus persica]
Length=986

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            +S+T +NNLWVGNL  DVT++EL  LF +YG +DS+T+YS+RSY F++F+ +ED+ AAK+
Sbjct  14   DSETPSNNLWVGNLASDVTDSELMDLFAQYGALDSVTTYSSRSYGFVFFKRVEDSAAAKE  73

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            +LQG +LRGNP+KIEFA+P 
Sbjct  74   SLQGALLRGNPIKIEFARPA  93



>ref|XP_008222429.1| PREDICTED: flowering time control protein FPA [Prunus mume]
 ref|XP_008222430.1| PREDICTED: flowering time control protein FPA [Prunus mume]
Length=989

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            +S+T +NNLWVGNL  DVT++EL  LF +YG +DS+T+YS+RSY F++F+ +ED+ AAK+
Sbjct  14   DSETPSNNLWVGNLASDVTDSELMDLFAQYGALDSVTTYSSRSYGFVFFKRVEDSAAAKE  73

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            +LQG +LRGNP+KIEFA+P 
Sbjct  74   SLQGALLRGNPIKIEFARPA  93



>ref|XP_011007413.1| PREDICTED: flowering time control protein FPA-like [Populus euphratica]
 ref|XP_011007414.1| PREDICTED: flowering time control protein FPA-like [Populus euphratica]
Length=924

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            +NNLWVGN++ DVTE++L  LF +YG +D++T+Y+ARSY F+YF+  EDAK AKDALQGT
Sbjct  29   SNNLWVGNISRDVTESDLMKLFAQYGAIDNVTTYTARSYGFVYFKRAEDAKQAKDALQGT  88

Query  90   VLRGNPLKIEFAKPVCIFVSRH  25
             LRGN +KIEFA+P     SRH
Sbjct  89   SLRGNQIKIEFARPAK--PSRH  108



>emb|CDY17927.1| BnaC04g02920D [Brassica napus]
Length=1914

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 85/140 (61%), Gaps = 16/140 (11%)
 Frame = -2

Query  375   FFLVQPNTEQPFMQSRVSTMVPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKY  196
             F L  P    P + +  + M  PFR     +S   +NNLWVG++T D TE++LT LF ++
Sbjct  952   FSLASPIQPIPHLCAMAAAM-KPFRGRESDDSGFTSNNLWVGSITMDTTESDLTELFGRF  1010

Query  195   GQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPVC---------  43
             G +D IT+YS+R +AF+Y+R +E+A AAK+ALQGT L G  LKI++A+PVC         
Sbjct  1011  GDIDRITAYSSRGFAFIYYRHVEEAVAAKEALQGTNLNGGLLKIQYARPVCSNLLDSLEL  1070

Query  42    ------IFVSRHCLMMMMMM  1
                   +FV   CL+ M+ +
Sbjct  1071  SSNNIRLFVDFDCLVSMITL  1090



>ref|XP_002309788.2| hypothetical protein POPTR_0007s01730g [Populus trichocarpa]
 gb|EEE90238.2| hypothetical protein POPTR_0007s01730g [Populus trichocarpa]
Length=829

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            +NNLWVGN++ DVTE++L  LF +YG +D++T+Y+ARSY F+YF+ +EDAK AKDALQGT
Sbjct  29   SNNLWVGNISRDVTESDLMKLFAQYGSIDNVTTYTARSYGFVYFKRVEDAKQAKDALQGT  88

Query  90   VLRGNPLKIEFAKPVCIFVSRH  25
             LRGN + IEFA+P     SRH
Sbjct  89   SLRGNQIIIEFARPAK--PSRH  108



>gb|KDO42852.1| hypothetical protein CISIN_1g002168mg [Citrus sinensis]
Length=957

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 70/94 (74%), Gaps = 3/94 (3%)
 Frame = -2

Query  318  MVPP---FRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAF  148
            M PP   F  +   +    ++NLWVGNL+ D T+A+L  LF K+G +D +T+YS+RS+AF
Sbjct  1    MAPPPSKFNRAYDDKEAPPSSNLWVGNLSADTTDADLKELFGKFGALDKVTTYSSRSFAF  60

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            +YF+ +EDAKAAKDALQG+  RGNP+KIEFA+P 
Sbjct  61   VYFKRVEDAKAAKDALQGSDFRGNPIKIEFARPA  94



>ref|XP_006442983.1| hypothetical protein CICLE_v10018733mg [Citrus clementina]
 ref|XP_006442984.1| hypothetical protein CICLE_v10018733mg [Citrus clementina]
 ref|XP_006478736.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Citrus sinensis]
 ref|XP_006478737.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Citrus sinensis]
 gb|ESR56223.1| hypothetical protein CICLE_v10018733mg [Citrus clementina]
 gb|ESR56224.1| hypothetical protein CICLE_v10018733mg [Citrus clementina]
Length=957

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 70/94 (74%), Gaps = 3/94 (3%)
 Frame = -2

Query  318  MVPP---FRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAF  148
            M PP   F  +   +    ++NLWVGNL+ D T+A+L  LF K+G +D +T+YS+RS+AF
Sbjct  1    MAPPPSKFNRAYDDKEAPPSSNLWVGNLSADTTDADLKELFGKFGALDKVTTYSSRSFAF  60

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            +YF+ +EDAKAAKDALQG+  RGNP+KIEFA+P 
Sbjct  61   VYFKRVEDAKAAKDALQGSDFRGNPIKIEFARPA  94



>gb|KDO42853.1| hypothetical protein CISIN_1g002168mg [Citrus sinensis]
Length=954

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 70/94 (74%), Gaps = 3/94 (3%)
 Frame = -2

Query  318  MVPP---FRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAF  148
            M PP   F  +   +    ++NLWVGNL+ D T+A+L  LF K+G +D +T+YS+RS+AF
Sbjct  1    MAPPPSKFNRAYDDKEAPPSSNLWVGNLSADTTDADLKELFGKFGALDKVTTYSSRSFAF  60

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            +YF+ +EDAKAAKDALQG+  RGNP+KIEFA+P 
Sbjct  61   VYFKRVEDAKAAKDALQGSDFRGNPIKIEFARPA  94



>ref|XP_007033897.1| RNA recognition motif-containing protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY04823.1| RNA recognition motif-containing protein, putative isoform 2 
[Theobroma cacao]
Length=946

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 69/95 (73%), Gaps = 4/95 (4%)
 Frame = -2

Query  318  MVPPFRSSA-KPESD---TATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYA  151
            MVPP +      ESD   T +NNLWVGNL+ +  +++L  LF KYG +DS+T+YS RSYA
Sbjct  1    MVPPMKQHKLGKESDELETPSNNLWVGNLSGETVDSDLMELFNKYGPLDSVTTYSLRSYA  60

Query  150  FLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            F++F  +EDAKAAKDALQG  L GN +KIEFA+P 
Sbjct  61   FVFFERVEDAKAAKDALQGATLHGNQIKIEFARPA  95



>ref|XP_007033896.1| RNA recognition motif-containing protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY04822.1| RNA recognition motif-containing protein, putative isoform 1 
[Theobroma cacao]
Length=970

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 69/95 (73%), Gaps = 4/95 (4%)
 Frame = -2

Query  318  MVPPFRSSA-KPESD---TATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYA  151
            MVPP +      ESD   T +NNLWVGNL+ +  +++L  LF KYG +DS+T+YS RSYA
Sbjct  1    MVPPMKQHKLGKESDELETPSNNLWVGNLSGETVDSDLMELFNKYGPLDSVTTYSLRSYA  60

Query  150  FLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            F++F  +EDAKAAKDALQG  L GN +KIEFA+P 
Sbjct  61   FVFFERVEDAKAAKDALQGATLHGNQIKIEFARPA  95



>ref|XP_010672253.1| PREDICTED: flowering time control protein FPA [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010672254.1| PREDICTED: flowering time control protein FPA [Beta vulgaris 
subsp. vulgaris]
Length=992

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  315  VPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFR  136
            + P +    P  +T +++LWVGNL PDVTE+ELT LF+K+G +D IT Y++RSYAF+Y++
Sbjct  3    IKPKKQGYGPVMETLSSHLWVGNLPPDVTESELTELFDKHGLLDGITCYASRSYAFVYYK  62

Query  135  SLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
             +EDA +AK ALQG ++ G+P+KIEFAKP 
Sbjct  63   RVEDAASAKTALQGFLINGSPIKIEFAKPA  92


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -2

Query  261  LWVGNLTPDVTEAE-LTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LWVG     V + E L      YG+++ I  + +R+Y+F+ FRS+E+AK AKD+LQG + 
Sbjct  234  LWVGYPPSVVIDEEMLHNAMILYGEIERIKCFPSRNYSFVEFRSVEEAKHAKDSLQGRLF  293

Query  84   RGNPLKIEFA  55
                + I F+
Sbjct  294  NDPRVSIMFS  303



>ref|XP_010258515.1| PREDICTED: flowering time control protein FPA [Nelumbo nucifera]
 ref|XP_010258516.1| PREDICTED: flowering time control protein FPA [Nelumbo nucifera]
 ref|XP_010258517.1| PREDICTED: flowering time control protein FPA [Nelumbo nucifera]
Length=1038

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            E +T ++NLWVGNL+ D T+ +L  +F KYG  +S+ +YS+R+YAF+YF+ LEDAK+AK+
Sbjct  27   EEETPSHNLWVGNLSNDTTDTDLMDVFSKYGDFESVATYSSRNYAFVYFKRLEDAKSAKE  86

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQG ++RGNP+KIEFA+P 
Sbjct  87   ALQGFIVRGNPIKIEFARPA  106



>ref|XP_011037125.1| PREDICTED: flowering time control protein FPA [Populus euphratica]
 ref|XP_011037126.1| PREDICTED: flowering time control protein FPA [Populus euphratica]
 ref|XP_011037127.1| PREDICTED: flowering time control protein FPA [Populus euphratica]
 ref|XP_011037128.1| PREDICTED: flowering time control protein FPA [Populus euphratica]
 ref|XP_011037129.1| PREDICTED: flowering time control protein FPA [Populus euphratica]
Length=930

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            +NNLWVGN++ +V +++L  LF ++G +DS+T+YSARSYAF+YF+ +EDAK AKDALQG+
Sbjct  29   SNNLWVGNISREVADSDLMELFAQFGALDSVTTYSARSYAFVYFKHVEDAKQAKDALQGS  88

Query  90   VLRGNPLKIEFAKPV  46
             LRGN +KIEFA+P 
Sbjct  89   SLRGNQIKIEFARPA  103



>ref|XP_006397509.1| hypothetical protein EUTSA_v10001307mg [Eutrema salsugineum]
 gb|ESQ38962.1| hypothetical protein EUTSA_v10001307mg [Eutrema salsugineum]
Length=860

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = -2

Query  327  VSTMVPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAF  148
            ++T + PFRS    ES   +NNLWVG+LT D TE++LT LF ++G +D IT+YS+R +AF
Sbjct  1    MATAMKPFRSREADESGFKSNNLWVGSLTMDTTESDLTELFGRFGDIDRITAYSSRGFAF  60

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            +Y+R +E+A AAK+ALQG  L G+ +KIE+A+P 
Sbjct  61   IYYRHVEEAVAAKEALQGANLNGSQIKIEYARPA  94



>ref|XP_003606822.1| Flowering time control protein FPA [Medicago truncatula]
 gb|AES89019.1| flowering time control FPA-like protein [Medicago truncatula]
Length=973

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            +S T +NNL+V NL+PDVT+++L  LF +YG +DS+TSYSAR+YAF++F+ ++DAKAAK+
Sbjct  21   DSSTPSNNLYVANLSPDVTDSDLMDLFVQYGALDSVTSYSARNYAFVFFKRIDDAKAAKN  80

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQG   RGN L+IEFA+P 
Sbjct  81   ALQGFNFRGNSLRIEFARPA  100


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -2

Query  261  LWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVLR  82
            LWVG ++P VT+ +L A F K+G+V+    +  R+ A + F +L+DA  A   + G  + 
Sbjct  106  LWVGGISPAVTKEDLEADFRKFGKVEDFKFFRDRNTACVEFFNLDDAIQAMKIMNGKHIG  165

Query  81   GNPLKIEFAK  52
            G  ++++F +
Sbjct  166  GENIRVDFLR  175



>ref|XP_011011513.1| PREDICTED: flowering time control protein FPA-like [Populus euphratica]
 ref|XP_011011516.1| PREDICTED: flowering time control protein FPA-like [Populus euphratica]
 ref|XP_011011517.1| PREDICTED: flowering time control protein FPA-like [Populus euphratica]
Length=925

 Score =   107 bits (266),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 47/74 (64%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            +NNLWVGN++ DV E++L  LF +YG +D++T+Y+ARSY F+YF+  EDAK AKDALQGT
Sbjct  29   SNNLWVGNISRDVIESDLMKLFAQYGAIDNVTTYTARSYGFVYFKRAEDAKQAKDALQGT  88

Query  90   VLRGNPLKIEFAKP  49
             LRGN +KIEFA+P
Sbjct  89   SLRGNQIKIEFARP  102



>gb|KHN33296.1| Flowering time control protein FPA [Glycine soja]
Length=497

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = -2

Query  318  MVPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYF  139
            M PP +S    E  T TNNLWVGNL  +VT+++L  LF  YG +DS+ SYS+R++AF+ F
Sbjct  1    MPPPSKSVEGEEWGTPTNNLWVGNLPTEVTDSDLMELFAPYGSLDSLISYSSRTFAFVLF  60

Query  138  RSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            R +EDAKAAK  LQG +LRG  ++IEFA+P 
Sbjct  61   RRIEDAKAAKSNLQGALLRGFQIRIEFARPA  91



>gb|EYU41080.1| hypothetical protein MIMGU_mgv1a000924mg [Erythranthe guttata]
Length=941

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 69/102 (68%), Gaps = 11/102 (11%)
 Frame = -2

Query  318  MVPPFRSSAKPESDTA-----------TNNLWVGNLTPDVTEAELTALFEKYGQVDSITS  172
            M PP RS++ P                +NNLW+GN+  +V++AEL AL E +G+VDS+T+
Sbjct  1    MAPPIRSASNPTQGHGFAADPPGQHPPSNNLWIGNVAAEVSDAELKALLEMHGRVDSVTT  60

Query  171  YSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            Y +R+YAF+YF  ++ AK+AK  LQG +LRG+ LKIEFAKP 
Sbjct  61   YPSRNYAFVYFTEVDGAKSAKQGLQGHILRGHALKIEFAKPA  102



>gb|KFK35180.1| hypothetical protein AALP_AA5G250300 [Arabis alpina]
Length=901

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            P R   +  S   +NNLWVG+LT D TE++LT LF +YG++D IT+YS+RS+AF+Y+R +
Sbjct  7    PSRGREQDGSGFQSNNLWVGSLTTDTTESDLTDLFGRYGEIDRITAYSSRSFAFIYYRRV  66

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            E+A AAK+ALQG  L G+ +KIEFA+P 
Sbjct  67   EEAVAAKEALQGVDLNGSQIKIEFARPA  94



>ref|XP_006597219.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Glycine max]
 ref|XP_006597220.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Glycine max]
Length=942

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = -2

Query  318  MVPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYF  139
            M PP +S    E  T TNNLWVGNL  +VT+++L  LF  YG +DS+ SYS+R++AF+ F
Sbjct  1    MPPPSKSVEGEEWGTPTNNLWVGNLPTEVTDSDLMELFAPYGSLDSLISYSSRTFAFVLF  60

Query  138  RSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            R +EDAKAAK  LQG +LRG  ++IEFA+P 
Sbjct  61   RRIEDAKAAKSNLQGALLRGFQIRIEFARPA  91



>emb|CDX79825.1| BnaA05g03310D [Brassica napus]
Length=949

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            PFR     +S   +NNLWVG++T D TE++LT LF ++G +D IT+YS+R +AF+Y+R +
Sbjct  7    PFRGRESDDSGFTSNNLWVGSITMDTTESDLTELFGRFGDIDRITAYSSRGFAFIYYRHV  66

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAKPVCIFVS  31
            E+A AAK+ALQGT L G  LKI++A+P+   VS
Sbjct  67   EEAVAAKEALQGTNLNGGLLKIQYARPMGGDVS  99



>ref|XP_004145033.1| PREDICTED: flowering time control protein FPA-like [Cucumis sativus]
Length=999

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = -2

Query  312  PPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRS  133
            P  R S  PE    +N+LWVGNL+ +VT+ +L  LF ++G +DS+TSY +RSYAF++F+ 
Sbjct  10   PLHRDSDVPE--MPSNSLWVGNLSMEVTDGDLMNLFAQFGGIDSVTSYPSRSYAFIFFKH  67

Query  132  LEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            +EDA+AAK+ALQG  LRGN +KIEFA+P 
Sbjct  68   MEDAQAAKEALQGYFLRGNSIKIEFARPA  96


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -2

Query  264  NLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            NLWVG ++P V+  +L   F K+G++D       R+ AF+ +  LEDA  A   + G  +
Sbjct  101  NLWVGGISPAVSREQLEEEFSKFGKIDEFKFLRDRNTAFVEYVRLEDASQALRMMNGKRI  160

Query  84   RGNPLKIEFAK  52
             G  L+++F +
Sbjct  161  GGEQLRVDFLR  171



>ref|XP_004153439.1| PREDICTED: flowering time control protein FPA-like [Cucumis sativus]
 gb|KGN46306.1| hypothetical protein Csa_6G081470 [Cucumis sativus]
Length=1000

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = -2

Query  312  PPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRS  133
            P  R S  PE    +N+LWVGNL+ +VT+ +L  LF ++G +DS+TSY +RSYAF++F+ 
Sbjct  10   PLHRDSDVPE--MPSNSLWVGNLSMEVTDGDLMNLFAQFGGIDSVTSYPSRSYAFIFFKH  67

Query  132  LEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            +EDA+AAK+ALQG  LRGN +KIEFA+P 
Sbjct  68   MEDAQAAKEALQGYFLRGNSIKIEFARPA  96


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -2

Query  264  NLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            NLWVG ++P V+  +L   F K+G++D       R+ AF+ +  LEDA  A   + G  +
Sbjct  101  NLWVGGISPAVSREQLEEEFSKFGKIDEFKFLRDRNTAFVEYVRLEDASQALRMMNGKRI  160

Query  84   RGNPLKIEFAK  52
             G  L+++F +
Sbjct  161  GGEQLRVDFLR  171



>ref|XP_009142931.1| PREDICTED: flowering time control protein FPA [Brassica rapa]
Length=835

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            PFR     +S   +NNLWVG++T D TE++LT LF ++G +D IT+YS+R +AF+Y+R +
Sbjct  7    PFRGRESDDSGFTSNNLWVGSITMDTTESDLTELFGRFGDIDRITAYSSRGFAFIYYRHV  66

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            E+A AAK+ALQGT L G  LKI++A+P 
Sbjct  67   EEAVAAKEALQGTNLNGGLLKIQYARPA  94



>ref|NP_181869.2| Flowering time control protein FPA [Arabidopsis thaliana]
 gb|AEC10262.1| Flowering time control protein FPA [Arabidopsis thaliana]
Length=858

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            PFR+    +S   +NNLWVG+LTP+ TE++LT LF +YG +D IT YS+R +AF+Y+R +
Sbjct  7    PFRAD---DSGFQSNNLWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGFAFIYYRHV  63

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            E+A AAK+ALQG  L G+ +KIE+A+P 
Sbjct  64   EEAVAAKEALQGANLNGSQIKIEYARPA  91



>gb|AAM19833.1| At2g43410/T1O24.15 [Arabidopsis thaliana]
 gb|AAO23594.1| At2g43410/T1O24.15 [Arabidopsis thaliana]
Length=901

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            PFR+    +S   +NNLWVG+LTP+ TE++LT LF +YG +D IT YS+R +AF+Y+R +
Sbjct  7    PFRAD---DSGFQSNNLWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGFAFIYYRHV  63

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            E+A AAK+ALQG  L G+ +KIE+A+P 
Sbjct  64   EEAVAAKEALQGANLNGSQIKIEYARPA  91



>ref|NP_001078046.1| Flowering time control protein FPA [Arabidopsis thaliana]
 ref|NP_001078047.1| Flowering time control protein FPA [Arabidopsis thaliana]
 ref|NP_001078048.1| Flowering time control protein FPA [Arabidopsis thaliana]
 sp|Q8LPQ9.2|FPA_ARATH RecName: Full=Flowering time control protein FPA [Arabidopsis 
thaliana]
 gb|AEC10263.1| Flowering time control protein FPA [Arabidopsis thaliana]
 gb|AEC10264.1| Flowering time control protein FPA [Arabidopsis thaliana]
 gb|AEC10265.1| Flowering time control protein FPA [Arabidopsis thaliana]
Length=901

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            PFR+    +S   +NNLWVG+LTP+ TE++LT LF +YG +D IT YS+R +AF+Y+R +
Sbjct  7    PFRAD---DSGFQSNNLWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGFAFIYYRHV  63

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            E+A AAK+ALQG  L G+ +KIE+A+P 
Sbjct  64   EEAVAAKEALQGANLNGSQIKIEYARPA  91



>ref|XP_002881902.1| hypothetical protein ARALYDRAFT_483451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58161.1| hypothetical protein ARALYDRAFT_483451 [Arabidopsis lyrata subsp. 
lyrata]
Length=902

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            PFR+    +S   +NNLWVG+LTP+ TE++LT LF +YG +D IT YS+R +AF+Y+R +
Sbjct  7    PFRAD---DSGFQSNNLWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGFAFIYYRRV  63

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            E+A AAK+ALQG  L G+ +KIE+A+P 
Sbjct  64   EEAVAAKEALQGANLNGSQIKIEYARPA  91



>dbj|BAH19726.1| AT2G43410 [Arabidopsis thaliana]
Length=901

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            PFR+    +S   +NNLWVG+LTP+ TE++LT LF +YG +D IT YS+R +AF+Y+R +
Sbjct  7    PFRAD---DSGFQSNNLWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGFAFIYYRHV  63

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            E+A AAK+ALQG  L G+ +KIE+A+P 
Sbjct  64   EEAVAAKEALQGANLNGSQIKIEYARPA  91



>gb|KFK37173.1| flowering time control protein fpa [Arabis alpina]
Length=869

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            ES   +NNLWVG+LT D TE++LT LF +YG VD IT+YS RS+AF+Y+R +E+A AAK+
Sbjct  7    ESGIPSNNLWVGSLTTDTTESDLTELFGRYGDVDRITAYSTRSFAFIYYRRVEEAVAAKE  66

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQG  L G+ +KI++A+P 
Sbjct  67   ALQGANLNGSEIKIQYARPA  86



>ref|XP_010527796.1| PREDICTED: flowering time control protein FPA-like [Tarenaya 
hassleriana]
Length=920

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            P RS  + +S   +NNLWVG+L+ D TE++L  LF ++G VD IT+YS+R +AF+YFR +
Sbjct  7    PTRSREQDDSSFKSNNLWVGSLSTDTTESDLAELFGRFGDVDRITAYSSRCFAFIYFRRV  66

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            E+A AAK+ALQGT L G+ +KIE+A+P 
Sbjct  67   EEAVAAKEALQGTSLNGSQIKIEYARPA  94



>gb|AHZ89702.1| flowering time control protein FPA2 [Dimocarpus longan]
 gb|AHZ89703.1| flowering time control protein FPA-2 [Dimocarpus longan]
Length=979

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            E    +NNLWVGNL P+ ++++L  LF + G +DS+ +YS+RS+AF+YF+ ++DAKAAK+
Sbjct  14   ERAAPSNNLWVGNLRPETSDSDLMQLFVRDGALDSVATYSSRSFAFVYFKRVDDAKAAKE  73

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQGT L G P+KIEFA+P 
Sbjct  74   ALQGTPLHGTPIKIEFARPA  93



>ref|XP_008460035.1| PREDICTED: flowering time control protein FPA [Cucumis melo]
Length=1011

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = -2

Query  312  PPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRS  133
            P  R S  PE    +N+LWVGNL+ +VT+ +L  LF ++G +DS+TSY +RSYAF++F+ 
Sbjct  10   PLHRDSDVPE--MPSNSLWVGNLSMEVTDGDLMNLFAQFGVIDSVTSYPSRSYAFIFFKH  67

Query  132  LEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            +EDA+AAK+ALQG  LRGN +KIEFA+P 
Sbjct  68   MEDAQAAKEALQGFFLRGNSIKIEFARPA  96


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -2

Query  264  NLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            NLWVG ++P V+  +L   F K+G++D       R+ AF+ +  LEDA  A   + G  +
Sbjct  101  NLWVGGISPAVSREQLEEEFSKFGKIDEFKFLRDRNTAFVEYVRLEDASQALRMMNGKRI  160

Query  84   RGNPLKIEFAK  52
             G  L+++F +
Sbjct  161  GGEQLRVDFLR  171



>gb|KHF99673.1| Flowering time control FPA -like protein [Gossypium arboreum]
Length=965

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -2

Query  282  SDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDA  103
            SDT ++NLWVGNL+ +  +++L  LF K+G++DS+ +YS+RS+AF++F+ +EDAKAAK+A
Sbjct  17   SDTPSSNLWVGNLSGETVDSDLMDLFGKFGELDSVATYSSRSFAFVFFKRVEDAKAAKEA  76

Query  102  LQGTVLRGNPLKIEFAKPV  46
            L+G  L GN +KIEFA+P 
Sbjct  77   LRGATLHGNQIKIEFARPA  95


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = -2

Query  270  TNNLWVGNLTPDVT--EAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQ  97
            TN LWVG   P V   E  L      +G++++I S+ +R YAF+ FRS+E+A+ AK+ LQ
Sbjct  219  TNVLWVG-YPPSVQIDEQMLHNAMILFGEIENIKSFPSRHYAFVEFRSVEEARRAKEGLQ  277

Query  96   GTVLRGNPLKIEFA  55
            G +     + I F+
Sbjct  278  GRLFNDPRITIMFS  291



>ref|XP_007150444.1| hypothetical protein PHAVU_005G154000g [Phaseolus vulgaris]
 ref|XP_007150445.1| hypothetical protein PHAVU_005G154000g [Phaseolus vulgaris]
 gb|ESW22438.1| hypothetical protein PHAVU_005G154000g [Phaseolus vulgaris]
 gb|ESW22439.1| hypothetical protein PHAVU_005G154000g [Phaseolus vulgaris]
Length=948

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = -2

Query  318  MVPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYF  139
            M PP +S    +  T TNNLWVGNL P+VT+++L  LF  YG +D++ SYS R++AFL F
Sbjct  1    MPPPTKSLESEDWGTPTNNLWVGNLPPEVTDSDLMELFAPYGSLDTLVSYSPRTFAFLLF  60

Query  138  RSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
              +EDAKAAK  LQG +LRG  ++IEFA P 
Sbjct  61   GRVEDAKAAKTNLQGALLRGFQIRIEFAVPA  91



>ref|XP_006293654.1| hypothetical protein CARUB_v10022611mg [Capsella rubella]
 gb|EOA26552.1| hypothetical protein CARUB_v10022611mg [Capsella rubella]
Length=887

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            PFR+    +S   +NNLWVG+LT + TE++LT LF +YG +D IT+YS+R +AF+Y+R +
Sbjct  7    PFRAD---DSGFKSNNLWVGSLTMETTESDLTELFGRYGDIDRITAYSSRGFAFIYYRHV  63

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            E+A AAK+ALQG  L G+ +KIE+A+P 
Sbjct  64   EEAVAAKEALQGANLNGSQIKIEYARPA  91



>ref|XP_006595068.1| PREDICTED: flowering time control protein FPA-like isoform X3 
[Glycine max]
Length=908

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = -2

Query  318  MVPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYF  139
            M PP +     E  + TNNLWVGNL P+V ++ L  LF  YG +DS+ SYS+R++AF+ F
Sbjct  1    MPPPSKFVEGEELGSPTNNLWVGNLPPEVIDSNLMELFAPYGSLDSLISYSSRTFAFVLF  60

Query  138  RSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            R +EDAKAAK  LQG  LRG  ++IEFA+P 
Sbjct  61   RRVEDAKAAKSNLQGAWLRGFQIRIEFARPA  91



>ref|XP_010526143.1| PREDICTED: flowering time control protein FPA-like [Tarenaya 
hassleriana]
 ref|XP_010526151.1| PREDICTED: flowering time control protein FPA-like [Tarenaya 
hassleriana]
 ref|XP_010526159.1| PREDICTED: flowering time control protein FPA-like [Tarenaya 
hassleriana]
 ref|XP_010526168.1| PREDICTED: flowering time control protein FPA-like [Tarenaya 
hassleriana]
 ref|XP_010526176.1| PREDICTED: flowering time control protein FPA-like [Tarenaya 
hassleriana]
Length=921

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -2

Query  306  FRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLE  127
             R+  + +S   +NNLWVG+L+ D TE++L  LF ++G +D IT+YS+RS+AF+YFR +E
Sbjct  8    IRAREQVDSTFTSNNLWVGSLSTDTTESDLAELFGRFGDLDRITAYSSRSFAFIYFRRVE  67

Query  126  DAKAAKDALQGTVLRGNPLKIEFAKPV  46
            DA AAK+ LQGT L G+ +KIE+A+P 
Sbjct  68   DAVAAKETLQGTNLNGSQIKIEYARPA  94



>ref|XP_006595066.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Glycine max]
 ref|XP_006595067.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Glycine max]
Length=944

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = -2

Query  318  MVPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYF  139
            M PP +     E  + TNNLWVGNL P+V ++ L  LF  YG +DS+ SYS+R++AF+ F
Sbjct  1    MPPPSKFVEGEELGSPTNNLWVGNLPPEVIDSNLMELFAPYGSLDSLISYSSRTFAFVLF  60

Query  138  RSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            R +EDAKAAK  LQG  LRG  ++IEFA+P 
Sbjct  61   RRVEDAKAAKSNLQGAWLRGFQIRIEFARPA  91



>gb|KHN30092.1| Flowering time control protein FPA [Glycine soja]
Length=944

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = -2

Query  318  MVPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYF  139
            M PP +     E  + TNNLWVGNL P+V ++ L  LF  YG +DS+ SYS+R++AF+ F
Sbjct  1    MPPPSKFVEGEELGSPTNNLWVGNLPPEVIDSNLMELFAPYGSLDSLISYSSRTFAFVLF  60

Query  138  RSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            R +EDAKAAK  LQG  LRG  ++IEFA+P 
Sbjct  61   RRVEDAKAAKSNLQGAWLRGFQIRIEFARPA  91



>emb|CDX71900.1| BnaC08g29740D [Brassica napus]
Length=788

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 68/94 (72%), Gaps = 3/94 (3%)
 Frame = -2

Query  318  MVPPFRSSAKPESDTA---TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAF  148
            M P  + S   E D +   + NLWVG+LTPD TE++L  LF ++G++D +T+YS+R +AF
Sbjct  1    MAPVMKPSRGREPDGSGFQSTNLWVGSLTPDTTESDLADLFGRFGEIDRLTAYSSRCFAF  60

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            +Y+R +E+A AAK+ALQG  L G+ +KIEFA+P 
Sbjct  61   IYYRRVEEAVAAKEALQGANLNGSRIKIEFARPA  94



>ref|XP_010508436.1| PREDICTED: flowering time control protein FPA-like [Camelina 
sativa]
 ref|XP_010508437.1| PREDICTED: flowering time control protein FPA-like [Camelina 
sativa]
Length=882

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            PF++    +S   +NNLWVG+LT + T+++LT LF +YG +D IT+YS+R +AF+Y+R +
Sbjct  7    PFKAD---DSGFKSNNLWVGSLTIETTDSDLTELFGRYGDIDRITAYSSRGFAFIYYRHV  63

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            E+A AAK+ALQG  L G+ +KIEFA+P 
Sbjct  64   EEAVAAKEALQGADLNGSQIKIEFARPA  91



>ref|XP_010506210.1| PREDICTED: flowering time control protein FPA-like [Camelina 
sativa]
 ref|XP_010506211.1| PREDICTED: flowering time control protein FPA-like [Camelina 
sativa]
Length=880

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            +S   +NNLWVG+LT + T+++LT LF +YG +D IT+YS+R +AF+Y+R +E+A AAK+
Sbjct  12   DSGFKSNNLWVGSLTIETTDSDLTELFGRYGDIDRITAYSSRGFAFIYYRHVEEAVAAKE  71

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQG  L G+ +KIEFA+P 
Sbjct  72   ALQGADLNGSQIKIEFARPA  91



>ref|XP_010517900.1| PREDICTED: flowering time control protein FPA [Camelina sativa]
Length=882

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            +S   +NNLWVG+LT + T+++LT LF +YG +D IT+YS+R +AF+Y+R +E+A AAK+
Sbjct  12   DSGFKSNNLWVGSLTIETTDSDLTELFGRYGDIDRITAYSSRGFAFVYYRHVEEAVAAKE  71

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQG  L G+ +KIEFA+P 
Sbjct  72   ALQGADLNGSQIKIEFARPA  91



>ref|XP_010469306.1| PREDICTED: flowering time control protein FPA-like [Camelina 
sativa]
Length=911

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            P+R      S   +NNLWVG+LT + TE+++  LF ++G++D I  YS+RS+AFLY+R +
Sbjct  7    PWRGREPDGSGFQSNNLWVGSLTAETTESDVVDLFARFGEIDRIMVYSSRSFAFLYYRRV  66

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            E+A AAK+ALQG+ L G+ +KIEFA+P 
Sbjct  67   EEAVAAKEALQGSYLNGSQIKIEFARPA  94



>emb|CAN74982.1| hypothetical protein VITISV_007871 [Vitis vinifera]
Length=1976

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = -2

Query  330  RVSTMVPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYA  151
            + S+M P  R  A+  S+    +LWVGN+   VTE++L A+F ++G +D   SYS+RS+A
Sbjct  573  KSSSMAPLIRRDAE-NSEVHPFSLWVGNVGNSVTESDLLAVFSRFGALDCFISYSSRSFA  631

Query  150  FLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKP  49
            F+YFR  EDA+AA++ALQG V+ G P+KIEFA+P
Sbjct  632  FVYFRRGEDARAAREALQGMVVLGTPMKIEFARP  665


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 43/85 (51%), Gaps = 5/85 (6%)
 Frame = -2

Query  306  FRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLE  127
            F   AKP       +LWVG  +P  T+ EL   F K+G+++    +  R+ A + +  LE
Sbjct  662  FARPAKP-----CKSLWVGGFSPSTTKGELENEFLKFGKIEDFKFFWDRNSALVEYVKLE  716

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
            DA  A   L G  + G  ++++F +
Sbjct  717  DASQALKGLNGKQIGGAMIRVDFLR  741



>ref|XP_010908978.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Elaeis guineensis]
 ref|XP_010908983.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Elaeis guineensis]
Length=984

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            + D  ++ LWVGNL+PD  + ++   F K+G +D  T + ARSY+F++FRS+EDAKAAKD
Sbjct  24   DDDPPSSVLWVGNLSPDTIDLDVMTAFSKFGALDCNTMHGARSYSFVFFRSIEDAKAAKD  83

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQG+ L GN ++IEFA+P 
Sbjct  84   ALQGSTLHGNTVRIEFARPA  103



>ref|XP_010908991.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Elaeis guineensis]
Length=950

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            + D  ++ LWVGNL+PD  + ++   F K+G +D  T + ARSY+F++FRS+EDAKAAKD
Sbjct  24   DDDPPSSVLWVGNLSPDTIDLDVMTAFSKFGALDCNTMHGARSYSFVFFRSIEDAKAAKD  83

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQG+ L GN ++IEFA+P 
Sbjct  84   ALQGSTLHGNTVRIEFARPA  103



>emb|CDY05992.1| BnaA09g37880D [Brassica napus]
Length=793

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 73/119 (61%), Gaps = 13/119 (11%)
 Frame = -2

Query  408  HLSHSPFHFFNFFLVQPNTEQPFMQSRVSTMVPPFRSSAKPESDTATNNLWVGNLTPDVT  229
            HL H  F   +FF + P             ++ P R      S   + NLWVG+LTPD T
Sbjct  31   HLHHWTFACKSFFPILP-------------VMKPSRGREPDGSGFQSTNLWVGSLTPDTT  77

Query  228  EAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            E++L  LF ++G +D +T+YS+R +AF+Y+R +E+A AAK+ALQG  L G+ +KIEFA+
Sbjct  78   ESDLADLFGRFGDIDRLTAYSSRCFAFIYYRRVEEAVAAKEALQGANLNGSHIKIEFAR  136



>gb|EYU36725.1| hypothetical protein MIMGU_mgv1a021744mg, partial [Erythranthe 
guttata]
Length=493

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -2

Query  300  SSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDA  121
            S A    +  + NLW+G++ PDVT++EL ALFE +G+V  +  Y +R++A++YFR +E A
Sbjct  20   SVANSSENHPSKNLWIGSVMPDVTDSELKALFESHGEVAGVRLYPSRNFAYVYFREIESA  79

Query  120  KAAKDALQGTVLRGNPLKIEFAKPV  46
            ++A   LQG +LRGN LKIEFAKP 
Sbjct  80   RSAMQGLQGHLLRGNRLKIEFAKPA  104



>emb|CBI36724.3| unnamed protein product [Vitis vinifera]
Length=510

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = -2

Query  318  MVPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYF  139
            M P  R  A+  S+    +LWVGN+   VTE++L A+F ++G +D   SYS+RS+AF+YF
Sbjct  1    MAPLIRRDAE-NSEVHPFSLWVGNVGNSVTESDLLAVFSRFGALDCFISYSSRSFAFVYF  59

Query  138  RSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            R  EDA+AA++ALQG V+ G P+KIEFA+P 
Sbjct  60   RRGEDARAAREALQGMVVLGTPMKIEFARPA  90


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 43/85 (51%), Gaps = 5/85 (6%)
 Frame = -2

Query  306  FRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLE  127
            F   AKP       +LWVG  +P  T+ EL   F K+G+++    +  R+ A + +  LE
Sbjct  86   FARPAKP-----CKSLWVGGFSPSTTKGELENEFLKFGKIEDFKFFWDRNSALVEYVKLE  140

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
            DA  A   L G  + G  ++++F +
Sbjct  141  DASQALKGLNGKQIGGAMIRVDFLR  165



>ref|XP_002878276.1| hypothetical protein ARALYDRAFT_907458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54535.1| hypothetical protein ARALYDRAFT_907458 [Arabidopsis lyrata subsp. 
lyrata]
Length=906

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            +NNLWVG+LT D TE+++  LF ++G++D IT++S+RS+AF+Y+R +E+A AAK+ALQG 
Sbjct  16   SNNLWVGSLTTDTTESDIADLFGRFGEIDRITAFSSRSFAFIYYRRVEEAVAAKEALQGA  75

Query  90   VLRGNPLKIEFAKPV  46
             L G+ +KIEFA+P 
Sbjct  76   DLNGSLIKIEFARPA  90



>ref|XP_010512218.1| PREDICTED: flowering time control protein FPA-like [Camelina 
sativa]
Length=908

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 67/94 (71%), Gaps = 3/94 (3%)
 Frame = -2

Query  318  MVPPFRSSAKPESDTA---TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAF  148
            M P  + S   E D +   +NNLWVG+LT + TE+++  LF ++G++D I  YS+RS+AF
Sbjct  1    MAPVMKPSRGREPDGSGFQSNNLWVGSLTAETTESDVVDLFARFGEIDRIMVYSSRSFAF  60

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            LY+R +E+A AAK+ALQG  L G+ +KIEFA+P 
Sbjct  61   LYYRRVEEAVAAKEALQGCYLNGSQIKIEFARPA  94



>ref|XP_010413682.1| PREDICTED: flowering time control protein FPA-like [Camelina 
sativa]
Length=910

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 68/94 (72%), Gaps = 3/94 (3%)
 Frame = -2

Query  318  MVPPFRSSAKPESDTA---TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAF  148
            M P  + S   E D +   +NNLWVG++T + TE+++  LF ++G++D I  YS+RS+AF
Sbjct  1    MAPVMKPSRGREPDGSGFQSNNLWVGSVTAETTESDVADLFGRFGEIDRIMVYSSRSFAF  60

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            LY+R +E+A AAK+ALQG+ L G+ +KIEFA+P 
Sbjct  61   LYYRRVEEAVAAKEALQGSYLNGSQIKIEFARPA  94


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 48/85 (56%), Gaps = 6/85 (7%)
 Frame = -2

Query  306  FRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLE  127
            F   AKP       +LWVG ++P V++ +L A F K+G+++       R  AF+ F  ++
Sbjct  90   FARPAKP-----CKSLWVGGISPSVSKDDLEAEFRKFGKIEDFRFLWERKTAFIDFYDID  144

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
            DA  AK ++ G  + G+ L+++F +
Sbjct  145  DAIQAK-SMNGKRMGGSYLRVDFLR  168



>ref|XP_008788213.1| PREDICTED: flowering time control protein FPA-like [Phoenix dactylifera]
 ref|XP_008788214.1| PREDICTED: flowering time control protein FPA-like [Phoenix dactylifera]
 ref|XP_008788215.1| PREDICTED: flowering time control protein FPA-like [Phoenix dactylifera]
Length=986

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            + D  ++ LWVGNL PD  + ++   F K+G +D  T + ARSY+F++FR +E+AKAAKD
Sbjct  24   DDDPPSSVLWVGNLLPDTIDPDVMTFFSKFGALDCNTMHGARSYSFVFFRGIEEAKAAKD  83

Query  105  ALQGTVLRGNPLKIEFAKPV  46
            ALQG+ L GN +KIEFA+P 
Sbjct  84   ALQGSTLHGNTVKIEFARPA  103



>ref|XP_010650623.1| PREDICTED: flowering time control protein FPA [Vitis vinifera]
Length=973

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = -2

Query  318  MVPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYF  139
            M P  R  A+  S+    +LWVGN+   VTE++L A+F ++G +D   SYS+RS+AF+YF
Sbjct  1    MAPLIRRDAE-NSEVHPFSLWVGNVGNSVTESDLLAVFSRFGALDCFISYSSRSFAFVYF  59

Query  138  RSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            R  EDA+AA++ALQG V+ G P+KIEFA+P 
Sbjct  60   RRGEDARAAREALQGMVVLGTPMKIEFARPA  90



>ref|XP_009116618.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Brassica rapa]
 ref|XP_009116619.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Brassica rapa]
Length=840

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 66/94 (70%), Gaps = 3/94 (3%)
 Frame = -2

Query  318  MVPPFRSSAKPESDTA---TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAF  148
            M P  + S   E D +   + NLWVG+LT D TE++L  LF ++G +D +T+YS+R +AF
Sbjct  1    MAPVMKPSRGREPDGSGFQSTNLWVGSLTSDTTESDLADLFGRFGDIDRLTAYSSRCFAF  60

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            +Y+R +E+A AAK+ALQG  L G+ +KIEFA+P 
Sbjct  61   IYYRRVEEAVAAKEALQGANLNGSRIKIEFARPA  94



>ref|XP_010321974.1| PREDICTED: flowering time control protein FPA-like [Solanum lycopersicum]
Length=365

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -2

Query  264  NLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            +LWVGNL PD+T+ +L +LF+ +G V+SIT  ++R Y F+ F ++ D+K AKDALQG+  
Sbjct  10   SLWVGNLAPDMTDEDLVSLFQNFGPVNSITRCNSRGYGFVLFGNIHDSKEAKDALQGSFF  69

Query  84   RGNPLKIEFAKP  49
             GN L+IEFAKP
Sbjct  70   HGNALRIEFAKP  81



>ref|XP_009414659.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=1011

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -2

Query  297  SAKPESDTA-TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDA  121
            S +PE+D A +N LWVGNL  D+T+ ++ A+F K+G +D  T   +RSY F+YFR++++A
Sbjct  19   SKEPENDEAPSNTLWVGNLPVDITDPDVMAVFAKHGALDCTTMRGSRSYTFVYFRTVDEA  78

Query  120  KAAKDALQGTVLRGNPLKIEFAKP  49
            KAAK+AL+G++++G+ +++EFA+P
Sbjct  79   KAAKEALKGSIIQGHAMRLEFARP  102



>ref|XP_001771278.1| predicted protein [Physcomitrella patens]
 gb|EDQ63838.1| predicted protein [Physcomitrella patens]
Length=83

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LW+GN++ D +EA +   F ++G VDS+T YS+R+YAF+ FR+LEDA  AK  LQG 
Sbjct  3    SRHLWIGNVSQDASEAAIRDKFSQFGDVDSVTVYSSRNYAFVNFRNLEDAVEAKTHLQGF  62

Query  90   VLRGNPLKIEFAKPVCI-FVS  31
            VL G  ++IE+AK V I F+S
Sbjct  63   VLGGMAIRIEYAKGVSITFIS  83



>ref|XP_009414660.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=1006

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -2

Query  297  SAKPESDTA-TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDA  121
            S +PE+D A +N LWVGNL  D+T+ ++ A+F K+G +D  T   +RSY F+YFR++++A
Sbjct  19   SKEPENDEAPSNTLWVGNLPVDITDPDVMAVFAKHGALDCTTMRGSRSYTFVYFRTVDEA  78

Query  120  KAAKDALQGTVLRGNPLKIEFAKP  49
            KAAK+AL+G++++G+ +++EFA+P
Sbjct  79   KAAKEALKGSIIQGHAMRLEFARP  102



>gb|ABR16173.1| unknown [Picea sitchensis]
Length=1019

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = -2

Query  291  KPESDT--ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAK  118
            K ESDT  A+ NLWVGN+  +VTE  L   F ++G+++SIT YSAR+YAF+ FR  EDA 
Sbjct  41   KTESDTIQASRNLWVGNVYQNVTETALAEQFSRFGEIESITVYSARNYAFINFRKEEDAV  100

Query  117  AAKDALQGTVLRGNPLKIEFAKPVCIFVSRH  25
             AK +LQG VL G  L+IEFAK      S H
Sbjct  101  IAKRSLQGLVLSGLALRIEFAKGDSHLSSSH  131



>gb|AAX51263.1| FPA [Arabidopsis thaliana]
Length=1056

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 58/77 (75%), Gaps = 3/77 (4%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            PFR+    +S   +NNLWVG+LTP+ TE++LT LF +YG +D IT YS+R +AF+Y+R +
Sbjct  7    PFRAD---DSGFQSNNLWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGFAFIYYRHV  63

Query  129  EDAKAAKDALQGTVLRG  79
            E+A AAK+ALQG  L G
Sbjct  64   EEAVAAKEALQGANLNG  80



>gb|AAB64314.1| hypothetical protein [Arabidopsis thaliana]
Length=1056

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 58/77 (75%), Gaps = 3/77 (4%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            PFR+    +S   +NNLWVG+LTP+ TE++LT LF +YG +D IT YS+R +AF+Y+R +
Sbjct  7    PFRAD---DSGFQSNNLWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGFAFIYYRHV  63

Query  129  EDAKAAKDALQGTVLRG  79
            E+A AAK+ALQG  L G
Sbjct  64   EEAVAAKEALQGANLNG  80



>ref|XP_006286323.1| hypothetical protein CARUB_v100073761mg, partial [Capsella rubella]
 gb|EOA19221.1| hypothetical protein CARUB_v100073761mg, partial [Capsella rubella]
Length=145

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL   + E +L   F ++G+++S+     RSYAF+ F+  EDA AA ++LQG 
Sbjct  20   SRHLWVGNLPHGIPERDLADRFLRFGELESLAFQPGRSYAFVNFKHEEDAFAAIESLQGF  79

Query  90   VLRGNPLKIEFAKPVCIFVSRHCL  19
             L GNPL+IEFAKP C+ V+  CL
Sbjct  80   SLSGNPLRIEFAKPECLKVTSMCL  103



>ref|XP_004308182.1| PREDICTED: flowering time control protein FPA-like [Fragaria 
vesca subsp. vesca]
Length=834

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            P +     E    +NNLWVGN+  DVT+++L  LF +YG +D +TSYS RSYAF+ F+  
Sbjct  8    PGKQGGGDEGRAMSNNLWVGNIGRDVTDSDLYDLFSQYGALDGVTSYSTRSYAFVLFKRK  67

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            E+A AAK+ALQGT +RG P+KIEFA+P 
Sbjct  68   EEAAAAKEALQGTPVRGLPIKIEFARPA  95



>ref|XP_008790591.1| PREDICTED: flowering time control protein FPA-like [Phoenix dactylifera]
 ref|XP_008790592.1| PREDICTED: flowering time control protein FPA-like [Phoenix dactylifera]
Length=976

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 41/88 (47%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = -2

Query  312  PPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRS  133
            PP +     E+ ++   LWVGN+  D  ++ +  +F K+G +D  T + ARSY+F++FRS
Sbjct  17   PPSKEGDSYEASSSV--LWVGNIPADTVDSVVMDVFSKFGALDCNTMHGARSYSFVFFRS  74

Query  132  LEDAKAAKDALQGTVLRGNPLKIEFAKP  49
            ++DAKAAKDALQG+ L G+ +KIEFA+P
Sbjct  75   IDDAKAAKDALQGSPLHGSSIKIEFARP  102



>ref|XP_010927889.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Elaeis guineensis]
Length=936

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -2

Query  261  LWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVLR  82
            LWVGN+  D  + ++  +F K+G +D  T + ARSY+F++FRS++DAKAAKDALQG+ L 
Sbjct  32   LWVGNIPADTVDNDVMTVFFKFGALDCNTMHGARSYSFVFFRSIDDAKAAKDALQGSPLH  91

Query  81   GNPLKIEFAKP  49
            G+ +KIEFA+P
Sbjct  92   GSSIKIEFARP  102


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  +LW+G ++  VT+ +L   F K+G+++    +  R+ A + +   EDA AA   + G
Sbjct  105  AVKHLWIGGISSSVTKEQLEDEFLKFGKIEEHRFFRDRNSALIDYHKTEDAIAAHKNMNG  164

Query  93   TVLRGNPLKIEFAK  52
              L G PL+++F +
Sbjct  165  KHLGGEPLRVDFQR  178



>gb|KCW47627.1| hypothetical protein EUGRSUZ_K01370, partial [Eucalyptus grandis]
Length=218

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = -2

Query  303  RSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLED  124
            R+S+   S   + +LWVGNL+  ++E +L   F ++G++DS+     RSYAF+ F++ E 
Sbjct  92   RNSSGQSSAPPSRHLWVGNLSHSISEGDLVRPFLEFGELDSVAFQPGRSYAFINFKTDEG  151

Query  123  AKAAKDALQGTVLRGNPLKIEFAKPVCI  40
            A AA DAL+G+ L GNPL+IEFAK V +
Sbjct  152  AIAALDALRGSPLAGNPLRIEFAKVVSL  179



>ref|XP_010927888.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Elaeis guineensis]
Length=969

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -2

Query  261  LWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVLR  82
            LWVGN+  D  + ++  +F K+G +D  T + ARSY+F++FRS++DAKAAKDALQG+ L 
Sbjct  32   LWVGNIPADTVDNDVMTVFFKFGALDCNTMHGARSYSFVFFRSIDDAKAAKDALQGSPLH  91

Query  81   GNPLKIEFAKP  49
            G+ +KIEFA+P
Sbjct  92   GSSIKIEFARP  102


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  +LW+G ++  VT+ +L   F K+G+++    +  R+ A + +   EDA AA   + G
Sbjct  105  AVKHLWIGGISSSVTKEQLEDEFLKFGKIEEHRFFRDRNSALIDYHKTEDAIAAHKNMNG  164

Query  93   TVLRGNPLKIEFAK  52
              L G PL+++F +
Sbjct  165  KHLGGEPLRVDFQR  178



>gb|ABK93989.1| unknown [Populus trichocarpa]
Length=149

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = -2

Query  300  SSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDA  121
            S+ K  ++  + +LWVGNL+  + E +LT  F ++G +DS+     RSYAF+ F   EDA
Sbjct  31   SNGKRGNNPPSRHLWVGNLSHSIEETDLTDEFLQFGDLDSVAFQPGRSYAFVNFNKEEDA  90

Query  120  KAAKDALQGTVLRGNPLKIEFAKPV--CIFVS  31
             AA  +LQG  L GNPL+IEFAK V  C F S
Sbjct  91   IAAIKSLQGYPLAGNPLRIEFAKAVSFCHFCS  122



>ref|XP_011074230.1| PREDICTED: flowering time control protein FPA-like [Sesamum indicum]
Length=738

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/102 (44%), Positives = 62/102 (61%), Gaps = 12/102 (12%)
 Frame = -2

Query  318  MVPPFRSSAKP-ESDTA-----------TNNLWVGNLTPDVTEAELTALFEKYGQVDSIT  175
            M PP +S+A+  ++D A           +NNLW+GNL+P+VT+ EL  LF  +G+V  I 
Sbjct  1    MAPPTKSAAEATQNDDAAIKNLQRKILPSNNLWIGNLSPNVTDFELKHLFAAHGEVIGIN  60

Query  174  SYSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKP  49
             +  R YAF++F+  E A  A+  LQG VL G PL I FAKP
Sbjct  61   LFPPRRYAFVHFKETEGANLARQGLQGYVLHGKPLVINFAKP  102



>ref|XP_006447878.1| hypothetical protein CICLE_v10018231mg, partial [Citrus clementina]
 gb|ESR61118.1| hypothetical protein CICLE_v10018231mg, partial [Citrus clementina]
Length=184

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+ ++ EA+LT  F ++G+++S+     RSYAF+ F+  EDA A+  ALQG 
Sbjct  65   SRHLWVGNLSHNIEEADLTDQFLRFGELESVAFQPGRSYAFINFKMEEDAIASMKALQGF  124

Query  90   VLRGNPLKIEFAKPVCIF  37
             L GNPL+IEFAK V  F
Sbjct  125  PLAGNPLRIEFAKAVSCF  142



>ref|XP_011074231.1| PREDICTED: flowering time control protein FPA-like [Sesamum indicum]
Length=761

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 45/102 (44%), Positives = 61/102 (60%), Gaps = 12/102 (12%)
 Frame = -2

Query  318  MVPPFRSSAKP--ESDTA----------TNNLWVGNLTPDVTEAELTALFEKYGQVDSIT  175
            M PP +S+A+    +D A          +NNLW+GNL+P+VT+ EL  LF  +G+V  I 
Sbjct  1    MAPPTKSAAEATQNNDAAIKSLQREILPSNNLWIGNLSPNVTDFELKHLFAAHGEVIGIN  60

Query  174  SYSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKP  49
             +  R YAF++F+  E A  A+  LQG VL G PL I FAKP
Sbjct  61   LFPPRRYAFVHFKETEGATLARHGLQGYVLHGKPLVINFAKP  102



>emb|CDP06136.1| unnamed protein product [Coffea canephora]
Length=164

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 67/106 (63%), Gaps = 5/106 (5%)
 Frame = -2

Query  309  PFRSSAKPE---SDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYF  139
            P RS  K     S+  + +LWVGNL+ ++ E+ LT  F ++G+++++     RSYAF+ F
Sbjct  21   PLRSEEKSHHGRSNPPSRHLWVGNLSHNLDESSLTHHFLQFGELENVAFQPGRSYAFINF  80

Query  138  RSLEDAKAAKDALQGTVLRGNPLKIEFAKPVCIFVSRHCLMMMMMM  1
            ++ EDA AA   LQG  + GNPL+IEF K V  FV+  CL+  M++
Sbjct  81   KNEEDAFAAMRELQGFSVAGNPLRIEFTKAVS-FVNL-CLISFMVL  124



>emb|CDY67811.1| BnaA06g38360D [Brassica napus]
Length=798

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL   ++E EL   F ++G+++S+    ARSYAFL F+  EDA AA D+LQG 
Sbjct  26   SRHLWVGNLPLGISERELADRFLRFGELESVAFQPARSYAFLNFKHDEDAFAAIDSLQGF  85

Query  90   VLRGNPLKIEFAKP  49
             L GNPLKIEFAKP
Sbjct  86   PLNGNPLKIEFAKP  99



>gb|KDO51063.1| hypothetical protein CISIN_1g036554mg, partial [Citrus sinensis]
Length=105

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+ ++ EA LT  F ++G+++S+     RSYAF+ F+  EDA A+  ALQG 
Sbjct  32   SRHLWVGNLSHNIEEANLTDQFLRFGELESVAFQPGRSYAFINFKIEEDAIASMKALQGF  91

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  92   PLAGNPLRIEFAK  104



>ref|XP_009149084.1| PREDICTED: uncharacterized protein LOC103872442 [Brassica rapa]
Length=790

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL   ++E EL   F ++G+++S+    ARSYAFL F+  EDA AA D+LQG 
Sbjct  18   SRHLWVGNLPLGISERELADRFLRFGELESVAFQPARSYAFLNFKHDEDAFAAIDSLQGF  77

Query  90   VLRGNPLKIEFAKP  49
             L GNPLKIEFAKP
Sbjct  78   PLNGNPLKIEFAKP  91



>ref|XP_011073880.1| PREDICTED: flowering time control protein FPA-like [Sesamum indicum]
Length=782

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 44/101 (44%), Positives = 61/101 (60%), Gaps = 12/101 (12%)
 Frame = -2

Query  318  MVPPFRSSAKP-ESDTA-----------TNNLWVGNLTPDVTEAELTALFEKYGQVDSIT  175
            M PP +S+A+  ++D A           +NNLW+GNL+P+VT+ EL  LF  +G+V  I 
Sbjct  1    MAPPVKSAAEATQNDDAAIKNLQREILPSNNLWIGNLSPNVTDLELKHLFAAHGEVIGIN  60

Query  174  SYSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
             +  R YAF++F+  E A  A+  LQG VL G PL I FAK
Sbjct  61   LFPLRRYAFVHFKETEGANLARHGLQGYVLHGKPLVINFAK  101



>gb|KHM98707.1| Flowering time control protein FPA [Glycine soja]
Length=171

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = -2

Query  264  NLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            +LWVGNL+ ++ E EL   F +YG ++++     RSYAF+ FR  EDA  A  ALQG  L
Sbjct  48   HLWVGNLSHNIVEEELAHHFLRYGPLENVAFQPGRSYAFINFRMDEDAIDALRALQGFPL  107

Query  84   RGNPLKIEFAKPVCIFVSRHCLMMM  10
             GNPL+IEFAK V +    H L+++
Sbjct  108  AGNPLRIEFAKAVSV---AHLLLLV  129



>ref|XP_010046755.1| PREDICTED: flowering time control protein FPA [Eucalyptus grandis]
 gb|KCW87730.1| hypothetical protein EUGRSUZ_A00103 [Eucalyptus grandis]
 gb|KCW87731.1| hypothetical protein EUGRSUZ_A00103 [Eucalyptus grandis]
Length=973

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            +NNLW+GNL+ DVT+ +L  +F KYG +D+ TSY+ARS+AF++F+  +DA AAKDALQGT
Sbjct  32   SNNLWIGNLSSDVTDTDLMDVFGKYGALDA-TSYAARSFAFVFFKRPDDAAAAKDALQGT  90

Query  90   VLRGNPLKIEFAKPV  46
             ++GN +KIEFA+P 
Sbjct  91   SVKGNQIKIEFARPA  105



>ref|XP_007146063.1| hypothetical protein PHAVU_006G009600g, partial [Phaseolus vulgaris]
 gb|ESW18057.1| hypothetical protein PHAVU_006G009600g, partial [Phaseolus vulgaris]
Length=136

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+  + E EL   F ++G ++++   S RSYAF+ FR  EDA  A   LQG 
Sbjct  42   SRHLWVGNLSHSIVEEELARHFLRFGPLENVAFQSGRSYAFVNFRRDEDAIDAMRTLQGF  101

Query  90   VLRGNPLKIEFAKPVCIFVSRHCLMMM  10
             L GNPL+IEFAK V +    H L+++
Sbjct  102  PLAGNPLRIEFAKAVSV---AHLLLLV  125



>ref|XP_006858855.1| hypothetical protein AMTR_s00066p00188130 [Amborella trichopoda]
 gb|ERN20322.1| hypothetical protein AMTR_s00066p00188130 [Amborella trichopoda]
Length=894

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  210  LFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            LF KYG +DS+ +Y+ R+YAF+YF+ LEDAKAAK+ALQGTV++G+ L+IEFA+P 
Sbjct  3    LFGKYGALDSVATYNFRNYAFVYFKHLEDAKAAKEALQGTVVKGSALRIEFARPA  57


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 46/85 (54%), Gaps = 5/85 (6%)
 Frame = -2

Query  306  FRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLE  127
            F   AKP       +LWVG ++P VT+  L   F K+G+V+       R+ A + +  LE
Sbjct  53   FARPAKP-----GKHLWVGGVSPSVTKELLEQEFLKFGKVEEFKFLRDRNSALVDYVKLE  107

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
            DA +A  A+ G +L G  L++++ +
Sbjct  108  DAVSALKAMNGKLLGGEQLRVDYLR  132



>emb|CAB53756.1| putative protein [Arabidopsis thaliana]
 emb|CAB78306.1| putative protein [Arabidopsis thaliana]
Length=109

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL   + E EL   F ++G+++S+     RSYAF+ F   EDA AA ++LQG 
Sbjct  14   SRHLWVGNLPHGILERELADRFLRFGELESLAFQPGRSYAFVNFNHDEDAFAAIESLQGF  73

Query  90   VLRGNPLKIEFAKPVCI  40
             L GNPL+IEFAK V +
Sbjct  74   PLSGNPLRIEFAKAVSV  90



>gb|AAT41832.1| At4g12630 [Arabidopsis thaliana]
Length=117

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL   + E EL   F ++G+++S+     RSYAF+ F   EDA AA ++LQG 
Sbjct  22   SRHLWVGNLPHGILERELADRFLRFGELESLAFQPGRSYAFVNFNHDEDAFAAIESLQGF  81

Query  90   VLRGNPLKIEFAKPVCI  40
             L GNPL+IEFAK V +
Sbjct  82   PLSGNPLRIEFAKAVSV  98



>ref|XP_009386963.1| PREDICTED: flowering time control protein FPA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009386964.1| PREDICTED: flowering time control protein FPA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009386965.1| PREDICTED: flowering time control protein FPA-like [Musa acuminata 
subsp. malaccensis]
Length=1013

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 60/90 (67%), Gaps = 5/90 (6%)
 Frame = -2

Query  312  PPFRSSAKPESDTA-TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARS-YAFLYF  139
            PP + S   ESD   +N LWVGNL  D T++++ A+  K+G +D  T   +RS Y F+YF
Sbjct  19   PPSKES---ESDEGPSNTLWVGNLPADTTDSDVMAVLAKHGALDCTTMRGSRSWYTFVYF  75

Query  138  RSLEDAKAAKDALQGTVLRGNPLKIEFAKP  49
            R +++AKAAK+AL+GT + G   + EFA+P
Sbjct  76   RDVDEAKAAKEALRGTTIHGTASRTEFARP  105



>ref|XP_007216722.1| hypothetical protein PRUPE_ppa026096mg [Prunus persica]
 gb|EMJ17921.1| hypothetical protein PRUPE_ppa026096mg [Prunus persica]
Length=118

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+  + E +LT  F ++G+++S+     RSYAFL F+  ++A AA ++LQG 
Sbjct  23   SRHLWVGNLSHSIMENDLTEHFLQFGELESVAFQPGRSYAFLNFKREDEAIAAMESLQGF  82

Query  90   VLRGNPLKIEFAKPVCIFVSRHCLMM  13
             + GNPL+IEF K +   +   C+ +
Sbjct  83   PVAGNPLRIEFTKALIKMLHDRCITI  108



>gb|EPS65670.1| hypothetical protein M569_09107, partial [Genlisea aurea]
Length=92

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = -2

Query  309  PFRSSAKPESDTATN----NLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLY  142
            P R   K       N    +LWVGNL+  +TE+ +   F +YG ++SI     RSYAF+ 
Sbjct  2    PRRPEEKSHHGRGNNPPSRHLWVGNLSHSLTESAVARQFLQYGDLESIAFQPGRSYAFIN  61

Query  141  FRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            FR+ EDA AA   LQG  L GN LKIEFAK
Sbjct  62   FRNEEDAFAAIKELQGFSLAGNALKIEFAK  91



>gb|KFK23627.1| hypothetical protein AALP_AAs74839U000100 [Arabis alpina]
Length=811

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LW+GNL   ++E EL   F ++G+++S+    ARSYAFL FR  EDA AA ++LQG 
Sbjct  21   SRHLWIGNLPHGISERELADRFIRFGELESLAFQPARSYAFLNFRHEEDAFAAIESLQGV  80

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  81   PLAGNPLRIEFAK  93



>ref|XP_010036110.1| PREDICTED: flowering time control protein FPA [Eucalyptus grandis]
Length=873

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -2

Query  303  RSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLED  124
            R+S+   S   + +LWVGNL+  ++E +L   F ++G++DS+     RSYAF+ F++ E 
Sbjct  18   RNSSGQSSAPPSRHLWVGNLSHSISEGDLVRPFLEFGELDSVAFQPGRSYAFINFKTDEG  77

Query  123  AKAAKDALQGTVLRGNPLKIEFAK  52
            A AA DAL+G+ L GNPL+IEFAK
Sbjct  78   AIAALDALRGSPLAGNPLRIEFAK  101



>gb|EYU26221.1| hypothetical protein MIMGU_mgv11b020481mg, partial [Erythranthe 
guttata]
Length=104

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 4/90 (4%)
 Frame = -2

Query  309  PFRSSAKPESDTA----TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLY  142
            P RS  K +        + +LWVGNL+  +TE  L   F ++G+++ I     RSYAF+ 
Sbjct  14   PLRSEEKSQHGRGNIPPSRHLWVGNLSHSLTENALAHHFLQFGELEKIAFQPGRSYAFIN  73

Query  141  FRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            +R+ E+A  A   LQG V+ GNP++IEFAK
Sbjct  74   YRNEEEAFIAVRELQGFVIEGNPVRIEFAK  103



>ref|XP_010542059.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Tarenaya hassleriana]
Length=786

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL   ++E  LT  F ++G+++S+     RSYAFL F+  EDA AA DALQG 
Sbjct  20   SRHLWVGNLPQGISERALTDRFLRFGELESVAFQPNRSYAFLNFKHDEDAFAAIDALQGF  79

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  80   PLTGNPLRIEFAK  92


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G   T  V EA L   F  +G+++ +T +  RSYAF+ FRSL  A  AK+ LQG + 
Sbjct  151  LWIGFPATLRVDEATLRKAFFPFGEIEKVTVFPGRSYAFVEFRSLVAACKAKETLQGKLF  210

Query  84   RGNP-LKIEFAK  52
             GNP + I FAK
Sbjct  211  -GNPRVHICFAK  221



>ref|XP_010542058.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Tarenaya hassleriana]
Length=830

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL   ++E  LT  F ++G+++S+     RSYAFL F+  EDA AA DALQG 
Sbjct  20   SRHLWVGNLPQGISERALTDRFLRFGELESVAFQPNRSYAFLNFKHDEDAFAAIDALQGF  79

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  80   PLTGNPLRIEFAK  92


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G   T  V EA L   F  +G+++ +T +  RSYAF+ FRSL  A  AK+ LQG + 
Sbjct  151  LWIGFPATLRVDEATLRKAFFPFGEIEKVTVFPGRSYAFVEFRSLVAACKAKETLQGKLF  210

Query  84   RGNP-LKIEFAK  52
             GNP + I FAK
Sbjct  211  -GNPRVHICFAK  221



>ref|XP_001758250.1| predicted protein [Physcomitrella patens]
 gb|EDQ77072.1| predicted protein [Physcomitrella patens]
Length=1252

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            E    + +LW+GN++ D TEA +   F + G VDS+T YS+R+YAF+ FR+L DA  AK+
Sbjct  63   EDTPPSRHLWIGNVSHDATEAAIREKFSQIGDVDSVTVYSSRNYAFVNFRNLHDAVEAKN  122

Query  105  ALQGTVLRGNPLKIEFAK  52
             LQG V+ G  ++IE+AK
Sbjct  123  RLQGFVIGGMAIRIEYAK  140


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/71 (37%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = -2

Query  261  LWVGNLTPD-VTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LWVG   P  V E  L   F  YG+V+ + ++  R+YAF+ F+ +E+A  AK+AL G + 
Sbjct  294  LWVGFPLPSKVDEDGLRRAFMPYGEVERVKTFPGRTYAFVQFQKVEEATRAKNALDGKLF  353

Query  84   RGNPLKIEFAK  52
                + I ++K
Sbjct  354  DDPRVHIRYSK  364



>ref|XP_003601310.1| Splicing factor, arginine/serine-rich [Medicago truncatula]
Length=180

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+ ++ E EL   F ++G ++ +     RSYAF+ F   EDA  A  +LQG 
Sbjct  42   SRHLWVGNLSHNIVEDELAHPFIRFGPLEKVAFQPGRSYAFINFEVDEDAIDAMRSLQGF  101

Query  90   VLRGNPLKIEFAKPVCI  40
            +L GNPL+IEFAK V +
Sbjct  102  LLAGNPLRIEFAKAVSV  118



>ref|XP_011008186.1| PREDICTED: flowering time control protein FPA [Populus euphratica]
Length=934

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  300  SSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDA  121
             ++K  ++  + +LWVGNL+  + EA+LT  F ++G +DS+     RSYAF+ F   EDA
Sbjct  31   GNSKRGNNPPSRHLWVGNLSHSIVEADLTDEFLQFGDLDSVAFQPGRSYAFVNFNKEEDA  90

Query  120  KAAKDALQGTVLRGNPLKIEFAK  52
             AA  +LQG  L GNPL+IEFAK
Sbjct  91   IAAIKSLQGYPLAGNPLRIEFAK  113



>ref|XP_006469393.1| PREDICTED: flowering time control protein FPA-like [Citrus sinensis]
Length=912

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+ ++ EA LT  F ++G+++S+     RSYAF+ F+  EDA A+  ALQG 
Sbjct  33   SRHLWVGNLSHNIEEANLTDQFLRFGELESVAFQPGRSYAFINFKIEEDAIASMKALQGF  92

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  93   PLAGNPLRIEFAK  105


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G      V E  L   F  +G+++ IT +  RSYAF+ FRS+  A  AK+ LQG + 
Sbjct  163  LWIGFPALLKVDEVILRKAFSPFGEIEKITVFPGRSYAFVQFRSIISACRAKETLQGKLF  222

Query  84   RGNP-LKIEFAK  52
             GNP + I FAK
Sbjct  223  -GNPRVHICFAK  233



>ref|XP_006391711.1| hypothetical protein EUTSA_v10023280mg [Eutrema salsugineum]
 gb|ESQ28997.1| hypothetical protein EUTSA_v10023280mg [Eutrema salsugineum]
Length=817

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL   ++E EL   F ++G+++S+    ARSYAFL F+ ++DA AA ++LQG 
Sbjct  17   SRHLWVGNLPLGISERELADRFVRFGELESVAFQPARSYAFLNFKHVDDAFAAIESLQGF  76

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  77   PLAGNPLRIEFAK  89



>ref|XP_002320541.2| RNA recognition motif containing family protein [Populus trichocarpa]
 gb|EEE98856.2| RNA recognition motif containing family protein [Populus trichocarpa]
Length=863

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  300  SSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDA  121
            S+ K  ++  + +LWVGNL+  + E +LT  F ++G +DS+     RSYAF+ F   EDA
Sbjct  31   SNGKRGNNPPSRHLWVGNLSHSIEETDLTDEFLQFGDLDSVAFQPGRSYAFVNFNKEEDA  90

Query  120  KAAKDALQGTVLRGNPLKIEFAK  52
             AA  +LQG  L GNPL+IEFAK
Sbjct  91   IAAIKSLQGYPLAGNPLRIEFAK  113


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 54/106 (51%), Gaps = 9/106 (8%)
 Frame = -2

Query  345  PFMQ--SRVSTMVP----PFRSSAKPESDTATNNLWVG-NLTPDVTEAELTALFEKYGQV  187
            PF+Q  SRV    P    P +S     S   +  LW+G      V E  L   F  +G++
Sbjct  141  PFLQRDSRVRNASPETFYPDKSKMSDNSAEPSEVLWIGFPALLKVDEMILRKAFSPFGEI  200

Query  186  DSITSYSARSYAFLYFRSLEDAKAAKDALQGTVLRGNP-LKIEFAK  52
            + IT +  RSYAF+ F +L  A  AK+ LQG +  GNP + I FAK
Sbjct  201  EKITVFPGRSYAFVRFTNLTSACRAKETLQGKLF-GNPRVHICFAK  245



>ref|XP_010112891.1| Flowering time control protein FPA [Morus notabilis]
 gb|EXC35026.1| Flowering time control protein FPA [Morus notabilis]
Length=1040

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  297  SAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAK  118
            S K  +   + +LWVGNL+  + E++LT+ F ++G+++S+     RSYAFL F   EDA 
Sbjct  145  SNKTSNAAPSRHLWVGNLSHSLMESDLTSHFLRFGELESVAFQPGRSYAFLNFAREEDAI  204

Query  117  AAKDALQGTVLRGNPLKIEFAKPV  46
             A +ALQG  L GNPL+IEFAK V
Sbjct  205  DAIEALQGFPLAGNPLRIEFAKAV  228


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G   + +V E  L   F  +G+++ IT++  RSYAF+ F+S++ A+ AKD L G + 
Sbjct  334  LWIGFPASLNVDEMVLRRAFSPFGEIEKITAFPGRSYAFVRFKSVKSARNAKDTLHGKLF  393

Query  84   RGNP-LKIEFAK  52
             GNP + I FAK
Sbjct  394  -GNPRVHICFAK  404



>ref|XP_007049464.1| RNA binding protein, putative [Theobroma cacao]
 gb|EOX93621.1| RNA binding protein, putative [Theobroma cacao]
Length=911

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 5/84 (6%)
 Frame = -2

Query  303  RSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLED  124
            RS+A P     + +LW+GNL+  + E +LT  F +YG+++S+     RSYAF+ F++ ED
Sbjct  22   RSNAPP-----SRHLWLGNLSHSILEPDLTDHFLQYGELESVAFQPGRSYAFINFKNEED  76

Query  123  AKAAKDALQGTVLRGNPLKIEFAK  52
            A +A  ALQG  + GNPL+IEFAK
Sbjct  77   AISAMKALQGFPVAGNPLRIEFAK  100



>ref|XP_008448142.1| PREDICTED: flowering time control protein FPA [Cucumis melo]
Length=896

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -2

Query  282  SDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDA  103
            S+  + +LWVGNL   V E +L+  F ++G++DSI    +RSYAF+ F+  EDA AA   
Sbjct  32   SNPPSRHLWVGNLAHVVVERDLSRYFSQFGELDSIAFQPSRSYAFINFKRDEDAMAAMRE  91

Query  102  LQGTVLRGNPLKIEFAK  52
            LQG  L GNP+KIEF K
Sbjct  92   LQGFSLGGNPIKIEFTK  108


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G      V E  L   F  +G++D IT++  R+YAF+ FR +  A  AK+ LQG + 
Sbjct  165  LWIGFPALLKVDEMILRKAFSPFGEIDKITTFPGRTYAFVRFRGVASAWRAKETLQGKLF  224

Query  84   RGNP-LKIEFAK  52
             GNP + I FAK
Sbjct  225  -GNPRVHICFAK  235



>ref|XP_002524560.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF37768.1| RNA binding protein, putative [Ricinus communis]
Length=929

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+  + E +LT  F ++G++DS+     RSYAF+ F++ ++A AA  ALQG 
Sbjct  51   SRHLWVGNLSHSIMENDLTDHFVRFGELDSVAFQPGRSYAFINFKNDDEAIAALKALQGF  110

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  111  PLAGNPLRIEFAK  123



>ref|XP_004154577.1| PREDICTED: uncharacterized protein LOC101229209 [Cucumis sativus]
Length=898

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -2

Query  282  SDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDA  103
            S+  + +LWVGNL   V E +L+  F ++G++DSI    +RSYAF+ F+  EDA AA   
Sbjct  32   SNPPSRHLWVGNLAHVVVERDLSRYFSQFGELDSIAFQPSRSYAFVNFKRDEDAMAAMRE  91

Query  102  LQGTVLRGNPLKIEFAK  52
            LQG  L GNP+KIEF K
Sbjct  92   LQGFSLGGNPIKIEFTK  108


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G      V E  L   F  +G++D IT++  R+YAF+ FR +  A  AK+ LQG + 
Sbjct  165  LWIGFPALLKVDEMILRKAFSPFGEIDKITTFPGRTYAFVRFRGVTSAWRAKETLQGKLF  224

Query  84   RGNP-LKIEFAK  52
             GNP + I FAK
Sbjct  225  -GNPRVHICFAK  235



>ref|XP_004140066.1| PREDICTED: uncharacterized protein LOC101216073 [Cucumis sativus]
 gb|KGN46625.1| hypothetical protein Csa_6G115600 [Cucumis sativus]
Length=898

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -2

Query  282  SDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDA  103
            S+  + +LWVGNL   V E +L+  F ++G++DSI    +RSYAF+ F+  EDA AA   
Sbjct  32   SNPPSRHLWVGNLAHVVVERDLSRYFSQFGELDSIAFQPSRSYAFVNFKRDEDAMAAMRE  91

Query  102  LQGTVLRGNPLKIEFAK  52
            LQG  L GNP+KIEF K
Sbjct  92   LQGFSLGGNPIKIEFTK  108


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G      V E  L   F  +G++D IT++  R+YAF+ FR +  A  AK+ LQG + 
Sbjct  165  LWIGFPALLKVDEMILRKAFSPFGEIDKITTFPGRTYAFVRFRGVTSAWRAKETLQGKLF  224

Query  84   RGNP-LKIEFAK  52
             GNP + I FAK
Sbjct  225  -GNPRVHICFAK  235



>ref|XP_010252942.1| PREDICTED: flowering time control protein FPA [Nelumbo nucifera]
Length=952

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -2

Query  282  SDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDA  103
            S+  + +LWVGNL+  + E+ L+  F ++G++DSI     RSYAF+ FR  EDA  A   
Sbjct  27   SNPPSRHLWVGNLSHHLNESALSEQFLRFGELDSIAFQPGRSYAFVNFRRDEDAIVAMKT  86

Query  102  LQGTVLRGNPLKIEFAKPVCIFVSRH  25
            LQG ++ G PLKIEFAK      S H
Sbjct  87   LQGVLVAGMPLKIEFAKAERPLTSLH  112


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (59%), Gaps = 5/73 (7%)
 Frame = -2

Query  261  LWVGNLTP---DVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            LW+G   P   +V E  L   F  +G+++ IT++  RSYAF+ FRSL  A  AK+ALQG 
Sbjct  164  LWIG--FPAFLNVDEMVLRKAFLPFGEIEKITAFPGRSYAFVQFRSLAAACRAKEALQGK  221

Query  90   VLRGNPLKIEFAK  52
            +     + I FAK
Sbjct  222  LFNNPRVNICFAK  234



>ref|XP_004303911.1| PREDICTED: uncharacterized protein LOC101296020 [Fragaria vesca 
subsp. vesca]
Length=913

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LW+GNL+  +TE ELT  F  +G ++S+     RSYAF+ F+  EDA+AA +AL G 
Sbjct  30   SRHLWIGNLSHGITEDELTRHFLNFGDLESVAFQPGRSYAFINFKMEEDARAAMEALNGF  89

Query  90   VLRGNPLKIEFAK  52
             + GNPL++EF K
Sbjct  90   PVAGNPLRVEFTK  102



>ref|XP_003543235.1| PREDICTED: flowering time control protein FPA-like [Glycine max]
Length=934

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+ ++ E EL   F +YG ++++     RSYAF+ FR  EDA  A  ALQG 
Sbjct  42   SRHLWVGNLSHNIVEEELAHHFLRYGPLENVAFQPGRSYAFINFRMDEDAIDALRALQGF  101

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  102  PLAGNPLRIEFAK  114


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G      V E+ L   F  +G++  IT++  RSYAF+ FRSL  A +A+D L+G + 
Sbjct  174  LWIGFPAQLKVEESILRKAFSPFGEIVKITTFPGRSYAFVRFRSLTSACSARDDLKGKLF  233

Query  84   RGNP-LKIEFAK  52
             GNP + I FAK
Sbjct  234  -GNPRVHICFAK  244



>gb|KHN40233.1| Flowering time control protein FPA [Glycine soja]
Length=938

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = -2

Query  264  NLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            +LWVGNL+ ++ E EL   F +YG ++++     RSYAF+ FR  EDA  A  ALQG  L
Sbjct  48   HLWVGNLSHNIVEEELAHHFLRYGPLENVAFQPGRSYAFINFRMDEDAIDALRALQGFPL  107

Query  84   RGNPLKIEFAK  52
             GNPL+IEFAK
Sbjct  108  AGNPLRIEFAK  118


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G      V E+ L   F  +G++  IT++  RSYAF+ FRSL  A +A+D L+G + 
Sbjct  178  LWIGFPAQLKVEESILRKAFSPFGEIVKITTFPGRSYAFVRFRSLTSACSARDDLKGKLF  237

Query  84   RGNP-LKIEFAK  52
             GNP + I FAK
Sbjct  238  -GNPRVHICFAK  248



>ref|XP_003556809.1| PREDICTED: flowering time control protein FPA-like [Glycine max]
Length=925

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = -2

Query  264  NLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            +LWVGNL+ ++ E EL   F +YG ++++     RSYAF+ FR  EDA  A  ALQG  L
Sbjct  44   HLWVGNLSHNIVEEELAHHFLRYGPLENVAFQPGRSYAFINFRMDEDAIDALRALQGFPL  103

Query  84   RGNPLKIEFAK  52
             GNPL+IEFAK
Sbjct  104  AGNPLRIEFAK  114


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G      V E+ L   F  +G++  IT++  RSYAF+ FRSL  A  A+D L+G + 
Sbjct  174  LWIGFPAQLKVDESILRKAFSPFGEIVKITTFPGRSYAFVRFRSLTSACRARDDLKGKLF  233

Query  84   RGNP-LKIEFAK  52
             GNP + I FAK
Sbjct  234  -GNPRVHICFAK  244



>ref|XP_010238377.1| PREDICTED: flowering time control protein FPA isoform X3 [Brachypodium 
distachyon]
Length=851

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSI-TSYSARSYAFLYFRSLEDAKAAKDALQG  94
            TN LWVGNL P  +E ++ A F  +G +D + T   +RSY+F+ FRSL +++AA +AL+G
Sbjct  38   TNTLWVGNLPPFASEDDVMAAFTAHGALDCVLTRAGSRSYSFVLFRSLSESRAALEALRG  97

Query  93   TVLRGNPLKIEFAKPV  46
              ++G+ ++IEFA+P 
Sbjct  98   AKVKGSSIRIEFARPA  113


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  NLWVG ++P +++ EL   F+K+G+++ +     ++ A++ F  LEDA +A  AL G
Sbjct  115  AIRNLWVGGISPSISKEELEEEFQKFGKIEGVAFSRDQTSAYIDFEKLEDAISAHRALNG  174

Query  93   TVLRGNPLKIEFAK  52
            TVL G  L ++F +
Sbjct  175  TVLGGKELCVDFQR  188



>ref|XP_010238374.1| PREDICTED: flowering time control protein FPA isoform X1 [Brachypodium 
distachyon]
 ref|XP_010238375.1| PREDICTED: flowering time control protein FPA isoform X1 [Brachypodium 
distachyon]
Length=876

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSI-TSYSARSYAFLYFRSLEDAKAAKDALQG  94
            TN LWVGNL P  +E ++ A F  +G +D + T   +RSY+F+ FRSL +++AA +AL+G
Sbjct  38   TNTLWVGNLPPFASEDDVMAAFTAHGALDCVLTRAGSRSYSFVLFRSLSESRAALEALRG  97

Query  93   TVLRGNPLKIEFAKPV  46
              ++G+ ++IEFA+P 
Sbjct  98   AKVKGSSIRIEFARPA  113


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  NLWVG ++P +++ EL   F+K+G+++ +     ++ A++ F  LEDA +A  AL G
Sbjct  115  AIRNLWVGGISPSISKEELEEEFQKFGKIEGVAFSRDQTSAYIDFEKLEDAISAHRALNG  174

Query  93   TVLRGNPLKIEFAK  52
            TVL G  L ++F +
Sbjct  175  TVLGGKELCVDFQR  188



>gb|KDP45161.1| hypothetical protein JCGZ_15026 [Jatropha curcas]
Length=933

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  300  SSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDA  121
            S+ K  ++  + +LWVGNL+  + E++LT  F ++G++DS+     RSYAF+ F++ +DA
Sbjct  31   SNNKRGNNPPSRHLWVGNLSHSIMESDLTDQFLQFGELDSVAFQPGRSYAFINFKNEDDA  90

Query  120  KAAKDALQGTVLRGNPLKIEFAK  52
             AA  +LQG  L  NPL+IEFAK
Sbjct  91   IAAIKSLQGFPLASNPLRIEFAK  113



>ref|XP_010238376.1| PREDICTED: flowering time control protein FPA isoform X2 [Brachypodium 
distachyon]
Length=875

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSI-TSYSARSYAFLYFRSLEDAKAAKDALQG  94
            TN LWVGNL P  +E ++ A F  +G +D + T   +RSY+F+ FRSL +++AA +AL+G
Sbjct  38   TNTLWVGNLPPFASEDDVMAAFTAHGALDCVLTRAGSRSYSFVLFRSLSESRAALEALRG  97

Query  93   TVLRGNPLKIEFAKPV  46
              ++G+ ++IEFA+P 
Sbjct  98   AKVKGSSIRIEFARPA  113


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  NLWVG ++P +++ EL   F+K+G+++ +     ++ A++ F  LEDA +A  AL G
Sbjct  115  AIRNLWVGGISPSISKEELEEEFQKFGKIEGVAFSRDQTSAYIDFEKLEDAISAHRALNG  174

Query  93   TVLRGNPLKIEFAK  52
            TVL G  L ++F +
Sbjct  175  TVLGGKELCVDFQR  188



>ref|XP_002863230.1| RNA recognition motif-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH39489.1| RNA recognition motif-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=817

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL   + E EL   F ++G+++S+     RSYAF+ F+  EDA AA ++LQG 
Sbjct  13   SRHLWVGNLPHGIPERELADRFLRFGELESLAFQPGRSYAFVNFKHNEDAFAAIESLQGF  72

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  73   PLSGNPLRIEFAK  85



>dbj|BAJ93493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=854

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = -2

Query  312  PPFRS--SAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSARSYAFLY  142
            PP  S  +A P +   TN LWVGNL     E ++ A F  +G +D +     +RSYAF+ 
Sbjct  23   PPKESEPAAAPGAAHETNTLWVGNLPTHAGEDDVMAAFAPHGALDCVVMRAGSRSYAFVL  82

Query  141  FRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
            FRS+++++AA +AL+G+ ++G P+++EF +P 
Sbjct  83   FRSVDESRAALEALRGSKVKGLPIRVEFGRPA  114


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  NLWVG ++P +++ E+   F+K+G+++ I     ++ A++ F  LEDA +A  AL G
Sbjct  116  AVRNLWVGGISPSISKQEVEDEFQKFGKIEGIAFSHDQTSAYIDFEKLEDAISAHRALNG  175

Query  93   TVLRGNPLKIEFAK  52
            T L G  L ++F +
Sbjct  176  TDLGGKELCVDFQR  189



>ref|NP_001062811.1| Os09g0298700 [Oryza sativa Japonica Group]
 dbj|BAD32991.1| RNA recognition motif (RRM)-containing protein-like [Oryza sativa 
Japonica Group]
 dbj|BAF24725.1| Os09g0298700 [Oryza sativa Japonica Group]
 gb|EEE69401.1| hypothetical protein OsJ_28759 [Oryza sativa Japonica Group]
Length=1005

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = -2

Query  312  PPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRS  133
            PP RSS+       + +LWVG+L+P V  A+L+ LF + G V+ I+    RS+AF+ F  
Sbjct  34   PPRRSSSGWGVAPPSRHLWVGSLSPGVAAADLSELFLRCGDVEGISRDPGRSFAFVTFAR  93

Query  132  LEDAKAAKDALQGTVLRGNPLKIEF  58
             EDA AA   LQG  LRG P++IEF
Sbjct  94   EEDAVAAVRELQGIHLRGAPIRIEF  118



>gb|EEC84885.1| hypothetical protein OsI_32043 [Oryza sativa Indica Group]
Length=900

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSA-RSYAFLYFRSLEDAKAAKDALQG  94
            TN LWVGNL     E ++ A F  +G +D + + +  RSYAF+ FRS+ +A+AA DALQG
Sbjct  45   TNTLWVGNLPAQAAEDDVMAAFSPHGALDCVMARAGPRSYAFVLFRSVPEARAALDALQG  104

Query  93   TVLRGNPLKIEFAKPV  46
            + ++G+ +++EFA+P 
Sbjct  105  SKVKGSVVRLEFARPA  120


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  NLWVG ++  +++ EL   F+K+G+VD I     ++ A++ F  LEDA +A  AL G
Sbjct  122  AVKNLWVGGISSSISKEELEEEFKKFGKVDGIAFSRDQTSAYIDFDKLEDAISAHRALNG  181

Query  93   TVLRGNPLKIEFAK  52
             VL G  L ++F +
Sbjct  182  RVLGGQELCVDFQR  195



>gb|EEC84301.1| hypothetical protein OsI_30787 [Oryza sativa Indica Group]
Length=1005

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = -2

Query  312  PPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRS  133
            PP RSS+       + +LWVG+L+P V  A+L+ LF + G V+ I+    RS+AF+ F  
Sbjct  34   PPRRSSSGWGVAPPSRHLWVGSLSPGVAAADLSELFLRCGDVEGISRDPGRSFAFVTFAR  93

Query  132  LEDAKAAKDALQGTVLRGNPLKIEF  58
             EDA AA   LQG  LRG P++IEF
Sbjct  94   EEDAVAAVRELQGIHLRGAPIRIEF  118



>tpg|DAA62331.1| TPA: hypothetical protein ZEAMMB73_716132 [Zea mays]
Length=947

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVD-SITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            TN LWVGNL   VTE +L ALF  +G +D ++    +RSYAF+ FRS  +A+ A +A +G
Sbjct  39   TNTLWVGNLPSHVTEGDLLALFGPHGALDCALARAGSRSYAFVLFRSPAEAREAVEATRG  98

Query  93   TVLRGNPLKIEFAKPVCIFVSRHCLMMMMM  4
              ++G  ++ EFA+PV +    +    +++
Sbjct  99   EKVKGAAMRTEFARPVFVVADENATRTVLV  128


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  NLWVG ++P +++ EL   F K+G+V+ +     ++ A++ F  LEDA +A  +L G
Sbjct  148  AVRNLWVGGISPSISKEELEGEFLKFGKVEGVAFSQDQTSAYIDFEKLEDAISAHRSLNG  207

Query  93   TVLRGNPLKIEFAK  52
             +L G  L ++F +
Sbjct  208  KMLGGKELCVDFQR  221



>emb|CCM44540.1| spen-like protein [Oryza sativa Japonica Group x Oryza sativa 
Indica Group]
Length=900

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSA-RSYAFLYFRSLEDAKAAKDALQG  94
            TN LWVGNL     E ++ A F  +G +D + + +  RSYAF+ FRS+ +A+AA DALQG
Sbjct  45   TNTLWVGNLPAQAAEDDVMASFSPHGALDCVMARAGPRSYAFVLFRSVPEARAALDALQG  104

Query  93   TVLRGNPLKIEFAKPV  46
            + ++G+ +++EFA+P 
Sbjct  105  SKVKGSVVRLEFARPA  120


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  NLWVG ++  +++ EL   F+K+G+VD I     ++ A++ F  LEDA +A  AL G
Sbjct  122  AVKNLWVGGISSSISKEELEEEFKKFGKVDGIAFSRDQTSAYIDFDKLEDAISAHRALNG  181

Query  93   TVLRGNPLKIEFAK  52
             VL G  L ++F +
Sbjct  182  RVLGGQELCVDFQR  195



>ref|NP_001063671.1| Os09g0516300 [Oryza sativa Japonica Group]
 dbj|BAD34441.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD33821.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25585.1| Os09g0516300 [Oryza sativa Japonica Group]
 dbj|BAG89424.1| unnamed protein product [Oryza sativa Japonica Group]
Length=900

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSA-RSYAFLYFRSLEDAKAAKDALQG  94
            TN LWVGNL     E ++ A F  +G +D + + +  RSYAF+ FRS+ +A+AA DALQG
Sbjct  45   TNTLWVGNLPAQAAEDDVMASFSPHGALDCVMARAGPRSYAFVLFRSVPEARAALDALQG  104

Query  93   TVLRGNPLKIEFAKPV  46
            + ++G+ +++EFA+P 
Sbjct  105  SKVKGSVVRLEFARPA  120


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  NLWVG ++  +++ EL   F+K+G+VD I     ++ A++ F  LEDA +A  AL G
Sbjct  122  AVKNLWVGGISSSISKEELEEEFKKFGKVDGIAFSRDQTSAYIDFDKLEDAISAHRALNG  181

Query  93   TVLRGNPLKIEFAK  52
             VL G  L ++F +
Sbjct  182  RVLGGQELCVDFQR  195



>ref|XP_008380039.1| PREDICTED: flowering time control protein FPA-like [Malus domestica]
Length=906

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + NLWVGNL+    E +L   F ++G+++S+  +  RSYAFL F+  +DA AA D+LQ  
Sbjct  33   SRNLWVGNLSHSTVEEDLVNPFLQFGELESVAFHPGRSYAFLKFKREDDAIAAMDSLQDL  92

Query  90   VLRGNPLKIEFAK  52
             + GNPL+IEF K
Sbjct  93   PVAGNPLRIEFTK  105



>ref|XP_006661434.1| PREDICTED: flowering time control protein FPA-like [Oryza brachyantha]
Length=889

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVD-SITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            TN LWVGNL     E ++ A+F  +G +D ++     RSYAF+ FRS+ +A+AA DALQG
Sbjct  28   TNTLWVGNLPAQAAEDDVMAVFSPHGALDCALARAGPRSYAFVLFRSVAEARAALDALQG  87

Query  93   TVLRGNPLKIEFAKPV  46
            + ++G+ ++ EFA+P 
Sbjct  88   SKVKGSAVRPEFARPA  103


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  NLWVG ++P +++ EL   F K+G+VD +     R+ A++ F  LEDA +A  AL G
Sbjct  105  AVKNLWVGGISPSISKDELEKEFNKFGKVDGVAFSRDRTSAYIDFEKLEDAISAHRALNG  164

Query  93   TVLRGNPLKIEFAK  52
            TVL G  L ++F +
Sbjct  165  TVLGGQELCVDFQR  178



>dbj|BAF01596.1| hypothetical protein [Arabidopsis thaliana]
Length=823

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL   + E EL   F ++G+++S+     RSYAF+ F   EDA AA ++LQG 
Sbjct  22   SRHLWVGNLPHGILERELADRFLRFGELESLAFQPGRSYAFVNFNHDEDAFAAIESLQGF  81

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  82   PLSGNPLRIEFAK  94



>ref|NP_193001.2| RNA recognition motif (RRM)-containing protein [Arabidopsis thaliana]
 gb|AEE83159.1| RNA recognition motif (RRM)-containing protein [Arabidopsis thaliana]
Length=823

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL   + E EL   F ++G+++S+     RSYAF+ F   EDA AA ++LQG 
Sbjct  22   SRHLWVGNLPHGILERELADRFLRFGELESLAFQPGRSYAFVNFNHDEDAFAAIESLQGF  81

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  82   PLSGNPLRIEFAK  94



>dbj|BAF01027.1| hypothetical protein [Arabidopsis thaliana]
Length=823

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL   + E EL   F ++G+++S+     RSYAF+ F   EDA AA ++LQG 
Sbjct  22   SRHLWVGNLPHGILERELADRFLRFGELESLAFQPGRSYAFVNFNHDEDAFAAIESLQGF  81

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  82   PLSGNPLRIEFAK  94



>dbj|BAJ91078.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1019

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVG+L P VT ++L+ LF + G ++ IT    R++AF+ F   +DA AA   LQGT
Sbjct  53   SRHLWVGSLGPGVTASDLSQLFHRCGDIEGITRDPGRNFAFVNFMREQDAVAAVRELQGT  112

Query  90   VLRGNPLKIEFAK  52
             L G PL+IEF+K
Sbjct  113  RLHGVPLRIEFSK  125



>emb|CAF93650.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=602

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 6/86 (7%)
 Frame = -2

Query  291  KPESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQV-DSITSYSAR----SYAFLYFRSL  130
            KPE D  AT+NL++GNL  +VTEAEL   F+KYG + D +    AR    +YAF+ F++L
Sbjct  179  KPEDDQRATSNLFIGNLDGNVTEAELRRGFDKYGIIEDVVIKRPARGQGGAYAFVKFQNL  238

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAK  52
            + A  AK A+QG ++ GNP+KI + K
Sbjct  239  DMAHRAKVAMQGRLIGGNPIKIGYGK  264



>ref|XP_002462663.1| hypothetical protein SORBIDRAFT_02g029880 [Sorghum bicolor]
 gb|EER99184.1| hypothetical protein SORBIDRAFT_02g029880 [Sorghum bicolor]
Length=918

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVD-SITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            TN LWVGNL   VTE +L ALF  +G +D ++    +RSYAFL FRS  +A+AA +A +G
Sbjct  43   TNTLWVGNLPLHVTEGDLLALFGPHGALDCALARAGSRSYAFLLFRSPAEARAAVEATRG  102

Query  93   TVLRGNPLKIEFAKPV  46
              ++G  ++ EFA+P 
Sbjct  103  EKVKGAAMRTEFARPA  118


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  NLWVG+++P V++ EL   F+K+G+V+ +     ++ A++ F  LEDA +A  +L G
Sbjct  120  AVRNLWVGSISPSVSKEELEEEFQKFGKVEGVAFSQDQTSAYIDFEKLEDAISAHRSLNG  179

Query  93   TVLRGNPLKIEFAK  52
              L G  L ++F +
Sbjct  180  KTLGGKELCVDFQR  193



>gb|AHZ89701.1| flowering time control protein FPA1 [Dimocarpus longan]
Length=923

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LW+GNL+  + EA+L     ++G+++S+     RSYAF+ F S EDA A+  ALQG 
Sbjct  34   SRHLWIGNLSHSIEEADLRDQLLRFGELESVAFQPGRSYAFVNFVSEEDAFASMKALQGF  93

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  94   PLAGNPLRIEFAK  106



>emb|CBI28491.3| unnamed protein product [Vitis vinifera]
Length=1054

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -2

Query  303  RSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLED  124
            +S +   S   + +LWVGNL+  ++E  LT  F ++G++D++     RSYAF+ F+  ED
Sbjct  413  KSHSGRSSHPPSRHLWVGNLSHSISENTLTDPFLQFGELDTVAFQPGRSYAFINFKQEED  472

Query  123  AKAAKDALQGTVLRGNPLKIEFAK  52
            A  A  +LQG  + G PLKIEFAK
Sbjct  473  AIHAMRSLQGFSVAGMPLKIEFAK  496


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 3/88 (3%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTP-DVTEAELTALFEKYGQVDSITSYSARSYAFLYFRS  133
            P +SS           LW+G  +   V E  L   F  +G+++ ITS+  RSYAF+ FRS
Sbjct  542  PDKSSISDRKGEPCEVLWIGFPSLLKVDETILRKAFSPFGEIEKITSFPGRSYAFVQFRS  601

Query  132  LEDAKAAKDALQGTVLRGNP-LKIEFAK  52
            +  A  AK+ LQG +  GNP + I FAK
Sbjct  602  VTAACRAKETLQGKLF-GNPRVHICFAK  628



>ref|XP_008229757.1| PREDICTED: flowering time control protein FPA [Prunus mume]
Length=934

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = -2

Query  309  PFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            P R  +K      + +LWVGNL+  + E +LT  F ++G+++S+     RSYAFL F+  
Sbjct  26   PRRFDSKNGKAPPSRHLWVGNLSHSIMENDLTEHFLQFGELESVAFQPGRSYAFLNFKRE  85

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAK  52
            ++A AA ++LQG  + GNPL+IEF K
Sbjct  86   DEAIAAMESLQGFPVAGNPLRIEFTK  111


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G      V E  L   F  +G+++ IT++  RSYAF+ FRS+  A  AKDALQG + 
Sbjct  173  LWIGFPALLKVDELILKKAFSPFGEIEKITAFPGRSYAFVRFRSVMSACRAKDALQGKLF  232

Query  84   RGNP-LKIEFAK  52
             GNP + I FAK
Sbjct  233  -GNPRVHICFAK  243



>ref|XP_010532945.1| PREDICTED: flowering time control protein FPA [Tarenaya hassleriana]
Length=818

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +L+VGNL   ++E E T  F ++G+++S+     RSYAF+ F+  EDA AA D+LQG 
Sbjct  37   SRHLFVGNLPHGISEREFTDRFLRFGELESVAFQLNRSYAFVNFKHDEDAFAAIDSLQGF  96

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  97   PLAGNPLRIEFAK  109


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G      V EA L   F  +G+++ IT +  RSYAF+ FRSL  A  AK+ LQG + 
Sbjct  169  LWIGFPAMLRVDEAILRKAFSPFGEIEKITIFPGRSYAFVQFRSLAAACKAKETLQGKLF  228

Query  84   RGNP-LKIEFAK  52
             GNP + I FAK
Sbjct  229  -GNPRVHICFAK  239



>ref|XP_010450326.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104732473 
[Camelina sativa]
Length=757

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            E      +LWVGNL   + E +L   F ++G++ S+     RSYAF+ F+  EDA AA  
Sbjct  16   EDGRGGRHLWVGNLPHGILERDLADRFLRFGELGSLAFQPGRSYAFVKFKHDEDAFAAIG  75

Query  105  ALQGTVLRGNPLKIEFAK  52
            +LQG  L GNPL+IEFAK
Sbjct  76   SLQGFPLAGNPLRIEFAK  93



>ref|XP_010942508.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Elaeis guineensis]
Length=964

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL P VT++ L+  F ++G++++IT    R+YAF+ ++  +DA  A   LQG 
Sbjct  35   SRHLWVGNLGPHVTQSTLSEHFLRFGEIENITHIPGRNYAFVDYKKEDDAVIALRGLQGF  94

Query  90   VLRGNPLKIEFAK  52
             + G PL+IEFAK
Sbjct  95   NIAGMPLRIEFAK  107


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 50/95 (53%), Gaps = 9/95 (9%)
 Frame = -2

Query  309  PFRSSAKPESDTATNN--------LWVGNLT-PDVTEAELTALFEKYGQVDSITSYSARS  157
            P R S +   D +  N        LW+G  +  +V E  L   F  +G+++ I+++  RS
Sbjct  143  PLRLSPEKSYDKSKGNKSAEPSEMLWIGFPSFLNVDEVVLRRAFSPFGEIEKISTFPGRS  202

Query  156  YAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            YAF+ +RS+  A  AK+ALQG +     + I FAK
Sbjct  203  YAFVRYRSVVAACRAKEALQGKLFNNPRVNICFAK  237



>ref|XP_010942509.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Elaeis guineensis]
Length=963

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL P VT++ L+  F ++G++++IT    R+YAF+ ++  +DA  A   LQG 
Sbjct  34   SRHLWVGNLGPHVTQSTLSEHFLRFGEIENITHIPGRNYAFVDYKKEDDAVIALRGLQGF  93

Query  90   VLRGNPLKIEFAK  52
             + G PL+IEFAK
Sbjct  94   NIAGMPLRIEFAK  106


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 50/95 (53%), Gaps = 9/95 (9%)
 Frame = -2

Query  309  PFRSSAKPESDTATNN--------LWVGNLT-PDVTEAELTALFEKYGQVDSITSYSARS  157
            P R S +   D +  N        LW+G  +  +V E  L   F  +G+++ I+++  RS
Sbjct  142  PLRLSPEKSYDKSKGNKSAEPSEMLWIGFPSFLNVDEVVLRRAFSPFGEIEKISTFPGRS  201

Query  156  YAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            YAF+ +RS+  A  AK+ALQG +     + I FAK
Sbjct  202  YAFVRYRSVVAACRAKEALQGKLFNNPRVNICFAK  236



>ref|XP_008794728.1| PREDICTED: flowering time control protein FPA isoform X2 [Phoenix 
dactylifera]
Length=963

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL P VT++ L+  F ++G++++I+    R+YAF+ ++  EDA  A   LQG 
Sbjct  34   SRHLWVGNLGPRVTQSTLSEHFLRFGEIENISHVPGRNYAFVDYKKEEDAVIALRGLQGF  93

Query  90   VLRGNPLKIEFAK  52
             + G PL+IEFAK
Sbjct  94   SIAGMPLRIEFAK  106


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -2

Query  261  LWVGNLT-PDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G  +  +V E  L   F  +G+++ I+++  RSYAF+ +RS+  A  AK+ALQG + 
Sbjct  166  LWIGFPSFLNVDEVVLRRAFSPFGEIEKISTFPGRSYAFVRYRSVVAACRAKEALQGKLF  225

Query  84   RGNPLKIEFAK  52
                + I FAK
Sbjct  226  NNPRVNICFAK  236



>ref|XP_008794727.1| PREDICTED: flowering time control protein FPA isoform X1 [Phoenix 
dactylifera]
Length=964

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL P VT++ L+  F ++G++++I+    R+YAF+ ++  EDA  A   LQG 
Sbjct  35   SRHLWVGNLGPRVTQSTLSEHFLRFGEIENISHVPGRNYAFVDYKKEEDAVIALRGLQGF  94

Query  90   VLRGNPLKIEFAK  52
             + G PL+IEFAK
Sbjct  95   SIAGMPLRIEFAK  107



>ref|XP_007574995.1| PREDICTED: putative RNA-binding protein 15B [Poecilia formosa]
Length=825

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 62/178 (35%), Positives = 91/178 (51%), Gaps = 14/178 (8%)
 Frame = -2

Query  561  IYVP*RGVLPVFDSLSHPFLANTPTSPHSLSP-SYTYNNL*TTDAHRFVV-YLHLSHSPF  388
            +YV  R V P  D    P  A  P    SLSP     N+L    A ++ +  L L+    
Sbjct  178  MYVRRRSVTPP-DVGYLPLHAPYPYRQRSLSPPGPAVNSLRELRARQYALESLALTRDRD  236

Query  387  HFFNFFLVQPNTEQPFMQSRVSTMVPPFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTA  211
               +++ +     +PF    +     P     KPE D  AT+NL++GNL  +VTEAEL  
Sbjct  237  RLLDYYGMLDERGRPFGFPPM-----PVVEDLKPEDDQRATSNLFIGNLDGNVTEAELRR  291

Query  210  LFEKYGQV-DSITSYSAR----SYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
             F+KYG + D +    AR    +YAF+ F++L+ A  AK A+QG ++ GNP+KI + K
Sbjct  292  GFDKYGIIEDVVIKRPARGQGGAYAFVKFQNLDMAHRAKVAMQGRLIGGNPIKIGYGK  349



>gb|KHG15134.1| Flowering time control FPA -like protein [Gossypium arboreum]
Length=909

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+  + E +LT  F ++G+++S+     RSYAF+ F + E+A +A  ALQG 
Sbjct  28   SRHLWVGNLSHSILEPDLTDHFLQFGELESVAFQPGRSYAFINFMNEEEAISAMKALQGF  87

Query  90   VLRGNPLKIEFAK  52
             + GNPL+IEFAK
Sbjct  88   PVAGNPLRIEFAK  100


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 3/72 (4%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G      V E  L   F  +G+++ IT +  RSYAF+ FR L  A  AK+ LQG + 
Sbjct  162  LWIGFPALLKVDEGILRKAFSPFGEIEKITVFPGRSYAFVRFRRLSSACRAKETLQGKLF  221

Query  84   RGNP-LKIEFAK  52
             GNP + I FAK
Sbjct  222  -GNPRVHICFAK  232



>ref|XP_008318999.1| PREDICTED: putative RNA-binding protein 15B [Cynoglossus semilaevis]
Length=858

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = -2

Query  309  PFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQV-DSITSYSAR----SYAF  148
            P     KPE D  AT+NL++GNL  +VTEAEL   F+KYG + D +    AR    +YAF
Sbjct  276  PVVEDLKPEDDQRATSNLFIGNLDGNVTEAELRRGFDKYGIIEDVVIKRPARGQGGAYAF  335

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            + F++L+ A  AK A+QG ++ GNP+KI + K
Sbjct  336  VKFQNLDMAHRAKVAMQGRLIGGNPIKIGYGK  367



>ref|XP_010657507.1| PREDICTED: flowering time control protein FPA [Vitis vinifera]
Length=932

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -2

Query  303  RSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLED  124
            +S +   S   + +LWVGNL+  ++E  LT  F ++G++D++     RSYAF+ F+  ED
Sbjct  21   KSHSGRSSHPPSRHLWVGNLSHSISENTLTDPFLQFGELDTVAFQPGRSYAFINFKQEED  80

Query  123  AKAAKDALQGTVLRGNPLKIEFAK  52
            A  A  +LQG  + G PLKIEFAK
Sbjct  81   AIHAMRSLQGFSVAGMPLKIEFAK  104


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = -2

Query  261  LWVG--NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTV  88
            LW+G  +L   V E  L   F  +G+++ ITS+  RSYAF+ FRS+  A  AK+ LQG +
Sbjct  166  LWIGFPSLL-KVDETILRKAFSPFGEIEKITSFPGRSYAFVQFRSVTAACRAKETLQGKL  224

Query  87   LRGNP-LKIEFAK  52
              GNP + I FAK
Sbjct  225  F-GNPRVHICFAK  236



>tpg|DAA60948.1| TPA: hypothetical protein ZEAMMB73_205486, partial [Zea mays]
Length=152

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVG L P VT ++L+ LF + G V+ +     R++AF+ F    DA AA   LQG 
Sbjct  52   SRHLWVGGLAPSVTASDLSELFLRCGDVEGVAREPGRNFAFVSFLREGDAVAAVRELQGA  111

Query  90   VLRGNPLKIEFAKPVCIFVSRHCLMMMMM  4
             L G P++IEF+K V +    H L ++ +
Sbjct  112  RLAGAPVRIEFSKGVSV---EHPLFIICL  137



>ref|XP_010752148.1| PREDICTED: putative RNA-binding protein 15B [Larimichthys crocea]
Length=761

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = -2

Query  309  PFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQV-DSITSYSAR----SYAF  148
            P     KPE D  AT+NL++GNL  +VTEAEL   F+KYG + D +    AR    +YAF
Sbjct  181  PVVEDLKPEDDQRATSNLFIGNLDGNVTEAELRRGFDKYGIIEDVVIKRPARGQGGAYAF  240

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            + F++L+ A  AK A+QG ++ GNP+KI + K
Sbjct  241  VKFQNLDMAHRAKVAMQGRLIGGNPIKIGYGK  272



>ref|XP_005802588.1| PREDICTED: putative RNA-binding protein 15B-like [Xiphophorus 
maculatus]
Length=769

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 62/178 (35%), Positives = 91/178 (51%), Gaps = 14/178 (8%)
 Frame = -2

Query  561  IYVP*RGVLPVFDSLSHPFLANTPTSPHSLSP-SYTYNNL*TTDAHRFVV-YLHLSHSPF  388
            +YV  R V P  D    P  A  P    SLSP     N+L    A ++ +  L L+    
Sbjct  178  MYVRRRSVTPP-DVGFLPLHAPYPYRQRSLSPPGPAVNSLRELRARQYALESLALTRDRD  236

Query  387  HFFNFFLVQPNTEQPFMQSRVSTMVPPFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTA  211
               +++ +     +PF    +     P     KPE D  AT+NL++GNL  +VTEAEL  
Sbjct  237  RLLDYYGMLDERGRPFGFPPM-----PVVEDLKPEDDQRATSNLFIGNLDGNVTEAELRR  291

Query  210  LFEKYGQV-DSITSYSAR----SYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
             F+KYG + D +    AR    +YAF+ F++L+ A  AK A+QG ++ GNP+KI + K
Sbjct  292  GFDKYGIIEDVVIKRPARGQGGAYAFVKFQNLDMAHRAKVAMQGRLIGGNPIKIGYGK  349



>ref|XP_008406480.1| PREDICTED: putative RNA-binding protein 15B [Poecilia reticulata]
Length=824

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 62/178 (35%), Positives = 91/178 (51%), Gaps = 14/178 (8%)
 Frame = -2

Query  561  IYVP*RGVLPVFDSLSHPFLANTPTSPHSLSP-SYTYNNL*TTDAHRFVV-YLHLSHSPF  388
            +YV  R V P  D    P  A  P    SLSP     N+L    A ++ +  L L+    
Sbjct  178  MYVRRRSVTPP-DVGYLPLHAPYPYRQRSLSPPGPAVNSLRELRARQYALESLALTRDRD  236

Query  387  HFFNFFLVQPNTEQPFMQSRVSTMVPPFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTA  211
               +++ +     +PF    +     P     KPE D  AT+NL++GNL  +VTEAEL  
Sbjct  237  RLLDYYGMLDERGRPFGFPAM-----PVVEDLKPEDDQRATSNLFIGNLDGNVTEAELRR  291

Query  210  LFEKYGQV-DSITSYSAR----SYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
             F+KYG + D +    AR    +YAF+ F++L+ A  AK A+QG ++ GNP+KI + K
Sbjct  292  GFDKYGVIEDVVIKRPARGQGGAYAFVKFQNLDMAHRAKVAMQGRLIGGNPIKIGYGK  349



>gb|KFM29333.1| Flowering time control protein FPA [Auxenochlorella protothecoides]
Length=180

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            ES   T + W+GNL+  ++ A L  +F+K+G VD + ++  R YAF+ FR+ E+A AA D
Sbjct  81   ESGNPTRHFWIGNLSTHISRAVLKTVFDKFGVVDDVVTFPGRMYAFVNFRTTEEAVAAMD  140

Query  105  ALQGTVLR  82
             LQG V+R
Sbjct  141  TLQGLVVR  148



>ref|XP_003291310.1| hypothetical protein DICPUDRAFT_38760 [Dictyostelium purpureum]
 gb|EGC32172.1| hypothetical protein DICPUDRAFT_38760 [Dictyostelium purpureum]
Length=587

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = -2

Query  285  ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            + +  T NLW+GN+ P VT   L  LF+++G VD+I     R  AF+ F ++E A AA++
Sbjct  213  QEEVPTKNLWLGNIGPSVTSETLKQLFDQFGNVDNIRILVGRGCAFVNFFTVESAIAARN  272

Query  105  ALQGTVLRGNPLKIEFAKPVCIFVSR  28
             L GT++ G PLKI F K    + SR
Sbjct  273  NLTGTMVCGMPLKINFRKEDESYKSR  298


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
 Frame = -2

Query  324  STMVPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFL  145
            +++ P  + S KP   T    +W GN+ PD +E E+  LF ++G + +I    A+  AF+
Sbjct  100  NSLPPHLQGSGKPTEPTKI--VWAGNVHPDSSEDEIRGLFSQFGYIQAIKIIPAKQCAFI  157

Query  144  YFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
             F  +  A AA+  L GT +RG PLK+ F K
Sbjct  158  TFGDVNAAIAAQYNLNGTPIRGYPLKLGFGK  188



>ref|XP_008278691.1| PREDICTED: putative RNA-binding protein 15B [Stegastes partitus]
Length=838

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = -2

Query  309  PFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQV-DSITSYSAR----SYAF  148
            P     KPE D  AT+NL++GNL  +VTEAEL   F+KYG + D +    AR    +YAF
Sbjct  260  PVVEDLKPEDDQRATSNLFIGNLDGNVTEAELRRGFDKYGIIEDVVIKRPARGQGGAYAF  319

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            + F++L+ A  AK A+QG ++ GNP+KI + K
Sbjct  320  VKFQNLDMAHRAKVAMQGRLIGGNPIKIGYGK  351



>gb|AES71563.2| RNA recognition motif (RRM) containing protein [Medicago truncatula]
Length=928

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+ ++ E EL   F ++G ++ +     RSYAF+ F   EDA  A  +LQG 
Sbjct  42   SRHLWVGNLSHNIVEDELAHPFIRFGPLEKVAFQPGRSYAFINFEVDEDAIDAMRSLQGF  101

Query  90   VLRGNPLKIEFAK  52
            +L GNPL+IEFAK
Sbjct  102  LLAGNPLRIEFAK  114



>ref|XP_008652945.1| PREDICTED: flowering time control protein FPA [Zea mays]
 ref|XP_008652946.1| PREDICTED: flowering time control protein FPA [Zea mays]
 ref|XP_008652948.1| PREDICTED: flowering time control protein FPA [Zea mays]
 tpg|DAA62332.1| TPA: hypothetical protein ZEAMMB73_716132 [Zea mays]
Length=915

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVD-SITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            TN LWVGNL   VTE +L ALF  +G +D ++    +RSYAF+ FRS  +A+ A +A +G
Sbjct  39   TNTLWVGNLPSHVTEGDLLALFGPHGALDCALARAGSRSYAFVLFRSPAEAREAVEATRG  98

Query  93   TVLRGNPLKIEFAKPV  46
              ++G  ++ EFA+P 
Sbjct  99   EKVKGAAMRTEFARPA  114


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  NLWVG ++P +++ EL   F K+G+V+ +     ++ A++ F  LEDA +A  +L G
Sbjct  116  AVRNLWVGGISPSISKEELEGEFLKFGKVEGVAFSQDQTSAYIDFEKLEDAISAHRSLNG  175

Query  93   TVLRGNPLKIEFAK  52
             +L G  L ++F +
Sbjct  176  KMLGGKELCVDFQR  189



>ref|XP_006661092.1| PREDICTED: flowering time control protein FPA-like, partial [Oryza 
brachyantha]
Length=969

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVG+L P VT ++L+ LF + G V+ I+    R++AF+ F  +EDA AA   LQG 
Sbjct  10   SRHLWVGSLGPGVTASDLSELFLRCGDVEGISRDPGRNFAFVTFARVEDAIAAVRELQGI  69

Query  90   VLRGNPLKIEF  58
             LRG P++IEF
Sbjct  70   QLRGAPIRIEF  80



>tpg|DAA60946.1| TPA: hypothetical protein ZEAMMB73_205486, partial [Zea mays]
Length=176

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVG L P VT ++L+ LF + G V+ +     R++AF+ F    DA AA   LQG 
Sbjct  53   SRHLWVGGLAPSVTASDLSELFLRCGDVEGVAREPGRNFAFVSFLREGDAVAAVRELQGA  112

Query  90   VLRGNPLKIEFAKPVCI  40
             L G P++IEF+K V +
Sbjct  113  RLAGAPVRIEFSKGVSV  129



>tpg|DAA60945.1| TPA: hypothetical protein ZEAMMB73_205486, partial [Zea mays]
Length=174

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVG L P VT ++L+ LF + G V+ +     R++AF+ F    DA AA   LQG 
Sbjct  52   SRHLWVGGLAPSVTASDLSELFLRCGDVEGVAREPGRNFAFVSFLREGDAVAAVRELQGA  111

Query  90   VLRGNPLKIEFAKPVCI  40
             L G P++IEF+K V +
Sbjct  112  RLAGAPVRIEFSKGVSV  128



>emb|CDQ91237.1| unnamed protein product, partial [Oncorhynchus mykiss]
Length=531

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 77/155 (50%), Gaps = 14/155 (9%)
 Frame = -2

Query  492  PTSPHSLSPSYTYNNL*TTDA--HRFVVYLHLSHSPFHFFNFFLVQPNTEQPFMQSRVST  319
            P    SLSP    +++    A  H  V  L LS       +++ +     +P+       
Sbjct  220  PYRQRSLSPGAGVSSIRDIRALRHYPVEGLGLSRERERILDYYGMLDERGRPY------G  273

Query  318  MVPPFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----S  157
            +  P     KPE D  A  NL++GNL  +VTE EL   F+KYG ++ +     AR    +
Sbjct  274  LPVPEHEDIKPEDDARACRNLFIGNLDHNVTEGELRRGFDKYGIIEEVVIKRPARGQGGA  333

Query  156  YAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            YAFL F++L+ A  AK  +QG V+ GNP+KI + K
Sbjct  334  YAFLKFQNLDMAHRAKITMQGRVIGGNPVKIGYGK  368



>ref|NP_001108062.1| putative RNA-binding protein 15B [Danio rerio]
 gb|AAI55335.1| Zgc:175165 protein [Danio rerio]
Length=402

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 6/86 (7%)
 Frame = -2

Query  291  KPESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----SYAFLYFRSL  130
            KPE D  AT NL++GNL  ++TE EL   F+KYG ++ +     AR    +YAFL F++L
Sbjct  32   KPEDDQRATRNLFIGNLDHNITEVELRQGFDKYGIIEEVVIKRPARGQGGAYAFLKFQNL  91

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAK  52
            + A  AK A+QG ++ GNP+KI + K
Sbjct  92   DMAHRAKVAMQGRMINGNPIKIGYGK  117



>ref|XP_004957358.1| PREDICTED: flowering time control protein FPA-like isoform X3 
[Setaria italica]
Length=859

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 13/102 (13%)
 Frame = -2

Query  312  PPFRSSAKPESDTA------------TNNLWVGNLTPDVTEAELTALFEKYGQVD-SITS  172
            P  R+SA P  D              TN LWVGNL   V+E +L ALF  +G +D ++  
Sbjct  11   PEARASASPPKDAVASGAGAAAGFLETNTLWVGNLPSYVSEGDLMALFAPHGALDCALAR  70

Query  171  YSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
              +RSYAF+ FR+  +A+AA +A +G  ++G  ++ EFA+P 
Sbjct  71   AGSRSYAFVLFRTPAEARAAVEATRGEKVKGAAMRTEFARPA  112


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  NLWVG ++P V++ EL   F+K+G+V+ +     ++ A++ F  LEDA +A  +L G
Sbjct  114  AVRNLWVGGISPSVSKEELEEEFQKFGKVEGVAFSQDQTSAYVDFEKLEDAISAHRSLNG  173

Query  93   TVLRGNPLKIEFAK  52
              L G  L ++F +
Sbjct  174  RTLGGKELCVDFQR  187



>ref|XP_004957356.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Setaria italica]
 ref|XP_004957357.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Setaria italica]
Length=900

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 13/102 (13%)
 Frame = -2

Query  312  PPFRSSAKPESDTA------------TNNLWVGNLTPDVTEAELTALFEKYGQVD-SITS  172
            P  R+SA P  D              TN LWVGNL   V+E +L ALF  +G +D ++  
Sbjct  11   PEARASASPPKDAVASGAGAAAGFLETNTLWVGNLPSYVSEGDLMALFAPHGALDCALAR  70

Query  171  YSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAKPV  46
              +RSYAF+ FR+  +A+AA +A +G  ++G  ++ EFA+P 
Sbjct  71   AGSRSYAFVLFRTPAEARAAVEATRGEKVKGAAMRTEFARPA  112


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A  NLWVG ++P V++ EL   F+K+G+V+ +     ++ A++ F  LEDA +A  +L G
Sbjct  114  AVRNLWVGGISPSVSKEELEEEFQKFGKVEGVAFSQDQTSAYVDFEKLEDAISAHRSLNG  173

Query  93   TVLRGNPLKIEFAK  52
              L G  L ++F +
Sbjct  174  RTLGGKELCVDFQR  187



>ref|XP_004956511.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Setaria italica]
 ref|XP_004956512.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Setaria italica]
 ref|XP_004956513.1| PREDICTED: flowering time control protein FPA-like isoform X3 
[Setaria italica]
Length=1011

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 59/112 (53%), Gaps = 13/112 (12%)
 Frame = -2

Query  363  QPNTEQPFMQS----RVSTMVPPFRSS----AKPESDTATNNLWVGNLTPDVTEAELTAL  208
            Q   E+P+        V    PP R+S    A P     + +LWVG L P VT ++L+ L
Sbjct  18   QRGDERPYRHGARVDEVPCTTPPRRASGWGVAPP-----SRHLWVGGLAPGVTASDLSEL  72

Query  207  FEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            F + G V+ I     R++AF+ FR   DA AA   LQG  L G P++IEF+K
Sbjct  73   FLRCGDVEGIARDPGRNFAFVSFRREGDAVAAVRGLQGARLAGAPVRIEFSK  124



>ref|XP_006857606.1| hypothetical protein AMTR_s00061p00106080 [Amborella trichopoda]
 gb|ERN19073.1| hypothetical protein AMTR_s00061p00106080 [Amborella trichopoda]
Length=637

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = -2

Query  282  SDTATN-NLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            +DT T+ +LWVGN++  VTE  L   F ++G+++SI  Y  R+YAF+ FR  EDA  A  
Sbjct  478  NDTGTSRHLWVGNISRHVTENALAEQFSRFGELESIAMYPERNYAFVNFRREEDAALALR  537

Query  105  ALQGTVLRGNPLKIEFAK  52
             LQG ++    +KIEFAK
Sbjct  538  GLQGFLIGNLAMKIEFAK  555



>ref|XP_010864934.1| PREDICTED: putative RNA-binding protein 15B [Esox lucius]
Length=857

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = -2

Query  309  PFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----SYAF  148
            P     KPE D  A  NL++GNL  +VTE EL   F+KYG ++ +     AR    +YAF
Sbjct  279  PEHDDLKPEDDARACRNLFIGNLDHNVTEGELRRGFDKYGIIEEVVIKRPARGQGGAYAF  338

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            L F++L+ A  AK A+QG V+ GNP+KI + K
Sbjct  339  LKFQNLDMAHRAKMAMQGRVIGGNPVKIGYGK  370



>ref|XP_010689354.1| PREDICTED: flowering time control protein FPA [Beta vulgaris 
subsp. vulgaris]
Length=943

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+  + ++ +   F ++G+++++  +  RSYAF+ F   EDA+AA  +LQG 
Sbjct  51   SRHLWVGNLSHHIDQSTIVDHFIRFGELENVACHPGRSYAFVNFMREEDARAALHSLQGF  110

Query  90   VLRGNPLKIEFAK  52
             L G PL+IEFAK
Sbjct  111  SLAGMPLRIEFAK  123


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -2

Query  282  SDTATNNLWVGNLT-PDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKD  106
            SD  +  LW+G  +   V +  L   F  +G ++ IT++  R+YAF+ FR+L  A  AK+
Sbjct  180  SDHPSEILWIGFPSFMKVDDTILRKAFSPFGDIEKITAFPGRTYAFVQFRNLASACRAKE  239

Query  105  ALQGTVLRGNP-LKIEFAK  52
             LQG +  GNP + I FA+
Sbjct  240  TLQGKLF-GNPRVHISFAR  257



>ref|XP_629218.1| hypothetical protein DDB_G0293252 [Dictyostelium discoideum AX4]
 gb|EAL60825.1| hypothetical protein DDB_G0293252 [Dictyostelium discoideum AX4]
Length=691

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 35/86 (41%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = -2

Query  306  FRSSAKP-ESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSL  130
            F    KP + +T T NLW+GN+  +V+   L  +F+++G VD+I     R  AF+ F ++
Sbjct  262  FDQYNKPHQEETPTKNLWLGNVNSNVSYELLKQIFDQFGNVDTIRILHGRGCAFVNFFTV  321

Query  129  EDAKAAKDALQGTVLRGNPLKIEFAK  52
            E A AA++ L GT++ G PLKI F K
Sbjct  322  ESAAAARNGLNGTMVCGMPLKINFRK  347


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/89 (33%), Positives = 46/89 (52%), Gaps = 0/89 (0%)
 Frame = -2

Query  318  MVPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYF  139
            M P +++         T  +W GN+ P+ TE E+  LF ++G + +I     +  AF+ F
Sbjct  160  MAPHYQNKGAGGQLEPTKIVWAGNINPESTEEEVRHLFSQFGYLQAIKIIPNKQCAFITF  219

Query  138  RSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
              +  A  A+  L GT+ RG PLK+ F K
Sbjct  220  ADVNCAIQAQFNLNGTIFRGLPLKLGFGK  248



>ref|XP_010238038.1| PREDICTED: flowering time control protein FPA [Brachypodium distachyon]
Length=985

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 59/100 (59%), Gaps = 9/100 (9%)
 Frame = -2

Query  345  PFMQSRVSTMVPPFRSS----AKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSI  178
            P + +R    +PP RSS    A P     + +LWVG+L   VT ++L+ LF + G+++ I
Sbjct  27   PRLGARDEPPLPPRRSSGWGVAPP-----SRHLWVGSLGSGVTVSDLSELFLRCGEIEGI  81

Query  177  TSYSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEF  58
            T    RS+AF+ F    +A AA   LQGT LRG P++IEF
Sbjct  82   TRDPGRSFAFVSFMREHEAVAAVRELQGTRLRGAPIRIEF  121



>ref|XP_004251817.1| PREDICTED: flowering time control protein FPA [Solanum lycopersicum]
Length=909

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+  ++E+ L + F ++G ++ +     RSYAF+ F+ +E A AA   LQG 
Sbjct  32   SRHLWVGNLSHSLSESTLASHFLRFGDLERVAFQPGRSYAFINFKDVEGAFAAIRHLQGY  91

Query  90   VLRGNPLKIEFAK  52
            V+ GNPL+IEF K
Sbjct  92   VVAGNPLRIEFTK  104



>ref|XP_004501989.1| PREDICTED: flowering time control protein FPA-like [Cicer arietinum]
Length=935

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+ ++ E EL   F ++G ++ +     RSYAF+ F   EDA  A  +LQG 
Sbjct  46   SRHLWVGNLSHNLVEDELAHHFIRFGPLEKVAFQPGRSYAFINFEVDEDAIDAMRSLQGF  105

Query  90   VLRGNPLKIEFAK  52
             L GNPL+IEFAK
Sbjct  106  PLAGNPLRIEFAK  118



>ref|XP_005469809.1| PREDICTED: putative RNA-binding protein 15B-like [Oreochromis 
niloticus]
Length=847

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = -2

Query  309  PFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQV-DSITSYSAR----SYAF  148
            P     KPE D  AT+NL++GNL  +VTEAEL   F+KYG + D +    +R    +YAF
Sbjct  260  PVVEDLKPEDDQRATSNLFIGNLDGNVTEAELRRGFDKYGIIEDVVIKRPSRGQGGAYAF  319

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            + F++L+ A  AK A+QG ++ GNP+KI + K
Sbjct  320  VKFQNLDMAHRAKVAMQGRLIGGNPIKIGYGK  351



>ref|XP_006801942.1| PREDICTED: putative RNA-binding protein 15B-like [Neolamprologus 
brichardi]
Length=845

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = -2

Query  309  PFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQV-DSITSYSAR----SYAF  148
            P     KPE D  AT+NL++GNL  +VTEAEL   F+KYG + D +    +R    +YAF
Sbjct  260  PVVEDLKPEDDQRATSNLFIGNLDGNVTEAELRRGFDKYGIIEDVVIKRPSRGQGGAYAF  319

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            + F++L+ A  AK A+QG ++ GNP+KI + K
Sbjct  320  VKFQNLDMAHRAKVAMQGRLIGGNPIKIGYGK  351



>ref|XP_005928999.1| PREDICTED: putative RNA-binding protein 15B-like [Haplochromis 
burtoni]
Length=843

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = -2

Query  309  PFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQV-DSITSYSAR----SYAF  148
            P     KPE D  AT+NL++GNL  +VTEAEL   F+KYG + D +    +R    +YAF
Sbjct  260  PVVEDLKPEDDQRATSNLFIGNLDGNVTEAELRRGFDKYGIIEDVVIKRPSRGQGGAYAF  319

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            + F++L+ A  AK A+QG ++ GNP+KI + K
Sbjct  320  VKFQNLDMAHRAKVAMQGRLIGGNPIKIGYGK  351



>ref|XP_005740940.1| PREDICTED: putative RNA-binding protein 15B-like [Pundamilia 
nyererei]
Length=845

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = -2

Query  309  PFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQV-DSITSYSAR----SYAF  148
            P     KPE D  AT+NL++GNL  +VTEAEL   F+KYG + D +    +R    +YAF
Sbjct  260  PVVEDLKPEDDQRATSNLFIGNLDGNVTEAELRRGFDKYGIIEDVVIKRPSRGQGGAYAF  319

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            + F++L+ A  AK A+QG ++ GNP+KI + K
Sbjct  320  VKFQNLDMAHRAKVAMQGRLIGGNPIKIGYGK  351



>ref|XP_009775910.1| PREDICTED: flowering time control protein FPA [Nicotiana sylvestris]
Length=921

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+  ++E+ L   F ++G ++S+     RSYAF+ FR  E A AA   LQG 
Sbjct  32   SRHLWVGNLSHSLSESTLADHFLRFGDLESVAFQPGRSYAFINFRDEEGAFAAIRHLQGY  91

Query  90   VLRGNPLKIEFAK  52
             + GNPL+IEF K
Sbjct  92   AVAGNPLRIEFTK  104



>ref|XP_004559039.1| PREDICTED: putative RNA-binding protein 15B-like [Maylandia zebra]
Length=847

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = -2

Query  309  PFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQV-DSITSYSAR----SYAF  148
            P     KPE D  AT+NL++GNL  +VTEAEL   F+KYG + D +    +R    +YAF
Sbjct  260  PVVEDLKPEDDQRATSNLFIGNLDGNVTEAELRRGFDKYGIIEDVVIKRPSRGQGGAYAF  319

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            + F++L+ A  AK A+QG ++ GNP+KI + K
Sbjct  320  VKFQNLDMAHRAKVAMQGRLIGGNPIKIGYGK  351



>ref|XP_009621299.1| PREDICTED: flowering time control protein FPA isoform X1 [Nicotiana 
tomentosiformis]
Length=921

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+  ++E+ L   F ++G ++S+     RSYAF+ FR  E A AA   LQG 
Sbjct  32   SRHLWVGNLSHSLSESTLADHFLRFGDLESVAFQPGRSYAFINFRDEEGAFAAIRHLQGY  91

Query  90   VLRGNPLKIEFAK  52
             + GNPL+IEF K
Sbjct  92   AVAGNPLRIEFTK  104



>emb|CDQ91294.1| unnamed protein product [Oncorhynchus mykiss]
Length=783

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 6/92 (7%)
 Frame = -2

Query  309  PFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----SYAF  148
            P     KPE D  A  NL++GNL  +VTE EL   F+KYG ++ +     AR    +YAF
Sbjct  277  PEHDDIKPEDDARACRNLFIGNLDHNVTEGELRRGFDKYGIIEEVVIKRPARGQGGAYAF  336

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            L F++L+ A  AK  +QG V+ GNP+KI + K
Sbjct  337  LKFQNLDMAHRAKITMQGRVIGGNPVKIGYGK  368



>ref|XP_009407917.1| PREDICTED: flowering time control protein FPA isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407918.1| PREDICTED: flowering time control protein FPA isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407919.1| PREDICTED: flowering time control protein FPA isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407920.1| PREDICTED: flowering time control protein FPA isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407921.1| PREDICTED: flowering time control protein FPA isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=965

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+  VT+  L   F ++G +++I     RSYAF+ ++  EDA  A   LQG+
Sbjct  33   SRHLWVGNLSSHVTQNTLYEHFLRFGDIENIAYMPGRSYAFVNYKKEEDAVIALRGLQGS  92

Query  90   VLRGNPLKIEFAK  52
            ++ GN L++EFAK
Sbjct  93   IVAGNSLRVEFAK  105


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G  +  +V E  L   F  +G++++I ++  RSYAF+ +RS+  A  AK+ALQG + 
Sbjct  164  LWIGFPVYLNVEEEALRRAFSPFGEIENIATFPGRSYAFVRYRSIVAACRAKEALQGKLF  223

Query  84   RGNPLKIEFAK  52
                + I FA+
Sbjct  224  NNPRVHICFAR  234



>ref|XP_009407922.1| PREDICTED: flowering time control protein FPA isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=964

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+  VT+  L   F ++G +++I     RSYAF+ ++  EDA  A   LQG+
Sbjct  32   SRHLWVGNLSSHVTQNTLYEHFLRFGDIENIAYMPGRSYAFVNYKKEEDAVIALRGLQGS  91

Query  90   VLRGNPLKIEFAK  52
            ++ GN L++EFAK
Sbjct  92   IVAGNSLRVEFAK  104


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -2

Query  261  LWVG-NLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            LW+G  +  +V E  L   F  +G++++I ++  RSYAF+ +RS+  A  AK+ALQG + 
Sbjct  163  LWIGFPVYLNVEEEALRRAFSPFGEIENIATFPGRSYAFVRYRSIVAACRAKEALQGKLF  222

Query  84   RGNPLKIEFAK  52
                + I FA+
Sbjct  223  NNPRVHICFAR  233



>ref|XP_006350011.1| PREDICTED: flowering time control protein FPA-like [Solanum tuberosum]
Length=909

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL+  ++E+ L   F ++G ++ +     RSYAF+ F+ +E A AA   LQG 
Sbjct  32   SRHLWVGNLSHSLSESTLANHFLRFGDLERVAFQPGRSYAFINFKDVEGAFAAIRHLQGY  91

Query  90   VLRGNPLKIEFAK  52
            V+ GNPL+IEF K
Sbjct  92   VVAGNPLRIEFTK  104



>ref|XP_007251604.1| PREDICTED: putative RNA-binding protein 15B [Astyanax mexicanus]
Length=864

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 42/101 (42%), Positives = 59/101 (58%), Gaps = 6/101 (6%)
 Frame = -2

Query  336  QSRVSTMVPPFRSSAKPESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSA  163
            +SR   +        KPE D  AT NL++GNL  +V+EAEL   FEKYG ++ +     A
Sbjct  295  RSRALALQLQVEEDLKPEDDQRATRNLFIGNLDHNVSEAELRQGFEKYGVIEEVVIKRPA  354

Query  162  R----SYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            R    +YAF+ F++L+ A  AK A+QG V  GN +KI + K
Sbjct  355  RGQGCAYAFIKFQNLDMAHRAKVAMQGRVFGGNQVKIGYGK  395


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/75 (35%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            T  LWVG L P+V+ A L   F+++G + +I      ++A++++ SL+ A+AA   ++G 
Sbjct  399  TTRLWVGGLGPNVSLAALAREFDRFGSIRTIDYVKGDNFAYIHYESLDAAQAACAQMRGF  458

Query  90   VLRG--NPLKIEFAK  52
             L G    L+++FAK
Sbjct  459  PLGGPNRRLRVDFAK  473



>ref|XP_010929002.1| PREDICTED: flowering time control protein FPA-like isoform X2 
[Elaeis guineensis]
Length=900

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL P  T + L   F ++G++++I     RSYAF+ ++  EDA  A   LQG 
Sbjct  38   SRHLWVGNLGPQATRSTLLEHFLRFGEIENIAYIPGRSYAFVDYKKEEDAVIALRGLQGF  97

Query  90   VLRGNPLKIEFAK  52
               G PL+IEFAK
Sbjct  98   KFDGMPLRIEFAK  110


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 51/95 (54%), Gaps = 9/95 (9%)
 Frame = -2

Query  309  PFRSSAKPESDTATNN--------LWVGNLT-PDVTEAELTALFEKYGQVDSITSYSARS  157
            P R S +   D +  N        LW+G  +  +V E  L   F  +G++++IT++  RS
Sbjct  146  PLRLSPEKSYDKSKGNNSAEPSEMLWIGFPSFLNVDEVVLRMAFSPFGEIENITTFPGRS  205

Query  156  YAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            YAF+ +RS+  A  AK+ALQG +     + I FAK
Sbjct  206  YAFVRYRSVVAACKAKEALQGKLFNNPHVNICFAK  240



>ref|XP_010928998.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Elaeis guineensis]
 ref|XP_010928999.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Elaeis guineensis]
 ref|XP_010929001.1| PREDICTED: flowering time control protein FPA-like isoform X1 
[Elaeis guineensis]
Length=947

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVGNL P  T + L   F ++G++++I     RSYAF+ ++  EDA  A   LQG 
Sbjct  38   SRHLWVGNLGPQATRSTLLEHFLRFGEIENIAYIPGRSYAFVDYKKEEDAVIALRGLQGF  97

Query  90   VLRGNPLKIEFAK  52
               G PL+IEFAK
Sbjct  98   KFDGMPLRIEFAK  110


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 51/95 (54%), Gaps = 9/95 (9%)
 Frame = -2

Query  309  PFRSSAKPESDTATNN--------LWVGNLT-PDVTEAELTALFEKYGQVDSITSYSARS  157
            P R S +   D +  N        LW+G  +  +V E  L   F  +G++++IT++  RS
Sbjct  146  PLRLSPEKSYDKSKGNNSAEPSEMLWIGFPSFLNVDEVVLRMAFSPFGEIENITTFPGRS  205

Query  156  YAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            YAF+ +RS+  A  AK+ALQG +     + I FAK
Sbjct  206  YAFVRYRSVVAACKAKEALQGKLFNNPHVNICFAK  240



>ref|WP_004039180.1| RNP-1 like RNA-binding protein [Methanofollis liminatans]
 gb|EJG07422.1| RNP-1 like RNA-binding protein [Methanofollis liminatans DSM 
4140]
Length=86

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            T+ L+VGNLT  VTE +L  LF +YG V S+     + + F+   S E+A+ AK+AL  T
Sbjct  3    TSRLYVGNLTYSVTEKQLEELFSQYGDVKSVKIIGDKGFGFVEMGSPEEAEKAKEALNET  62

Query  90   VLRGNPLKIEFAKP  49
            V  G  L+I+ A+P
Sbjct  63   VFVGRTLRIDEAQP  76



>ref|XP_005696154.1| PREDICTED: putative RNA-binding protein 15B [Capra hircus]
Length=608

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 67/129 (52%), Gaps = 14/129 (11%)
 Frame = -2

Query  396  SPFHFFNFFLV-QPNTEQPFMQSRVSTMVPPFRSSAKPESD--------TATNNLWVGNL  244
            SP + F F    QP T+Q      ++ ++  FR++A  E +         AT NL++GNL
Sbjct  4    SPVYAFRFTKSFQPGTQQVSPSECIAMVLKAFRAAATSEHECKGYSRYGRATRNLFIGNL  63

Query  243  TPDVTEAELTALFEKYGQVDSI-----TSYSARSYAFLYFRSLEDAKAAKDALQGTVLRG  79
               V+E EL   FEKYG ++ +           +YAFL F++L+ A  AK  + G V+  
Sbjct  64   DHSVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLDMAHRAKVGMSGRVIGR  123

Query  78   NPLKIEFAK  52
            NP+KI + K
Sbjct  124  NPIKIGYGK  132



>ref|XP_011145506.1| PREDICTED: hrp65 protein isoform X2 [Harpegnathos saltator]
Length=411

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  276  TATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQ  97
            +  N L++GNLT DVTE E+  +F KYG++  +     +S+AFL      +A+ AK  L 
Sbjct  58   SGRNRLYIGNLTNDVTEEEIQTMFRKYGEISELFVNKEKSFAFLRMDYRINAEKAKHELD  117

Query  96   GTVLRGNPLKIEFA  55
            GTV +G  LK+ FA
Sbjct  118  GTVRKGRALKVRFA  131



>ref|XP_011145504.1| PREDICTED: hrp65 protein isoform X1 [Harpegnathos saltator]
Length=450

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  276  TATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQ  97
            +  N L++GNLT DVTE E+  +F KYG++  +     +S+AFL      +A+ AK  L 
Sbjct  58   SGRNRLYIGNLTNDVTEEEIQTMFRKYGEISELFVNKEKSFAFLRMDYRINAEKAKHELD  117

Query  96   GTVLRGNPLKIEFA  55
            GTV +G  LK+ FA
Sbjct  118  GTVRKGRALKVRFA  131



>gb|AHF96528.1| RNP-1 like RNA-binding protein [Desulfurella acetivorans A63]
 gb|AHF96799.1| RNP-1 like RNA-binding protein [Desulfurella acetivorans A63]
Length=94

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            TN L+VGNL    TE +L  +F  YG V S+     + + F+   S +DA+ AKDAL  T
Sbjct  3    TNKLYVGNLNYRTTEEKLKEVFSGYGNVVSVKVIEGKGFGFVEMESKDDAQKAKDALDNT  62

Query  90   VLRGNPLKIEFAKP  49
             L G  ++++ AKP
Sbjct  63   DLDGRNIRVDEAKP  76



>ref|WP_021327387.1| RNP-1 like protein RNA-binding protein [candidate division ZIXI]
 gb|EQB62635.1| RNP-1 like protein RNA-binding protein [candidate division ZIXI 
bacterium RBG-1]
Length=105

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -2

Query  273  ATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQG  94
            A+N L+VGNL   VTE EL  +F  +GQV S+   + + + F+   +   A+AAK+AL G
Sbjct  2    ASNKLYVGNLNYQVTEEELREIFSAHGQVLSVNLIAGKGFGFVEMDTPASAQAAKEALNG  61

Query  93   TVLRGNPLKIEFAKP  49
            T L+G  + ++ A+P
Sbjct  62   TDLQGRTMNVDEARP  76



>gb|EFN80529.1| Hrp65 protein [Harpegnathos saltator]
Length=589

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  276  TATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQ  97
            +  N L++GNLT DVTE E+  +F KYG++  +     +S+AFL      +A+ AK  L 
Sbjct  171  SGRNRLYIGNLTNDVTEEEIQTMFRKYGEISELFVNKEKSFAFLRMDYRINAEKAKHELD  230

Query  96   GTVLRGNPLKIEFA  55
            GTV +G  LK+ FA
Sbjct  231  GTVRKGRALKVRFA  244



>ref|WP_026308251.1| MULTISPECIES: RNA-binding protein [unclassified Atribacteria]
Length=86

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -2

Query  261  LWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVLR  82
            L+VGNL   VT  +LT +F  YG+V S+     + + F+   S ++A+ AKDAL  T   
Sbjct  6    LYVGNLKYSVTNDQLTEVFSAYGEVKSVNIIEGKGFGFVEMSSPQEAEKAKDALNNTDFD  65

Query  81   GNPLKIEFAKP  49
            G PLKI+ A+P
Sbjct  66   GRPLKIDEARP  76



>ref|WP_014868175.1| RNA recognition motif-containing protein [Methanoculleus bourgensis]
 ref|YP_006545918.1| RNA recognition motif-containing protein [Methanoculleus bourgensis 
MS2]
 emb|CCJ37202.1| RNA recognition motif-containing protein [Methanoculleus bourgensis 
MS2]
Length=86

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            ++ L+VGNLT  V E +L  LF +YG V+ +     + + F+   S E+A+ AK+AL  T
Sbjct  3    SSKLYVGNLTYSVNEEQLKELFAQYGTVNDVRVIERKGFGFVEMSSPEEAEKAKEALNDT  62

Query  90   VLRGNPLKIEFAKP  49
            V  G  LKI+ A+P
Sbjct  63   VFEGRTLKIDEARP  76



>ref|XP_008078096.1| RNA-binding, RBD [Glarea lozoyensis ATCC 20868]
 gb|EHK96478.1| putative Uncharacterized RNA-binding protein C25G10.01 [Glarea 
lozoyensis 74030]
 gb|EPE35109.1| RNA-binding, RBD [Glarea lozoyensis ATCC 20868]
Length=296

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 53/107 (50%), Gaps = 9/107 (8%)
 Frame = -2

Query  345  PFMQSRVSTMVPPFRSSAKPESDTATN---NLWVGNLTPDVTEAELTALFEKYGQVDSIT  175
            P       +  PP      P+ D A N   NL+V  + P ++E E+T LFEKYG V+   
Sbjct  49   PAGNGHTDSRGPPKNDRGAPQDDGAINPGSNLFVTGIHPRLSEVEVTRLFEKYGDVEKCQ  108

Query  174  ------SYSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
                  +  +R + F+   + E A AAK+ LQG V+ G  L IE A+
Sbjct  109  IMLDPHTKESRGFGFVKMETAEQADAAKEGLQGEVIEGRTLSIEKAR  155



>gb|EFN71412.1| Hrp65 protein [Camponotus floridanus]
Length=548

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  276  TATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQ  97
            +  N L++GNLT DVTE E+  +F+KYG++  +     +S+AFL      +A  AK  L 
Sbjct  134  SGRNRLYIGNLTNDVTEEEIQTMFQKYGEISELFVNKEKSFAFLRMDYKANADTAKRELD  193

Query  96   GTVLRGNPLKIEFA  55
            GT+ +G  LK+ FA
Sbjct  194  GTMRKGRALKVRFA  207



>gb|KFY43057.1| hypothetical protein V495_04193, partial [Pseudogymnoascus pannorum 
VKM F-4514 (FW-929)]
Length=214

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 56/107 (52%), Gaps = 9/107 (8%)
 Frame = -2

Query  345  PFMQSRVSTMVPPFRSSAKPESDTATN---NLWVGNLTPDVTEAELTALFEKYGQVDSIT  175
            P    +V +  P       P+ D A N   NL+V  + P ++EAE+T LFEKYG+V+   
Sbjct  46   PGGNGQVDSRGPKNDRGPPPQDDGAVNPGSNLFVTGIHPRLSEAEVTRLFEKYGEVEKCQ  105

Query  174  ------SYSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
                  +  +R + F+   + E A AAK+ LQG V+ G  L IE A+
Sbjct  106  IMLDPHTKESRGFGFVKMVTAEQADAAKEGLQGEVIEGRTLSIEKAR  152



>ref|XP_011065115.1| PREDICTED: protein no-on-transient A-like isoform X2 [Acromyrmex 
echinatior]
Length=469

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  276  TATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQ  97
            +  N L+VGNLT DVTE E+  +F+KYG++  +     +S+AFL      +A  AK  L 
Sbjct  117  SGRNRLYVGNLTNDVTEEEIQTMFQKYGEISELFVNKEKSFAFLRLDYKANADTAKRELD  176

Query  96   GTVLRGNPLKIEFA  55
            G++ +G  LK+ FA
Sbjct  177  GSMRKGRALKVRFA  190



>ref|XP_011065114.1| PREDICTED: protein no-on-transient A-like isoform X1 [Acromyrmex 
echinatior]
Length=532

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  315  VPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFR  136
            +PP  ++ K  S    N L+VGNLT DVTE E+  +F+KYG++  +     +S+AFL   
Sbjct  106  LPPQDTTEKKFS--GRNRLYVGNLTNDVTEEEIQTMFQKYGEISELFVNKEKSFAFLRLD  163

Query  135  SLEDAKAAKDALQGTVLRGNPLKIEFA  55
               +A  AK  L G++ +G  LK+ FA
Sbjct  164  YKANADTAKRELDGSMRKGRALKVRFA  190



>gb|EGI58932.1| Hrp65 protein [Acromyrmex echinatior]
Length=510

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  315  VPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFR  136
            +PP  ++ K  S    N L+VGNLT DVTE E+  +F+KYG++  +     +S+AFL   
Sbjct  84   LPPQDTTEKKFS--GRNRLYVGNLTNDVTEEEIQTMFQKYGEISELFVNKEKSFAFLRLD  141

Query  135  SLEDAKAAKDALQGTVLRGNPLKIEFA  55
               +A  AK  L G++ +G  LK+ FA
Sbjct  142  YKANADTAKRELDGSMRKGRALKVRFA  168



>gb|KGL84141.1| Putative RNA-binding protein 15B [Tinamus guttatus]
Length=410

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSI-----TSYSARSYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +           +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>ref|XP_007288071.1| RNA recognition domain-containing protein [Marssonina brunnea 
f. sp. 'multigermtubi' MB_m1]
 gb|EKD21069.1| RNA recognition domain-containing protein [Marssonina brunnea 
f. sp. 'multigermtubi' MB_m1]
Length=321

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 53/107 (50%), Gaps = 9/107 (8%)
 Frame = -2

Query  345  PFMQSRVSTMVPPFRSSAKPESDTATN---NLWVGNLTPDVTEAELTALFEKYGQVDSIT  175
            P       +  PP      P+ D A N   NL+V  + P ++E E+T LFEKYG V+   
Sbjct  48   PNGNGHADSRGPPKNDRGAPQDDGAINPGSNLFVTGIHPRLSEQEVTRLFEKYGDVEKCQ  107

Query  174  ------SYSARSYAFLYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
                  +  +R + F+   + + A AAK+ LQG V+ G  L IE A+
Sbjct  108  IMLDPHTKESRGFGFVKMVTADQADAAKEGLQGEVIEGRTLSIEKAR  154



>ref|XP_003528518.1| PREDICTED: glycine-rich RNA-binding protein 4, mitochondrial-like 
[Glycine max]
 gb|KHN43055.1| Glycine-rich RNA-binding protein 2, mitochondrial [Glycine soja]
Length=137

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 45/84 (54%), Gaps = 6/84 (7%)
 Frame = -2

Query  288  PESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT------SYSARSYAFLYFRSLE  127
            P S  ++N L+VG L+  V    L   F  +G V  +T      S  +R + F+ F + +
Sbjct  31   PPSHASSNKLFVGGLSWSVDHKSLKEAFSSFGDVTEVTIVYDKDSGRSRGFGFVIFSNED  90

Query  126  DAKAAKDALQGTVLRGNPLKIEFA  55
            DAK AKDA+ G  L G PL+I FA
Sbjct  91   DAKCAKDAMDGKALLGRPLRINFA  114



>ref|XP_010222941.1| PREDICTED: putative RNA-binding protein 15B, partial [Tinamus 
guttatus]
Length=446

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSI-----TSYSARSYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +           +YAFL F++L+
Sbjct  39   PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  98

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  99   MAHRAKVAMSGRVVGRNPIKIGYGK  123



>gb|KFV49859.1| Putative RNA-binding protein 15B [Gavia stellata]
Length=549

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSI-----TSYSARSYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +           +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEGELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>ref|XP_009805490.1| PREDICTED: LOW QUALITY PROTEIN: putative RNA-binding protein 
15B [Gavia stellata]
Length=557

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSI-----TSYSARSYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +           +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEGELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>emb|CDS05703.1| hypothetical protein LRAMOSA08231 [Absidia idahoensis var. thermophila]
Length=366

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = -2

Query  264  NLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGTVL  85
            N++VGNL+PD TE +LT LFE++G V  +   S R YAF+   +  +A +A   LQG ++
Sbjct  208  NVYVGNLSPDTTETDLTCLFEQHGTVQEVKLQSDRGYAFVKLDTHANAASAIVKLQGMMV  267

Query  84   RGNPLKIEFAK  52
             G  LK+ + K
Sbjct  268  NGRGLKLSWGK  278



>ref|XP_007617615.1| PREDICTED: putative RNA-binding protein 15B [Cricetulus griseus]
Length=584

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 5/92 (5%)
 Frame = -2

Query  312  PPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSI-----TSYSARSYAF  148
            P     A P+   AT NL++GNL   V+E EL   FEKYG ++ +           +YAF
Sbjct  15   PAIHYPALPDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAF  74

Query  147  LYFRSLEDAKAAKDALQGTVLRGNPLKIEFAK  52
            L F++L+ A  AK A+ G V+  NP+KI + K
Sbjct  75   LKFQNLDMAHRAKVAMSGRVIGRNPIKIGYGK  106



>ref|XP_004715246.1| PREDICTED: putative RNA-binding protein 15B [Echinops telfairi]
Length=563

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSI-----TSYSARSYAFLYFRSLE  127
            PE D  AT NL++GNL   V+E EL   FEKYG ++ +           +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGTIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVIGRNPIKIGYGK  86



>ref|XP_008652528.1| PREDICTED: flowering time control protein FPA [Zea mays]
 tpg|DAA60947.1| TPA: hypothetical protein ZEAMMB73_205486 [Zea mays]
Length=1015

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -2

Query  270  TNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQGT  91
            + +LWVG L P VT ++L+ LF + G V+ +     R++AF+ F    DA AA   LQG 
Sbjct  53   SRHLWVGGLAPSVTASDLSELFLRCGDVEGVAREPGRNFAFVSFLREGDAVAAVRELQGA  112

Query  90   VLRGNPLKIEFAK  52
             L G P++IEF+K
Sbjct  113  RLAGAPVRIEFSK  125



>ref|XP_003436621.1| AGAP003794-PB [Anopheles gambiae str. PEST]
 gb|EGK96375.1| AGAP003794-PB [Anopheles gambiae str. PEST]
Length=569

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  315  VPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFR  136
            +PP    A+    +  N L+VGNLT DVTE EL  +F+ YG++  +     ++YAF+   
Sbjct  148  IPPI--EAQDVKFSGRNRLYVGNLTNDVTEEELVDMFKVYGEISEVFMNKEKNYAFVRVD  205

Query  135  SLEDAKAAKDALQGTVLRGNPLKIEFA  55
             L +A+AAK  L GT  +   L++ FA
Sbjct  206  YLSNAEAAKRGLDGTTRKNRVLRVRFA  232



>ref|XP_007061908.1| PREDICTED: putative RNA-binding protein 15B isoform X1 [Chelonia 
mydas]
Length=557

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----SYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +     AR    +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>ref|XP_310351.7| AGAP003794-PA [Anopheles gambiae str. PEST]
 gb|EAA45208.5| AGAP003794-PA [Anopheles gambiae str. PEST]
Length=595

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  315  VPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFR  136
            +PP    A+    +  N L+VGNLT DVTE EL  +F+ YG++  +     ++YAF+   
Sbjct  148  IPPI--EAQDVKFSGRNRLYVGNLTNDVTEEELVDMFKVYGEISEVFMNKEKNYAFVRVD  205

Query  135  SLEDAKAAKDALQGTVLRGNPLKIEFA  55
             L +A+AAK  L GT  +   L++ FA
Sbjct  206  YLSNAEAAKRGLDGTTRKNRVLRVRFA  232



>gb|EZA57672.1| Hrp65 protein [Cerapachys biroi]
Length=519

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  315  VPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFR  136
            +PP  ++ K  S    N L++GNLT DVTE E+  +F+KYG+V  +     +S+AFL   
Sbjct  160  LPPQETTEKKFS--GRNRLYIGNLTNDVTEEEIQNMFQKYGEVSELFVNKEKSFAFLRMD  217

Query  135  SLEDAKAAKDALQGTVLRGNPLKIEFA  55
               +A+ AK  L G + +G  LK+ FA
Sbjct  218  YKANAETAKRELDGIMRKGRALKVRFA  244



>ref|XP_004581822.1| PREDICTED: putative RNA-binding protein 15B, partial [Ochotona 
princeps]
Length=600

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSI-----TSYSARSYAFLYFRSLE  127
            PE D  AT NL++GNL   V+E EL   FEKYG ++ +           +YAFL F++L+
Sbjct  40   PEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGMIEEVVIKRPARGQGGAYAFLKFQNLD  99

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  100  MAHRAKVAMSGRVIGRNPIKIGYGK  124



>ref|XP_009956627.1| PREDICTED: putative RNA-binding protein 15B [Leptosomus discolor]
 gb|KFQ01078.1| Putative RNA-binding protein 15B [Leptosomus discolor]
Length=555

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----SYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +     AR    +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>ref|XP_009995230.1| PREDICTED: putative RNA-binding protein 15B [Chaetura pelagica]
 gb|KFU89096.1| Putative RNA-binding protein 15B [Chaetura pelagica]
Length=555

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----SYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +     AR    +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>gb|KFQ75625.1| Putative RNA-binding protein 15B [Phoenicopterus ruber ruber]
Length=559

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----SYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +     AR    +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>ref|XP_003706377.1| PREDICTED: hrp65 protein-like [Megachile rotundata]
Length=566

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -2

Query  315  VPPFRSSAKPESDTATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFR  136
            +PP  ++ K  S    N L++GNLT DVTE E+  +F++YG++  +     +++AFL   
Sbjct  136  LPPQETTEKKFS--GRNRLYIGNLTNDVTEEEIQQMFQQYGEISELFVNKEKNFAFLRMD  193

Query  135  SLEDAKAAKDALQGTVLRGNPLKIEFA  55
               +A+ AK  L GT+ +G  LK+ FA
Sbjct  194  YRVNAEKAKHELDGTMRKGRALKVRFA  220



>ref|XP_009679042.1| PREDICTED: putative RNA-binding protein 15B [Struthio camelus 
australis]
 gb|KFV84334.1| Putative RNA-binding protein 15B [Struthio camelus australis]
Length=557

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----SYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +     AR    +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>gb|KFP57133.1| Putative RNA-binding protein 15B [Cathartes aura]
Length=557

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----SYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +     AR    +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>ref|XP_006607185.1| PREDICTED: hrp65 protein-like isoform X4 [Apis dorsata]
Length=437

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  276  TATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQ  97
            +  N L++GNLT DVTE E+  +F++YG++  +     +++AFL      +A+ AK  L 
Sbjct  79   SGRNRLYIGNLTNDVTEEEIQQMFQQYGEISELFVNKEKNFAFLRMDYRVNAEKAKHELD  138

Query  96   GTVLRGNPLKIEFA  55
            GT+ +G  LK+ FA
Sbjct  139  GTMRKGRALKVRFA  152



>ref|XP_009889561.1| PREDICTED: putative RNA-binding protein 15B [Charadrius vociferus]
 gb|KGL98284.1| Putative RNA-binding protein 15B [Charadrius vociferus]
Length=557

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----SYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +     AR    +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>ref|XP_009868987.1| PREDICTED: putative RNA-binding protein 15B [Apaloderma vittatum]
 gb|KFP89567.1| Putative RNA-binding protein 15B [Apaloderma vittatum]
Length=550

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----SYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +     AR    +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>ref|XP_006607186.1| PREDICTED: hrp65 protein-like isoform X5 [Apis dorsata]
Length=433

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  276  TATNNLWVGNLTPDVTEAELTALFEKYGQVDSITSYSARSYAFLYFRSLEDAKAAKDALQ  97
            +  N L++GNLT DVTE E+  +F++YG++  +     +++AFL      +A+ AK  L 
Sbjct  79   SGRNRLYIGNLTNDVTEEEIQQMFQQYGEISELFVNKEKNFAFLRMDYRVNAEKAKHELD  138

Query  96   GTVLRGNPLKIEFA  55
            GT+ +G  LK+ FA
Sbjct  139  GTMRKGRALKVRFA  152



>ref|XP_009637663.1| PREDICTED: putative RNA-binding protein 15B [Egretta garzetta]
 gb|KFP16408.1| Putative RNA-binding protein 15B [Egretta garzetta]
Length=557

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSI-----TSYSARSYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +           +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>ref|XP_009279337.1| PREDICTED: putative RNA-binding protein 15B [Aptenodytes forsteri]
 ref|XP_009320102.1| PREDICTED: putative RNA-binding protein 15B [Pygoscelis adeliae]
 gb|KFM01168.1| Putative RNA-binding protein 15B [Aptenodytes forsteri]
 gb|KFW65636.1| Putative RNA-binding protein 15B [Pygoscelis adeliae]
Length=557

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSI-----TSYSARSYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +           +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>ref|XP_006909243.1| PREDICTED: putative RNA-binding protein 15B [Pteropus alecto]
Length=719

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----SYAFLYFRSLE  127
            PE D  AT NL++GNL   V+E EL   FEKYG ++ +     AR    +YAFL F++L+
Sbjct  159  PEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  218

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  219  MAHRAKVAMSGRVIGRNPIKIGYGK  243



>gb|KFQ79672.1| Putative RNA-binding protein 15B [Phaethon lepturus]
Length=540

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----SYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +     AR    +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>ref|XP_008497177.1| PREDICTED: putative RNA-binding protein 15B [Calypte anna]
 gb|KFP04847.1| Putative RNA-binding protein 15B [Calypte anna]
Length=557

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSIT-SYSAR----SYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +     AR    +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>gb|KFW95248.1| Putative RNA-binding protein 15B [Phalacrocorax carbo]
Length=557

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSI-----TSYSARSYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +           +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



>ref|XP_005422468.1| PREDICTED: putative RNA-binding protein 15B [Geospiza fortis]
Length=557

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = -2

Query  288  PESDT-ATNNLWVGNLTPDVTEAELTALFEKYGQVDSI-----TSYSARSYAFLYFRSLE  127
            PE D  AT NL++GNL  +V+E EL   FEKYG ++ +           +YAFL F++L+
Sbjct  2    PEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLD  61

Query  126  DAKAAKDALQGTVLRGNPLKIEFAK  52
             A  AK A+ G V+  NP+KI + K
Sbjct  62   MAHRAKVAMSGRVVGRNPIKIGYGK  86



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 820624058880