BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25406_g1_i8 len=3415 path=[1763:0-401 2165:402-432 20747:433-437
18479:438-685 12874:686-723 19216:724-762 @12948@!:763-2794
14979:2795-3071 3730:3072-3414]

Length=3415
                                                                      Score     E

ref|XP_009618316.1|  PREDICTED: pentatricopeptide repeat-containi...   1049   0.0      
ref|XP_009780195.1|  PREDICTED: pentatricopeptide repeat-containi...   1039   0.0      
ref|XP_004250478.1|  PREDICTED: pentatricopeptide repeat-containi...   1014   0.0      
ref|XP_006361496.1|  PREDICTED: pentatricopeptide repeat-containi...    993   0.0      
emb|CDO99888.1|  unnamed protein product                                887   0.0      
ref|XP_006436646.1|  hypothetical protein CICLE_v10030857mg             860   0.0      
gb|KDO42139.1|  hypothetical protein CISIN_1g005881mg                   840   0.0      
ref|XP_010242606.1|  PREDICTED: pentatricopeptide repeat-containi...    830   0.0      
ref|XP_007010243.1|  Pentatricopeptide repeat-containing protein        826   0.0      
ref|XP_011102135.1|  PREDICTED: pentatricopeptide repeat-containi...    820   0.0      
gb|EYU37193.1|  hypothetical protein MIMGU_mgv1a021143mg                762   0.0      
ref|XP_010943720.1|  PREDICTED: pentatricopeptide repeat-containi...    682   0.0      
ref|XP_008801246.1|  PREDICTED: pentatricopeptide repeat-containi...    678   0.0      
ref|XP_006855329.1|  hypothetical protein AMTR_s00057p00087430          676   0.0      
ref|XP_009406673.1|  PREDICTED: pentatricopeptide repeat-containi...    628   0.0      
ref|XP_010244384.1|  PREDICTED: pentatricopeptide repeat-containi...    484   3e-150   
gb|KCW87396.1|  hypothetical protein EUGRSUZ_B03875                     481   6e-150   
ref|XP_010045232.1|  PREDICTED: pentatricopeptide repeat-containi...    481   6e-149   
ref|XP_006849876.1|  hypothetical protein AMTR_s00022p00075660          474   3e-148   
emb|CBI21510.3|  unnamed protein product                                472   4e-147   
gb|AEB39781.1|  pentatricopeptide repeat protein 79                     469   3e-145   
ref|XP_006348570.1|  PREDICTED: pentatricopeptide repeat-containi...    470   3e-145   
ref|XP_008806000.1|  PREDICTED: pentatricopeptide repeat-containi...    465   2e-144   
ref|XP_002262885.1|  PREDICTED: pentatricopeptide repeat-containi...    468   4e-144   Vitis vinifera
ref|XP_004228912.1|  PREDICTED: pentatricopeptide repeat-containi...    465   2e-143   
ref|NP_001061590.1|  Os08g0340900                                       463   6e-143   Oryza sativa Japonica Group [Japonica rice]
gb|KDP36856.1|  hypothetical protein JCGZ_08147                         459   8e-143   
ref|XP_010107584.1|  hypothetical protein L484_024440                   461   1e-142   
ref|XP_010249162.1|  PREDICTED: putative pentatricopeptide repeat...    462   2e-142   
ref|XP_010653538.1|  PREDICTED: pentatricopeptide repeat-containi...    459   3e-142   
ref|XP_002284799.1|  PREDICTED: pentatricopeptide repeat-containi...    457   3e-142   Vitis vinifera
ref|XP_010249165.1|  PREDICTED: putative pentatricopeptide repeat...    459   4e-142   
gb|EYU32070.1|  hypothetical protein MIMGU_mgv1a017635mg                458   5e-142   
ref|XP_008805366.1|  PREDICTED: pentatricopeptide repeat-containi...    467   1e-141   
emb|CAN67343.1|  hypothetical protein VITISV_038220                     456   2e-141   Vitis vinifera
ref|XP_010243341.1|  PREDICTED: pentatricopeptide repeat-containi...    460   2e-141   
gb|AHB18406.1|  pentatricopeptide repeat-containing protein             457   3e-141   
ref|XP_008675521.1|  PREDICTED: pentatricopeptide repeat-containi...    458   4e-141   
ref|XP_008787073.1|  PREDICTED: putative pentatricopeptide repeat...    461   5e-141   
ref|XP_010905005.1|  PREDICTED: pentatricopeptide repeat-containi...    465   8e-141   
gb|KCW57624.1|  hypothetical protein EUGRSUZ_H00390                     454   1e-140   
ref|XP_006349117.1|  PREDICTED: pentatricopeptide repeat-containi...    458   1e-140   
gb|KDO77668.1|  hypothetical protein CISIN_1g046775mg                   455   2e-140   
gb|KDP37589.1|  hypothetical protein JCGZ_07935                         458   2e-140   
ref|XP_010652859.1|  PREDICTED: pentatricopeptide repeat-containi...    457   3e-140   
emb|CDP06710.1|  unnamed protein product                                454   4e-140   
ref|XP_004971430.1|  PREDICTED: pentatricopeptide repeat-containi...    456   4e-140   
ref|XP_009413852.1|  PREDICTED: pentatricopeptide repeat-containi...    455   6e-140   
ref|XP_006449392.1|  hypothetical protein CICLE_v10018358mg             459   7e-140   
gb|AEB39778.1|  pentatricopeptide repeat protein 77                     464   1e-139   
ref|XP_010661558.1|  PREDICTED: putative pentatricopeptide repeat...    454   1e-139   
ref|XP_004163716.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    456   1e-139   
ref|XP_009398523.1|  PREDICTED: pentatricopeptide repeat-containi...    461   2e-139   
dbj|BAD67156.2|  PpPPR_77                                               461   3e-139   Physcomitrella patens
ref|XP_010671697.1|  PREDICTED: pentatricopeptide repeat-containi...    454   3e-139   
gb|KDP35246.1|  hypothetical protein JCGZ_09405                         451   3e-139   
ref|XP_001780298.1|  predicted protein                                  458   3e-139   
gb|KDP23280.1|  hypothetical protein JCGZ_23113                         452   4e-139   
ref|XP_004139569.1|  PREDICTED: pentatricopeptide repeat-containi...    455   4e-139   
dbj|BAD67155.1|  PpPPR_98                                               458   4e-139   Physcomitrella patens
ref|XP_010277183.1|  PREDICTED: pentatricopeptide repeat-containi...    451   5e-139   
ref|XP_010069315.1|  PREDICTED: pentatricopeptide repeat-containi...    453   8e-139   
ref|XP_004251045.1|  PREDICTED: pentatricopeptide repeat-containi...    454   9e-139   
ref|XP_002510620.1|  pentatricopeptide repeat-containing protein,...    448   9e-139   Ricinus communis
ref|XP_006827122.1|  hypothetical protein AMTR_s00010p00246970          450   9e-139   
ref|XP_008231644.1|  PREDICTED: pentatricopeptide repeat-containi...    447   2e-138   
ref|XP_009794124.1|  PREDICTED: putative pentatricopeptide repeat...    453   2e-138   
ref|XP_006467747.1|  PREDICTED: pentatricopeptide repeat-containi...    455   3e-138   
ref|XP_002305120.2|  hypothetical protein POPTR_0004s04740g             451   4e-138   Populus trichocarpa [western balsam poplar]
ref|XP_011046269.1|  PREDICTED: pentatricopeptide repeat-containi...    452   4e-138   
ref|XP_011027784.1|  PREDICTED: pentatricopeptide repeat-containi...    454   6e-138   
gb|KCW44369.1|  hypothetical protein EUGRSUZ_L02158                     449   6e-138   
ref|XP_001775099.1|  predicted protein                                  449   6e-138   
ref|XP_009370649.1|  PREDICTED: pentatricopeptide repeat-containi...    446   1e-137   
gb|KCW74539.1|  hypothetical protein EUGRSUZ_E03251                     447   2e-137   
ref|XP_010061133.1|  PREDICTED: pentatricopeptide repeat-containi...    445   2e-137   
ref|XP_010915655.1|  PREDICTED: pentatricopeptide repeat-containi...    449   3e-137   
ref|XP_007045237.1|  Tetratricopeptide repeat-like superfamily pr...    445   3e-137   
ref|XP_009378828.1|  PREDICTED: putative pentatricopeptide repeat...    448   3e-137   
ref|XP_002306231.2|  hypothetical protein POPTR_0004s19560g             445   5e-137   Populus trichocarpa [western balsam poplar]
ref|XP_011020847.1|  PREDICTED: putative pentatricopeptide repeat...    447   6e-137   
ref|XP_010255496.1|  PREDICTED: pentatricopeptide repeat-containi...    448   7e-137   
ref|XP_007025555.1|  Tetratricopeptide repeat-like superfamily pr...    450   1e-136   
ref|XP_009804600.1|  PREDICTED: pentatricopeptide repeat-containi...    448   1e-136   
ref|XP_004137966.1|  PREDICTED: pentatricopeptide repeat-containi...    445   1e-136   
ref|XP_009343153.1|  PREDICTED: pentatricopeptide repeat-containi...    444   1e-136   
ref|XP_011088875.1|  PREDICTED: pentatricopeptide repeat-containi...    447   2e-136   
ref|XP_010693463.1|  PREDICTED: pentatricopeptide repeat-containi...    442   2e-136   
ref|XP_007051907.1|  Tetratricopeptide repeat-like superfamily pr...    446   2e-136   
ref|XP_008239469.1|  PREDICTED: pentatricopeptide repeat-containi...    444   2e-136   
ref|XP_008387621.1|  PREDICTED: pentatricopeptide repeat-containi...    444   2e-136   
ref|XP_010113220.1|  hypothetical protein L484_000366                   446   2e-136   
ref|XP_010041412.1|  PREDICTED: pentatricopeptide repeat-containi...    449   3e-136   
gb|KCW57628.1|  hypothetical protein EUGRSUZ_H00398                     443   3e-136   
gb|AEB39779.1|  pentatricopeptide repeat protein 98                     450   3e-136   
ref|XP_004166371.1|  PREDICTED: pentatricopeptide repeat-containi...    444   4e-136   
ref|XP_006840276.1|  hypothetical protein AMTR_s00045p00048330          438   4e-136   
ref|XP_003567531.1|  PREDICTED: pentatricopeptide repeat-containi...    445   4e-136   
ref|XP_008358674.1|  PREDICTED: pentatricopeptide repeat-containi...    448   6e-136   
ref|XP_001774871.1|  predicted protein                                  447   7e-136   
ref|XP_009352868.1|  PREDICTED: pentatricopeptide repeat-containi...    447   7e-136   
dbj|BAJ94557.1|  predicted protein                                      443   7e-136   
gb|EYU25211.1|  hypothetical protein MIMGU_mgv1a001568mg                443   9e-136   
ref|XP_007207533.1|  hypothetical protein PRUPE_ppa015196mg             441   1e-135   
ref|XP_010057372.1|  PREDICTED: pentatricopeptide repeat-containi...    447   1e-135   
ref|XP_010932118.1|  PREDICTED: putative pentatricopeptide repeat...    447   1e-135   
ref|XP_010257871.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    446   1e-135   
ref|XP_006344830.1|  PREDICTED: pentatricopeptide repeat-containi...    441   1e-135   
ref|XP_011100907.1|  PREDICTED: pentatricopeptide repeat-containi...    440   1e-135   
gb|AEB39776.1|  pentatricopeptide repeat protein 78                     449   1e-135   
ref|XP_002304652.2|  pentatricopeptide repeat-containing family p...    443   2e-135   Populus trichocarpa [western balsam poplar]
ref|XP_010272360.1|  PREDICTED: pentatricopeptide repeat-containi...    444   2e-135   
ref|XP_010932176.1|  PREDICTED: pentatricopeptide repeat-containi...    440   2e-135   
ref|XP_008808560.1|  PREDICTED: pentatricopeptide repeat-containi...    444   2e-135   
ref|XP_007043839.1|  Tetratricopeptide repeat-like superfamily pr...    443   2e-135   
ref|XP_004306236.1|  PREDICTED: pentatricopeptide repeat-containi...    441   3e-135   
ref|XP_010657139.1|  PREDICTED: putative pentatricopeptide repeat...    443   3e-135   
ref|XP_006659345.1|  PREDICTED: pentatricopeptide repeat-containi...    443   3e-135   
ref|XP_004233934.1|  PREDICTED: pentatricopeptide repeat-containi...    439   3e-135   
ref|XP_010066066.1|  PREDICTED: pentatricopeptide repeat-containi...    441   5e-135   
ref|XP_008385706.1|  PREDICTED: pentatricopeptide repeat-containi...    442   7e-135   
ref|XP_010473800.1|  PREDICTED: pentatricopeptide repeat-containi...    440   8e-135   
ref|XP_010277283.1|  PREDICTED: pentatricopeptide repeat-containi...    449   8e-135   
ref|XP_010089854.1|  hypothetical protein L484_022371                   442   9e-135   
gb|KHN09480.1|  Pentatricopeptide repeat-containing protein, mito...    438   9e-135   
ref|XP_009797200.1|  PREDICTED: putative pentatricopeptide repeat...    443   9e-135   
ref|XP_008390176.1|  PREDICTED: putative pentatricopeptide repeat...    442   1e-134   
ref|XP_009340625.1|  PREDICTED: pentatricopeptide repeat-containi...    441   1e-134   
ref|XP_002280412.1|  PREDICTED: pentatricopeptide repeat-containi...    441   1e-134   Vitis vinifera
ref|XP_010665377.1|  PREDICTED: pentatricopeptide repeat-containi...    441   1e-134   
ref|XP_009608542.1|  PREDICTED: pentatricopeptide repeat-containi...    442   1e-134   
ref|XP_008232760.1|  PREDICTED: pentatricopeptide repeat-containi...    442   1e-134   
ref|XP_002264194.2|  PREDICTED: pentatricopeptide repeat-containi...    443   2e-134   Vitis vinifera
ref|XP_002273710.2|  PREDICTED: pentatricopeptide repeat-containi...    444   2e-134   Vitis vinifera
ref|XP_010272359.1|  PREDICTED: pentatricopeptide repeat-containi...    444   2e-134   
ref|XP_008232744.1|  PREDICTED: pentatricopeptide repeat-containi...    440   2e-134   
ref|XP_010276946.1|  PREDICTED: pentatricopeptide repeat-containi...    442   2e-134   
emb|CDO99505.1|  unnamed protein product                                439   2e-134   
ref|XP_007214178.1|  hypothetical protein PRUPE_ppa019185mg             442   2e-134   
ref|XP_009351179.1|  PREDICTED: pentatricopeptide repeat-containi...    440   3e-134   
ref|XP_008229432.1|  PREDICTED: pentatricopeptide repeat-containi...    442   3e-134   
ref|XP_004246925.1|  PREDICTED: pentatricopeptide repeat-containi...    438   3e-134   
ref|XP_007206763.1|  hypothetical protein PRUPE_ppa025253mg             437   4e-134   
ref|XP_008462120.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    441   4e-134   
ref|XP_006445136.1|  hypothetical protein CICLE_v10018890mg             439   5e-134   
ref|XP_006577708.1|  PREDICTED: pentatricopeptide repeat-containi...    439   6e-134   
ref|XP_010044231.1|  PREDICTED: pentatricopeptide repeat-containi...    440   7e-134   
ref|XP_008225136.1|  PREDICTED: pentatricopeptide repeat-containi...    443   7e-134   
ref|XP_009351131.1|  PREDICTED: pentatricopeptide repeat-containi...    439   8e-134   
gb|KCW88451.1|  hypothetical protein EUGRSUZ_A00839                     439   8e-134   
gb|KGN52982.1|  hypothetical protein Csa_4G009340                       439   9e-134   
gb|EPS67966.1|  hypothetical protein M569_06805                         441   9e-134   
ref|XP_010909807.1|  PREDICTED: pentatricopeptide repeat-containi...    439   2e-133   
ref|XP_006855406.1|  hypothetical protein AMTR_s00057p00151990          439   2e-133   
ref|XP_008385425.1|  PREDICTED: pentatricopeptide repeat-containi...    439   2e-133   
gb|KDO86035.1|  hypothetical protein CISIN_1g003584mg                   437   2e-133   
ref|XP_010249164.1|  PREDICTED: putative pentatricopeptide repeat...    437   2e-133   
ref|XP_004491510.1|  PREDICTED: putative pentatricopeptide repeat...    437   2e-133   
ref|XP_009597833.1|  PREDICTED: pentatricopeptide repeat-containi...    439   3e-133   
ref|XP_003568274.2|  PREDICTED: pentatricopeptide repeat-containi...    440   3e-133   
ref|XP_003617808.1|  Pentatricopeptide repeat-containing protein        437   5e-133   
ref|XP_004984890.1|  PREDICTED: pentatricopeptide repeat-containi...    440   5e-133   
ref|XP_006480654.1|  PREDICTED: pentatricopeptide repeat-containi...    436   5e-133   
ref|XP_010097733.1|  hypothetical protein L484_023874                   441   5e-133   
ref|XP_004308660.1|  PREDICTED: pentatricopeptide repeat-containi...    433   6e-133   
gb|ABA99524.2|  pentatricopeptide, putative, expressed                  446   6e-133   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066981.1|  Os12g0552300                                       446   6e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009600826.1|  PREDICTED: putative pentatricopeptide repeat...    438   6e-133   
ref|XP_008791051.1|  PREDICTED: putative pentatricopeptide repeat...    437   6e-133   
ref|XP_011091742.1|  PREDICTED: pentatricopeptide repeat-containi...    436   8e-133   
emb|CAN83351.1|  hypothetical protein VITISV_028907                     440   8e-133   Vitis vinifera
ref|XP_008442216.1|  PREDICTED: putative pentatricopeptide repeat...    434   8e-133   
emb|CDP06943.1|  unnamed protein product                                437   9e-133   
ref|XP_004308608.1|  PREDICTED: pentatricopeptide repeat-containi...    437   1e-132   
ref|XP_006479094.1|  PREDICTED: pentatricopeptide repeat-containi...    443   1e-132   
ref|XP_006660454.1|  PREDICTED: pentatricopeptide repeat-containi...    437   1e-132   
ref|XP_006347856.1|  PREDICTED: pentatricopeptide repeat-containi...    437   1e-132   
ref|XP_007153123.1|  hypothetical protein PHAVU_003G008700g             435   1e-132   
gb|EYU44257.1|  hypothetical protein MIMGU_mgv1a021838mg                436   1e-132   
emb|CBI23556.3|  unnamed protein product                                436   2e-132   
ref|XP_010660541.1|  PREDICTED: pentatricopeptide repeat-containi...    434   2e-132   
ref|XP_009404489.1|  PREDICTED: pentatricopeptide repeat-containi...    436   2e-132   
ref|XP_010686039.1|  PREDICTED: pentatricopeptide repeat-containi...    437   2e-132   
ref|XP_006438846.1|  hypothetical protein CICLE_v10033965mg             435   3e-132   
ref|XP_009380649.1|  PREDICTED: pentatricopeptide repeat-containi...    439   3e-132   
ref|XP_008454122.1|  PREDICTED: putative pentatricopeptide repeat...    435   3e-132   
ref|XP_006483017.1|  PREDICTED: putative pentatricopeptide repeat...    435   3e-132   
ref|XP_008393178.1|  PREDICTED: pentatricopeptide repeat-containi...    435   4e-132   
ref|XP_009380120.1|  PREDICTED: putative pentatricopeptide repeat...    435   4e-132   
ref|XP_006604564.1|  PREDICTED: pentatricopeptide repeat-containi...    432   4e-132   
gb|EYU21860.1|  hypothetical protein MIMGU_mgv1a025261mg                440   4e-132   
ref|XP_010469443.1|  PREDICTED: pentatricopeptide repeat-containi...    433   4e-132   
ref|XP_010512450.1|  PREDICTED: putative pentatricopeptide repeat...    434   5e-132   
ref|XP_009393452.1|  PREDICTED: pentatricopeptide repeat-containi...    435   5e-132   
ref|NP_001051869.1|  Os03g0844000                                       430   5e-132   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011003872.1|  PREDICTED: pentatricopeptide repeat-containi...    435   6e-132   
ref|XP_003529187.2|  PREDICTED: putative pentatricopeptide repeat...    434   7e-132   
ref|XP_008442211.1|  PREDICTED: putative pentatricopeptide repeat...    433   7e-132   
ref|XP_010518772.1|  PREDICTED: pentatricopeptide repeat-containi...    437   8e-132   
ref|XP_010262348.1|  PREDICTED: pentatricopeptide repeat-containi...    439   9e-132   
ref|XP_007220232.1|  hypothetical protein PRUPE_ppa001951mg             431   1e-131   
dbj|BAJ97995.1|  predicted protein                                      436   1e-131   
ref|XP_006487970.1|  PREDICTED: pentatricopeptide repeat-containi...    435   1e-131   
ref|XP_007139957.1|  hypothetical protein PHAVU_008G072900g             433   1e-131   
ref|XP_009412103.1|  PREDICTED: pentatricopeptide repeat-containi...    436   1e-131   
ref|XP_010509849.1|  PREDICTED: pentatricopeptide repeat-containi...    432   1e-131   
ref|XP_006410511.1|  hypothetical protein EUTSA_v10017851mg             430   2e-131   
ref|XP_009401519.1|  PREDICTED: pentatricopeptide repeat-containi...    430   2e-131   
ref|XP_009629343.1|  PREDICTED: pentatricopeptide repeat-containi...    431   2e-131   
ref|XP_007150084.1|  hypothetical protein PHAVU_005G125200g             434   2e-131   
ref|XP_007214267.1|  hypothetical protein PRUPE_ppa025121mg             432   2e-131   
ref|XP_002302563.2|  hypothetical protein POPTR_0002s15650g             432   2e-131   Populus trichocarpa [western balsam poplar]
ref|XP_008806485.1|  PREDICTED: pentatricopeptide repeat-containi...    431   3e-131   
ref|XP_002278668.2|  PREDICTED: pentatricopeptide repeat-containi...    434   3e-131   Vitis vinifera
ref|XP_006403701.1|  hypothetical protein EUTSA_v10010938mg             430   3e-131   
gb|EMT08522.1|  hypothetical protein F775_10372                         430   3e-131   
gb|EEE53393.1|  hypothetical protein OsJ_36441                          441   4e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002512645.1|  pentatricopeptide repeat-containing protein,...    428   5e-131   Ricinus communis
ref|XP_009116030.1|  PREDICTED: pentatricopeptide repeat-containi...    430   5e-131   
ref|XP_003532850.2|  PREDICTED: pentatricopeptide repeat-containi...    432   5e-131   
ref|XP_010923888.1|  PREDICTED: pentatricopeptide repeat-containi...    430   5e-131   
ref|XP_010682665.1|  PREDICTED: putative pentatricopeptide repeat...    432   5e-131   
ref|XP_003610363.1|  Pentatricopeptide repeat-containing protein        429   6e-131   
gb|KGN54859.1|  hypothetical protein Csa_4G554180                       431   7e-131   
ref|XP_011089777.1|  PREDICTED: pentatricopeptide repeat-containi...    437   8e-131   
gb|KHN29112.1|  Pentatricopeptide repeat-containing protein             432   1e-130   
ref|XP_007162705.1|  hypothetical protein PHAVU_001G173400g             429   1e-130   
ref|XP_010413449.1|  PREDICTED: putative pentatricopeptide repeat...    430   1e-130   
ref|XP_004289123.1|  PREDICTED: putative pentatricopeptide repeat...    427   1e-130   
ref|XP_004288861.1|  PREDICTED: pentatricopeptide repeat-containi...    430   1e-130   
ref|XP_007207165.1|  hypothetical protein PRUPE_ppa023637mg             427   1e-130   
ref|XP_007153023.1|  hypothetical protein PHAVU_003G001300g             431   2e-130   
ref|XP_010920030.1|  PREDICTED: pentatricopeptide repeat-containi...    426   2e-130   
ref|XP_009385091.1|  PREDICTED: pentatricopeptide repeat-containi...    431   2e-130   
ref|XP_003596787.1|  Pentatricopeptide repeat-containing protein        431   2e-130   
ref|XP_010539664.1|  PREDICTED: pentatricopeptide repeat-containi...    431   2e-130   
gb|KDP24314.1|  hypothetical protein JCGZ_25610                         428   2e-130   
ref|XP_010934285.1|  PREDICTED: pentatricopeptide repeat-containi...    436   2e-130   
ref|XP_006664625.1|  PREDICTED: pentatricopeptide repeat-containi...    432   2e-130   
ref|XP_010110214.1|  hypothetical protein L484_009819                   430   2e-130   
ref|XP_004237632.1|  PREDICTED: putative pentatricopeptide repeat...    432   3e-130   
ref|XP_010557403.1|  PREDICTED: pentatricopeptide repeat-containi...    431   3e-130   
ref|XP_008442662.1|  PREDICTED: pentatricopeptide repeat-containi...    429   3e-130   
ref|XP_011023411.1|  PREDICTED: pentatricopeptide repeat-containi...    429   3e-130   
ref|XP_002319164.2|  pentatricopeptide repeat-containing family p...    432   4e-130   Populus trichocarpa [western balsam poplar]
ref|XP_010523729.1|  PREDICTED: pentatricopeptide repeat-containi...    429   4e-130   
ref|XP_007226729.1|  hypothetical protein PRUPE_ppa019364mg             429   5e-130   
gb|KDP21001.1|  hypothetical protein JCGZ_21472                         430   5e-130   
ref|XP_010090626.1|  hypothetical protein L484_003942                   428   6e-130   
ref|XP_006293702.1|  hypothetical protein CARUB_v10022660mg             428   6e-130   
ref|XP_006292825.1|  hypothetical protein CARUB_v10019077mg             427   7e-130   
ref|XP_008786573.1|  PREDICTED: pentatricopeptide repeat-containi...    427   7e-130   
ref|XP_008678753.1|  PREDICTED: pentatricopeptide repeat-containi...    430   8e-130   
ref|NP_180329.1|  pentatricopeptide repeat-containing protein           430   8e-130   Arabidopsis thaliana [mouse-ear cress]
gb|EYU24289.1|  hypothetical protein MIMGU_mgv1a024266mg                430   9e-130   
ref|XP_004293078.1|  PREDICTED: pentatricopeptide repeat-containi...    429   9e-130   
ref|XP_011075167.1|  PREDICTED: pentatricopeptide repeat-containi...    426   1e-129   
ref|XP_009798732.1|  PREDICTED: pentatricopeptide repeat-containi...    429   1e-129   
ref|XP_003633097.1|  PREDICTED: pentatricopeptide repeat-containi...    433   1e-129   
ref|XP_009591261.1|  PREDICTED: putative pentatricopeptide repeat...    428   1e-129   
ref|XP_009760813.1|  PREDICTED: pentatricopeptide repeat-containi...    429   1e-129   
ref|XP_010907184.1|  PREDICTED: pentatricopeptide repeat-containi...    429   1e-129   
ref|XP_010270642.1|  PREDICTED: pentatricopeptide repeat-containi...    424   1e-129   
ref|XP_009760814.1|  PREDICTED: pentatricopeptide repeat-containi...    429   1e-129   
ref|XP_010911842.1|  PREDICTED: putative pentatricopeptide repeat...    429   2e-129   
ref|XP_009398812.1|  PREDICTED: pentatricopeptide repeat-containi...    429   2e-129   
ref|XP_010504096.1|  PREDICTED: pentatricopeptide repeat-containi...    426   2e-129   
ref|XP_010417911.1|  PREDICTED: pentatricopeptide repeat-containi...    428   2e-129   
ref|XP_010473149.1|  PREDICTED: pentatricopeptide repeat-containi...    428   2e-129   
ref|XP_003545972.2|  PREDICTED: pentatricopeptide repeat-containi...    430   2e-129   
ref|XP_009798731.1|  PREDICTED: pentatricopeptide repeat-containi...    429   2e-129   
gb|KHN07701.1|  Pentatricopeptide repeat-containing protein, chlo...    430   2e-129   
ref|XP_010925117.1|  PREDICTED: putative pentatricopeptide repeat...    423   3e-129   
ref|XP_004289272.1|  PREDICTED: pentatricopeptide repeat-containi...    426   3e-129   
ref|XP_004516023.1|  PREDICTED: pentatricopeptide repeat-containi...    430   3e-129   
gb|ABR17838.1|  unknown                                                 426   3e-129   Picea sitchensis
ref|XP_002879150.1|  pentatricopeptide repeat-containing protein        428   3e-129   
ref|XP_007030706.1|  Pentatricopeptide repeat (PPR) superfamily p...    433   4e-129   
ref|XP_007048121.1|  Tetratricopeptide repeat (TPR)-like superfam...    427   4e-129   
ref|XP_002321443.2|  hypothetical protein POPTR_0015s02060g             429   4e-129   
ref|XP_009623675.1|  PREDICTED: pentatricopeptide repeat-containi...    424   4e-129   
gb|EYU34910.1|  hypothetical protein MIMGU_mgv1a001179mg                427   5e-129   
ref|XP_006357349.1|  PREDICTED: pentatricopeptide repeat-containi...    429   5e-129   
gb|KDO46745.1|  hypothetical protein CISIN_1g002975mg                   427   6e-129   
ref|XP_010647598.1|  PREDICTED: pentatricopeptide repeat-containi...    425   6e-129   
emb|CDX78171.1|  BnaA09g33660D                                          424   6e-129   
emb|CDP19953.1|  unnamed protein product                                422   6e-129   
ref|XP_010510757.1|  PREDICTED: pentatricopeptide repeat-containi...    427   7e-129   
ref|XP_008225340.1|  PREDICTED: pentatricopeptide repeat-containi...    427   7e-129   
ref|XP_006422178.1|  hypothetical protein CICLE_v10006927mg             427   7e-129   
emb|CDY56690.1|  BnaCnng30980D                                          424   7e-129   
ref|XP_008793555.1|  PREDICTED: pentatricopeptide repeat-containi...    427   7e-129   
ref|NP_180924.1|  pentatricopeptide repeat-containing protein           423   8e-129   
ref|XP_010320030.1|  PREDICTED: pentatricopeptide repeat-containi...    431   8e-129   
gb|KHN27656.1|  Pentatricopeptide repeat-containing protein             424   8e-129   
ref|XP_010097404.1|  hypothetical protein L484_009628                   431   9e-129   
ref|XP_009415626.1|  PREDICTED: putative pentatricopeptide repeat...    423   1e-128   
ref|XP_007217040.1|  hypothetical protein PRUPE_ppa001611mg             424   1e-128   
ref|XP_004491978.1|  PREDICTED: pentatricopeptide repeat-containi...    427   1e-128   
ref|XP_010526111.1|  PREDICTED: pentatricopeptide repeat-containi...    422   1e-128   
gb|EPS64446.1|  hypothetical protein M569_10333                         421   1e-128   
ref|XP_006384245.1|  hypothetical protein POPTR_0004s11010g             427   1e-128   
ref|XP_008785200.1|  PREDICTED: pentatricopeptide repeat-containi...    431   1e-128   
ref|XP_004310131.1|  PREDICTED: putative pentatricopeptide repeat...    422   1e-128   
ref|XP_006592747.1|  PREDICTED: pentatricopeptide repeat-containi...    426   2e-128   
ref|XP_010931946.1|  PREDICTED: pentatricopeptide repeat-containi...    425   2e-128   
ref|XP_003539465.1|  PREDICTED: pentatricopeptide repeat-containi...    426   2e-128   
ref|NP_195663.1|  pentatricopeptide repeat-containing protein           425   2e-128   
ref|XP_007202871.1|  hypothetical protein PRUPE_ppa015725mg             419   2e-128   
ref|XP_009413784.1|  PREDICTED: pentatricopeptide repeat-containi...    426   3e-128   
ref|XP_009373813.1|  PREDICTED: pentatricopeptide repeat-containi...    426   3e-128   
ref|XP_010100741.1|  hypothetical protein L484_005808                   426   3e-128   
ref|XP_006389523.1|  pentatricopeptide repeat-containing family p...    424   3e-128   
ref|XP_004515015.1|  PREDICTED: pentatricopeptide repeat-containi...    421   3e-128   
ref|XP_011069446.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    422   3e-128   
ref|XP_004971848.1|  PREDICTED: putative pentatricopeptide repeat...    424   3e-128   
ref|XP_011009905.1|  PREDICTED: pentatricopeptide repeat-containi...    426   3e-128   
ref|XP_008345967.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    424   4e-128   
ref|XP_009340714.1|  PREDICTED: putative pentatricopeptide repeat...    421   4e-128   
ref|XP_006411752.1|  hypothetical protein EUTSA_v10027184mg             424   4e-128   
ref|XP_011047908.1|  PREDICTED: pentatricopeptide repeat-containi...    423   4e-128   
ref|XP_009625829.1|  PREDICTED: pentatricopeptide repeat-containi...    425   5e-128   
ref|XP_006842433.1|  hypothetical protein AMTR_s00077p00031710          426   6e-128   
gb|EYU38224.1|  hypothetical protein MIMGU_mgv1a019053mg                417   6e-128   
ref|XP_004289268.1|  PREDICTED: pentatricopeptide repeat-containi...    422   6e-128   
ref|XP_002278218.1|  PREDICTED: pentatricopeptide repeat-containi...    429   9e-128   
ref|XP_009352737.1|  PREDICTED: pentatricopeptide repeat-containi...    424   9e-128   
ref|XP_004306045.1|  PREDICTED: pentatricopeptide repeat-containi...    423   1e-127   
ref|XP_002436772.1|  hypothetical protein SORBIDRAFT_10g008520          422   1e-127   
ref|XP_009802996.1|  PREDICTED: putative pentatricopeptide repeat...    423   1e-127   
emb|CAN70631.1|  hypothetical protein VITISV_020725                     419   1e-127   
ref|XP_010694524.1|  PREDICTED: pentatricopeptide repeat-containi...    424   1e-127   
ref|XP_011086551.1|  PREDICTED: pentatricopeptide repeat-containi...    424   1e-127   
ref|XP_009366440.1|  PREDICTED: pentatricopeptide repeat-containi...    429   2e-127   
ref|XP_008338199.1|  PREDICTED: putative pentatricopeptide repeat...    419   2e-127   
gb|EMT12957.1|  hypothetical protein F775_16926                         431   2e-127   
ref|XP_006295891.1|  hypothetical protein CARUB_v10025021mg             423   2e-127   
gb|KHN38224.1|  Pentatricopeptide repeat-containing protein             424   2e-127   
ref|XP_007015858.1|  Tetratricopeptide repeat (TPR)-like superfam...    424   2e-127   
gb|KEH25607.1|  pentatricopeptide (PPR) repeat protein                  430   2e-127   
gb|KHN13782.1|  Pentatricopeptide repeat-containing protein             418   2e-127   
ref|XP_009366439.1|  PREDICTED: pentatricopeptide repeat-containi...    429   2e-127   
ref|XP_010252916.1|  PREDICTED: pentatricopeptide repeat-containi...    421   2e-127   
ref|XP_004952954.1|  PREDICTED: pentatricopeptide repeat-containi...    423   2e-127   
ref|XP_003575265.1|  PREDICTED: pentatricopeptide repeat-containi...    423   2e-127   
ref|XP_002266026.1|  PREDICTED: putative pentatricopeptide repeat...    418   2e-127   
ref|XP_008366040.1|  PREDICTED: pentatricopeptide repeat-containi...    423   2e-127   
ref|XP_004487730.1|  PREDICTED: pentatricopeptide repeat-containi...    423   3e-127   
ref|XP_010426976.1|  PREDICTED: pentatricopeptide repeat-containi...    420   3e-127   
ref|XP_010912119.1|  PREDICTED: putative pentatricopeptide repeat...    420   3e-127   
emb|CDM85693.1|  unnamed protein product                                421   3e-127   
ref|XP_004164425.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    422   3e-127   
ref|XP_008802382.1|  PREDICTED: pentatricopeptide repeat-containi...    416   4e-127   
ref|XP_004151259.1|  PREDICTED: pentatricopeptide repeat-containi...    422   4e-127   
ref|XP_011083198.1|  PREDICTED: putative pentatricopeptide repeat...    416   4e-127   
ref|XP_010556099.1|  PREDICTED: putative pentatricopeptide repeat...    421   4e-127   
ref|XP_008783512.1|  PREDICTED: pentatricopeptide repeat-containi...    422   4e-127   
ref|XP_008386813.1|  PREDICTED: pentatricopeptide repeat-containi...    428   4e-127   
gb|EEE60281.1|  hypothetical protein OsJ_13335                          429   5e-127   
ref|XP_004301089.1|  PREDICTED: pentatricopeptide repeat-containi...    425   5e-127   
ref|XP_010098515.1|  hypothetical protein L484_025954                   422   5e-127   
ref|XP_002441185.1|  hypothetical protein SORBIDRAFT_09g021880          422   5e-127   
ref|XP_010686415.1|  PREDICTED: pentatricopeptide repeat-containi...    424   5e-127   
ref|XP_007139372.1|  hypothetical protein PHAVU_008G023900g             422   6e-127   
ref|XP_008230331.1|  PREDICTED: pentatricopeptide repeat-containi...    421   6e-127   
ref|XP_004152153.1|  PREDICTED: putative pentatricopeptide repeat...    417   6e-127   
ref|XP_004231236.1|  PREDICTED: pentatricopeptide repeat-containi...    421   6e-127   
ref|XP_010246449.1|  PREDICTED: pentatricopeptide repeat-containi...    422   7e-127   
ref|XP_003621610.1|  Pentatricopeptide repeat-containing protein        422   7e-127   
ref|XP_010066427.1|  PREDICTED: putative pentatricopeptide repeat...    421   8e-127   
ref|XP_004148468.1|  PREDICTED: pentatricopeptide repeat-containi...    421   8e-127   
gb|KFK25561.1|  hypothetical protein AALP_AA8G130700                    419   8e-127   
ref|XP_009341671.1|  PREDICTED: pentatricopeptide repeat-containi...    416   8e-127   
ref|XP_004494006.1|  PREDICTED: pentatricopeptide repeat-containi...    420   8e-127   
ref|XP_010276478.1|  PREDICTED: pentatricopeptide repeat-containi...    420   9e-127   
ref|XP_011076005.1|  PREDICTED: pentatricopeptide repeat-containi...    421   9e-127   
ref|XP_006468372.1|  PREDICTED: pentatricopeptide repeat-containi...    421   9e-127   
ref|XP_008793691.1|  PREDICTED: pentatricopeptide repeat-containi...    420   1e-126   
ref|XP_010261389.1|  PREDICTED: pentatricopeptide repeat-containi...    418   1e-126   
ref|XP_010266600.1|  PREDICTED: pentatricopeptide repeat-containi...    424   1e-126   
gb|KGN62074.1|  hypothetical protein Csa_2G295990                       421   1e-126   
ref|XP_007030705.1|  Pentatricopeptide repeat superfamily protein...    433   1e-126   
gb|KCW56352.1|  hypothetical protein EUGRSUZ_I02086                     420   1e-126   
ref|XP_008783966.1|  PREDICTED: pentatricopeptide repeat-containi...    421   1e-126   
ref|XP_010529313.1|  PREDICTED: pentatricopeptide repeat-containi...    421   1e-126   
ref|XP_004308661.1|  PREDICTED: pentatricopeptide repeat-containi...    416   1e-126   
ref|XP_010504671.1|  PREDICTED: pentatricopeptide repeat-containi...    421   2e-126   
ref|XP_010100626.1|  hypothetical protein L484_011557                   421   2e-126   
ref|XP_004242544.1|  PREDICTED: pentatricopeptide repeat-containi...    420   2e-126   
ref|XP_004961923.1|  PREDICTED: pentatricopeptide repeat-containi...    421   2e-126   
ref|XP_010412754.1|  PREDICTED: pentatricopeptide repeat-containi...    418   2e-126   
ref|XP_009413292.1|  PREDICTED: pentatricopeptide repeat-containi...    417   2e-126   
ref|XP_009143839.1|  PREDICTED: pentatricopeptide repeat-containi...    418   2e-126   
emb|CAB66100.1|  putative protein                                       418   2e-126   
ref|XP_009798649.1|  PREDICTED: pentatricopeptide repeat-containi...    425   2e-126   
ref|XP_010052618.1|  PREDICTED: pentatricopeptide repeat-containi...    421   2e-126   
ref|XP_001764438.1|  predicted protein                                  420   3e-126   
gb|KHN14453.1|  Pentatricopeptide repeat-containing protein             418   3e-126   
ref|XP_006470740.1|  PREDICTED: pentatricopeptide repeat-containi...    415   3e-126   
ref|XP_004294643.1|  PREDICTED: pentatricopeptide repeat-containi...    420   3e-126   
ref|XP_004161068.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    415   3e-126   
gb|KGN62280.1|  hypothetical protein Csa_2G348180                       418   3e-126   
ref|XP_009116777.1|  PREDICTED: putative pentatricopeptide repeat...    418   3e-126   
ref|XP_006366808.1|  PREDICTED: pentatricopeptide repeat-containi...    421   3e-126   
ref|XP_009101863.1|  PREDICTED: pentatricopeptide repeat-containi...    419   4e-126   
ref|XP_006356287.1|  PREDICTED: pentatricopeptide repeat-containi...    424   4e-126   
ref|XP_009764400.1|  PREDICTED: pentatricopeptide repeat-containi...    425   4e-126   
ref|XP_002512026.1|  pentatricopeptide repeat-containing protein,...    418   4e-126   
ref|XP_004233816.1|  PREDICTED: pentatricopeptide repeat-containi...    425   4e-126   
ref|XP_010029438.1|  PREDICTED: pentatricopeptide repeat-containi...    421   4e-126   
ref|XP_007025334.1|  Pentatricopeptide, putative                        420   4e-126   
ref|XP_010270723.1|  PREDICTED: pentatricopeptide repeat-containi...    419   4e-126   
ref|XP_006594225.1|  PREDICTED: pentatricopeptide repeat-containi...    416   5e-126   
gb|KHN05841.1|  Pentatricopeptide repeat-containing protein             416   5e-126   
ref|XP_009774998.1|  PREDICTED: pentatricopeptide repeat-containi...    415   5e-126   
ref|XP_010260747.1|  PREDICTED: pentatricopeptide repeat-containi...    420   5e-126   
ref|NP_001057720.1|  Os06g0506100                                       416   6e-126   
ref|XP_008222365.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    416   6e-126   
ref|XP_009605798.1|  PREDICTED: pentatricopeptide repeat-containi...    419   6e-126   
emb|CDP12017.1|  unnamed protein product                                424   6e-126   
ref|XP_010260746.1|  PREDICTED: pentatricopeptide repeat-containi...    420   6e-126   
gb|EYU23583.1|  hypothetical protein MIMGU_mgv1a001176mg                419   6e-126   
ref|NP_190904.1|  pentatricopeptide repeat-containing protein           416   8e-126   
ref|XP_010518818.1|  PREDICTED: pentatricopeptide repeat-containi...    419   9e-126   
ref|XP_006282436.1|  hypothetical protein CARUB_v10004043mg             424   9e-126   
ref|XP_003630505.1|  Pentatricopeptide repeat-containing protein        422   9e-126   
ref|NP_001050460.1|  Os03g0441400                                       418   9e-126   
gb|KDO77573.1|  hypothetical protein CISIN_1g003150mg                   418   9e-126   
ref|XP_009367299.1|  PREDICTED: pentatricopeptide repeat-containi...    413   9e-126   
ref|XP_008378492.1|  PREDICTED: pentatricopeptide repeat-containi...    413   1e-125   
ref|XP_008441615.1|  PREDICTED: pentatricopeptide repeat-containi...    418   1e-125   
ref|XP_006428022.1|  hypothetical protein CICLE_v10024954mg             415   1e-125   
ref|XP_006347148.1|  PREDICTED: pentatricopeptide repeat-containi...    423   1e-125   
ref|XP_010113414.1|  hypothetical protein L484_026747                   414   1e-125   
gb|KDP35999.1|  hypothetical protein JCGZ_08394                         413   1e-125   
ref|XP_008669451.1|  PREDICTED: pentatricopeptide repeat-containi...    419   2e-125   
gb|AAP40452.1|  unknown protein                                         419   2e-125   
ref|NP_191302.2|  protein ORGANELLE TRANSCRIPT PROCESSING 84            418   2e-125   
gb|EAZ01101.1|  hypothetical protein OsI_23130                          415   2e-125   
ref|XP_006285114.1|  hypothetical protein CARUB_v10006447mg             417   2e-125   
ref|XP_003530462.1|  PREDICTED: pentatricopeptide repeat-containi...    417   2e-125   
ref|XP_010244849.1|  PREDICTED: pentatricopeptide repeat-containi...    417   3e-125   
gb|EEE69272.1|  hypothetical protein OsJ_28537                          415   3e-125   
ref|XP_009121782.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    416   3e-125   
ref|XP_002282164.2|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    429   3e-125   
emb|CDX77129.1|  BnaC04g39240D                                          419   3e-125   
gb|KEH44228.1|  pentatricopeptide (PPR) repeat protein                  417   3e-125   
gb|KGN57354.1|  hypothetical protein Csa_3G180420                       419   3e-125   
gb|KCW81073.1|  hypothetical protein EUGRSUZ_C02443                     414   3e-125   
ref|XP_010921568.1|  PREDICTED: pentatricopeptide repeat-containi...    421   4e-125   
ref|XP_008342059.1|  PREDICTED: pentatricopeptide repeat-containi...    418   4e-125   
ref|XP_009600041.1|  PREDICTED: pentatricopeptide repeat-containi...    422   4e-125   
ref|XP_010233088.1|  PREDICTED: putative pentatricopeptide repeat...    416   4e-125   
ref|XP_004288922.1|  PREDICTED: putative pentatricopeptide repeat...    420   4e-125   
ref|XP_006482464.1|  PREDICTED: pentatricopeptide repeat-containi...    417   4e-125   
ref|XP_010100885.1|  hypothetical protein L484_009655                   417   6e-125   
ref|XP_008669458.1|  PREDICTED: pentatricopeptide repeat-containi...    418   6e-125   
gb|KDO44965.1|  hypothetical protein CISIN_1g005487mg                   411   6e-125   
ref|XP_007159760.1|  hypothetical protein PHAVU_002G264900g             416   6e-125   
ref|XP_007224379.1|  hypothetical protein PRUPE_ppa021566mg             411   6e-125   
ref|XP_002876202.1|  pentatricopeptide repeat-containing protein        414   6e-125   
ref|XP_006448816.1|  hypothetical protein CICLE_v10014257mg             416   7e-125   
ref|XP_007046869.1|  Tetratricopeptide repeat-like superfamily pr...    411   7e-125   
ref|XP_003565766.1|  PREDICTED: pentatricopeptide repeat-containi...    412   8e-125   
ref|XP_003551787.1|  PREDICTED: pentatricopeptide repeat-containi...    416   1e-124   
ref|XP_008445307.1|  PREDICTED: pentatricopeptide repeat-containi...    411   1e-124   
ref|XP_009790915.1|  PREDICTED: pentatricopeptide repeat-containi...    414   1e-124   
emb|CDX72037.1|  BnaC08g28370D                                          416   1e-124   
ref|XP_010528729.1|  PREDICTED: pentatricopeptide repeat-containi...    421   1e-124   
ref|XP_010106970.1|  hypothetical protein L484_016898                   415   1e-124   
ref|XP_003630936.1|  Pentatricopeptide repeat-containing protein        418   1e-124   
ref|XP_009587534.1|  PREDICTED: pentatricopeptide repeat-containi...    415   1e-124   
ref|XP_004493200.1|  PREDICTED: pentatricopeptide repeat-containi...    415   2e-124   
ref|XP_011094220.1|  PREDICTED: pentatricopeptide repeat-containi...    415   2e-124   
ref|XP_006494746.1|  PREDICTED: pentatricopeptide repeat-containi...    415   2e-124   
ref|XP_010446500.1|  PREDICTED: pentatricopeptide repeat-containi...    414   2e-124   
ref|XP_008457961.1|  PREDICTED: uncharacterized protein LOC103497526    431   2e-124   
ref|XP_009602859.1|  PREDICTED: pentatricopeptide repeat-containi...    413   2e-124   
ref|XP_008341824.1|  PREDICTED: pentatricopeptide repeat-containi...    414   2e-124   
gb|KHN02361.1|  Pentatricopeptide repeat-containing protein, mito...    408   3e-124   
ref|XP_011034449.1|  PREDICTED: pentatricopeptide repeat-containi...    426   3e-124   
ref|XP_009612771.1|  PREDICTED: pentatricopeptide repeat-containi...    420   3e-124   
emb|CDP03192.1|  unnamed protein product                                417   3e-124   
ref|XP_010929076.1|  PREDICTED: pentatricopeptide repeat-containi...    415   3e-124   
emb|CDP10583.1|  unnamed protein product                                407   3e-124   
ref|XP_008781342.1|  PREDICTED: pentatricopeptide repeat-containi...    412   3e-124   
ref|XP_009373739.1|  PREDICTED: pentatricopeptide repeat-containi...    414   3e-124   
gb|KDO72337.1|  hypothetical protein CISIN_1g002718mg                   415   3e-124   
gb|AES80039.2|  pentatricopeptide (PPR) repeat protein                  412   4e-124   
ref|XP_003588887.1|  Pentatricopeptide repeat-containing protein        409   4e-124   
ref|XP_010048705.1|  PREDICTED: putative pentatricopeptide repeat...    414   4e-124   
emb|CBI20738.3|  unnamed protein product                                414   4e-124   
emb|CDO96840.1|  unnamed protein product                                415   4e-124   
ref|XP_004499531.1|  PREDICTED: pentatricopeptide repeat-containi...    409   4e-124   
ref|XP_006365050.1|  PREDICTED: putative pentatricopeptide repeat...    409   4e-124   
ref|XP_007138386.1|  hypothetical protein PHAVU_009G204200g             417   4e-124   
ref|XP_010516359.1|  PREDICTED: pentatricopeptide repeat-containi...    414   4e-124   
ref|XP_006430993.1|  hypothetical protein CICLE_v10011041mg             415   5e-124   
ref|NP_001062682.1|  Os09g0251500                                       414   5e-124   
ref|XP_006290586.1|  hypothetical protein CARUB_v10016675mg             414   5e-124   



>ref|XP_009618316.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=698

 Score =  1049 bits (2713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/696 (71%), Positives = 589/696 (85%), Gaps = 0/696 (0%)
 Frame = -2

Query  3072  MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDE  2893
             MS+SQ++R+CT +KS+L+GKA HAQL+K+GSK DVY NNHLL MY+  ++   AQ+L D 
Sbjct  1     MSISQLLRACTNSKSLLNGKAVHAQLLKFGSKPDVYINNHLLVMYLKLNQFADAQQLLDR  60

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAART  2713
             MP+RN+I+WTTLIS+YS  G+SEKALG FRSMVLEDGF PN YTYV ALSAC+ LGA RT
Sbjct  61    MPERNIISWTTLISTYSQKGMSEKALGCFRSMVLEDGFAPNGYTYVAALSACTSLGAERT  120

Query  2712  GKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQ  2533
             GKE+HGR++R EE+LN+FV+NCLVNFYGKCGLLKSA+LVFD +LEPN+VTWASL+SC+C 
Sbjct  121   GKELHGRMYRTEESLNSFVTNCLVNFYGKCGLLKSARLVFDGILEPNSVTWASLISCYCH  180

Query  2532  CGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
             CGEY EGL IFL +LR G +VNEF CG  L ACA+++ L  GM IH LIVK G  MDQ++
Sbjct  181   CGEYQEGLMIFLLALRVGGIVNEFFCGSVLNACAAMKTLQLGMQIHSLIVKSGFGMDQFL  240

Query  2352  VTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
             VTGL++FY KCG L LA   F+ A A ELHAWTA+IGGCVQ G GREA++LFCKLLSS L
Sbjct  241   VTGLIDFYAKCGVLDLARRAFDEADARELHAWTAMIGGCVQLGSGREAIDLFCKLLSSDL  300

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             KPSERT++SVLGAF D K  +VG Q+H  I+KLGF+SF+FVCNAL+D YSKS+L DES K
Sbjct  301   KPSERTFSSVLGAFADVKGVRVGKQIHCRIVKLGFDSFSFVCNALMDLYSKSDLFDESLK  360

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPA  1813
             +FQEM E+D+V+WN LIAG + SG YE A++ L+EML EG E +L+TYS ILSICGDLPA
Sbjct  361   LFQEMKEHDVVSWNTLIAGCVSSGRYEDAMRFLKEMLLEGFEASLYTYSSILSICGDLPA  420

Query  1812  IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIG  1633
             IEWGKQ HCR++KPGFDSNVVVGSTLIDMYAKCGRLGDAR+VFDILP KNLVSWNTML+G
Sbjct  421   IEWGKQSHCRVLKPGFDSNVVVGSTLIDMYAKCGRLGDARRVFDILPMKNLVSWNTMLVG  480

Query  1632  YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITP  1453
             YAQHGFGKEALEIY+ MQ +G+KPNDITF+GVLSACGH GLL+EGL+HFNSM   YGITP
Sbjct  481   YAQHGFGKEALEIYATMQNSGIKPNDITFLGVLSACGHVGLLDEGLHHFNSMTQVYGITP  540

Query  1452  RTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEI  1273
             RT+HLAC+V+LFARKGQTK+AY FI+SFP +PDKVVWRCLLSGC  N+DF+LGKYAAE+I
Sbjct  541   RTDHLACIVSLFARKGQTKEAYGFIKSFPGEPDKVVWRCLLSGCKANRDFILGKYAAEKI  600

Query  1272  LSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSS  1093
             L IDP+DTSA++ LSNIYA L MWDE A++RK++K+K LKKETG SWTELQNKIY FS+ 
Sbjct  601   LGIDPDDTSAYIVLSNIYAELQMWDETAKMRKLIKEKSLKKETGYSWTELQNKIYTFSAC  660

Query  1092  YNMLLGEVSMKKLLIGLTAQLLDAGYVPDTKLSFDY  985
               M L E  ++++L GLTAQL D+GYVP+   S  +
Sbjct  661   NIMSLQESYLQQVLTGLTAQLFDSGYVPEVMFSLQF  696


 Score =   197 bits (502),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 139/530 (26%), Positives = 251/530 (47%), Gaps = 9/530 (2%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF  2929
             S +L     P   +    + +CT+  +  +GK  H ++ +     + +  N L++ Y   
Sbjct  91    SMVLEDGFAPNGYTYVAALSACTSLGAERTGKELHGRMYRTEESLNSFVTNCLVNFYGKC  150

Query  2928  HEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGA  2749
               ++ A+ +FD + + N +TW +LIS Y H G  ++ L  F  + L  G   N +     
Sbjct  151   GLLKSARLVFDGILEPNSVTWASLISCYCHCGEYQEGLMIFL-LALRVGGIVNEFFCGSV  209

Query  2748  LSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNT  2569
             L+AC+ +   + G +IH  I ++   ++ F+   L++FY KCG+L  A+  FD       
Sbjct  210   LNACAAMKTLQLGMQIHSLIVKSGFGMDQFLVTGLIDFYAKCGVLDLARRAFDEADAREL  269

Query  2568  VTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCL  2389
               W +++    Q G   E + +F + L + +  +E      LGA A V+ +  G  IHC 
Sbjct  270   HAWTAMIGGCVQLGSGREAIDLFCKLLSSDLKPSERTFSSVLGAFADVKGVRVGKQIHCR  329

Query  2388  IVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREA  2209
             IVK G     +V   L++ Y K      +   F      ++ +W  LI GCV  G+  +A
Sbjct  330   IVKLGFDSFSFVCNALMDLYSKSDLFDESLKLFQEMKEHDVVSWNTLIAGCVSSGRYEDA  389

Query  2208  VNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDF  2029
             +    ++L  G + S  TY+S+L    D    + G Q H  ++K GF+S   V + L+D 
Sbjct  390   MRFLKEMLLEGFEASLYTYSSILSICGDLPAIEWGKQSHCRVLKPGFDSNVVVGSTLIDM  449

Query  2028  YSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTY  1849
             Y+K   L ++ ++F  +   ++V+WN ++ GY + G  ++A+++   M   G++PN  T+
Sbjct  450   YAKCGRLGDARRVFDILPMKNLVSWNTMLVGYAQHGFGKEALEIYATMQNSGIKPNDITF  509

Query  1848  SCILSICGDLPAIEWGKQVHCRIMKP--GFDSNVVVGSTLIDMYAKCGRLGDARKVFDIL  1675
               +LS CG +  ++ G   H   M    G        + ++ ++A+ G+  +A       
Sbjct  510   LGVLSACGHVGLLDEGLH-HFNSMTQVYGITPRTDHLACIVSLFARKGQTKEAYGFIKSF  568

Query  1674  PCK-NLVSWNTMLIG-YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLS  1531
             P + + V W  +L G  A   F    L  Y+  +  G+ P+D +   VLS
Sbjct  569   PGEPDKVVWRCLLSGCKANRDF---ILGKYAAEKILGIDPDDTSAYIVLS  615



>ref|XP_009780195.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Nicotiana sylvestris]
Length=698

 Score =  1039 bits (2686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/696 (70%), Positives = 591/696 (85%), Gaps = 0/696 (0%)
 Frame = -2

Query  3072  MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDE  2893
             MS + + R+CT++KS+L+GKA HA+L+K+GSK++V+TNNHLL+MY+  ++ + AQ+LFD 
Sbjct  1     MSFTPLFRACTSSKSLLNGKAVHAKLLKFGSKANVFTNNHLLAMYLKLNQFDDAQRLFDR  60

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAART  2713
             MP+RN+I+WTTLIS+YS MG+SEKAL  FRSMVLEDGF PN YTYV ALSAC+ LGA RT
Sbjct  61    MPERNIISWTTLISTYSQMGMSEKALDCFRSMVLEDGFAPNGYTYVAALSACTSLGAERT  120

Query  2712  GKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQ  2533
             GKE+HGR++R EE+LN+FV+NCLVNFYGKCGLLKSA+LVFD +LEPN+VTWASL+SC+CQ
Sbjct  121   GKELHGRMYRTEESLNSFVTNCLVNFYGKCGLLKSARLVFDGILEPNSVTWASLISCYCQ  180

Query  2532  CGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
             CGEY+EGLRIFL +LR G +VN+F CG  L ACA+++ L  GM IH LIVK G  MDQ++
Sbjct  181   CGEYEEGLRIFLLALRLGGIVNKFFCGSVLNACAAMKSLQLGMQIHSLIVKSGFGMDQFL  240

Query  2352  VTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
             VTGL++FY KCG L LA   F+ A A ELHAWTA+IGGCVQ G GREA++LFCKLLSS L
Sbjct  241   VTGLIDFYAKCGVLDLARRAFDEADAWELHAWTAMIGGCVQLGSGREAIDLFCKLLSSDL  300

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             KPSE T++SVLGAF D K  +VG Q+H  I+KLGF+SF+FVCNAL+DF+SKS+L +ES K
Sbjct  301   KPSETTFSSVLGAFADVKGVRVGKQIHCRIVKLGFDSFSFVCNALMDFFSKSDLFEESLK  360

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPA  1813
             +FQEM E+D+V+WN LIA  + SG YE AI+ L+EML EG E +L+TYS ILSICGDLPA
Sbjct  361   LFQEMKEHDVVSWNTLIAACVSSGRYEDAIRFLKEMLLEGFEASLYTYSSILSICGDLPA  420

Query  1812  IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIG  1633
             IEWGKQ HCR++KPGFDSNVVVGSTLIDMYAKCGRL +AR+VFDILP KNLVSWNTML+G
Sbjct  421   IEWGKQSHCRVLKPGFDSNVVVGSTLIDMYAKCGRLSEARRVFDILPTKNLVSWNTMLVG  480

Query  1632  YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITP  1453
             YAQHGFGKEALEIY+ MQ +GVKPNDITF+GVLSACGH GLL+EGL+HFNSM   YGI P
Sbjct  481   YAQHGFGKEALEIYATMQNSGVKPNDITFLGVLSACGHVGLLDEGLHHFNSMTQVYGIIP  540

Query  1452  RTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEI  1273
             RT+HLAC+V+LFARKGQTK+AY FI++FP +PDKVVWRCLLSGC  N DF+LGKYAAE+I
Sbjct  541   RTDHLACIVSLFARKGQTKQAYGFIKNFPGEPDKVVWRCLLSGCKANGDFILGKYAAEKI  600

Query  1272  LSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSS  1093
             L IDP+DTSA++ LSNIYA L MWDE A++RK++K+K LKKETG SWTELQNKIY FS+ 
Sbjct  601   LGIDPDDTSAYIVLSNIYAELQMWDETAKMRKLIKEKSLKKETGYSWTELQNKIYTFSAC  660

Query  1092  YNMLLGEVSMKKLLIGLTAQLLDAGYVPDTKLSFDY  985
               M L E  ++++L GLTAQL D+GYVPD   S  +
Sbjct  661   NIMSLQESYLQQVLTGLTAQLFDSGYVPDVMFSLQF  696


 Score =   196 bits (499),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 140/532 (26%), Positives = 251/532 (47%), Gaps = 13/532 (2%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF  2929
             S +L     P   +    + +CT+  +  +GK  H ++ +     + +  N L++ Y   
Sbjct  91    SMVLEDGFAPNGYTYVAALSACTSLGAERTGKELHGRMYRTEESLNSFVTNCLVNFYGKC  150

Query  2928  HEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGA  2749
               ++ A+ +FD + + N +TW +LIS Y   G  E+ L  F  + L  G   N +     
Sbjct  151   GLLKSARLVFDGILEPNSVTWASLISCYCQCGEYEEGLRIFL-LALRLGGIVNKFFCGSV  209

Query  2748  LSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNT  2569
             L+AC+ + + + G +IH  I ++   ++ F+   L++FY KCG+L  A+  FD       
Sbjct  210   LNACAAMKSLQLGMQIHSLIVKSGFGMDQFLVTGLIDFYAKCGVLDLARRAFDEADAWEL  269

Query  2568  VTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCL  2389
               W +++    Q G   E + +F + L + +  +E      LGA A V+ +  G  IHC 
Sbjct  270   HAWTAMIGGCVQLGSGREAIDLFCKLLSSDLKPSETTFSSVLGAFADVKGVRVGKQIHCR  329

Query  2388  IVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREA  2209
             IVK G     +V   L++F+ K      +   F      ++ +W  LI  CV  G+  +A
Sbjct  330   IVKLGFDSFSFVCNALMDFFSKSDLFEESLKLFQEMKEHDVVSWNTLIAACVSSGRYEDA  389

Query  2208  VNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDF  2029
             +    ++L  G + S  TY+S+L    D    + G Q H  ++K GF+S   V + L+D 
Sbjct  390   IRFLKEMLLEGFEASLYTYSSILSICGDLPAIEWGKQSHCRVLKPGFDSNVVVGSTLIDM  449

Query  2028  YSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTY  1849
             Y+K   L E+ ++F  +   ++V+WN ++ GY + G  ++A+++   M   G++PN  T+
Sbjct  450   YAKCGRLSEARRVFDILPTKNLVSWNTMLVGYAQHGFGKEALEIYATMQNSGVKPNDITF  509

Query  1848  SCILSICGDLPAIEWGKQVHCRIMKP--GFDSNVVVGSTLIDMYAKCGRLGDARKVFDIL  1675
               +LS CG +  ++ G   H   M    G        + ++ ++A+ G+   A       
Sbjct  510   LGVLSACGHVGLLDEGLH-HFNSMTQVYGIIPRTDHLACIVSLFARKGQTKQAYGFIKNF  568

Query  1674  PCK-NLVSWNTMLIGYAQHG---FGKEALEIYSMMQENGVKPNDITFVGVLS  1531
             P + + V W  +L G   +G    GK A E     +  G+ P+D +   VLS
Sbjct  569   PGEPDKVVWRCLLSGCKANGDFILGKYAAE-----KILGIDPDDTSAYIVLS  615



>ref|XP_004250478.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Solanum lycopersicum]
Length=702

 Score =  1014 bits (2623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/697 (69%), Positives = 578/697 (83%), Gaps = 1/697 (0%)
 Frame = -2

Query  3072  MSLSQIIRSCTTNKSILSGKAAHAQLIKYGS-KSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             MS  Q+IR CT++KS+ +GK+ HAQL+K GS K+D++TNNHLL+MY+  ++ + AQ+LFD
Sbjct  1     MSFIQLIRGCTSSKSLFNGKSLHAQLLKLGSLKADIFTNNHLLTMYLKLNQFDDAQQLFD  60

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              MP+RN+I+WTTLIS+Y+ +G+ EKALG FRSM LEDGF PN YTYV ALSACS LGA R
Sbjct  61    RMPERNIISWTTLISTYTQLGMYEKALGCFRSMNLEDGFGPNGYTYVAALSACSSLGAER  120

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
             TGKE+HGR+ R EE LN+FVSNCLVNFYGKCGLL SA++VFD +LEPN+VTWASL+SC+ 
Sbjct  121   TGKELHGRMLRTEERLNSFVSNCLVNFYGKCGLLISARIVFDGILEPNSVTWASLISCYF  180

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
              CGEY EGL +F+ SLR GV+VNEF CG  LGACA V+ L  GM IH LIVK  + MDQ+
Sbjct  181   HCGEYGEGLNMFVLSLRGGVIVNEFFCGSVLGACAVVKSLQLGMQIHGLIVKLSLGMDQF  240

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             VVTGL+NFY KCG+L LA   F+ A  PELHAWTA+IGGCVQ G GREA+ LFCKLLSSG
Sbjct  241   VVTGLINFYAKCGRLELARQAFDEADGPELHAWTAIIGGCVQLGSGREAIELFCKLLSSG  300

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             LKPSERT++SV+GAF D KE +VG Q+H  I+K+GF+SF+FVCNAL+DFYSKS+L +ES 
Sbjct  301   LKPSERTFSSVIGAFADVKEVRVGKQIHCRIVKMGFDSFSFVCNALLDFYSKSDLFEESL  360

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
             K+FQEM E D+V+WN LIAG + S  YE+A++ L+EML EG EP+L+TYS ILSICGDLP
Sbjct  361   KLFQEMKEQDVVSWNTLIAGCVSSSRYEEALRFLREMLLEGFEPSLYTYSSILSICGDLP  420

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             AIEWGKQ HCR++K   DSNVVV S LIDMYAKCGRLG AR+VFDILP KNLVSWNTM++
Sbjct  421   AIEWGKQTHCRVLKSRLDSNVVVDSALIDMYAKCGRLGYARRVFDILPAKNLVSWNTMVV  480

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             GYAQHGFGKEALEIY MMQ +GVKPNDITF+GVLSACGH GLL+EGL+HF SM   +GI 
Sbjct  481   GYAQHGFGKEALEIYGMMQSSGVKPNDITFLGVLSACGHVGLLDEGLHHFTSMTKVHGII  540

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             PRT+HLAC+V+LFARKG+TK+AY FI+SF  +PDKVVWRCLLSGC  N+DFVLGKYAAE+
Sbjct  541   PRTDHLACVVSLFARKGKTKEAYHFIQSFSVEPDKVVWRCLLSGCKANRDFVLGKYAAEK  600

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSS  1096
             IL IDP+DTSA++ LSNIYA L MWDE A+IRK++  K LKKETG SW ELQNK+Y FS+
Sbjct  601   ILDIDPDDTSAYIVLSNIYAELQMWDETAKIRKLINAKALKKETGHSWIELQNKMYTFSA  660

Query  1095  SYNMLLGEVSMKKLLIGLTAQLLDAGYVPDTKLSFDY  985
                M L E  ++++L GLTAQLLD+GYVPD   S  +
Sbjct  661   CNIMSLQESYLQQVLTGLTAQLLDSGYVPDLMFSLSF  697


 Score =   205 bits (521),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 142/523 (27%), Positives = 252/523 (48%), Gaps = 11/523 (2%)
 Frame = -2

Query  3084  GPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQK  2905
             GP   +    + +C++  +  +GK  H ++++   + + + +N L++ Y     +  A+ 
Sbjct  100   GPNGYTYVAALSACSSLGAERTGKELHGRMLRTEERLNSFVSNCLVNFYGKCGLLISARI  159

Query  2904  LFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             +FD + + N +TW +LIS Y H G   + L  F  + L  G   N +     L AC+ + 
Sbjct  160   VFDGILEPNSVTWASLISCYFHCGEYGEGLNMF-VLSLRGGVIVNEFFCGSVLGACAVVK  218

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
             + + G +IHG I +    ++ FV   L+NFY KCG L+ A+  FD    P    W +++ 
Sbjct  219   SLQLGMQIHGLIVKLSLGMDQFVVTGLINFYAKCGRLELARQAFDEADGPELHAWTAIIG  278

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
                Q G   E + +F + L +G+  +E      +GA A V+ +  G  IHC IVK G   
Sbjct  279   GCVQLGSGREAIELFCKLLSSGLKPSERTFSSVIGAFADVKEVRVGKQIHCRIVKMGFDS  338

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
               +V   L++FY K      +   F      ++ +W  LI GCV   +  EA+    ++L
Sbjct  339   FSFVCNALLDFYSKSDLFEESLKLFQEMKEQDVVSWNTLIAGCVSSSRYEEALRFLREML  398

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
               G +PS  TY+S+L    D    + G Q H  ++K   +S   V +AL+D Y+K   L 
Sbjct  399   LEGFEPSLYTYSSILSICGDLPAIEWGKQTHCRVLKSRLDSNVVVDSALIDMYAKCGRLG  458

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
              + ++F  +   ++V+WN ++ GY + G  ++A+++   M   G++PN  T+  +LS CG
Sbjct  459   YARRVFDILPAKNLVSWNTMVVGYAQHGFGKEALEIYGMMQSSGVKPNDITFLGVLSACG  518

Query  1824  DLPAIEWGKQVHCRIMKP-GFDSNVVVGSTLIDMYAKCGRLGDAR---KVFDILPCKNLV  1657
              +  ++ G      + K  G        + ++ ++A+ G+  +A    + F + P K  V
Sbjct  519   HVGLLDEGLHHFTSMTKVHGIIPRTDHLACVVSLFARKGKTKEAYHFIQSFSVEPDK--V  576

Query  1656  SWNTMLIG-YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLS  1531
              W  +L G  A   F    L  Y+  +   + P+D +   VLS
Sbjct  577   VWRCLLSGCKANRDF---VLGKYAAEKILDIDPDDTSAYIVLS  616


 Score =   128 bits (321),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 89/291 (31%), Positives = 140/291 (48%), Gaps = 3/291 (1%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L++   P + + S +I +    K +  GK  H +++K G  S  +  N LL  Y     
Sbjct  296   LLSSGLKPSERTFSSVIGAFADVKEVRVGKQIHCRIVKMGFDSFSFVCNALLDFYSKSDL  355

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
              E + KLF EM +++V++W TLI+        E+AL   R M+LE GF P+ YTY   LS
Sbjct  356   FEESLKLFQEMKEQDVVSWNTLIAGCVSSSRYEEALRFLREMLLE-GFEPSLYTYSSILS  414

Query  2742  ACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVT  2563
              C  L A   GK+ H R+ ++    N  V + L++ Y KCG L  A+ VFD +   N V+
Sbjct  415   ICGDLPAIEWGKQTHCRVLKSRLDSNVVVDSALIDMYAKCGRLGYARRVFDILPAKNLVS  474

Query  2562  WASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIV  2383
             W +++  + Q G   E L I+     +GV  N+      L AC  V  L  G+     + 
Sbjct  475   WNTMVVGYAQHGFGKEALEIYGMMQSSGVKPNDITFLGVLSACGHVGLLDEGLHHFTSMT  534

Query  2382  KC-GVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASA-PELHAWTALIGGC  2236
             K  G+      +  +V+ + + G+   AY+     S  P+   W  L+ GC
Sbjct  535   KVHGIIPRTDHLACVVSLFARKGKTKEAYHFIQSFSVEPDKVVWRCLLSGC  585



>ref|XP_006361496.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Solanum tuberosum]
Length=702

 Score =   993 bits (2568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/697 (68%), Positives = 581/697 (83%), Gaps = 1/697 (0%)
 Frame = -2

Query  3072  MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSK-SDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             MS  Q++R CT++KS+ +GK+ HAQL+K GS+ +D++TNNHLL+MY+  ++++ AQ+LFD
Sbjct  1     MSFIQLLRGCTSSKSLFNGKSLHAQLLKLGSQNADIFTNNHLLTMYLKLNQLDDAQQLFD  60

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              MP+RN+I+WTTLIS+YS +G+SEKALG FRSM LE GF PN YTYV A SACS LGA R
Sbjct  61    RMPERNIISWTTLISTYSQLGMSEKALGCFRSMNLEYGFGPNGYTYVAAFSACSSLGAER  120

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
             TGKE+HGR+ + EE+LN+FVSNCLVNFYGKCGLLKSA++VFD +LEPN+VTWASL+SC  
Sbjct  121   TGKELHGRMLKTEESLNSFVSNCLVNFYGKCGLLKSARIVFDGILEPNSVTWASLISCFF  180

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
              C EY EGL +F+ +LR GV++NEF CG  LGACA+++ L  GM IH LIVK  + MDQ+
Sbjct  181   HCREYQEGLNMFVLALRGGVILNEFFCGSVLGACAAIKSLQLGMQIHGLIVKSSLGMDQF  240

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             VVTGL+NFY KCG+L LA   F+ A  PELHAWTA+IGGCVQ G GREA+ LFCKLLSSG
Sbjct  241   VVTGLINFYAKCGRLELARQAFDEADEPELHAWTAIIGGCVQLGSGREAIELFCKLLSSG  300

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             LKPSERT++SV+GAF D KE +VG Q+HS I+K GF+SF+FVCNAL+DFYSKS L ++S 
Sbjct  301   LKPSERTFSSVIGAFADIKELRVGKQIHSRIVKQGFDSFSFVCNALLDFYSKSELFEKSL  360

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
             K+FQEM E+D+V+WN LIAG + SG YE+A++ L+EML EG EP+L+TYS ILSICGDLP
Sbjct  361   KLFQEMKEHDVVSWNTLIAGCVSSGRYEEALRFLREMLLEGFEPSLYTYSSILSICGDLP  420

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             AIEWGKQ HCR++K  FDSNVVV S LIDMYAKCGRLG AR+VFDILP KNL+SWNTM++
Sbjct  421   AIEWGKQTHCRVLKSRFDSNVVVDSALIDMYAKCGRLGYARRVFDILPAKNLISWNTMVV  480

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             GYAQHGFGKEALEIY MMQ + VKPNDITF+GVLSACGH GLL+EGL+HF SM   + I 
Sbjct  481   GYAQHGFGKEALEIYGMMQSSEVKPNDITFLGVLSACGHVGLLDEGLHHFTSMTKVHEII  540

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             PRT+HLAC+V+LFARKG+TK+AY FI+SF  +PDKVVWRCLLSGC  N+DFVLGKYAAE+
Sbjct  541   PRTDHLACVVSLFARKGKTKEAYRFIKSFSGEPDKVVWRCLLSGCKANRDFVLGKYAAEK  600

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSS  1096
             IL IDP+DTSA++ LSNIYA L MWDE A+IRK++K K LKKETG SW ELQNK+Y FS+
Sbjct  601   ILDIDPDDTSAYIVLSNIYAELQMWDETAKIRKLIKAKALKKETGHSWIELQNKMYTFSA  660

Query  1095  SYNMLLGEVSMKKLLIGLTAQLLDAGYVPDTKLSFDY  985
                M L E  ++++L GLTAQLLD+GYVPD   S ++
Sbjct  661   CNIMSLQESYLQQVLTGLTAQLLDSGYVPDLMFSLNF  697


 Score =   203 bits (516),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 144/527 (27%), Positives = 252/527 (48%), Gaps = 19/527 (4%)
 Frame = -2

Query  3084  GPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQK  2905
             GP   +      +C++  +  +GK  H +++K     + + +N L++ Y     ++ A+ 
Sbjct  100   GPNGYTYVAAFSACSSLGAERTGKELHGRMLKTEESLNSFVSNCLVNFYGKCGLLKSARI  159

Query  2904  LFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             +FD + + N +TW +LIS + H    ++ L  F  + L  G   N +     L AC+ + 
Sbjct  160   VFDGILEPNSVTWASLISCFFHCREYQEGLNMF-VLALRGGVILNEFFCGSVLGACAAIK  218

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
             + + G +IHG I ++   ++ FV   L+NFY KCG L+ A+  FD   EP    W +++ 
Sbjct  219   SLQLGMQIHGLIVKSSLGMDQFVVTGLINFYAKCGRLELARQAFDEADEPELHAWTAIIG  278

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
                Q G   E + +F + L +G+  +E      +GA A ++ L  G  IH  IVK G   
Sbjct  279   GCVQLGSGREAIELFCKLLSSGLKPSERTFSSVIGAFADIKELRVGKQIHSRIVKQGFDS  338

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
               +V   L++FY K      +   F      ++ +W  LI GCV  G+  EA+    ++L
Sbjct  339   FSFVCNALLDFYSKSELFEKSLKLFQEMKEHDVVSWNTLIAGCVSSGRYEEALRFLREML  398

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
               G +PS  TY+S+L    D    + G Q H  ++K  F+S   V +AL+D Y+K   L 
Sbjct  399   LEGFEPSLYTYSSILSICGDLPAIEWGKQTHCRVLKSRFDSNVVVDSALIDMYAKCGRLG  458

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
              + ++F  +   ++++WN ++ GY + G  ++A+++   M    ++PN  T+  +LS CG
Sbjct  459   YARRVFDILPAKNLISWNTMVVGYAQHGFGKEALEIYGMMQSSEVKPNDITFLGVLSACG  518

Query  1824  DLPAIEWGKQVHCRIMK-----PGFDSNVVVGSTLIDMYAKCGRLGDAR---KVFDILPC  1669
              +  ++ G      + K     P  D    V    + ++A+ G+  +A    K F   P 
Sbjct  519   HVGLLDEGLHHFTSMTKVHEIIPRTDHLACV----VSLFARKGKTKEAYRFIKSFSGEPD  574

Query  1668  KNLVSWNTMLIG-YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLS  1531
             K  V W  +L G  A   F    L  Y+  +   + P+D +   VLS
Sbjct  575   K--VVWRCLLSGCKANRDF---VLGKYAAEKILDIDPDDTSAYIVLS  616


 Score =   125 bits (313),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 86/291 (30%), Positives = 140/291 (48%), Gaps = 3/291 (1%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L++   P + + S +I +    K +  GK  H++++K G  S  +  N LL  Y     
Sbjct  296   LLSSGLKPSERTFSSVIGAFADIKELRVGKQIHSRIVKQGFDSFSFVCNALLDFYSKSEL  355

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
              E + KLF EM + +V++W TLI+     G  E+AL   R M+LE GF P+ YTY   LS
Sbjct  356   FEKSLKLFQEMKEHDVVSWNTLIAGCVSSGRYEEALRFLREMLLE-GFEPSLYTYSSILS  414

Query  2742  ACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVT  2563
              C  L A   GK+ H R+ ++    N  V + L++ Y KCG L  A+ VFD +   N ++
Sbjct  415   ICGDLPAIEWGKQTHCRVLKSRFDSNVVVDSALIDMYAKCGRLGYARRVFDILPAKNLIS  474

Query  2562  WASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIV  2383
             W +++  + Q G   E L I+     + V  N+      L AC  V  L  G+     + 
Sbjct  475   WNTMVVGYAQHGFGKEALEIYGMMQSSEVKPNDITFLGVLSACGHVGLLDEGLHHFTSMT  534

Query  2382  KCGVKMDQYV-VTGLVNFYVKCGQLGLAYNTF-NMASAPELHAWTALIGGC  2236
             K    + +   +  +V+ + + G+   AY    + +  P+   W  L+ GC
Sbjct  535   KVHEIIPRTDHLACVVSLFARKGKTKEAYRFIKSFSGEPDKVVWRCLLSGC  585



>emb|CDO99888.1| unnamed protein product [Coffea canephora]
Length=637

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/638 (67%), Positives = 510/638 (80%), Gaps = 1/638 (0%)
 Frame = -2

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAART  2713
             MPKRNVITWTTLI S+S MGLSEKAL   RSMVLE GF PN +TYVGA+SAC    A   
Sbjct  1     MPKRNVITWTTLICSFSQMGLSEKALSCLRSMVLE-GFLPNEHTYVGAISACVNTRAVSI  59

Query  2712  GKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQ  2533
             GKEIHGRI+R +++LN+FVSN LVNFYGKCGLLKSA+L F A+ EPN V WASL+SC  Q
Sbjct  60    GKEIHGRIYRTQDSLNSFVSNSLVNFYGKCGLLKSARLAFAAIFEPNLVAWASLISCCFQ  119

Query  2532  CGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
             CG+ +EGL++FLRSLR G+ VNEF C   LGAC  +E L  G  IHCL+VKC + MDQ+V
Sbjct  120   CGQNEEGLKLFLRSLRVGMTVNEFTCSSVLGACTMLENLELGKQIHCLVVKCCILMDQFV  179

Query  2352  VTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
             +TGLVNFY KCGQL  A+  F  A+ P L AWTALIGGCVQQGKGR+A+ LF ++LSSG+
Sbjct  180   ITGLVNFYAKCGQLEAAHQAFLEANEPHLSAWTALIGGCVQQGKGRDAILLFHRMLSSGM  239

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             KPSE+T+ASV GA  D  + +VG QLHS IIKLGF+SFT VCN  + FY K  L++E+ K
Sbjct  240   KPSEKTFASVFGAIHDGMDVRVGKQLHSLIIKLGFDSFTVVCNTTLAFYIKRGLVEEALK  299

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPA  1813
              F EM EYDIVTWNA+I G++ SGHYE AI+ L++MLFEG +PNL+TYS +LSICGDLPA
Sbjct  300   TFYEMDEYDIVTWNAMITGFVGSGHYEGAIQFLRDMLFEGFDPNLYTYSSLLSICGDLPA  359

Query  1812  IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIG  1633
             ++WGKQ+H RI+KPGFDSNVVVGS LIDMYAKCG +  ARKVFD  P +NL+SWNTML+G
Sbjct  360   VQWGKQIHSRILKPGFDSNVVVGSALIDMYAKCGHMDAARKVFDTFPSRNLISWNTMLVG  419

Query  1632  YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITP  1453
             YAQ+GF KEALEIY MMQ NGVKPNDITF+GVLSACGH GLL+EGL HFNSM  +Y ITP
Sbjct  420   YAQNGFAKEALEIYDMMQMNGVKPNDITFIGVLSACGHVGLLQEGLCHFNSMIGDYRITP  479

Query  1452  RTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEI  1273
             + +HLACMV+LFAR GQT++A+DFIR FP + DKVVWRCLLSGC  NKD VLGKYAAE +
Sbjct  480   KADHLACMVSLFARHGQTQEAFDFIRRFPGEADKVVWRCLLSGCKTNKDVVLGKYAAERV  539

Query  1272  LSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSS  1093
             LSIDP+DTS H+ LSNIYA L MW+E A+ RK+MK+K LKK+TG SWTEL+N+I  FS+S
Sbjct  540   LSIDPDDTSVHIMLSNIYAGLRMWNELAETRKLMKEKTLKKDTGFSWTELKNRIVLFSAS  599

Query  1092  YNMLLGEVSMKKLLIGLTAQLLDAGYVPDTKLSFDYGD  979
              N  L + S+ ++L GL AQL+D  YVP+   S   G+
Sbjct  600   QNPHLEQNSLHEVLSGLAAQLVDEKYVPEIMFSLQCGE  637


 Score =   196 bits (498),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 124/419 (30%), Positives = 208/419 (50%), Gaps = 3/419 (1%)
 Frame = -2

Query  3054  IRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNV  2875
             I +C   +++  GK  H ++ +     + + +N L++ Y     ++ A+  F  + + N+
Sbjct  48    ISACVNTRAVSIGKEIHGRIYRTQDSLNSFVSNSLVNFYGKCGLLKSARLAFAAIFEPNL  107

Query  2874  ITWTTLISSYSHMGLSEKALGSF-RSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
             + W +LIS     G +E+ L  F RS  L  G T N +T    L AC+ L     GK+IH
Sbjct  108   VAWASLISCCFQCGQNEEGLKLFLRS--LRVGMTVNEFTCSSVLGACTMLENLELGKQIH  165

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
               + +    ++ FV   LVNFY KCG L++A   F    EP+   W +L+    Q G+  
Sbjct  166   CLVVKCCILMDQFVITGLVNFYAKCGQLEAAHQAFLEANEPHLSAWTALIGGCVQQGKGR  225

Query  2517  EGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLV  2338
             + + +F R L +G+  +E       GA      +  G  +H LI+K G      V    +
Sbjct  226   DAILLFHRMLSSGMKPSEKTFASVFGAIHDGMDVRVGKQLHSLIIKLGFDSFTVVCNTTL  285

Query  2337  NFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSER  2158
              FY+K G +  A  TF      ++  W A+I G V  G    A+     +L  G  P+  
Sbjct  286   AFYIKRGLVEEALKTFYEMDEYDIVTWNAMITGFVGSGHYEGAIQFLRDMLFEGFDPNLY  345

Query  2157  TYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEM  1978
             TY+S+L    D    Q G Q+HS I+K GF+S   V +AL+D Y+K   +D + K+F   
Sbjct  346   TYSSLLSICGDLPAVQWGKQIHSRILKPGFDSNVVVGSALIDMYAKCGHMDAARKVFDTF  405

Query  1977  TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWG  1801
                ++++WN ++ GY ++G  ++A+++   M   G++PN  T+  +LS CG +  ++ G
Sbjct  406   PSRNLISWNTMLVGYAQNGFAKEALEIYDMMQMNGVKPNDITFIGVLSACGHVGLLQEG  464


 Score = 82.0 bits (201),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 94/186 (51%), Gaps = 13/186 (7%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + S ++  C    ++  GK  H++++K G  S+V   + L+ MY     ++ A+K+
Sbjct  342   PNLYTYSSLLSICGDLPAVQWGKQIHSRILKPGFDSNVVVGSALIDMYAKCGHMDAARKV  401

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD  P RN+I+W T++  Y+  G +++AL  +  M + +G  PN  T++G LSAC  +G 
Sbjct  402   FDTFPSRNLISWNTMLVGYAQNGFAKEALEIYDMMQM-NGVKPNDITFIGVLSACGHVGL  460

Query  2721  ARTGK-EIHGRI--FRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAML----EPNTVT  2563
              + G    +  I  +R     ++    C+V+ + + G     Q  FD +     E + V 
Sbjct  461   LQEGLCHFNSMIGDYRITPKADHLA--CMVSLFARHG---QTQEAFDFIRRFPGEADKVV  515

Query  2562  WASLLS  2545
             W  LLS
Sbjct  516   WRCLLS  521



>ref|XP_006436646.1| hypothetical protein CICLE_v10030857mg [Citrus clementina]
 ref|XP_006436647.1| hypothetical protein CICLE_v10030857mg [Citrus clementina]
 ref|XP_006492198.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like 
[Citrus sinensis]
 gb|ESR49886.1| hypothetical protein CICLE_v10030857mg [Citrus clementina]
 gb|ESR49887.1| hypothetical protein CICLE_v10030857mg [Citrus clementina]
Length=697

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/692 (61%), Positives = 529/692 (76%), Gaps = 7/692 (1%)
 Frame = -2

Query  3072  MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDE  2893
             MS S+++R    +K IL G+  HA++I  G   +V T NHLL MYV F  I  AQKLFDE
Sbjct  1     MSFSRLLRLFGDSKCILKGRTLHAKMITSGFHPNVITYNHLLLMYVKFSRINDAQKLFDE  60

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMV---LEDGFTPNHYTYVGALSACSCLGA  2722
             MP+RNVI+W+ LIS +S +G+ E AL  FR MV   LE    PN+YTYVGA+SAC+  G 
Sbjct  61    MPERNVISWSALISGFSQIGMPEVALNYFRLMVCCVLE----PNYYTYVGAVSACASRGD  116

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
             AR+GKEIHGR++R+   LN+ VSNCL+N YGKCGLL SAQ VFDA LE N+++W SLLS 
Sbjct  117   ARSGKEIHGRMYRSGLELNSHVSNCLINMYGKCGLLSSAQFVFDASLERNSISWVSLLSS  176

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             +CQCGE+  GL+IFL S ++GV ++EF C   LGACA +  L  GM IH L+ KC ++ D
Sbjct  177   YCQCGEHVHGLKIFLLSRKSGVAISEFSCASVLGACAVLGNLKVGMQIHSLVFKCALEFD  236

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
             ++V  GL+N Y KC +L LA   F+    P+L AW+ALIGG  Q GK  EA++LF K+ S
Sbjct  237   KFVAMGLINLYAKCEKLDLASRVFSNIQLPDLTAWSALIGGYAQLGKACEAIDLFVKMFS  296

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
             SGL PSE T++ VLGAF D KE   G QLHS IIK+GF+SFTFV N ++DFYSK  LL+E
Sbjct  297   SGLMPSEVTFSYVLGAFADVKETIGGRQLHSLIIKMGFSSFTFVANTVLDFYSKCELLEE  356

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             S K F EM E+D+V+WNALIAG++ S HY +AI+LL++MLFEG  PNL+TYS IL+I  D
Sbjct  357   SLKTFDEMDEHDVVSWNALIAGHLASCHYGEAIELLKDMLFEGHCPNLYTYSNILNISSD  416

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             +PAIEWGKQ HC I+KPGFDSNVV+GS L+DMYAKCGRL DARKVFD L  KNLVSWNTM
Sbjct  417   IPAIEWGKQTHCCIVKPGFDSNVVIGSALVDMYAKCGRLNDARKVFDHLSSKNLVSWNTM  476

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             L+GYAQHG G+EALEIYSMMQEN +KPND TF+GVLSAC H GL+EEG ++FNSM  ++G
Sbjct  477   LVGYAQHGLGREALEIYSMMQENKIKPNDNTFIGVLSACVHIGLVEEGWHYFNSMIRDHG  536

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I+PR +H+A +V+LFA +GQT++AY+FI+S P +P+KVVWRCLLSGC  +KD VLG+YAA
Sbjct  537   ISPRMDHIASVVHLFACRGQTRRAYEFIKSSPIEPNKVVWRCLLSGCKTHKDLVLGRYAA  596

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             E+ILS DP DTSAH+ LSN+YA  NMWDE A++RK+MK+K LKK+TGCSWTELQNK++ F
Sbjct  597   EKILSTDPEDTSAHIMLSNVYAEANMWDETAKVRKIMKEKSLKKDTGCSWTELQNKMHYF  656

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPD  1006
             S+S       + + +++  L+  L D GYVPD
Sbjct  657   STSRFAQFQGIDLHEVMNQLSVHLFDGGYVPD  688


 Score =   102 bits (253),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/284 (27%), Positives = 127/284 (45%), Gaps = 3/284 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +++ S ++ +    K  + G+  H+ +IK G  S  +  N +L  Y     +E + K 
Sbjct  301   PSEVTFSYVLGAFADVKETIGGRQLHSLIIKMGFSSFTFVANTVLDFYSKCELLEESLKT  360

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FDEM + +V++W  LI+ +       +A+   + M+ E G  PN YTY   L+  S + A
Sbjct  361   FDEMDEHDVVSWNALIAGHLASCHYGEAIELLKDMLFE-GHCPNLYTYSNILNISSDIPA  419

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+ H  I +     N  + + LV+ Y KCG L  A+ VFD +   N V+W ++L  
Sbjct  420   IEWGKQTHCCIVKPGFDSNVVIGSALVDMYAKCGRLNDARKVFDHLSSKNLVSWNTMLVG  479

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMG-IHCLIVKCGVKM  2365
             + Q G   E L I+       +  N+      L AC  +  +  G    + +I   G+  
Sbjct  480   YAQHGLGREALEIYSMMQENKIKPNDNTFIGVLSACVHIGLVEEGWHYFNSMIRDHGISP  539

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMAS-APELHAWTALIGGC  2236
                 +  +V+ +   GQ   AY     +   P    W  L+ GC
Sbjct  540   RMDHIASVVHLFACRGQTRRAYEFIKSSPIEPNKVVWRCLLSGC  583



>gb|KDO42139.1| hypothetical protein CISIN_1g005881mg [Citrus sinensis]
Length=672

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/667 (61%), Positives = 513/667 (77%), Gaps = 7/667 (1%)
 Frame = -2

Query  2997  LIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKA  2818
             +I  G   +V T NHLL MYV F  I  AQKLFDEMP+RNVI+W+ LIS +S +G+ E A
Sbjct  1     MITSGFHPNVITYNHLLLMYVKFSRINDAQKLFDEMPERNVISWSALISGFSQIGMPEVA  60

Query  2817  LGSFRSMV---LEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNC  2647
             L  FR MV   LE    PN+YTYVGA+SAC+  G AR+GKEIHGR++R+   LN+ VSNC
Sbjct  61    LNYFRLMVCCVLE----PNYYTYVGAVSACASRGDARSGKEIHGRMYRSGLELNSHVSNC  116

Query  2646  LVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVN  2467
             L+N YGKCGLL SAQ VFDA LE N+++W SLLS +CQCGE+  GL+IFL S ++GV ++
Sbjct  117   LINMYGKCGLLSSAQFVFDASLERNSISWVSLLSSYCQCGEHVHGLKIFLLSRKSGVAIS  176

Query  2466  EFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFN  2287
             EF C   LGACA +  L  GM IH L+ KC ++ D++V  GL+N Y KC +L LA   F+
Sbjct  177   EFSCASVLGACAVLGNLKVGMQIHSLVFKCALEFDKFVAMGLINLYAKCEKLDLASRVFS  236

Query  2286  MASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQV  2107
                 P+L AW+ALIGG  Q GK  EA++LF K+ SSGL PSE T++ VLGAF D KE   
Sbjct  237   NIQLPDLTAWSALIGGYAQLGKACEAIDLFVKMFSSGLMPSEVTFSYVLGAFADVKETIG  296

Query  2106  GMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIR  1927
             G QLHS IIK+GF+SFTFV N ++DFYSK  LL+ES K F EM E+D+V+WNALIAG++ 
Sbjct  297   GRQLHSLIIKMGFSSFTFVANTVLDFYSKCELLEESLKTFDEMDEHDVVSWNALIAGHLA  356

Query  1926  SGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVV  1747
             S HY +AI+LL++MLFEG  PNL+TYS IL+I  D+PAIEWGKQ HC I+KPGFDSNVV+
Sbjct  357   SCHYGEAIELLKDMLFEGHCPNLYTYSNILNISSDIPAIEWGKQTHCCIVKPGFDSNVVI  416

Query  1746  GSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGV  1567
             GS L+DMYAKCGRL DARKVFD L  KNLVSWNTML+GYAQHG G+EALEIYSMMQEN +
Sbjct  417   GSALVDMYAKCGRLNDARKVFDHLSSKNLVSWNTMLVGYAQHGLGREALEIYSMMQENKI  476

Query  1566  KPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAY  1387
             KPND TF+GVLSAC H GL+EEG ++FNSM  ++GI+PR +H+A +V+LFA +GQT++AY
Sbjct  477   KPNDNTFIGVLSACVHIGLVEEGWHYFNSMIRDHGISPRMDHIASVVHLFACRGQTRRAY  536

Query  1386  DFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLN  1207
             +FI+S P +P+KVVWRCLLSGC  +KD VLG+YAAE+ILS DP DTSAH+ LSN+YA  N
Sbjct  537   EFIKSSPIEPNKVVWRCLLSGCKTHKDLVLGRYAAEKILSTDPEDTSAHIMLSNVYAEAN  596

Query  1206  MWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGEVSMKKLLIGLTAQLL  1027
             MWDE A++RK+MK+K LKK+TGCSWTELQNK++ FS+S       + + +++  L+  L 
Sbjct  597   MWDETAKVRKIMKEKSLKKDTGCSWTELQNKMHYFSTSRFAQFQGIDLHEVMNQLSVHLF  656

Query  1026  DAGYVPD  1006
             D GYVPD
Sbjct  657   DGGYVPD  663


 Score =   214 bits (544),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 134/480 (28%), Positives = 241/480 (50%), Gaps = 3/480 (1%)
 Frame = -2

Query  3054  IRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNV  2875
             + +C +     SGK  H ++ + G + + + +N L++MY     +  AQ +FD   +RN 
Sbjct  83    VSACASRGDARSGKEIHGRMYRSGLELNSHVSNCLINMYGKCGLLSSAQFVFDASLERNS  142

Query  2874  ITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHG  2695
             I+W +L+SSY   G     L  F  +  + G   + ++    L AC+ LG  + G +IH 
Sbjct  143   ISWVSLLSSYCQCGEHVHGLKIFL-LSRKSGVAISEFSCASVLGACAVLGNLKVGMQIHS  201

Query  2694  RIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDE  2515
              +F+     + FV+  L+N Y KC  L  A  VF  +  P+   W++L+  + Q G+  E
Sbjct  202   LVFKCALEFDKFVAMGLINLYAKCEKLDLASRVFSNIQLPDLTAWSALIGGYAQLGKACE  261

Query  2514  GLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVN  2335
              + +F++   +G++ +E      LGA A V+    G  +H LI+K G     +V   +++
Sbjct  262   AIDLFVKMFSSGLMPSEVTFSYVLGAFADVKETIGGRQLHSLIIKMGFSSFTFVANTVLD  321

Query  2334  FYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERT  2155
             FY KC  L  +  TF+     ++ +W ALI G +      EA+ L   +L  G  P+  T
Sbjct  322   FYSKCELLEESLKTFDEMDEHDVVSWNALIAGHLASCHYGEAIELLKDMLFEGHCPNLYT  381

Query  2154  YASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMT  1975
             Y+++L   +D    + G Q H  I+K GF+S   + +ALVD Y+K   L+++ K+F  ++
Sbjct  382   YSNILNISSDIPAIEWGKQTHCCIVKPGFDSNVVIGSALVDMYAKCGRLNDARKVFDHLS  441

Query  1974  EYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWG-K  1798
               ++V+WN ++ GY + G   +A+++   M    ++PN +T+  +LS C  +  +E G  
Sbjct  442   SKNLVSWNTMLVGYAQHGLGREALEIYSMMQENKIKPNDNTFIGVLSACVHIGLVEEGWH  501

Query  1797  QVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-NLVSWNTMLIGYAQH  1621
               +  I   G    +   ++++ ++A  G+   A +     P + N V W  +L G   H
Sbjct  502   YFNSMIRDHGISPRMDHIASVVHLFACRGQTRRAYEFIKSSPIEPNKVVWRCLLSGCKTH  561


 Score =   102 bits (253),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/284 (27%), Positives = 127/284 (45%), Gaps = 3/284 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +++ S ++ +    K  + G+  H+ +IK G  S  +  N +L  Y     +E + K 
Sbjct  276   PSEVTFSYVLGAFADVKETIGGRQLHSLIIKMGFSSFTFVANTVLDFYSKCELLEESLKT  335

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FDEM + +V++W  LI+ +       +A+   + M+ E G  PN YTY   L+  S + A
Sbjct  336   FDEMDEHDVVSWNALIAGHLASCHYGEAIELLKDMLFE-GHCPNLYTYSNILNISSDIPA  394

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+ H  I +     N  + + LV+ Y KCG L  A+ VFD +   N V+W ++L  
Sbjct  395   IEWGKQTHCCIVKPGFDSNVVIGSALVDMYAKCGRLNDARKVFDHLSSKNLVSWNTMLVG  454

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMG-IHCLIVKCGVKM  2365
             + Q G   E L I+       +  N+      L AC  +  +  G    + +I   G+  
Sbjct  455   YAQHGLGREALEIYSMMQENKIKPNDNTFIGVLSACVHIGLVEEGWHYFNSMIRDHGISP  514

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMAS-APELHAWTALIGGC  2236
                 +  +V+ +   GQ   AY     +   P    W  L+ GC
Sbjct  515   RMDHIASVVHLFACRGQTRRAYEFIKSSPIEPNKVVWRCLLSGC  558



>ref|XP_010242606.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like 
[Nelumbo nucifera]
Length=697

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/693 (56%), Positives = 514/693 (74%), Gaps = 1/693 (0%)
 Frame = -2

Query  3072  MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDE  2893
             M+ + ++R       +L G+  HA +I  G   DVYT+NHL+SMYV F   + A++L ++
Sbjct  1     MAFNHLLRVFGETGCVLKGRTVHAMIITSGFSLDVYTSNHLVSMYVKFGRFDDARRLLNQ  60

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAART  2713
             +P RN+++WT LI+ YS    +E+AL  FRSMV E G  PNHYTYV A+SAC+  GAART
Sbjct  61    LPDRNLVSWTVLIAGYSQARFAEEALDCFRSMVAE-GINPNHYTYVSAISACANTGAART  119

Query  2712  GKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQ  2533
             GKE+HG+I+R E+  N+FV NCLVN Y KC L+KSAQLVFD++LEPN V+W SLLS +CQ
Sbjct  120   GKEVHGKIYRTEQEPNSFVDNCLVNLYVKCRLMKSAQLVFDSILEPNLVSWTSLLSGYCQ  179

Query  2532  CGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
             CG+ +EGLRIFL+  RAGV  NEF+    LGACA++E L  GM +H  +VK G+  DQ++
Sbjct  180   CGDNEEGLRIFLQCRRAGVKANEFISASVLGACAALENLEAGMQVHSEVVKSGIGSDQFI  239

Query  2352  VTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
             VTG+++ Y KCG+L LA   F     P L +WTALIGGC QQG+ +EA++LF KL S  +
Sbjct  240   VTGIIHLYAKCGKLQLARQAFLELEKPPLSSWTALIGGCTQQGEVKEAIDLFQKLHSLAI  299

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             KPS+ T++S+LG   D    + G Q+HSFIIK GFNS TFV N+++D YSK  LL+ES K
Sbjct  300   KPSDHTFSSILGGLADAMAIEEGKQIHSFIIKSGFNSVTFVVNSILDLYSKCGLLEESSK  359

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPA  1813
             +F+E+   D+V+WNA+I+GYI+ G +++AI+LL +M+ EGL P+ +TYS ILSICG +PA
Sbjct  360   VFEEIKGKDVVSWNAMISGYIKQGKFKEAIELLDKMVLEGLNPSPYTYSSILSICGTIPA  419

Query  1812  IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIG  1633
             IEWGKQ+HC I+KPGFD+NVVVGS+L+DMYAKCGR+ DA+KVF+ L  K+LVSWNTML+G
Sbjct  420   IEWGKQIHCCIIKPGFDTNVVVGSSLVDMYAKCGRISDAQKVFNNLTSKSLVSWNTMLVG  479

Query  1632  YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITP  1453
             YAQHGFG+EALEI+  MQ  G+ PNDITF+GVLSACGH G +EEG  HFNSM  ++ I P
Sbjct  480   YAQHGFGREALEIFEEMQREGISPNDITFLGVLSACGHVGNVEEGWRHFNSMIRDHRIVP  539

Query  1452  RTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEI  1273
             R +H +CMV+L  RKGQ ++AY+FI+  P +PDKVVWRCLL+GC    D V+GKYAAE+I
Sbjct  540   RIDHYSCMVSLLTRKGQIRRAYEFIKGMPMEPDKVVWRCLLAGCKAQNDLVVGKYAAEKI  599

Query  1272  LSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSS  1093
             L IDP D SAH+ L  +YA   MWDE AQ+RK MK+K LKK+ G SW  ++NK+  F + 
Sbjct  600   LEIDPEDASAHIMLFRVYAGAEMWDETAQVRKRMKEKGLKKDPGHSWIVVKNKVTSFIAG  659

Query  1092  YNMLLGEVSMKKLLIGLTAQLLDAGYVPDTKLS  994
              N  +   S+ +++  LT Q++DAGY P+ + S
Sbjct  660   DNAHVHGDSLHEVVSRLTNQMIDAGYTPNLRFS  692


 Score =   226 bits (577),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 131/493 (27%), Positives = 244/493 (49%), Gaps = 3/493 (1%)
 Frame = -2

Query  3105  SILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFH  2926
             S++     P   +    I +C    +  +GK  H ++ +   + + + +N L+++YV   
Sbjct  91    SMVAEGINPNHYTYVSAISACANTGAARTGKEVHGKIYRTEQEPNSFVDNCLVNLYVKCR  150

Query  2925  EIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGAL  2746
              ++ AQ +FD + + N+++WT+L+S Y   G +E+ L  F       G   N +     L
Sbjct  151   LMKSAQLVFDSILEPNLVSWTSLLSGYCQCGDNEEGLRIFLQ-CRRAGVKANEFISASVL  209

Query  2745  SACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTV  2566
              AC+ L     G ++H  + ++    + F+   +++ Y KCG L+ A+  F  + +P   
Sbjct  210   GACAALENLEAGMQVHSEVVKSGIGSDQFIVTGIIHLYAKCGKLQLARQAFLELEKPPLS  269

Query  2565  TWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLI  2386
             +W +L+    Q GE  E + +F +     +  ++      LG  A    +  G  IH  I
Sbjct  270   SWTALIGGCTQQGEVKEAIDLFQKLHSLAIKPSDHTFSSILGGLADAMAIEEGKQIHSFI  329

Query  2385  VKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAV  2206
             +K G     +VV  +++ Y KCG L  +   F      ++ +W A+I G ++QGK +EA+
Sbjct  330   IKSGFNSVTFVVNSILDLYSKCGLLEESSKVFEEIKGKDVVSWNAMISGYIKQGKFKEAI  389

Query  2205  NLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFY  2026
              L  K++  GL PS  TY+S+L         + G Q+H  IIK GF++   V ++LVD Y
Sbjct  390   ELLDKMVLEGLNPSPYTYSSILSICGTIPAIEWGKQIHCCIIKPGFDTNVVVGSSLVDMY  449

Query  2025  SKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYS  1846
             +K   + ++ K+F  +T   +V+WN ++ GY + G   +A+++ +EM  EG+ PN  T+ 
Sbjct  450   AKCGRISDAQKVFNNLTSKSLVSWNTMLVGYAQHGFGREALEIFEEMQREGISPNDITFL  509

Query  1845  CILSICGDLPAIEWG-KQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPC  1669
              +LS CG +  +E G +  +  I        +   S ++ +  + G++  A +    +P 
Sbjct  510   GVLSACGHVGNVEEGWRHFNSMIRDHRIVPRIDHYSCMVSLLTRKGQIRRAYEFIKGMPM  569

Query  1668  K-NLVSWNTMLIG  1633
             + + V W  +L G
Sbjct  570   EPDKVVWRCLLAG  582


 Score =   124 bits (310),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 87/289 (30%), Positives = 137/289 (47%), Gaps = 7/289 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + S I+       +I  GK  H+ +IK G  S  +  N +L +Y     +E + K+
Sbjct  301   PSDHTFSSILGGLADAMAIEEGKQIHSFIIKSGFNSVTFVVNSILDLYSKCGLLEESSKV  360

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F+E+  ++V++W  +IS Y   G  ++A+     MVLE G  P+ YTY   LS C  + A
Sbjct  361   FEEIKGKDVVSWNAMISGYIKQGKFKEAIELLDKMVLE-GLNPSPYTYSSILSICGTIPA  419

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IH  I +     N  V + LV+ Y KCG +  AQ VF+ +   + V+W ++L  
Sbjct  420   IEWGKQIHCCIIKPGFDTNVVVGSSLVDMYAKCGRISDAQKVFNNLTSKSLVSWNTMLVG  479

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFG-MGIHCLIVKCGV--  2371
             + Q G   E L IF    R G+  N+      L AC  V  +  G    + +I    +  
Sbjct  480   YAQHGFGREALEIFEEMQREGISPNDITFLGVLSACGHVGNVEEGWRHFNSMIRDHRIVP  539

Query  2370  KMDQYVVTGLVNFYVKCGQLGLAYNTFN-MASAPELHAWTALIGGCVQQ  2227
             ++D Y  + +V+   + GQ+  AY     M   P+   W  L+ GC  Q
Sbjct  540   RIDHY--SCMVSLLTRKGQIRRAYEFIKGMPMEPDKVVWRCLLAGCKAQ  586



>ref|XP_007010243.1| Pentatricopeptide repeat-containing protein [Theobroma cacao]
 gb|EOY19053.1| Pentatricopeptide repeat-containing protein [Theobroma cacao]
Length=671

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/660 (60%), Positives = 501/660 (76%), Gaps = 1/660 (0%)
 Frame = -2

Query  3069  SLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM  2890
             S S++ R     +SI +G A HA++I      D+YTNNHLL+MYV F+ I  A+K+FD M
Sbjct  3     SFSRLFRLLGDTRSIRNGIALHAKIITSQISRDIYTNNHLLAMYVKFNRIVDARKVFDGM  62

Query  2889  PKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTG  2710
             P+RNVI+WT LIS YS MG++EKAL    S+++ D   PN+YT+V A+SAC+ LG    G
Sbjct  63    PERNVISWTALISGYSQMGMAEKALDCL-SLMVSDDLEPNYYTFVSAVSACASLGDGSVG  121

Query  2709  KEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQC  2530
             KE+HGRI+R+    +  V N L+N YGKCGLLKSAQLVFDAMLEPN ++W SLLSC+CQ 
Sbjct  122   KEVHGRIYRSGVDFSTPVCNSLINMYGKCGLLKSAQLVFDAMLEPNLISWTSLLSCYCQQ  181

Query  2529  GEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVV  2350
             GE  E L+IF++S R GV VNEF C   L  CA +E L  GM IH L+VKCG++ D++V 
Sbjct  182   GENMESLKIFVQSRRVGVRVNEFTCASVLSVCAGLEDLKVGMQIHGLVVKCGLEFDKFVE  241

Query  2349  TGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLK  2170
             TGL++FY KCG+L LA   F   +   + AWT+LIGG VQQG+  EA++LF KL SSG++
Sbjct  242   TGLISFYTKCGELILAGQVFLEVNQSNVAAWTSLIGGYVQQGRREEAIDLFLKLHSSGIR  301

Query  2169  PSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKI  1990
             PSERT++SVLGA  D +  +VG Q HS I K+G+ SF +V NA++DFYSK  LL E+ + 
Sbjct  302   PSERTFSSVLGACADAEVIEVGKQFHSLIAKMGYVSFIYVGNAVLDFYSKCGLLQEALRT  361

Query  1989  FQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAI  1810
             F++M  +D+V+WN+LI+G++ SG YE AI+LL+EMLF+G +PNL+TYS IL+IC D+PAI
Sbjct  362   FEDMDGHDMVSWNSLISGHVGSGQYEDAIELLKEMLFQGYKPNLYTYSSILNICSDVPAI  421

Query  1809  EWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGY  1630
             EWGKQ HC I+KP FDSNVVVGS LIDMYAKCG L  ARKVFD L  KNLVSWNTML+GY
Sbjct  422   EWGKQTHCCIIKPAFDSNVVVGSALIDMYAKCGVLNAARKVFDYLTSKNLVSWNTMLVGY  481

Query  1629  AQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPR  1450
             AQHGF +EALEIY MMQ + VKPND+TFVGVLSAC H GL EEGL+++NSM  ++ I P+
Sbjct  482   AQHGFAREALEIYCMMQRDDVKPNDVTFVGVLSACAHAGLSEEGLHYYNSMIRDHSIAPK  541

Query  1449  TNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEIL  1270
               HLA +VNL ARKG T++AYDFIRSFP  P KVVWRCLLSGC  +KD VLG++AAE+IL
Sbjct  542   MEHLASIVNLLARKGATRRAYDFIRSFPTDPSKVVWRCLLSGCKSHKDLVLGRFAAEKIL  601

Query  1269  SIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSY  1090
             SIDP DTSA++ LSNIYA   MWDE AQ+RK+MK+K +KK+ G +W EL+NK  C  + Y
Sbjct  602   SIDPEDTSAYIMLSNIYAEAKMWDETAQLRKIMKEKAMKKDAGYTWIELKNKDICLMTCY  661


 Score =   119 bits (297),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 80/286 (28%), Positives = 136/286 (48%), Gaps = 7/286 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + + S ++ +C   + I  GK  H+ + K G  S +Y  N +L  Y     ++ A + 
Sbjct  302   PSERTFSSVLGACADAEVIEVGKQFHSLIAKMGYVSFIYVGNAVLDFYSKCGLLQEALRT  361

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F++M   ++++W +LIS +   G  E A+   + M+ + G+ PN YTY   L+ CS + A
Sbjct  362   FEDMDGHDMVSWNSLISGHVGSGQYEDAIELLKEMLFQ-GYKPNLYTYSSILNICSDVPA  420

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+ H  I +     N  V + L++ Y KCG+L +A+ VFD +   N V+W ++L  
Sbjct  421   IEWGKQTHCCIIKPAFDSNVVVGSALIDMYAKCGVLNAARKVFDYLTSKNLVSWNTMLVG  480

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVK---CGV  2371
             + Q G   E L I+    R  V  N+      L ACA       G+  +  +++      
Sbjct  481   YAQHGFAREALEIYCMMQRDDVKPNDVTFVGVLSACAHAGLSEEGLHYYNSMIRDHSIAP  540

Query  2370  KMDQYVVTGLVNFYVKCGQLGLAYNTF-NMASAPELHAWTALIGGC  2236
             KM+   +  +VN   + G    AY+   +  + P    W  L+ GC
Sbjct  541   KMEH--LASIVNLLARKGATRRAYDFIRSFPTDPSKVVWRCLLSGC  584


 Score = 90.9 bits (224),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 93/178 (52%), Gaps = 2/178 (1%)
 Frame = -2

Query  1860  LHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFD  1681
             + ++S +  + GD  +I  G  +H +I+      ++   + L+ MY K  R+ DARKVFD
Sbjct  1     MSSFSRLFRLLGDTRSIRNGIALHAKIITSQISRDIYTNNHLLAMYVKFNRIVDARKVFD  60

Query  1680  ILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHggllee  1501
              +P +N++SW  ++ GY+Q G  ++AL+  S+M  + ++PN  TFV  +SAC   G    
Sbjct  61    GMPERNVISWTALISGYSQMGMAEKALDCLSLMVSDDLEPNYYTFVSAVSACASLGDGSV  120

Query  1500  gLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLS  1327
             G      +  + G+   T     ++N++ + G  K A     +  E P+ + W  LLS
Sbjct  121   GKEVHGRIYRS-GVDFSTPVCNSLINMYGKCGLLKSAQLVFDAMLE-PNLISWTSLLS  176



>ref|XP_011102135.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like 
[Sesamum indicum]
Length=588

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/588 (67%), Positives = 469/588 (80%), Gaps = 0/588 (0%)
 Frame = -2

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAART  2713
             M  RN++TWT LIS+YS MGLSEKAL  FR MVL+DG TPN YTYV A+SAC+ +GA R 
Sbjct  1     MLARNLVTWTALISAYSQMGLSEKALNYFRLMVLDDGITPNDYTYVAAISACARVGALRN  60

Query  2712  GKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQ  2533
             GKEIHGRI+R EET+N+FV+N LVN YGKCGLLKSA+LVFDA+ E N V+  SL++ + Q
Sbjct  61    GKEIHGRIYRREETVNSFVNNSLVNLYGKCGLLKSARLVFDAIPEINAVSCVSLITSYMQ  120

Query  2532  CGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
             CGE +EGLRIFLRSLR GV VNEF  G  LGACA++E L  G  + CL +KCGVKMDQ+V
Sbjct  121   CGENEEGLRIFLRSLRRGVKVNEFSYGSILGACANLEMLEVGRQVQCLALKCGVKMDQFV  180

Query  2352  VTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
             +T LVNFY KCGQL LA      A  P + A TALIGG VQ+GK REA+++F ++LS+G 
Sbjct  181   LTSLVNFYAKCGQLELASRVLREADKPNVEAVTALIGGFVQEGKSREAIDVFQEMLSAGT  240

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             KPSE+T+A+VLGAF   KE Q G QLH  IIK+GF SFTFVCNA +DFY+K + LDESFK
Sbjct  241   KPSEQTFAAVLGAFGKEKEIQGGAQLHCSIIKMGFESFTFVCNAALDFYAKIDCLDESFK  300

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPA  1813
             IF  M   DIV+WNALIAGY+ SGHYE AI  ++ ML +G  P+++TYS +LS+CGDLPA
Sbjct  301   IFCGMDVNDIVSWNALIAGYVNSGHYEAAIGFIRSMLLQGFHPDIYTYSILLSVCGDLPA  360

Query  1812  IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIG  1633
              EWGKQ HC I+KPG DSNVVVGS LIDMYAKCGRL DARKVF+ILP KNLVSWN M+ G
Sbjct  361   TEWGKQTHCCIIKPGLDSNVVVGSALIDMYAKCGRLNDARKVFNILPGKNLVSWNVMITG  420

Query  1632  YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITP  1453
             YAQHGFG+EALEIY +M  NGVKPNDITF+G+LS+CGH G LEE L+HF SM N++G+TP
Sbjct  421   YAQHGFGREALEIYDLMLRNGVKPNDITFIGILSSCGHVGALEEALHHFGSMTNDFGVTP  480

Query  1452  RTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEI  1273
             R +HLAC+V+L+ARKGQTK AYDFIR FP +P+KVVWRCLL GC  +KD  L  YAAE+I
Sbjct  481   RPDHLACIVSLYARKGQTKGAYDFIRRFPGEPNKVVWRCLLFGCVTDKDLELAVYAAEKI  540

Query  1272  LSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWT  1129
             LSIDPND S HV LSNIYA  NMW EA+Q+RK+M+ K L+KETG SW 
Sbjct  541   LSIDPNDASVHVMLSNIYADSNMWSEASQVRKLMEGKTLRKETGYSWA  588


 Score =   205 bits (521),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 147/531 (28%), Positives = 248/531 (47%), Gaps = 15/531 (3%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L     P   +    I +C    ++ +GK  H ++ +     + + NN L+++Y     
Sbjct  33    VLDDGITPNDYTYVAAISACARVGALRNGKEIHGRIYRREETVNSFVNNSLVNLYGKCGL  92

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSF-RSMVLEDGFTPNHYTYVGAL  2746
             ++ A+ +FD +P+ N ++  +LI+SY   G +E+ L  F RS  L  G   N ++Y   L
Sbjct  93    LKSARLVFDAIPEINAVSCVSLITSYMQCGENEEGLRIFLRS--LRRGVKVNEFSYGSIL  150

Query  2745  SACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTV  2566
              AC+ L     G+++     +    ++ FV   LVNFY KCG L+ A  V     +PN  
Sbjct  151   GACANLEMLEVGRQVQCLALKCGVKMDQFVLTSLVNFYAKCGQLELASRVLREADKPNVE  210

Query  2565  TWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLI  2386
                +L+    Q G+  E + +F   L AG   +E      LGA    + +  G  +HC I
Sbjct  211   AVTALIGGFVQEGKSREAIDVFQEMLSAGTKPSEQTFAAVLGAFGKEKEIQGGAQLHCSI  270

Query  2385  VKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAV  2206
             +K G +   +V    ++FY K   L  ++  F      ++ +W ALI G V  G    A+
Sbjct  271   IKMGFESFTFVCNAALDFYAKIDCLDESFKIFCGMDVNDIVSWNALIAGYVNSGHYEAAI  330

Query  2205  NLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFY  2026
                  +L  G  P   TY+ +L    D    + G Q H  IIK G +S   V +AL+D Y
Sbjct  331   GFIRSMLLQGFHPDIYTYSILLSVCGDLPATEWGKQTHCCIIKPGLDSNVVVGSALIDMY  390

Query  2025  SKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYS  1846
             +K   L+++ K+F  +   ++V+WN +I GY + G   +A+++   ML  G++PN  T+ 
Sbjct  391   AKCGRLNDARKVFNILPGKNLVSWNVMITGYAQHGFGREALEIYDLMLRNGVKPNDITFI  450

Query  1845  CILSICGDLPAIE-----WGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFD  1681
              ILS CG + A+E     +G   +   + P  D      + ++ +YA+ G+   A     
Sbjct  451   GILSSCGHVGALEEALHHFGSMTNDFGVTPRPDHL----ACIVSLYARKGQTKGAYDFIR  506

Query  1680  ILPCK-NLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLS  1531
               P + N V W  +L G          L +Y+  +   + PND +   +LS
Sbjct  507   RFPGEPNKVVWRCLLFGCVTD--KDLELAVYAAEKILSIDPNDASVHVMLS  555



>gb|EYU37193.1| hypothetical protein MIMGU_mgv1a021143mg [Erythranthe guttata]
Length=605

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/605 (61%), Positives = 461/605 (76%), Gaps = 0/605 (0%)
 Frame = -2

Query  2943  MYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHY  2764
             MY     I  AQKLFDEM  RNVITWT+LIS+YS +GLSEKAL  F+ MVL+DG  PN Y
Sbjct  1     MYSKIGYIGYAQKLFDEMLVRNVITWTSLISAYSQLGLSEKALSCFQLMVLDDGIAPNEY  60

Query  2763  TYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAM  2584
             T+V A+SAC+ +GA R GKEIHG+++R+EET+N FV+N L+NFYGKCG L+SA+LVFD M
Sbjct  61    TFVAAISACAQVGALRNGKEIHGKMYRSEETVNTFVNNSLINFYGKCGSLESARLVFDTM  120

Query  2583  LEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGM  2404
              EPN V+  SL++ + Q G+ +EGL +F + +R GV +NEFL G  LG CA++E L  GM
Sbjct  121   PEPNIVSCVSLIASYTQSGDNEEGLIVFSKFMRMGVEINEFLYGSVLGICAALEVLNVGM  180

Query  2403  GIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQG  2224
              + C+ +KCGV+MDQ+VVT LVNFY KCG+L LA      A+ P + AWTALIGG VQ G
Sbjct  181   QLQCIALKCGVRMDQFVVTALVNFYAKCGELELANKALREANKPNVTAWTALIGGYVQTG  240

Query  2223  KGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCN  2044
             K REA++LF ++L +GLKP+E+T+ASVLGA    KE + G+Q+H  IIKLGF SFT V N
Sbjct  241   KCREAIDLFQEMLFAGLKPNEQTFASVLGALGREKETRHGIQIHCLIIKLGFQSFTLVSN  300

Query  2043  ALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEP  1864
             A  DFY+K   LDESFK F EM  +DIV+WN LIAG++  G YE AIK ++ ML +G +P
Sbjct  301   ATSDFYAKIGCLDESFKTFCEMEVHDIVSWNTLIAGFLNYGRYELAIKFIENMLLDGFDP  360

Query  1863  NLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVF  1684
             N++TYS ILS+CGDLPA EWGKQ HCR++KPG DSNVVVGS LIDMYAKCG+L +ARKVF
Sbjct  361   NIYTYSSILSVCGDLPAAEWGKQTHCRVIKPGLDSNVVVGSALIDMYAKCGQLNNARKVF  420

Query  1683  DILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglle  1504
             D LP KNLVSWN+M+ GYAQHGFG+EALEIY +M    VKPNDITFVGVLSA GH G LE
Sbjct  421   DFLPIKNLVSWNSMITGYAQHGFGREALEIYDIMLRCRVKPNDITFVGVLSAYGHVGDLE  480

Query  1503  egLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
               L  F SM  ++ I PRT+HLAC+V+L+AR GQTK+A+D IRS   + +KVVWR LL G
Sbjct  481   AALQCFGSMTKDFRIAPRTDHLACVVSLYARNGQTKEAHDLIRSSRVEQNKVVWRSLLFG  540

Query  1323  CNINKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKET  1144
             C  +KD  L   AAE+ILSID +D SA V LSNIY+ L MW EA+++RK+++ K +KKET
Sbjct  541   CVNSKDLDLAVLAAEKILSIDLDDVSARVMLSNIYSDLGMWSEASEVRKVIEGKTVKKET  600

Query  1143  GCSWT  1129
             G SWT
Sbjct  601   GYSWT  605


 Score =   211 bits (538),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 139/496 (28%), Positives = 235/496 (47%), Gaps = 11/496 (2%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L     P + +    I +C    ++ +GK  H ++ +     + + NN L++ Y     
Sbjct  50    VLDDGIAPNEYTFVAAISACAQVGALRNGKEIHGKMYRSEETVNTFVNNSLINFYGKCGS  109

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
             +E A+ +FD MP+ N+++  +LI+SY+  G +E+ L  F S  +  G   N + Y   L 
Sbjct  110   LESARLVFDTMPEPNIVSCVSLIASYTQSGDNEEGLIVF-SKFMRMGVEINEFLYGSVLG  168

Query  2742  ACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVT  2563
              C+ L     G ++     +    ++ FV   LVNFY KCG L+ A        +PN   
Sbjct  169   ICAALEVLNVGMQLQCIALKCGVRMDQFVVTALVNFYAKCGELELANKALREANKPNVTA  228

Query  2562  WASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIV  2383
             W +L+  + Q G+  E + +F   L AG+  NE      LGA    +    G+ IHCLI+
Sbjct  229   WTALIGGYVQTGKCREAIDLFQEMLFAGLKPNEQTFASVLGALGREKETRHGIQIHCLII  288

Query  2382  KCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVN  2203
             K G +    V     +FY K G L  ++ TF      ++ +W  LI G +  G+   A+ 
Sbjct  289   KLGFQSFTLVSNATSDFYAKIGCLDESFKTFCEMEVHDIVSWNTLIAGFLNYGRYELAIK  348

Query  2202  LFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYS  2023
                 +L  G  P+  TY+S+L    D    + G Q H  +IK G +S   V +AL+D Y+
Sbjct  349   FIENMLLDGFDPNIYTYSSILSVCGDLPAAEWGKQTHCRVIKPGLDSNVVVGSALIDMYA  408

Query  2022  KSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSC  1843
             K   L+ + K+F  +   ++V+WN++I GY + G   +A+++   ML   ++PN  T+  
Sbjct  409   KCGQLNNARKVFDFLPIKNLVSWNSMITGYAQHGFGREALEIYDIMLRCRVKPNDITFVG  468

Query  1842  ILSICGDLPAIEWGKQVHCRIMK-----PGFDSNVVVGSTLIDMYAKCGRLGDARKVFDI  1678
             +LS  G +  +E   Q    + K     P  D    V    + +YA+ G+  +A  +   
Sbjct  469   VLSAYGHVGDLEAALQCFGSMTKDFRIAPRTDHLACV----VSLYARNGQTKEAHDLIRS  524

Query  1677  LPC-KNLVSWNTMLIG  1633
                 +N V W ++L G
Sbjct  525   SRVEQNKVVWRSLLFG  540



>ref|XP_010943720.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like [Elaeis guineensis]
Length=646

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/648 (51%), Positives = 450/648 (69%), Gaps = 4/648 (1%)
 Frame = -2

Query  3072  MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDE  2893
             MSL  ++ +  + + I   K  H ++I  G   ++  +NHL+S YV+   IE A++LFD+
Sbjct  1     MSLKFLLPALRSARCISKRKMVHGKIIVSGFLPNLVASNHLMSTYVSCDRIEDARRLFDQ  60

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAART  2713
             MP++NV++WT LIS YS  G  E A+ SFRSMV   GF+PN +TYV  LSAC+ +GAAR+
Sbjct  61    MPEKNVVSWTILISGYSKSGPKEAAVSSFRSMV-SSGFSPNDFTYVSVLSACASIGAARS  119

Query  2712  GKEIHGRIFRAEE-TLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
             GKEIHGRI+R E   L++FVSN LVN Y KCG++  ++ +FD +++PN V+W S+LS +C
Sbjct  120   GKEIHGRIYRLEGGVLSSFVSNSLVNLYAKCGMIHLSRSLFDGIIQPNMVSWGSILSGYC  179

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
             QCG+ +E LRIF R+ + GV +NEF+    L AC+S+  L  G  +HC ++K G+  DQ+
Sbjct  180   QCGQNEEALRIFARAWKEGVGINEFMVASVLSACSSLGVLAVGKQVHCYVIKSGIPSDQF  239

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V   +V+ YVKC +L LAY  F+    P L +W ALIGG  QQG G  A+ LF KL SS 
Sbjct  240   VEAAVVDMYVKCNELDLAYQAFSELDEPGLASWAALIGGYAQQGHGERAICLFRKLQSSC  299

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             LKP+E  +  VL   +     + G QLH+ IIK GF    +V NA++DFY+K  LLDES 
Sbjct  300   LKPNEHIFPCVLVGCSTVAAVEGGKQLHALIIKSGFRMAAYVGNAVMDFYAKCGLLDESV  359

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
             K+F+EM E+DIV++NA+IA Y+    ++  ++LL++ML EG  PN +TYS IL +C DLP
Sbjct  360   KLFEEMEEHDIVSYNAMIARYVDRCDFKGVMELLKQMLLEGTNPNPYTYSSILKLCADLP  419

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
              + WG+Q H  I++ G D+NV+VGS LIDMYAKCGRL DARKVF ++P KNLVSWN ML+
Sbjct  420   VVRWGQQTHNLIIRLGLDANVIVGSALIDMYAKCGRLEDARKVFRMMPSKNLVSWNGMLV  479

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             GYAQHGFG+EAL I+ MMQ   +KPN+ITF+GVLSAC H GL+++G  +F+ MK   GI 
Sbjct  480   GYAQHGFGEEALGIFHMMQMESIKPNEITFIGVLSACAHAGLVKQGQCYFDLMK-GCGII  538

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             PR +H ACMV+LFAR G  ++AY+FI+S P +P+KV+WR L++GC  + +  +G  AA +
Sbjct  539   PRIDHFACMVDLFARAGLVERAYEFIKSMPIQPNKVIWRSLMAGCKTHGNLGIGLNAARQ  598

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSW  1132
             IL IDP D SAHV LS +YA   MWDE A +R  +K    KK  GCSW
Sbjct  599   ILKIDPEDDSAHVMLSGVYANAGMWDERAGVRDFLKMG-FKKVPGCSW  645


 Score = 95.9 bits (237),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 100/193 (52%), Gaps = 14/193 (7%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L     P   + S I++ C     +  G+  H  +I+ G  ++V   + L+ MY     
Sbjct  396   MLLEGTNPNPYTYSSILKLCADLPVVRWGQQTHNLIIRLGLDANVIVGSALIDMYAKCGR  455

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
             +E A+K+F  MP +N+++W  ++  Y+  G  E+ALG F  M +E    PN  T++G LS
Sbjct  456   LEDARKVFRMMPSKNLVSWNGMLVGYAQHGFGEEALGIFHMMQMES-IKPNEITFIGVLS  514

Query  2742  ACSCLGAARTGK------EIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAM-  2584
             AC+  G  + G+      +  G I R    +++F   C+V+ + + GL++ A     +M 
Sbjct  515   ACAHAGLVKQGQCYFDLMKGCGIIPR----IDHFA--CMVDLFARAGLVERAYEFIKSMP  568

Query  2583  LEPNTVTWASLLS  2545
             ++PN V W SL++
Sbjct  569   IQPNKVIWRSLMA  581



>ref|XP_008801246.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like 
[Phoenix dactylifera]
Length=619

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/619 (53%), Positives = 436/619 (70%), Gaps = 4/619 (1%)
 Frame = -2

Query  2985  GSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSF  2806
             G   +++ +NHL+SMYV    IE A++LFD+MP++NV++WT LIS YS  G  E A+ SF
Sbjct  3     GFLPNLFASNHLMSMYVRCDRIEDARRLFDQMPEKNVVSWTILISGYSKSGPKEAAVRSF  62

Query  2805  RSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEE-TLNNFVSNCLVNFYG  2629
             RSM L  GF+PN +TYV  LSAC+ +GAAR+GKEIHGRI+R E    ++FVSN LVN Y 
Sbjct  63    RSMALA-GFSPNDFTYVSVLSACASIGAARSGKEIHGRIYRLEGGVFSSFVSNSLVNLYA  121

Query  2628  KCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGI  2449
             KCG++  A  VFD +L+PN V+W S+LS +CQCGE +E LRIF R+ + GV VNEF+   
Sbjct  122   KCGMIHLAHSVFDGILQPNMVSWGSILSGYCQCGENEEALRIFSRAWKEGVEVNEFMVAS  181

Query  2448  ALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPE  2269
              L AC+++     G  +HC ++K G+  DQ+V  G+++ YVKC +L LAY  F+    P 
Sbjct  182   VLSACSNLGVSAVGKQVHCYVIKSGIASDQFVEAGVIDMYVKCNELDLAYQAFSELDEPG  241

Query  2268  LHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHS  2089
             L +W ALI G   QG G  A+ LF KL SS LKP+E  + SVL   +     + G QLHS
Sbjct  242   LASWAALIAGYAHQGHGETAMGLFRKLHSSCLKPNEHIFPSVLVGCSIVAAVEEGKQLHS  301

Query  2088  FIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQ  1909
              IIK GF    +V NA++DFY+K  LLDESFK+F+EM E+DIV++NA+IA Y     ++ 
Sbjct  302   LIIKSGFRMAAYVGNAVMDFYAKCGLLDESFKLFEEMEEHDIVSYNAMIARYADQCDFKG  361

Query  1908  AIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLID  1729
              ++ L++ML EG+ PN +TYS IL +C DLP + WG+Q H  I++ G D+NV+VGS LID
Sbjct  362   VMEHLKQMLLEGINPNPYTYSSILKLCADLPVVGWGQQTHNLIIRLGLDTNVIVGSALID  421

Query  1728  MYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDIT  1549
             MYAKCGRL DARKVF ++P KNLVSWN+ML+GYAQHGFG EAL I+ MMQ   V+PN+IT
Sbjct  422   MYAKCGRLEDARKVFHMMPSKNLVSWNSMLVGYAQHGFGVEALGIFHMMQMESVRPNEIT  481

Query  1548  FVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSF  1369
             F+GVLSAC H GL+E+G  +F+ MK  YGI P  +H ACMV+LF+R G  ++AY+FI+S 
Sbjct  482   FIGVLSACAHAGLVEQGQCYFDLMK-GYGIIPSMDHFACMVDLFSRAGLVERAYEFIKSI  540

Query  1368  PEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAA  1189
             P KP+KV WR L++GC  + +  +G YAAE+IL IDP D SAHV LS +YA   MWDE A
Sbjct  541   PIKPNKVTWRSLMAGCKTHGNLGIGLYAAEQILKIDPEDVSAHVMLSGVYAHAGMWDERA  600

Query  1188  QIRKMMKQKELKKETGCSW  1132
               R ++K   LKK  GCSW
Sbjct  601   GARAVLKMG-LKKVPGCSW  618


 Score =   175 bits (443),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 101/380 (27%), Positives = 194/380 (51%), Gaps = 6/380 (2%)
 Frame = -2

Query  3066  LSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMP  2887
             ++ ++ +C+       GK  H  +IK G  SD +    ++ MYV  +E++ A + F E+ 
Sbjct  179   VASVLSACSNLGVSAVGKQVHCYVIKSGIASDQFVEAGVIDMYVKCNELDLAYQAFSELD  238

Query  2886  KRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGK  2707
             +  + +W  LI+ Y+H G  E A+G FR +       PN + +   L  CS + A   GK
Sbjct  239   EPGLASWAALIAGYAHQGHGETAMGLFRKL-HSSCLKPNEHIFPSVLVGCSIVAAVEEGK  297

Query  2706  EIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCG  2527
             ++H  I ++   +  +V N +++FY KCGLL  +  +F+ M E + V++ ++++ +    
Sbjct  298   QLHSLIIKSGFRMAAYVGNAVMDFYAKCGLLDESFKLFEEMEEHDIVSYNAMIARYADQC  357

Query  2526  EYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVT  2347
             ++   +    + L  G+  N +     L  CA +  +G+G   H LI++ G+  +  V +
Sbjct  358   DFKGVMEHLKQMLLEGINPNPYTYSSILKLCADLPVVGWGQQTHNLIIRLGLDTNVIVGS  417

Query  2346  GLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKP  2167
              L++ Y KCG+L  A   F+M  +  L +W +++ G  Q G G EA+ +F  +    ++P
Sbjct  418   ALIDMYAKCGRLEDARKVFHMMPSKNLVSWNSMLVGYAQHGFGVEALGIFHMMQMESVRP  477

Query  2166  SERTYASVLGAFTDTKEFQVGMQLHSFIIKLGF--NSFTFVCNALVDFYSKSNLLDESFK  1993
             +E T+  VL A       + G      +   G   +   F C  +VD +S++ L++ +++
Sbjct  478   NEITFIGVLSACAHAGLVEQGQCYFDLMKGYGIIPSMDHFAC--MVDLFSRAGLVERAYE  535

Query  1992  IFQEMT-EYDIVTWNALIAG  1936
               + +  + + VTW +L+AG
Sbjct  536   FIKSIPIKPNKVTWRSLMAG  555


 Score = 93.6 bits (231),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/193 (28%), Positives = 101/193 (52%), Gaps = 14/193 (7%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L     P   + S I++ C     +  G+  H  +I+ G  ++V   + L+ MY     
Sbjct  369   MLLEGINPNPYTYSSILKLCADLPVVGWGQQTHNLIIRLGLDTNVIVGSALIDMYAKCGR  428

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
             +E A+K+F  MP +N+++W +++  Y+  G   +ALG F  M +E    PN  T++G LS
Sbjct  429   LEDARKVFHMMPSKNLVSWNSMLVGYAQHGFGVEALGIFHMMQMES-VRPNEITFIGVLS  487

Query  2742  ACSCLGAARTGK------EIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSA-QLVFDAM  2584
             AC+  G    G+      + +G I     ++++F   C+V+ + + GL++ A + +    
Sbjct  488   ACAHAGLVEQGQCYFDLMKGYGII----PSMDHFA--CMVDLFSRAGLVERAYEFIKSIP  541

Query  2583  LEPNTVTWASLLS  2545
             ++PN VTW SL++
Sbjct  542   IKPNKVTWRSLMA  554



>ref|XP_006855329.1| hypothetical protein AMTR_s00057p00087430 [Amborella trichopoda]
 gb|ERN16796.1| hypothetical protein AMTR_s00057p00087430 [Amborella trichopoda]
Length=734

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/699 (49%), Positives = 465/699 (67%), Gaps = 3/699 (0%)
 Frame = -2

Query  3072  MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDE  2893
             M LS +IR+    +S+  GK  HA LI  G  ++VY NNHL+SMYV    +  A  +FD+
Sbjct  1     MLLSSLIRTLGHAQSLSKGKMLHANLITSGFPANVYINNHLMSMYVRCGCLNDAHSVFDQ  60

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAART  2713
             M +RN+I+WT +IS YS  GL ++AL  F++MV E GF PN +TYVG LSAC+ L A   
Sbjct  61    MAERNLISWTGIISGYSQHGLPDEALELFQNMVFE-GFYPNDFTYVGLLSACAQLEALNY  119

Query  2712  GKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQ  2533
             GKE H RI +++   N F+SN LVN Y KCGL++ +  +FD + +PN ++W S+++  CQ
Sbjct  120   GKETHARILKSDNGFNTFLSNSLVNLYAKCGLIEYSSRLFDEIPQPNFISWTSIIAGFCQ  179

Query  2532  CGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
              GE+ E LR F +S  AG+ VNEF     LG+CA +E L  G  IH   VKCG+ MD +V
Sbjct  180   SGEHMEALRFFSKSQEAGIKVNEFTSATILGSCAGLEELSLGQQIHVSCVKCGLLMDGFV  239

Query  2352  VTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
              TGL++ YVKCG+LGL +  F+    P L +WTALI G  QQG+G  A++LF KL  SGL
Sbjct  240   GTGLIDMYVKCGELGLGHRAFSEMYEPSLASWTALIAGYAQQGQGEVAIDLFKKLQLSGL  299

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             KP+E T  S   A         G Q+HS   KLGF    FV NA ++ Y+K   L ES K
Sbjct  300   KPNEFTLCSAFVACASNLLVMTGAQIHSVAFKLGFRVAGFVGNAAIEMYAKCGSLQESAK  359

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPA  1813
             +FQE+ E ++V+WN LI GY + G+ + AIKLL  ML EG+ PNL+TYSC+LS+CGDLPA
Sbjct  360   VFQEIVERNVVSWNVLITGYAQMGYCKDAIKLLVRMLNEGIYPNLYTYSCVLSVCGDLPA  419

Query  1812  IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIG  1633
              EWGKQVH RI+KP FD +  V ++LIDMY+KCG+L  A  VFD L  K+LVSWNTML+ 
Sbjct  420   PEWGKQVHSRIIKPRFDLDPFVSTSLIDMYSKCGQLVKAWTVFDSLTSKSLVSWNTMLMA  479

Query  1632  YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITP  1453
             YA HGFG+EAL ++  M++  ++PND+TF+ VLSACG  GL+ EGL++FNSM + + + P
Sbjct  480   YAHHGFGEEALNLFKDMEDANMRPNDVTFIAVLSACGRVGLVSEGLHYFNSMASKHRMAP  539

Query  1452  RTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNI-NKDFVLGKYAAEE  1276
             R  H AC+++L  R G+T+ AY+ I++ P +PDKV+WR LL+ C I ++D  LG++AAE 
Sbjct  540   RAEHYACVIDLLGRAGETEMAYELIQNMPFEPDKVIWRILLAACKIHDRDLELGRHAAEC  599

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSS  1096
             IL +DP D +A+V LS IYAR   WDE A+IRK M    LKK+ GCSW EL++K + F  
Sbjct  600   ILRLDPLDIAAYVMLSGIYARFEEWDEVARIRKAMNDMGLKKDPGCSWIELKHKTHAFVM  659

Query  1095  SYNMLLGEVSMKKLLIGLTAQLLDAGYVP-DTKLSFDYG  982
                       + + + GLT Q+L+  YVP ++   +D G
Sbjct  660   GDQAHPERECIYETVWGLTCQILEDVYVPCNSFFHYDAG  698


 Score =   130 bits (326),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/306 (27%), Positives = 141/306 (46%), Gaps = 11/306 (4%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +L     +C +N  +++G   H+   K G +   +  N  + MY     ++ + K+
Sbjct  301   PNEFTLCSAFVACASNLLVMTGAQIHSVAFKLGFRVAGFVGNAAIEMYAKCGSLQESAKV  360

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F E+ +RNV++W  LI+ Y+ MG  + A+     M L +G  PN YTY   LS C  L A
Sbjct  361   FQEIVERNVVSWNVLITGYAQMGYCKDAIKLLVRM-LNEGIYPNLYTYSCVLSVCGDLPA  419

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK++H RI +    L+ FVS  L++ Y KCG L  A  VFD++   + V+W ++L  
Sbjct  420   PEWGKQVHSRIIKPRFDLDPFVSTSLIDMYSKCGQLVKAWTVFDSLTSKSLVSWNTMLMA  479

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIV---KCGV  2371
             +   G  +E L +F     A +  N+      L AC  V  +  G+     +    +   
Sbjct  480   YAHHGFGEEALNLFKDMEDANMRPNDVTFIAVLSACGRVGLVSEGLHYFNSMASKHRMAP  539

Query  2370  KMDQYVVTGLVNFYVKCGQLGLAYNTF-NMASAPELHAWTALIGGCVQQGK----GREAV  2206
             + + Y    +++   + G+  +AY    NM   P+   W  L+  C    +    GR A 
Sbjct  540   RAEHYAC--VIDLLGRAGETEMAYELIQNMPFEPDKVIWRILLAACKIHDRDLELGRHAA  597

Query  2205  NLFCKL  2188
                 +L
Sbjct  598   ECILRL  603



>ref|XP_009406673.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
 ref|XP_009406674.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=646

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/649 (48%), Positives = 432/649 (67%), Gaps = 4/649 (1%)
 Frame = -2

Query  3072  MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDE  2893
             M+L  ++R+    + +  GK AH++LI      D+  +N +L MY     I  A+ +FD 
Sbjct  1     MTLQGLLRALGGARCLARGKLAHSKLIVSAFLPDIIVSNRVLIMYTKLGRIGDARTVFDH  60

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAART  2713
             MP +NV++WT +IS+YS +GL++ A+ S R MV   G  PNHYTYVG L AC+  GA R 
Sbjct  61    MPHKNVVSWTIMISAYSRLGLADDAIDSVRLMV-STGLDPNHYTYVGLLLACASAGAVRI  119

Query  2712  GKEIHGRIFRAE-ETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
             GKEIHGRI+R E   ++ FV N L+NFY KC ++  AQ VFD     + V+W S+LS + 
Sbjct  120   GKEIHGRIYRVELGAMSVFVDNSLINFYAKCRMMILAQRVFDGATHRSLVSWGSILSGYV  179

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
              CGE ++ LR+F  +++ GV VNEF+    L ACA +     G  +HCL +K G   DQY
Sbjct  180   YCGENEKALRVFSWAMKEGVEVNEFMITSTLSACADLGDPMIGKKLHCLAIKTGNGSDQY  239

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V  G+V+ Y  C ++ LA+ TF+    P L  W ALIGG  + G+G +A+ LF +LL SG
Sbjct  240   VEAGIVDMYANCSKMDLAHQTFSELEEPGLATWAALIGGFTKHGQGEKALVLFKELLLSG  299

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             L+P+E  + + L A + T   QVG Q+HS I+K GF     + NA+++FY+K  L+ ES 
Sbjct  300   LRPNEHIFPTALVACSSTGAVQVGRQIHSLIVKQGFKMSAHIGNAVMEFYAKCGLIKESS  359

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
             K+F+ M E DIV+WN+++  Y++   +E A   L++ML EG+ P+ +TYS IL++C +LP
Sbjct  360   KLFEYMEERDIVSWNSMVDCYVKQRDFEGARNCLKKMLVEGVNPDPYTYSSILNLCANLP  419

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
              + WG Q H +++K   DS+VVVGS LIDMYAKCGRL  A K+F+IL  KNLVSWN++L+
Sbjct  420   GLGWGSQTHGKVIKFSLDSHVVVGSALIDMYAKCGRLKYADKIFNILAFKNLVSWNSILV  479

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             GYAQHGFG+EAL+I+  MQE  VKPNDITF+GVLSAC H GL+EEG +HF +MK +Y IT
Sbjct  480   GYAQHGFGREALDIFRRMQEENVKPNDITFIGVLSACSHVGLVEEGQSHFQNMK-DYDIT  538

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             P+ +H ACMV+LFAR G  K AYDFIRS P +P+KV+WR LLSGC    D  +G YAA+ 
Sbjct  539   PKIDHFACMVDLFARAGLIKMAYDFIRSMPMEPNKVIWRSLLSGCKTYGDLEIGMYAAKC  598

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWT  1129
              L +DP D +A V LS + A + +WDE A +R+++ Q   KK  G SW 
Sbjct  599   TLELDPQDIAARVMLSGVCADIGLWDEKAGLREVVNQGS-KKVPGSSWV  646


 Score = 95.1 bits (235),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 101/201 (50%), Gaps = 6/201 (3%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L     P   + S I+  C     +  G   H ++IK+   S V   + L+ MY     
Sbjct  396   MLVEGVNPDPYTYSSILNLCANLPGLGWGSQTHGKVIKFSLDSHVVVGSALIDMYAKCGR  455

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
             ++ A K+F+ +  +N+++W +++  Y+  G   +AL  FR M  E+   PN  T++G LS
Sbjct  456   LKYADKIFNILAFKNLVSWNSILVGYAQHGFGREALDIFRRM-QEENVKPNDITFIGVLS  514

Query  2742  ACSCLGAARTGKE--IHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAM-LEPN  2572
             ACS +G    G+    + + +     +++F   C+V+ + + GL+K A     +M +EPN
Sbjct  515   ACSHVGLVEEGQSHFQNMKDYDITPKIDHFA--CMVDLFARAGLIKMAYDFIRSMPMEPN  572

Query  2571  TVTWASLLSCHCQCGEYDEGL  2509
              V W SLLS     G+ + G+
Sbjct  573   KVIWRSLLSGCKTYGDLEIGM  593



>ref|XP_010244384.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Nelumbo nucifera]
Length=879

 Score =   484 bits (1246),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 265/732 (36%), Positives = 428/732 (58%), Gaps = 10/732 (1%)
 Frame = -2

Query  3069  SLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM  2890
             +LS I++ C      + GK  H+  +K G ++DV     L+ MY+  + +E  +K+FD+M
Sbjct  107   TLSSILKVCGCLFDQILGKQIHSHCVKSGLEADVSVGTSLVDMYMKTNGVEDGKKVFDKM  166

Query  2889  PKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTG  2710
             P+RNV++WT+L++ Y+  GL++ A+  F  M  E G  PN +T+   L+A +       G
Sbjct  167   PERNVVSWTSLLAGYTQNGLADFAMERFCQMQTE-GIKPNPFTFASVLAASAAKCMVEEG  225

Query  2709  KEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQC  2530
              ++H ++ +       FV N L+N Y K GL++ A  VF+ M   + V+W  +++     
Sbjct  226   IQVHNQVIKLGFESTTFVGNSLINMYSKSGLIRDASAVFEDMKNRDAVSWNGMIAGFVLN  285

Query  2529  GEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVV  2350
             G   E L++F R   AGV + + +    +  CA+++ L F   +HC ++K G   D  + 
Sbjct  286   GFELEALQLFYRMRLAGVKLTQLIFVTVIKLCANIKELAFAKQLHCRVLKNGFGYDLNIT  345

Query  2349  TGLVNFYVKCGQLGLAYNTFN-MASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
             T L+  Y KCG++  A + F+ M     + +WTA+I G +Q G  ++A +LFCK+   G+
Sbjct  346   TALMVAYSKCGEMIGALDLFSTMYGVHNVVSWTAIICGFLQNGDTKQAADLFCKMSREGV  405

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             +P+  TY+++L AF     FQ+    H+ +IK  + +   V  AL+D Y+K   + E+  
Sbjct  406   RPNHFTYSTILAAFPAVSPFQI----HAQVIKANYENLPSVGTALLDAYTKLGNIQEATA  461

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC-GDLP  1816
             IF+ + + DIV W+A++AGY ++G  ++AIKL  +M  +G +PN  T+S +++ C G   
Sbjct  462   IFEMINDKDIVAWSAMLAGYAQTGDSDRAIKLFCKMQKDGQKPNEFTFSSVVNACAGPTA  521

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
               E GKQ+H  ++K G +  + V S+L+ MYAK G + +A KVF     ++LVSWN+M+ 
Sbjct  522   PTEQGKQLHGSLIKFGLEKAICVSSSLVTMYAKRGNIENALKVFRRQVERDLVSWNSMIS  581

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             GYAQHG+GK+ALEI+  MQ  G++ + IT +GV+SAC H GL++EG  +FN M   +GI 
Sbjct  582   GYAQHGYGKKALEIFEEMQNQGLELDGITLIGVISACTHAGLVDEGEKYFNLMVKEHGII  641

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             P+  H ACMV+L++R G+ +KA D I+  P      VWR LL  C +  +  LGK AAE 
Sbjct  642   PKMEHYACMVDLYSRAGKLEKAMDHIKGMPFPAGATVWRTLLGACRVYLNLELGKVAAEN  701

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSS  1096
             +++++P D++A+V LSNIYA    W+E A++RK+M ++++KKE G SW EL+NK + F +
Sbjct  702   LIALEPQDSAAYVLLSNIYAAAGQWEERAKVRKLMDERKVKKEAGYSWIELKNKTHSFMA  761

Query  1095  SYNMLLGEVSMKKLLIGLTAQLLDAGYVPDTKLSF-DYGD*LGLSI--RHLSRFVKFDPP  925
                       +   L  LT +L +AG+ PDT     D  +    +I  +H  R       
Sbjct  762   RDRSHPLSDHIYAKLEELTTRLKNAGHRPDTNFVLHDLEEEHKEAILSQHSERLAIAFGL  821

Query  924   ISTTGGSKLAVV  889
             IST  G+ L +V
Sbjct  822   ISTPPGTPLQIV  833


 Score =   207 bits (526),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 123/432 (28%), Positives = 221/432 (51%), Gaps = 7/432 (2%)
 Frame = -2

Query  2616  LKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGA  2437
             L  A+  FD + + +      LL  + +     E + +FL    + V ++       L  
Sbjct  55    LHQARKSFDGIPKRDVSECNKLLFEYSRNNLNQEAINLFLEMHGSDVHIDGSTLSSILKV  114

Query  2436  CASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAW  2257
             C  +     G  IH   VK G++ D  V T LV+ Y+K   +      F+      + +W
Sbjct  115   CGCLFDQILGKQIHSHCVKSGLEADVSVGTSLVDMYMKTNGVEDGKKVFDKMPERNVVSW  174

Query  2256  TALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIK  2077
             T+L+ G  Q G    A+  FC++ + G+KP+  T+ASVL A       + G+Q+H+ +IK
Sbjct  175   TSLLAGYTQNGLADFAMERFCQMQTEGIKPNPFTFASVLAASAAKCMVEEGIQVHNQVIK  234

Query  2076  LGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKL  1897
             LGF S TFV N+L++ YSKS L+ ++  +F++M   D V+WN +IAG++ +G   +A++L
Sbjct  235   LGFESTTFVGNSLINMYSKSGLIRDASAVFEDMKNRDAVSWNGMIAGFVLNGFELEALQL  294

Query  1896  LQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAK  1717
                M   G++     +  ++ +C ++  + + KQ+HCR++K GF  ++ + + L+  Y+K
Sbjct  295   FYRMRLAGVKLTQLIFVTVIKLCANIKELAFAKQLHCRVLKNGFGYDLNITTALMVAYSK  354

Query  1716  CGRLGDARKVFDIL-PCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVG  1540
             CG +  A  +F  +    N+VSW  ++ G+ Q+G  K+A +++  M   GV+PN  T+  
Sbjct  355   CGEMIGALDLFSTMYGVHNVVSWTAIICGFLQNGDTKQAADLFCKMSREGVRPNHFTYST  414

Query  1539  VLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEK  1360
             +L+A      +     H   +K NY   P       +++ + + G  ++A        +K
Sbjct  415   ILAA---FPAVSPFQIHAQVIKANYENLPSVG--TALLDAYTKLGNIQEATAIFEMINDK  469

Query  1359  PDKVVWRCLLSG  1324
              D V W  +L+G
Sbjct  470   -DIVAWSAMLAG  480


 Score =   199 bits (505),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 129/485 (27%), Positives = 234/485 (48%), Gaps = 9/485 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + + ++ +      +  G   H Q+IK G +S  +  N L++MY     I  A  +
Sbjct  204   PNPFTFASVLAASAAKCMVEEGIQVHNQVIKLGFESTTFVGNSLINMYSKSGLIRDASAV  263

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F++M  R+ ++W  +I+ +   G   +AL  F  M L  G       +V  +  C+ +  
Sbjct  264   FEDMKNRDAVSWNGMIAGFVLNGFELEALQLFYRMRLA-GVKLTQLIFVTVIKLCANIKE  322

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLE-PNTVTWASLLS  2545
                 K++H R+ +     +  ++  L+  Y KCG +  A  +F  M    N V+W +++ 
Sbjct  323   LAFAKQLHCRVLKNGFGYDLNITTALMVAYSKCGEMIGALDLFSTMYGVHNVVSWTAIIC  382

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
                Q G+  +   +F +  R GV  N F     L A  +V        IH  ++K   + 
Sbjct  383   GFLQNGDTKQAADLFCKMSREGVRPNHFTYSTILAAFPAVSPF----QIHAQVIKANYEN  438

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
                V T L++ Y K G +  A   F M +  ++ AW+A++ G  Q G    A+ LFCK+ 
Sbjct  439   LPSVGTALLDAYTKLGNIQEATAIFEMINDKDIVAWSAMLAGYAQTGDSDRAIKLFCKMQ  498

Query  2184  SSGLKPSERTYASVLGAFT-DTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
               G KP+E T++SV+ A    T   + G QLH  +IK G      V ++LV  Y+K   +
Sbjct  499   KDGQKPNEFTFSSVVNACAGPTAPTEQGKQLHGSLIKFGLEKAICVSSSLVTMYAKRGNI  558

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
             + + K+F+   E D+V+WN++I+GY + G+ ++A+++ +EM  +GLE +  T   ++S C
Sbjct  559   ENALKVFRRQVERDLVSWNSMISGYAQHGYGKKALEIFEEMQNQGLELDGITLIGVISAC  618

Query  1827  GDLPAIEWGKQVHCRIMKP-GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILP-CKNLVS  1654
                  ++ G++    ++K  G    +   + ++D+Y++ G+L  A      +P       
Sbjct  619   THAGLVDEGEKYFNLMVKEHGIIPKMEHYACMVDLYSRAGKLEKAMDHIKGMPFPAGATV  678

Query  1653  WNTML  1639
             W T+L
Sbjct  679   WRTLL  683


 Score =   124 bits (311),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 126/237 (53%), Gaps = 2/237 (1%)
 Frame = -2

Query  2022  KSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSC  1843
             + N L ++ K F  + + D+   N L+  Y R+   ++AI L  EM    +  +  T S 
Sbjct  51    EPNNLHQARKSFDGIPKRDVSECNKLLFEYSRNNLNQEAINLFLEMHGSDVHIDGSTLSS  110

Query  1842  ILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKN  1663
             IL +CG L     GKQ+H   +K G +++V VG++L+DMY K   + D +KVFD +P +N
Sbjct  111   ILKVCGCLFDQILGKQIHSHCVKSGLEADVSVGTSLVDMYMKTNGVEDGKKVFDKMPERN  170

Query  1662  LVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFN  1483
             +VSW ++L GY Q+G    A+E +  MQ  G+KPN  TF  VL+A     ++EEG+   N
Sbjct  171   VVSWTSLLAGYTQNGLADFAMERFCQMQTEGIKPNPFTFASVLAASAAKCMVEEGIQVHN  230

Query  1482  SMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNIN  1312
              +    G    T     ++N++++ G  + A         + D V W  +++G  +N
Sbjct  231   QVI-KLGFESTTFVGNSLINMYSKSGLIRDASAVFEDMKNR-DAVSWNGMIAGFVLN  285



>gb|KCW87396.1| hypothetical protein EUGRSUZ_B03875, partial [Eucalyptus grandis]
Length=806

 Score =   481 bits (1238),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 260/696 (37%), Positives = 405/696 (58%), Gaps = 19/696 (3%)
 Frame = -2

Query  3066  LSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMP  2887
             LS +I  C  +    +G+  H Q +K G   DV     L+ MY+    +E  ++ FDEM 
Sbjct  44    LSCVINVCANSFDQNTGRQVHCQCVKLGFLEDVSVGTSLVDMYMKTESVEDGRRAFDEMS  103

Query  2886  KRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGK  2707
              RNV++WT+L+S Y+   L+ +A+  FR M +E G  PN +TY   L A    G A  G 
Sbjct  104   DRNVVSWTSLLSGYTRNNLNGEAVELFRRMQVE-GIKPNAFTYTAVLGALGDDGLAEKGV  162

Query  2706  EIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCG  2527
             ++H  + +       +  N L+N Y K G+++ A+ VF+AM   + VTW S++S +   G
Sbjct  163   QLHAMVIKDGFASATYAGNSLINMYSKVGMVRDARSVFNAMENKDAVTWNSMISGYVANG  222

Query  2526  EYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVT  2347
                E L +F     A V +++      +  CA+V  L F   +HC +VK G++ D  V  
Sbjct  223   HDMEALVMFHSMRNAEVSLSQLTFANVIKLCANVRELSFARQLHCQVVKMGLEFDDKVRK  282

Query  2346  GLVNFYVKCGQLGLAYNTFNMASA-PELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLK  2170
              L+  Y KC ++  A+ +F+  S   ++ +WTA+I G +Q G+  +AV+LFC++   G+K
Sbjct  283   ALIGAYSKCCEMDDAFKSFSSVSRYQDVVSWTAIITGYLQNGQAAQAVDLFCQMRREGVK  342

Query  2169  PSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKI  1990
             P+E TY+ +LGA      ++V    H+ +IK    S + V  AL+D Y K    D++ K+
Sbjct  343   PNEFTYSLILGAQPLISPYEV----HAQVIKTNCQSLSTVGTALLDAYVKIGSTDDAAKV  398

Query  1989  FQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG-DLPA  1813
             F+ + E D+V+W+A++AGY  SG  E A+K+  ++  EG  PN  TYS +++ C     A
Sbjct  399   FKSVREKDVVSWSAMLAGYALSGDIENAVKVFLQLGKEGARPNEFTYSSVINACAAPSAA  458

Query  1812  IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIG  1633
             +E GKQ+H   +K G+   + V S L+ MYAK G +  A KVF     ++LVSWN+M+ G
Sbjct  459   VEQGKQLHACSIKSGYSDAICVSSALLTMYAKRGNIESANKVFHRQRERDLVSWNSMVSG  518

Query  1632  YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITP  1453
             YAQHG  K+ALE++  MQ   +  + ITF+GV+SAC HGG ++EG  +++ M N++ I+P
Sbjct  519   YAQHGHAKKALEVFDEMQRQKMTMDGITFIGVISACTHGGFVKEGERYYDMMVNDHQISP  578

Query  1452  RTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEI  1273
                H +CMV+L++R G  +KA D I   P  P   VWR +L+GC++ ++  LGK AAE++
Sbjct  579   TMEHYSCMVDLYSRAGMLEKAMDTINGMPFPPSAPVWRSILAGCHVQRNLELGKLAAEKL  638

Query  1272  LSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSS  1093
             +S+ P+ +SA+V LSNIYA    W E +++RKMM ++ ++KE G SW E++NK + F   
Sbjct  639   ISLQPDHSSAYVLLSNIYAAAGKWKERSEVRKMMDERNVRKEAGYSWIEVKNKTHFF---  695

Query  1092  YNMLLGEVS------MKKLLIGLTAQLLDAGYVPDT  1003
                L G+VS      +   L  L  +L D GY PDT
Sbjct  696   ---LAGDVSHPLQERIYAKLEELGVRLRDYGYQPDT  728


 Score =   202 bits (515),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 119/404 (29%), Positives = 210/404 (52%), Gaps = 7/404 (2%)
 Frame = -2

Query  2511  LRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNF  2332
             L +F    R G+ ++  +    +  CA+      G  +HC  VK G   D  V T LV+ 
Sbjct  26    LDLFASVHRWGLPIDGSVLSCVINVCANSFDQNTGRQVHCQCVKLGFLEDVSVGTSLVDM  85

Query  2331  YVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTY  2152
             Y+K   +      F+  S   + +WT+L+ G  +     EAV LF ++   G+KP+  TY
Sbjct  86    YMKTESVEDGRRAFDEMSDRNVVSWTSLLSGYTRNNLNGEAVELFRRMQVEGIKPNAFTY  145

Query  2151  ASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTE  1972
              +VLGA  D    + G+QLH+ +IK GF S T+  N+L++ YSK  ++ ++  +F  M  
Sbjct  146   TAVLGALGDDGLAEKGVQLHAMVIKDGFASATYAGNSLINMYSKVGMVRDARSVFNAMEN  205

Query  1971  YDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQV  1792
              D VTWN++I+GY+ +GH  +A+ +   M    +  +  T++ ++ +C ++  + + +Q+
Sbjct  206   KDAVTWNSMISGYVANGHDMEALVMFHSMRNAEVSLSQLTFANVIKLCANVRELSFARQL  265

Query  1791  HCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVF-DILPCKNLVSWNTMLIGYAQHGF  1615
             HC+++K G + +  V   LI  Y+KC  + DA K F  +   +++VSW  ++ GY Q+G 
Sbjct  266   HCQVVKMGLEFDDKVRKALIGAYSKCCEMDDAFKSFSSVSRYQDVVSWTAIITGYLQNGQ  325

Query  1614  GKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLA  1435
               +A++++  M+  GVKPN+ T+  +L   G   L+     H   +K N           
Sbjct  326   AAQAVDLFCQMRREGVKPNEFTYSLIL---GAQPLISPYEVHAQVIKTNCQSLSTVG--T  380

Query  1434  CMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDF  1303
              +++ + + G T  A    +S  EK D V W  +L+G  ++ D 
Sbjct  381   ALLDAYVKIGSTDDAAKVFKSVREK-DVVSWSAMLAGYALSGDI  423


 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 114/211 (54%), Gaps = 2/211 (1%)
 Frame = -2

Query  1956  WNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIM  1777
             ++A ++ Y R    +  + L   +   GL  +    SC++++C +      G+QVHC+ +
Sbjct  9     YSASLSEYSRYCRNQGPLDLFASVHRWGLPIDGSVLSCVINVCANSFDQNTGRQVHCQCV  68

Query  1776  KPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALE  1597
             K GF  +V VG++L+DMY K   + D R+ FD +  +N+VSW ++L GY ++    EA+E
Sbjct  69    KLGFLEDVSVGTSLVDMYMKTESVEDGRRAFDEMSDRNVVSWTSLLSGYTRNNLNGEAVE  128

Query  1596  IYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLF  1417
             ++  MQ  G+KPN  T+  VL A G  GL E+G+   ++M    G    T     ++N++
Sbjct  129   LFRRMQVEGIKPNAFTYTAVLGALGDDGLAEKGV-QLHAMVIKDGFASATYAGNSLINMY  187

Query  1416  ARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
             ++ G  + A     +  E  D V W  ++SG
Sbjct  188   SKVGMVRDARSVFNAM-ENKDAVTWNSMISG  217



>ref|XP_010045232.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Eucalyptus grandis]
Length=877

 Score =   481 bits (1237),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 260/696 (37%), Positives = 405/696 (58%), Gaps = 19/696 (3%)
 Frame = -2

Query  3066  LSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMP  2887
             LS +I  C  +    +G+  H Q +K G   DV     L+ MY+    +E  ++ FDEM 
Sbjct  106   LSCVINVCANSFDQNTGRQVHCQCVKLGFLEDVSVGTSLVDMYMKTESVEDGRRAFDEMS  165

Query  2886  KRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGK  2707
              RNV++WT+L+S Y+   L+ +A+  FR M +E G  PN +TY   L A    G A  G 
Sbjct  166   DRNVVSWTSLLSGYTRNNLNGEAVELFRRMQVE-GIKPNAFTYTAVLGALGDDGLAEKGV  224

Query  2706  EIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCG  2527
             ++H  + +       +  N L+N Y K G+++ A+ VF+AM   + VTW S++S +   G
Sbjct  225   QLHAMVIKDGFASATYAGNSLINMYSKVGMVRDARSVFNAMENKDAVTWNSMISGYVANG  284

Query  2526  EYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVT  2347
                E L +F     A V +++      +  CA+V  L F   +HC +VK G++ D  V  
Sbjct  285   HDMEALVMFHSMRNAEVSLSQLTFANVIKLCANVRELSFARQLHCQVVKMGLEFDDKVRK  344

Query  2346  GLVNFYVKCGQLGLAYNTFNMASA-PELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLK  2170
              L+  Y KC ++  A+ +F+  S   ++ +WTA+I G +Q G+  +AV+LFC++   G+K
Sbjct  345   ALIGAYSKCCEMDDAFKSFSSVSRYQDVVSWTAIITGYLQNGQAAQAVDLFCQMRREGVK  404

Query  2169  PSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKI  1990
             P+E TY+ +LGA      ++V    H+ +IK    S + V  AL+D Y K    D++ K+
Sbjct  405   PNEFTYSLILGAQPLISPYEV----HAQVIKTNCQSLSTVGTALLDAYVKIGSTDDAAKV  460

Query  1989  FQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG-DLPA  1813
             F+ + E D+V+W+A++AGY  SG  E A+K+  ++  EG  PN  TYS +++ C     A
Sbjct  461   FKSVREKDVVSWSAMLAGYALSGDIENAVKVFLQLGKEGARPNEFTYSSVINACAAPSAA  520

Query  1812  IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIG  1633
             +E GKQ+H   +K G+   + V S L+ MYAK G +  A KVF     ++LVSWN+M+ G
Sbjct  521   VEQGKQLHACSIKSGYSDAICVSSALLTMYAKRGNIESANKVFHRQRERDLVSWNSMVSG  580

Query  1632  YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITP  1453
             YAQHG  K+ALE++  MQ   +  + ITF+GV+SAC HGG ++EG  +++ M N++ I+P
Sbjct  581   YAQHGHAKKALEVFDEMQRQKMTMDGITFIGVISACTHGGFVKEGERYYDMMVNDHQISP  640

Query  1452  RTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEI  1273
                H +CMV+L++R G  +KA D I   P  P   VWR +L+GC++ ++  LGK AAE++
Sbjct  641   TMEHYSCMVDLYSRAGMLEKAMDTINGMPFPPSAPVWRSILAGCHVQRNLELGKLAAEKL  700

Query  1272  LSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSS  1093
             +S+ P+ +SA+V LSNIYA    W E +++RKMM ++ ++KE G SW E++NK + F   
Sbjct  701   ISLQPDHSSAYVLLSNIYAAAGKWKERSEVRKMMDERNVRKEAGYSWIEVKNKTHFF---  757

Query  1092  YNMLLGEVS------MKKLLIGLTAQLLDAGYVPDT  1003
                L G+VS      +   L  L  +L D GY PDT
Sbjct  758   ---LAGDVSHPLQERIYAKLEELGVRLRDYGYQPDT  790


 Score =   232 bits (592),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 151/528 (29%), Positives = 257/528 (49%), Gaps = 7/528 (1%)
 Frame = -2

Query  2904  LFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             +FD  P+R    ++  +S YS    ++  L  F S V   G   +       ++ C+   
Sbjct  59    VFDRSPQRAQTGYSASLSEYSRYCRNQGPLDLFAS-VHRWGLPIDGSVLSCVINVCANSF  117

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
                TG+++H +  +     +  V   LV+ Y K   ++  +  FD M + N V+W SLLS
Sbjct  118   DQNTGRQVHCQCVKLGFLEDVSVGTSLVDMYMKTESVEDGRRAFDEMSDRNVVSWTSLLS  177

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
              + +     E + +F R    G+  N F     LGA         G+ +H +++K G   
Sbjct  178   GYTRNNLNGEAVELFRRMQVEGIKPNAFTYTAVLGALGDDGLAEKGVQLHAMVIKDGFAS  237

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
               Y    L+N Y K G +  A + FN     +   W ++I G V  G   EA+ +F  + 
Sbjct  238   ATYAGNSLINMYSKVGMVRDARSVFNAMENKDAVTWNSMISGYVANGHDMEALVMFHSMR  297

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
             ++ +  S+ T+A+V+    + +E     QLH  ++K+G      V  AL+  YSK   +D
Sbjct  298   NAEVSLSQLTFANVIKLCANVRELSFARQLHCQVVKMGLEFDDKVRKALIGAYSKCCEMD  357

Query  2004  ESFKIFQEMTEY-DIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
             ++FK F  ++ Y D+V+W A+I GY+++G   QA+ L  +M  EG++PN  TYS IL   
Sbjct  358   DAFKSFSSVSRYQDVVSWTAIITGYLQNGQAAQAVDLFCQMRREGVKPNEFTYSLIL---  414

Query  1827  GDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWN  1648
             G  P I    +VH +++K    S   VG+ L+D Y K G   DA KVF  +  K++VSW+
Sbjct  415   GAQPLIS-PYEVHAQVIKTNCQSLSTVGTALLDAYVKIGSTDDAAKVFKSVREKDVVSWS  473

Query  1647  TMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNN  1468
              ML GYA  G  + A++++  + + G +PN+ T+  V++AC       E     ++    
Sbjct  474   AMLAGYALSGDIENAVKVFLQLGKEGARPNEFTYSSVINACAAPSAAVEQGKQLHACSIK  533

Query  1467  YGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
              G +      + ++ ++A++G  + A        E+ D V W  ++SG
Sbjct  534   SGYSDAICVSSALLTMYAKRGNIESANKVFHRQRER-DLVSWNSMVSG  580


 Score =   204 bits (520),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 124/433 (29%), Positives = 221/433 (51%), Gaps = 7/433 (2%)
 Frame = -2

Query  2598  VFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVEC  2419
             VFD   +     +++ LS + +       L +F    R G+ ++  +    +  CA+   
Sbjct  59    VFDRSPQRAQTGYSASLSEYSRYCRNQGPLDLFASVHRWGLPIDGSVLSCVINVCANSFD  118

Query  2418  LGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGG  2239
                G  +HC  VK G   D  V T LV+ Y+K   +      F+  S   + +WT+L+ G
Sbjct  119   QNTGRQVHCQCVKLGFLEDVSVGTSLVDMYMKTESVEDGRRAFDEMSDRNVVSWTSLLSG  178

Query  2238  CVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSF  2059
               +     EAV LF ++   G+KP+  TY +VLGA  D    + G+QLH+ +IK GF S 
Sbjct  179   YTRNNLNGEAVELFRRMQVEGIKPNAFTYTAVLGALGDDGLAEKGVQLHAMVIKDGFASA  238

Query  2058  TFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLF  1879
             T+  N+L++ YSK  ++ ++  +F  M   D VTWN++I+GY+ +GH  +A+ +   M  
Sbjct  239   TYAGNSLINMYSKVGMVRDARSVFNAMENKDAVTWNSMISGYVANGHDMEALVMFHSMRN  298

Query  1878  EGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGD  1699
               +  +  T++ ++ +C ++  + + +Q+HC+++K G + +  V   LI  Y+KC  + D
Sbjct  299   AEVSLSQLTFANVIKLCANVRELSFARQLHCQVVKMGLEFDDKVRKALIGAYSKCCEMDD  358

Query  1698  ARKVF-DILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACG  1522
             A K F  +   +++VSW  ++ GY Q+G   +A++++  M+  GVKPN+ T+  +L   G
Sbjct  359   AFKSFSSVSRYQDVVSWTAIITGYLQNGQAAQAVDLFCQMRREGVKPNEFTYSLIL---G  415

Query  1521  HgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVW  1342
                L+     H   +K N            +++ + + G T  A    +S  EK D V W
Sbjct  416   AQPLISPYEVHAQVIKTNCQSLSTVG--TALLDAYVKIGSTDDAAKVFKSVREK-DVVSW  472

Query  1341  RCLLSGCNINKDF  1303
               +L+G  ++ D 
Sbjct  473   SAMLAGYALSGDI  485


 Score =   116 bits (290),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 70/234 (30%), Positives = 122/234 (52%), Gaps = 2/234 (1%)
 Frame = -2

Query  2025  SKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYS  1846
             +KS +  E   +F    +     ++A ++ Y R    +  + L   +   GL  +    S
Sbjct  48    AKSLVSPEVHHVFDRSPQRAQTGYSASLSEYSRYCRNQGPLDLFASVHRWGLPIDGSVLS  107

Query  1845  CILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK  1666
             C++++C +      G+QVHC+ +K GF  +V VG++L+DMY K   + D R+ FD +  +
Sbjct  108   CVINVCANSFDQNTGRQVHCQCVKLGFLEDVSVGTSLVDMYMKTESVEDGRRAFDEMSDR  167

Query  1665  NLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHF  1486
             N+VSW ++L GY ++    EA+E++  MQ  G+KPN  T+  VL A G  GL E+G+   
Sbjct  168   NVVSWTSLLSGYTRNNLNGEAVELFRRMQVEGIKPNAFTYTAVLGALGDDGLAEKGV-QL  226

Query  1485  NSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
             ++M    G    T     ++N++++ G  + A     +  E  D V W  ++SG
Sbjct  227   HAMVIKDGFASATYAGNSLINMYSKVGMVRDARSVFNAM-ENKDAVTWNSMISG  279



>ref|XP_006849876.1| hypothetical protein AMTR_s00022p00075660 [Amborella trichopoda]
 gb|ERN11457.1| hypothetical protein AMTR_s00022p00075660 [Amborella trichopoda]
Length=711

 Score =   474 bits (1219),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 243/698 (35%), Positives = 411/698 (59%), Gaps = 9/698 (1%)
 Frame = -2

Query  3072  MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDE  2893
             +S S++++ C ++K++  G+  HAQ+IK G  SD +  N L++ Y    ++  A+  F+E
Sbjct  8     LSFSRLLQLCASDKNLRKGQNIHAQIIKTGFLSDPFLQNSLINTYSKCGDMADAELKFEE  67

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAART  2713
             +  ++V++W  LIS + +     K L  F+ M  E+   PN +T+ G ++A S L A R 
Sbjct  68    IQTKDVVSWNCLISGFCNHSHDSKVLNLFKRMTTEN-MKPNSFTFSGVITAISGLSALRE  126

Query  2712  GKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC-  2536
             G+++H    +     + +V + L+N Y KCGL+  A+LVF+ M + N VTWA+++S +  
Sbjct  127   GRQVHSLSMKTSILNDVYVGSSLINMYCKCGLVSEARLVFEEMPDKNMVTWAAMISGYAL  186

Query  2535  -QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQ  2359
              +CG   E + +F    +  + +NEF+    L A ++ E L +G+ IH   +K G++   
Sbjct  187   ERCGH--EAIALFKLLQKENMGLNEFIFTGVLSAASAKEFLNYGLQIHSQALKTGLESHI  244

Query  2358  YVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSS  2179
              V   +V  Y KC +L  A   F  +       W+A+I G  Q G   EA+ LF  +  +
Sbjct  245   SVKNAIVTMYSKCERLTDALLVFESSEEKNPITWSAMITGYTQNGDSSEALRLFSSMNLA  304

Query  2178  GLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDES  1999
             G++PSE T  +VL + ++      G+Q+H++++K+GF    F+ +AL+D Y+K   + ++
Sbjct  305   GIRPSEFTLVAVLNSCSNLMALWPGIQVHTYLLKMGFGHLLFIRSALIDMYAKCGSIKDA  364

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDL  1819
              K F ++ E D+V W ++I G++++G  E+A+ L  +M  E + PN  T + +L  C  L
Sbjct  365   RKGFDQLQEADVVLWTSIINGHVQNGENEEALSLYGQMERENIRPNSLTIASVLRACSSL  424

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
              A+E GKQ+H R +K GF      GS L  +Y+KCG L +    F  +P +++VSWNTM+
Sbjct  425   AALEQGKQIHARAVKYGFGLTNPTGSALSTLYSKCGCLEEGNLAFQRIPERDVVSWNTMI  484

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGI  1459
              GY+ +GFG++AL+++  M+  G+ P+ +TFV +LSAC H G++E G ++F  MK  YGI
Sbjct  485   SGYSHNGFGQKALKLFEEMESEGITPDSVTFVNLLSACSHMGVVERGWHYFKLMKEKYGI  544

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAE  1279
              PR +H AC+V++ +RKG   +A +FI S P      +WR LL  C   ++F +G YA +
Sbjct  545   EPRVDHYACIVDVLSRKGLLLEARNFIESVPIDHGLALWRILLGACRNQRNFEIGSYAGQ  604

Query  1278  EILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFS  1099
              ++ +   ++SA+V LS+IYA +  W +  ++RK+M+++ + KE GCSW EL+N+++ F 
Sbjct  605   RLMELGSTESSAYVLLSSIYASVGRWGDVERVRKLMRERGVAKEPGCSWVELKNRVHVFV  664

Query  1098  SSYNM--LLGEVSMKKLLIGLTAQLLDAGYVPDTKLSF  991
                 M   +GE+ ++  L  L  Q+ D GY PDT   F
Sbjct  665   VGDQMHPQIGEIRLE--LKRLNMQMGDEGYRPDTNWVF  700


 Score =   242 bits (617),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 141/484 (29%), Positives = 256/484 (53%), Gaps = 5/484 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + S +I + +   ++  G+  H+  +K    +DVY  + L++MY     +  A+ +
Sbjct  106   PNSFTFSGVITAISGLSALREGRQVHSLSMKTSILNDVYVGSSLINMYCKCGLVSEARLV  165

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F+EMP +N++TW  +IS Y+      +A+  F+ ++ ++    N + + G LSA S    
Sbjct  166   FEEMPDKNMVTWAAMISGYALERCGHEAIALFK-LLQKENMGLNEFIFTGVLSAASAKEF  224

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G +IH +  +     +  V N +V  Y KC  L  A LVF++  E N +TW+++++ 
Sbjct  225   LNYGLQIHSQALKTGLESHISVKNAIVTMYSKCERLTDALLVFESSEEKNPITWSAMITG  284

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q G+  E LR+F     AG+  +EF     L +C+++  L  G+ +H  ++K G    
Sbjct  285   YTQNGDSSEALRLFSSMNLAGIRPSEFTLVAVLNSCSNLMALWPGIQVHTYLLKMGFGHL  344

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              ++ + L++ Y KCG +  A   F+     ++  WT++I G VQ G+  EA++L+ ++  
Sbjct  345   LFIRSALIDMYAKCGSIKDARKGFDQLQEADVVLWTSIINGHVQNGENEEALSLYGQMER  404

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
               ++P+  T ASVL A +     + G Q+H+  +K GF       +AL   YSK   L+E
Sbjct  405   ENIRPNSLTIASVLRACSSLAALEQGKQIHARAVKYGFGLTNPTGSALSTLYSKCGCLEE  464

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
                 FQ + E D+V+WN +I+GY  +G  ++A+KL +EM  EG+ P+  T+  +LS C  
Sbjct  465   GNLAFQRIPERDVVSWNTMISGYSHNGFGQKALKLFEEMESEGITPDSVTFVNLLSACSH  524

Query  1821  LPAIEWGKQVHCRIMKP--GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKN-LVSW  1651
             +  +E G   + ++MK   G +  V   + ++D+ ++ G L +AR   + +P  + L  W
Sbjct  525   MGVVERGWH-YFKLMKEKYGIEPRVDHYACIVDVLSRKGLLLEARNFIESVPIDHGLALW  583

Query  1650  NTML  1639
               +L
Sbjct  584   RILL  587



>emb|CBI21510.3| unnamed protein product [Vitis vinifera]
Length=746

 Score =   472 bits (1214),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 244/692 (35%), Positives = 396/692 (57%), Gaps = 2/692 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +   + +++   +   I+  K  H Q+I  G +SD +  N L+++      ++ A+ +
Sbjct  47    PKRREFANLLQLSISRNPIIHYKIIHGQIIVSGLQSDTFLANILINVCSKSDRVDNARVV  106

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD+MP +N+ITW++++S YS  G SE+AL  F  +  + G  PN +     + AC+ LG 
Sbjct  107   FDKMPHKNLITWSSMVSMYSQQGYSEEALMVFVDLQRKSGEHPNEFVLASVIRACTQLGV  166

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G ++HG + R+    + +V   L++FY K G ++ A+LVFD + E   VTW ++++ 
Sbjct  167   VEKGAQLHGFVVRSGFDQDVYVGTSLIDFYSKNGNIEEARLVFDQLSEKTAVTWTTIIAG  226

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + +CG     L +F +     V+ + ++    L AC+ +E L  G  IH  +++ G +MD
Sbjct  227   YTKCGRSAVSLELFAQMRETNVVPDRYVVSSVLSACSMLEFLEGGKQIHAYVLRRGTEMD  286

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
               VV  L++FY KC ++      F+      + +WT +I G +Q     EA+ LF ++  
Sbjct  287   VSVVNVLIDFYTKCNRVKAGRKLFDQMVVKNIISWTTMISGYMQNSFDWEAMKLFGEMNR  346

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              G KP      SVL +    +  + G Q+H++ IK    S  FV N L+D Y+KSNLL +
Sbjct  347   LGWKPDGFACTSVLTSCGSREALEQGRQVHAYTIKANLESDEFVKNGLIDMYAKSNLLID  406

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             + K+F  M E +++++NA+I GY       +A++L  EM     +PN  T++ +++   +
Sbjct  407   AKKVFDVMAEQNVISYNAMIEGYSSQEKLSEALELFHEMRVRLQKPNEFTFAALITAASN  466

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L ++  G+Q H +++K G D    V + L+DMYAKCG + +ARK+F+    +++V WN+M
Sbjct  467   LASLRHGQQFHNQLVKMGLDFCPFVTNALVDMYAKCGSIEEARKMFNSSIWRDVVCWNSM  526

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +  +AQHG  +EAL ++  M + G++PN +TFV VLSAC H G +E+GLNHFNSM   +G
Sbjct  527   ISTHAQHGEAEEALGMFREMMKEGIQPNYVTFVAVLSACSHAGRVEDGLNHFNSMP-GFG  585

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I P T H AC+V+L  R G+  +A +FI   P +P  +VWR LLS C I  +  LGKYAA
Sbjct  586   IKPGTEHYACVVSLLGRSGKLFEAKEFIEKMPIEPAAIVWRSLLSACRIAGNVELGKYAA  645

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             E  +S DP D+ +++ LSNI+A   MW +  ++R  M   E+ KE G SW E+ NK+  F
Sbjct  646   EMAISTDPKDSGSYILLSNIFASKGMWADVKKVRDRMDSSEVVKEPGRSWIEVNNKVNVF  705

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPD  1006
              +  +    E  +  +L  L   +  AGYVPD
Sbjct  706   IAR-DTTHREADIGSVLDILIQHIKGAGYVPD  736


 Score = 75.9 bits (185),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 68/117 (58%), Gaps = 1/117 (1%)
 Frame = -2

Query  1872  LEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDAR  1693
             L P    ++ +L +      I   K +H +I+  G  S+  + + LI++ +K  R+ +AR
Sbjct  45    LRPKRREFANLLQLSISRNPIIHYKIIHGQIIVSGLQSDTFLANILINVCSKSDRVDNAR  104

Query  1692  KVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIY-SMMQENGVKPNDITFVGVLSAC  1525
              VFD +P KNL++W++M+  Y+Q G+ +EAL ++  + +++G  PN+     V+ AC
Sbjct  105   VVFDKMPHKNLITWSSMVSMYSQQGYSEEALMVFVDLQRKSGEHPNEFVLASVIRAC  161



>gb|AEB39781.1| pentatricopeptide repeat protein 79 [Funaria hygrometrica]
Length=820

 Score =   469 bits (1208),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 239/688 (35%), Positives = 388/688 (56%), Gaps = 1/688 (0%)
 Frame = -2

Query  3060  QIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKR  2881
             ++++SC   K +  GK  H  ++++G K +VY  N LL +YV    +  A++LFD+   +
Sbjct  49    KLLQSCVKAKDLAVGKQVHEHILRFGMKPNVYIINTLLKLYVHCGSVNEARRLFDKFSNK  108

Query  2880  NVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEI  2701
             +V++W  +IS Y+H GL ++A   F +++ ++G  P+ +T+V  LSACS   A   G+E+
Sbjct  109   SVVSWNVMISGYAHRGLGQEAFNLF-TLMQQEGLEPDKFTFVSILSACSSPAALNWGREV  167

Query  2700  HGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEY  2521
             H R+  A    N  V N L++ Y KCG ++ A+ VFDAM   + V+W +L   + + G  
Sbjct  168   HVRVMEAGLANNATVGNALISMYAKCGSVRDARRVFDAMASRDEVSWTTLTGAYAESGYA  227

Query  2520  DEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGL  2341
              E L+ +   L+ GV  +       L AC S+  L  G  IH  IV+     D  V T L
Sbjct  228   QESLKTYHAMLQEGVRPSRITYMNVLSACGSLAALEKGKQIHAQIVESEHHSDVRVSTAL  287

Query  2340  VNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSE  2161
                Y+KCG +  A   F      ++ AW  +IGG V  G+  EA  +F ++L   + P  
Sbjct  288   TKMYIKCGAVKDAREVFECLPNRDVIAWNTMIGGLVDSGQLEEAHGMFHRMLKECVAPDR  347

Query  2160  RTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQE  1981
              TY ++L A         G ++H+  +K G  S     NAL++ YSK+  + ++ ++F  
Sbjct  348   VTYLAILSACARPGGLACGKEIHARAVKDGLVSDVRFGNALINMYSKAGSMKDARQVFDR  407

Query  1980  MTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWG  1801
             M + D+V+W AL+ GY   G   ++    ++ML +G+E N  TY C+L  C +  A++WG
Sbjct  408   MPKRDVVSWTALVGGYADCGQVVESFSTFKKMLQQGVEANKITYMCVLKACSNPVALKWG  467

Query  1800  KQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQH  1621
             K++H  ++K G  +++ V + L+ MY KCG + DA +V + +  +++V+WNT++ G AQ+
Sbjct  468   KEIHAEVVKAGIFADLAVANALMSMYFKCGSVEDAIRVSEGMSTRDVVTWNTLIGGLAQN  527

Query  1620  GFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNH  1441
             G G EAL+ + +M+   ++PN  TFV V+SAC    L+EEG   F SM+ +YGI P   H
Sbjct  528   GRGLEALQKFEVMKSEEMRPNATTFVNVMSACRVRNLVEEGRRQFASMRKDYGIVPTEKH  587

Query  1440  LACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSID  1261
              ACMV++ AR G   +A D I + P KP   +W  LL+ C  + +  +G+ AAE+ L ++
Sbjct  588   YACMVDILARAGHLGEAEDVILTMPFKPSAAMWGALLAACRAHGNVEIGEQAAEQCLKLE  647

Query  1260  PNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNML  1081
             P +   +V+LS IYA   MW + A++RK+MK++ +KKE G SW E+  +++ F +     
Sbjct  648   PQNAGTYVSLSFIYAAAGMWRDVAKLRKLMKERGVKKEPGRSWIEVAGEVHSFVAGDQSH  707

Query  1080  LGEVSMKKLLIGLTAQLLDAGYVPDTKL  997
                  +   L  LT Q+   GYVPDT+ 
Sbjct  708   PRTEEIYSELEALTKQIKSLGYVPDTRF  735


 Score =   246 bits (629),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 145/503 (29%), Positives = 258/503 (51%), Gaps = 12/503 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P K +   I+ +C++  ++  G+  H ++++ G  ++    N L+SMY     +  A+++
Sbjct  143   PDKFTFVSILSACSSPAALNWGREVHVRVMEAGLANNATVGNALISMYAKCGSVRDARRV  202

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD M  R+ ++WTTL  +Y+  G ++++L ++ +M L++G  P+  TY+  LSAC  L A
Sbjct  203   FDAMASRDEVSWTTLTGAYAESGYAQESLKTYHAM-LQEGVRPSRITYMNVLSACGSLAA  261

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IH +I  +E   +  VS  L   Y KCG +K A+ VF+ +   + + W +++  
Sbjct  262   LEKGKQIHAQIVESEHHSDVRVSTALTKMYIKCGAVKDAREVFECLPNRDVIAWNTMIGG  321

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
                 G+ +E   +F R L+  V  +       L ACA    L  G  IH   VK G+  D
Sbjct  322   LVDSGQLEEAHGMFHRMLKECVAPDRVTYLAILSACARPGGLACGKEIHARAVKDGLVSD  381

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
                   L+N Y K G +  A   F+     ++ +WTAL+GG    G+  E+ + F K+L 
Sbjct  382   VRFGNALINMYSKAGSMKDARQVFDRMPKRDVVSWTALVGGYADCGQVVESFSTFKKMLQ  441

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              G++ ++ TY  VL A ++    + G ++H+ ++K G  +   V NAL+  Y K   +++
Sbjct  442   QGVEANKITYMCVLKACSNPVALKWGKEIHAEVVKAGIFADLAVANALMSMYFKCGSVED  501

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             + ++ + M+  D+VTWN LI G  ++G   +A++  + M  E + PN  T+  ++S C  
Sbjct  502   AIRVSEGMSTRDVVTWNTLIGGLAQNGRGLEALQKFEVMKSEEMRPNATTFVNVMSACRV  561

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGST----LIDMYAKCGRLGDARKVFDILPCK-NLV  1657
                +E G++    + K   D  +V        ++D+ A+ G LG+A  V   +P K +  
Sbjct  562   RNLVEEGRRQFASMRK---DYGIVPTEKHYACMVDILARAGHLGEAEDVILTMPFKPSAA  618

Query  1656  SWNTMLIGYAQHG---FGKEALE  1597
              W  +L     HG    G++A E
Sbjct  619   MWGALLAACRAHGNVEIGEQAAE  641


 Score =   240 bits (613),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 129/422 (31%), Positives = 218/422 (52%), Gaps = 0/422 (0%)
 Frame = -2

Query  2790  EDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLK  2611
             + G   + Y YV  L +C        GK++H  I R     N ++ N L+  Y  CG + 
Sbjct  37    QKGSQVDSYDYVKLLQSCVKAKDLAVGKQVHEHILRFGMKPNVYIINTLLKLYVHCGSVN  96

Query  2610  SAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACA  2431
              A+ +FD     + V+W  ++S +   G   E   +F    + G+  ++F     L AC+
Sbjct  97    EARRLFDKFSNKSVVSWNVMISGYAHRGLGQEAFNLFTLMQQEGLEPDKFTFVSILSACS  156

Query  2430  SVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTA  2251
             S   L +G  +H  +++ G+  +  V   L++ Y KCG +  A   F+  ++ +  +WT 
Sbjct  157   SPAALNWGREVHVRVMEAGLANNATVGNALISMYAKCGSVRDARRVFDAMASRDEVSWTT  216

Query  2250  LIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLG  2071
             L G   + G  +E++  +  +L  G++PS  TY +VL A       + G Q+H+ I++  
Sbjct  217   LTGAYAESGYAQESLKTYHAMLQEGVRPSRITYMNVLSACGSLAALEKGKQIHAQIVESE  276

Query  2070  FNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQ  1891
              +S   V  AL   Y K   + ++ ++F+ +   D++ WN +I G + SG  E+A  +  
Sbjct  277   HHSDVRVSTALTKMYIKCGAVKDAREVFECLPNRDVIAWNTMIGGLVDSGQLEEAHGMFH  336

Query  1890  EMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCG  1711
              ML E + P+  TY  ILS C     +  GK++H R +K G  S+V  G+ LI+MY+K G
Sbjct  337   RMLKECVAPDRVTYLAILSACARPGGLACGKEIHARAVKDGLVSDVRFGNALINMYSKAG  396

Query  1710  RLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLS  1531
              + DAR+VFD +P +++VSW  ++ GYA  G   E+   +  M + GV+ N IT++ VL 
Sbjct  397   SMKDARQVFDRMPKRDVVSWTALVGGYADCGQVVESFSTFKKMLQQGVEANKITYMCVLK  456

Query  1530  AC  1525
             AC
Sbjct  457   AC  458


 Score =   188 bits (478),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 112/378 (30%), Positives = 184/378 (49%), Gaps = 39/378 (10%)
 Frame = -2

Query  2154  YASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMT  1975
             Y  +L +    K+  VG Q+H  I++ G     ++ N L+  Y     ++E+ ++F + +
Sbjct  47    YVKLLQSCVKAKDLAVGKQVHEHILRFGMKPNVYIINTLLKLYVHCGSVNEARRLFDKFS  106

Query  1974  EYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQ  1795
                +V+WN +I+GY   G  ++A  L   M  EGLEP+  T+  ILS C    A+ WG++
Sbjct  107   NKSVVSWNVMISGYAHRGLGQEAFNLFTLMQQEGLEPDKFTFVSILSACSSPAALNWGRE  166

Query  1794  VHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGF  1615
             VH R+M+ G  +N  VG+ LI MYAKCG + DAR+VFD +  ++ VSW T+   YA+ G+
Sbjct  167   VHVRVMEAGLANNATVGNALISMYAKCGSVRDARRVFDAMASRDEVSWTTLTGAYAESGY  226

Query  1614  GKEALEIYSMMQENGVKPNDITFVGVLSACG---------HgglleegLNHFNSMKNNYG  1462
              +E+L+ Y  M + GV+P+ IT++ VLSACG                   H + ++ +  
Sbjct  227   AQESLKTYHAMLQEGVRPSRITYMNVLSACGSLAALEKGKQIHAQIVESEHHSDVRVSTA  286

Query  1461  IT-------------------PRTNHLA--CMVNLFARKGQTKKAYD-FIRSFPE--KPD  1354
             +T                   P  + +A   M+      GQ ++A+  F R   E   PD
Sbjct  287   LTKMYIKCGAVKDAREVFECLPNRDVIAWNTMIGGLVDSGQLEEAHGMFHRMLKECVAPD  346

Query  1353  KVVWRCLLSGCNINKDFVLGK-YAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRK  1177
             +V +  +LS C        GK   A  +     +D      L N+Y++     +A Q+  
Sbjct  347   RVTYLAILSACARPGGLACGKEIHARAVKDGLVSDVRFGNALINMYSKAGSMKDARQVFD  406

Query  1176  MMKQKELKKETGCSWTEL  1123
              M ++++      SWT L
Sbjct  407   RMPKRDV-----VSWTAL  419


 Score =   120 bits (302),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 135/289 (47%), Gaps = 3/289 (1%)
 Frame = -2

Query  3084  GPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQK  2905
              P +++   I+ +C     +  GK  HA+ +K G  SDV   N L++MY     ++ A++
Sbjct  344   APDRVTYLAILSACARPGGLACGKEIHARAVKDGLVSDVRFGNALINMYSKAGSMKDARQ  403

Query  2904  LFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             +FD MPKR+V++WT L+  Y+  G   ++  +F+ M L+ G   N  TY+  L ACS   
Sbjct  404   VFDRMPKRDVVSWTALVGGYADCGQVVESFSTFKKM-LQQGVEANKITYMCVLKACSNPV  462

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
             A + GKEIH  + +A    +  V+N L++ Y KCG ++ A  V + M   + VTW +L+ 
Sbjct  463   ALKWGKEIHAEVVKAGIFADLAVANALMSMYFKCGSVEDAIRVSEGMSTRDVVTWNTLIG  522

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVK-CGVK  2368
                Q G   E L+ F       +  N       + AC     +  G      + K  G+ 
Sbjct  523   GLAQNGRGLEALQKFEVMKSEEMRPNATTFVNVMSACRVRNLVEEGRRQFASMRKDYGIV  582

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNT-FNMASAPELHAWTALIGGCVQQG  2224
               +     +V+   + G LG A +    M   P    W AL+  C   G
Sbjct  583   PTEKHYACMVDILARAGHLGEAEDVILTMPFKPSAAMWGALLAACRAHG  631


 Score =   106 bits (265),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 103/190 (54%), Gaps = 4/190 (2%)
 Frame = -2

Query  1899  LLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYA  1720
             +LQ +  +G + + + Y  +L  C     +  GKQVH  I++ G   NV + +TL+ +Y 
Sbjct  31    VLQYLHQKGSQVDSYDYVKLLQSCVKAKDLAVGKQVHEHILRFGMKPNVYIINTLLKLYV  90

Query  1719  KCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVG  1540
              CG + +AR++FD    K++VSWN M+ GYA  G G+EA  ++++MQ+ G++P+  TFV 
Sbjct  91    HCGSVNEARRLFDKFSNKSVVSWNVMISGYAHRGLGQEAFNLFTLMQQEGLEPDKFTFVS  150

Query  1539  VLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPE  1363
             +LSAC     L  G   H   M+   G+         +++++A+ G  + A     +   
Sbjct  151   ILSACSSPAALNWGREVHVRVMEA--GLANNATVGNALISMYAKCGSVRDARRVFDAMAS  208

Query  1362  KPDKVVWRCL  1333
             + D+V W  L
Sbjct  209   R-DEVSWTTL  217



>ref|XP_006348570.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like 
[Solanum tuberosum]
Length=851

 Score =   470 bits (1210),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 247/662 (37%), Positives = 387/662 (58%), Gaps = 2/662 (0%)
 Frame = -2

Query  3087  RGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQ  2908
              GP +  L+ ++  C    SI+ G+  H  ++K G    VY    L+  Y    ++  A+
Sbjct  153   EGPNEFVLASVVSCCGRLGSIVKGEELHCFVVKAGFDQFVYVGTSLIDFYSKGGDVGSAR  212

Query  2907  KLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCL  2728
             ++FD++  ++  TWT +I++  ++G SE +L   R+M LE    P++Y     L ACS L
Sbjct  213   RIFDDLLVKSTATWTAIIAACVNVGKSEISLQLLRNM-LETDVVPDNYVVSSILGACSSL  271

Query  2727  GAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLL  2548
                + GKEIHG + R    ++  VSN L++FY KCG +K+A+ VFD M   NT++W +++
Sbjct  272   EYIKGGKEIHGYVLRRGVEMDVTVSNVLIDFYMKCGKVKTARSVFDRMQVKNTISWTTMI  331

Query  2547  SCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVK  2368
             S + Q     E + +F      G +++ F C   L +C SVE L  G  +H   VK  V 
Sbjct  332   SGYMQNSSDWEAISMFRDLNSLGWMLDRFACSSVLISCGSVEALELGRQVHAYTVKANVD  391

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
              D +V   L++ Y KC   G A   F++    ++ ++ A+I GC+ Q +  EA +LF ++
Sbjct  392   SDDFVKNSLIDMYAKCNSFGDARKVFDIMGDHDVISYNAIIEGCLTQNRLYEAFDLFAEM  451

Query  2187  LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
               + + PS  T+ S+LGA       ++  QLH   IK GF++  FVC+ L+D YSK + +
Sbjct  452   RDNLILPSLLTFVSLLGASASLFSLELSKQLHGLTIKFGFSADMFVCSILIDVYSKCSSI  511

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
             +++ ++F EM E DIV WN+++ GYI+    E+A+K   E+     +PN  T+  +++  
Sbjct  512   EDARQVFIEMNEKDIVVWNSMLFGYIQQCENEEALKFFLELRQSLQKPNALTFVALIAAS  571

Query  1827  GDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWN  1648
              +L ++  G Q H +I+K G + +  V + L+DMY+KCG L +ARK+F+    +++  WN
Sbjct  572   SNLVSLLHGLQFHNQIVKLGLNFDPHVTNALVDMYSKCGSLEEARKMFNSTIQRDIACWN  631

Query  1647  TMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNN  1468
             +M+  YAQHG  KEAL ++  M  +G+KPN++TFVGVLSAC H GL++EGL HF+SM   
Sbjct  632   SMISTYAQHGEAKEALNMFEKMINDGLKPNNVTFVGVLSACSHVGLVKEGLRHFHSMA-G  690

Query  1467  YGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKY  1288
             YGI P T H  C+V+L  R G+  +A +FI + P  P  +VWR LLS C       LGKY
Sbjct  691   YGIEPETEHYVCIVSLLGRAGKLVEATEFIETMPIPPAAIVWRSLLSACREAGHIDLGKY  750

Query  1287  AAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIY  1108
             AA   +SIDP D+ +++ LSNIYA   MW    ++R+ M    + KE GCSW E+ N+++
Sbjct  751   AASMAISIDPKDSGSYILLSNIYASKGMWINVKKLREKMDSNGVVKEKGCSWIEINNEVH  810

Query  1107  CF  1102
              F
Sbjct  811   LF  812


 Score =   294 bits (752),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 172/566 (30%), Positives = 313/566 (55%), Gaps = 6/566 (1%)
 Frame = -2

Query  3015  KAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHM  2836
             K  H Q+I  G +S+ + NN L+  Y     +  A+K+FD+MPKR++I+W+++I+ Y+  
Sbjct  73    KEIHTQVILSGFESNPFLNNILIQSYSIRGCLGYARKVFDKMPKRDMISWSSVITMYTQN  132

Query  2835  GLSEKALGSFRSMVL--EDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNN  2662
             G+ +++L  F  +    ++G  PN +     +S C  LG+   G+E+H  + +A      
Sbjct  133   GVYDESLLLFAELRRSCKEGEGPNEFVLASVVSCCGRLGSIVKGEELHCFVVKAGFDQFV  192

Query  2661  FVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRA  2482
             +V   L++FY K G + SA+ +FD +L  +T TW ++++     G+ +  L++    L  
Sbjct  193   YVGTSLIDFYSKGGDVGSARRIFDDLLVKSTATWTAIIAACVNVGKSEISLQLLRNMLET  252

Query  2481  GVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLA  2302
              V+ + ++    LGAC+S+E +  G  IH  +++ GV+MD  V   L++FY+KCG++  A
Sbjct  253   DVVPDNYVVSSILGACSSLEYIKGGKEIHGYVLRRGVEMDVTVSNVLIDFYMKCGKVKTA  312

Query  2301  YNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDT  2122
              + F+        +WT +I G +Q     EA+++F  L S G        +SVL +    
Sbjct  313   RSVFDRMQVKNTISWTTMISGYMQNSSDWEAISMFRDLNSLGWMLDRFACSSVLISCGSV  372

Query  2121  KEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALI  1942
             +  ++G Q+H++ +K   +S  FV N+L+D Y+K N   ++ K+F  M ++D++++NA+I
Sbjct  373   EALELGRQVHAYTVKANVDSDDFVKNSLIDMYAKCNSFGDARKVFDIMGDHDVISYNAII  432

Query  1941  AGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFD  1762
              G +      +A  L  EM    + P+L T+  +L     L ++E  KQ+H   +K GF 
Sbjct  433   EGCLTQNRLYEAFDLFAEMRDNLILPSLLTFVSLLGASASLFSLELSKQLHGLTIKFGFS  492

Query  1761  SNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMM  1582
             +++ V S LID+Y+KC  + DAR+VF  +  K++V WN+ML GY Q    +EAL+ +  +
Sbjct  493   ADMFVCSILIDVYSKCSSIEDARQVFIEMNEKDIVVWNSMLFGYIQQCENEEALKFFLEL  552

Query  1581  QENGVKPNDITFVGVLSACGHgglleegLNHFNSM-KNNYGITPRTNHLACMVNLFARKG  1405
             +++  KPN +TFV +++A  +   L  GL   N + K      P   +   +V+++++ G
Sbjct  553   RQSLQKPNALTFVALIAASSNLVSLLHGLQFHNQIVKLGLNFDPHVTN--ALVDMYSKCG  610

Query  1404  QTKKAYDFIRSFPEKPDKVVWRCLLS  1327
               ++A     S  ++ D   W  ++S
Sbjct  611   SLEEARKMFNSTIQR-DIACWNSMIS  635


 Score =   223 bits (568),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 134/492 (27%), Positives = 254/492 (52%), Gaps = 6/492 (1%)
 Frame = -2

Query  3105  SILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFH  2926
             ++L T   P    +S I+ +C++ + I  GK  H  +++ G + DV  +N L+  Y+   
Sbjct  248   NMLETDVVPDNYVVSSILGACSSLEYIKGGKEIHGYVLRRGVEMDVTVSNVLIDFYMKCG  307

Query  2925  EIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGAL  2746
             +++ A+ +FD M  +N I+WTT+IS Y       +A+  FR +    G+  + +     L
Sbjct  308   KVKTARSVFDRMQVKNTISWTTMISGYMQNSSDWEAISMFRDLN-SLGWMLDRFACSSVL  366

Query  2745  SACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTV  2566
              +C  + A   G+++H    +A    ++FV N L++ Y KC     A+ VFD M + + +
Sbjct  367   ISCGSVEALELGRQVHAYTVKANVDSDDFVKNSLIDMYAKCNSFGDARKVFDIMGDHDVI  426

Query  2565  TWASLLS-CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIA-LGACASVECLGFGMGIHC  2392
             ++ +++  C  Q   Y E   +F   +R  +++   L  ++ LGA AS+  L     +H 
Sbjct  427   SYNAIIEGCLTQNRLY-EAFDLFAE-MRDNLILPSLLTFVSLLGASASLFSLELSKQLHG  484

Query  2391  LIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGRE  2212
             L +K G   D +V + L++ Y KC  +  A   F   +  ++  W +++ G +QQ +  E
Sbjct  485   LTIKFGFSADMFVCSILIDVYSKCSSIEDARQVFIEMNEKDIVVWNSMLFGYIQQCENEE  544

Query  2211  AVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVD  2032
             A+  F +L  S  KP+  T+ +++ A ++      G+Q H+ I+KLG N    V NALVD
Sbjct  545   ALKFFLELRQSLQKPNALTFVALIAASSNLVSLLHGLQFHNQIVKLGLNFDPHVTNALVD  604

Query  2031  FYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHT  1852
              YSK   L+E+ K+F    + DI  WN++I+ Y + G  ++A+ + ++M+ +GL+PN  T
Sbjct  605   MYSKCGSLEEARKMFNSTIQRDIACWNSMISTYAQHGEAKEALNMFEKMINDGLKPNNVT  664

Query  1851  YSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILP  1672
             +  +LS C  +  ++ G +    +   G +        ++ +  + G+L +A +  + +P
Sbjct  665   FVGVLSACSHVGLVKEGLRHFHSMAGYGIEPETEHYVCIVSLLGRAGKLVEATEFIETMP  724

Query  1671  C-KNLVSWNTML  1639
                  + W ++L
Sbjct  725   IPPAAIVWRSLL  736



>ref|XP_008806000.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Phoenix dactylifera]
Length=745

 Score =   465 bits (1196),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 256/726 (35%), Positives = 408/726 (56%), Gaps = 24/726 (3%)
 Frame = -2

Query  3153  PATTASLRPA*QSQGSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKS  2974
             P+ T S RP  Q+ G     T++     +L +++  C   K++ SG + HA +IK GS +
Sbjct  2     PSVT-SRRPN-QALGGEAAATSQ-----TLFRLLLRCAEQKNLQSGSSLHAHIIKSGSWA  54

Query  2973  DVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGL--SEKALGSFRS  2800
              V   N +++MY     +  A   FDEM  R+V++W +LI+SYSH G   S      F+ 
Sbjct  55    HVLLANSVVNMYAKCGRLATAAAAFDEMHSRDVVSWNSLINSYSHEGPPHSNAVFRLFKR  114

Query  2799  MVLEDGF--TPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGK  2626
             M  + G    PN +T+ G  +A S   A   G+E H    +     + F+ + L+N Y K
Sbjct  115   MRADGGVHVLPNAFTFAGVFTAASASHAVLAGREAHCVAIKTANCDDVFLGSSLLNMYCK  174

Query  2625  CGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVL-VNEFLCGI  2449
              GLL  A++VFD ML+ N+V+WA+++S +       E  ++F   L  G    NEF+   
Sbjct  175   LGLLSDARMVFDRMLQRNSVSWAAMISGYAVDKHGAEAFKLFRSMLEEGECDTNEFVFTS  234

Query  2448  ALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPE  2269
              L A +    L  G  IH L +K G+     V   L+  Y KC ++  A   F  +S   
Sbjct  235   ILSAVSLPGLLEMGQQIHGLAIKNGLSSFLSVENSLITLYAKCERMDEALLMFESSSEKN  294

Query  2268  LHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHS  2089
                W+A+I G  Q G  R+A++LF ++ S+G++PSE T+  VL A +D      G Q H 
Sbjct  295   SITWSAMITGYAQNGDSRKALSLFSQMQSAGIRPSEFTFVGVLNACSDVMALVEGKQAHG  354

Query  2088  FIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQ  1909
             F++KLGF    +V  ALVD Y+K    D++ K F ++ E DI  W ++I GY+++G +E+
Sbjct  355   FLLKLGFELQVYVKTALVDMYAKCGSSDDARKGFDQLHEADIALWTSMIGGYVQNGEHEE  414

Query  1908  AIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLID  1729
             A+ L   M  EG+ PN  T + IL  C  L A+E GKQ+H + +K GF+  + +GS L  
Sbjct  415   ALALYCGMGREGILPNNLTMASILRACSSLAALEQGKQIHAQTLKYGFNLGIPIGSALST  474

Query  1728  MYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDIT  1549
             MYAKCG L D  +VF  +P +++V+WN+++ GY+Q+G G EAL ++  M+  G KP+ +T
Sbjct  475   MYAKCGNLEDCNRVFRRMPERDVVAWNSIISGYSQNGCGNEALNLFEEMKLEGTKPDHVT  534

Query  1548  FVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSF  1369
             F+ +LSAC H GL++ G ++F  M ++YG+ PR  + ACMV++ +R G  ++A DF+ S 
Sbjct  535   FINLLSACSHMGLVDRGWSYFRLMHDDYGLVPRVENYACMVDILSRAGMLEEAKDFVESV  594

Query  1368  PEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAA  1189
             P      +WR +L  C   + F +G YA E ++ +   D+SA++ LSNIYA    WD+  
Sbjct  595   PTDHGMCLWRIVLGACRSYRSFGVGAYAGERLMELGSLDSSAYILLSNIYAACRRWDDVE  654

Query  1188  QIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGEVSMKKL------LIGLTAQLL  1027
             ++R+MM+ + + KE GCSW E++++++ F      ++G++   ++      +  L   + 
Sbjct  655   RVRRMMRFRGVNKEPGCSWIEIKSRVHAF------VVGDLQHPEMKDIHAEVRRLLGHMT  708

Query  1026  DAGYVP  1009
             D GY P
Sbjct  709   DEGYRP  714



>ref|XP_002262885.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Vitis vinifera]
Length=866

 Score =   468 bits (1203),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 255/698 (37%), Positives = 401/698 (57%), Gaps = 19/698 (3%)
 Frame = -2

Query  3069  SLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM  2890
             SLS +++ C      + GK  H Q IK G   DV     L+ MY+    +E  +++FDEM
Sbjct  94    SLSCVLKVCGCLFDRIVGKQVHCQCIKCGFVEDVSVGTSLVDMYMKTESVEDGERVFDEM  153

Query  2889  PKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTG  2710
               +NV++WT+L++ Y   GL+E+AL  F  M LE G  PN +T+   L   +  GA   G
Sbjct  154   RVKNVVSWTSLLAGYRQNGLNEQALKLFSQMQLE-GIKPNPFTFAAVLGGLAADGAVEKG  212

Query  2709  KEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQC  2530
              ++H  + ++      FV N +VN Y K  ++  A+ VFD+M   N V+W S+++     
Sbjct  213   VQVHTMVIKSGLDSTIFVGNSMVNMYSKSLMVSDAKAVFDSMENRNAVSWNSMIAGFVTN  272

Query  2529  GEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVV  2350
             G   E   +F R    GV + + +    +  CA+++ + F   +HC ++K G   D  + 
Sbjct  273   GLDLEAFELFYRMRLEGVKLTQTIFATVIKLCANIKEMSFAKQLHCQVIKNGSDFDLNIK  332

Query  2349  TGLVNFYVKCGQLGLAYNTFNMASAPE-LHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
             T L+  Y KC ++  A+  F M    + + +WTA+I G VQ G+   A+NLFC++   G+
Sbjct  333   TALMVAYSKCSEIDDAFKLFCMMHGVQNVVSWTAIISGYVQNGRTDRAMNLFCQMRREGV  392

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             +P+  TY+++L A       Q+    H+ ++K  + +   V  AL D YSK    +E+ K
Sbjct  393   RPNHFTYSTILTANAAVSPSQI----HALVVKTNYENSPSVGTALSDSYSKIGDANEAAK  448

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPA  1813
             IF+ + E DIV W+A+++GY + G  E A+K+  ++  EG+EPN  T+S +L+ C    A
Sbjct  449   IFELIDEKDIVAWSAMLSGYAQMGDIEGAVKIFLQLAKEGVEPNEFTFSSVLNACAAPTA  508

Query  1812  -IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
              +E GKQ H   +K GF + + V S L+ MYAK G +  A +VF     ++LVSWN+M+ 
Sbjct  509   SVEQGKQFHSCSIKSGFSNALCVSSALVTMYAKRGNIESANEVFKRQVDRDLVSWNSMIS  568

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             GYAQHG GK++L+I+  M+   ++ + ITF+GV+SAC H GL+ EG  +F+ M  +Y I 
Sbjct  569   GYAQHGCGKKSLKIFEEMRSKNLELDGITFIGVISACTHAGLVNEGQRYFDLMVKDYHIV  628

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             P   H +CMV+L++R G  +KA D I   P      +WR LL+ C ++ +  LG+ AAE+
Sbjct  629   PTMEHYSCMVDLYSRAGMLEKAMDLINKMPFPAGATIWRTLLAACRVHLNVQLGELAAEK  688

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSS  1096
             ++S+ P D++A+V LSNIYA    W E A++RK+M  K++KKE G SW E++NK + F  
Sbjct  689   LISLQPQDSAAYVLLSNIYATAGNWQERAKVRKLMDMKKVKKEAGYSWIEVKNKTFSF--  746

Query  1095  SYNMLLGEVSMKK------LLIGLTAQLLDAGYVPDTK  1000
                 + G++S  +       L  L+ +L DAGY PDTK
Sbjct  747   ----MAGDLSHPQSDRIYLKLEELSIRLKDAGYYPDTK  780


 Score =   209 bits (533),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/429 (28%), Positives = 219/429 (51%), Gaps = 7/429 (2%)
 Frame = -2

Query  2607  AQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACAS  2428
             +Q +FD   +        LL    +  +  E L +FL   R+G   +       L  C  
Sbjct  45    SQQLFDETPQQGLSRNNHLLFEFSRNDQNKEALNLFLGLRRSGSPTDGSSLSCVLKVCGC  104

Query  2427  VECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTAL  2248
             +     G  +HC  +KCG   D  V T LV+ Y+K   +      F+      + +WT+L
Sbjct  105   LFDRIVGKQVHCQCIKCGFVEDVSVGTSLVDMYMKTESVEDGERVFDEMRVKNVVSWTSL  164

Query  2247  IGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGF  2068
             + G  Q G   +A+ LF ++   G+KP+  T+A+VLG        + G+Q+H+ +IK G 
Sbjct  165   LAGYRQNGLNEQALKLFSQMQLEGIKPNPFTFAAVLGGLAADGAVEKGVQVHTMVIKSGL  224

Query  2067  NSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQE  1888
             +S  FV N++V+ YSKS ++ ++  +F  M   + V+WN++IAG++ +G   +A +L   
Sbjct  225   DSTIFVGNSMVNMYSKSLMVSDAKAVFDSMENRNAVSWNSMIAGFVTNGLDLEAFELFYR  284

Query  1887  MLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGR  1708
             M  EG++     ++ ++ +C ++  + + KQ+HC+++K G D ++ + + L+  Y+KC  
Sbjct  285   MRLEGVKLTQTIFATVIKLCANIKEMSFAKQLHCQVIKNGSDFDLNIKTALMVAYSKCSE  344

Query  1707  LGDARKVFDILP-CKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLS  1531
             + DA K+F ++   +N+VSW  ++ GY Q+G    A+ ++  M+  GV+PN  T+  +L+
Sbjct  345   IDDAFKLFCMMHGVQNVVSWTAIISGYVQNGRTDRAMNLFCQMRREGVRPNHFTYSTILT  404

Query  1530  ACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDK  1351
             A       +    H   +K NY  +P       + + +++ G   +A        EK D 
Sbjct  405   ANAAVSPSQI---HALVVKTNYENSPSVG--TALSDSYSKIGDANEAAKIFELIDEK-DI  458

Query  1350  VVWRCLLSG  1324
             V W  +LSG
Sbjct  459   VAWSAMLSG  467


 Score =   197 bits (500),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 130/488 (27%), Positives = 238/488 (49%), Gaps = 15/488 (3%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + + ++     + ++  G   H  +IK G  S ++  N +++MY     +  A+ +
Sbjct  191   PNPFTFAAVLGGLAADGAVEKGVQVHTMVIKSGLDSTIFVGNSMVNMYSKSLMVSDAKAV  250

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD M  RN ++W ++I+ +   GL  +A   F  M LE G       +   +  C+ +  
Sbjct  251   FDSMENRNAVSWNSMIAGFVTNGLDLEAFELFYRMRLE-GVKLTQTIFATVIKLCANIKE  309

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLE-PNTVTWASLLS  2545
                 K++H ++ +     +  +   L+  Y KC  +  A  +F  M    N V+W +++S
Sbjct  310   MSFAKQLHCQVIKNGSDFDLNIKTALMVAYSKCSEIDDAFKLFCMMHGVQNVVSWTAIIS  369

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
              + Q G  D  + +F +  R GV  N F     L A A+V        IH L+VK   + 
Sbjct  370   GYVQNGRTDRAMNLFCQMRREGVRPNHFTYSTILTANAAVS----PSQIHALVVKTNYEN  425

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
                V T L + Y K G    A   F +    ++ AW+A++ G  Q G    AV +F +L 
Sbjct  426   SPSVGTALSDSYSKIGDANEAAKIFELIDEKDIVAWSAMLSGYAQMGDIEGAVKIFLQLA  485

Query  2184  SSGLKPSERTYASVLGA-FTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
               G++P+E T++SVL A    T   + G Q HS  IK GF++   V +ALV  Y+K   +
Sbjct  486   KEGVEPNEFTFSSVLNACAAPTASVEQGKQFHSCSIKSGFSNALCVSSALVTMYAKRGNI  545

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
             + + ++F+   + D+V+WN++I+GY + G  ++++K+ +EM  + LE +  T+  ++S C
Sbjct  546   ESANEVFKRQVDRDLVSWNSMISGYAQHGCGKKSLKIFEEMRSKNLELDGITFIGVISAC  605

Query  1827  GDLPAIEWGKQVHCRIMKPGFDSNVVVG----STLIDMYAKCGRLGDARKVFDILPCKNL  1660
                  +  G++    ++K   D ++V      S ++D+Y++ G L  A  + + +P    
Sbjct  606   THAGLVNEGQRYFDLMVK---DYHIVPTMEHYSCMVDLYSRAGMLEKAMDLINKMPFPAG  662

Query  1659  VS-WNTML  1639
              + W T+L
Sbjct  663   ATIWRTLL  670



>ref|XP_004228912.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 
[Solanum lycopersicum]
 ref|XP_010315741.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 
[Solanum lycopersicum]
Length=848

 Score =   465 bits (1197),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 246/662 (37%), Positives = 383/662 (58%), Gaps = 2/662 (0%)
 Frame = -2

Query  3087  RGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQ  2908
              GP +  L+ ++  C    SI+ G+  H  ++K G    VY    L+  Y    ++  A+
Sbjct  150   EGPNEFVLASVVSCCGRLGSIVKGEELHCFVVKAGFDQFVYVGTSLIDFYSKGRDVGSAR  209

Query  2907  KLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCL  2728
             ++FD++  ++  TWT +I++  ++G SE +L   R+M LE    P++Y     L ACS L
Sbjct  210   RVFDDLVVKSTATWTAIIAACVNVGKSEISLQLLRNM-LETDVAPDNYVVSSILGACSSL  268

Query  2727  GAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLL  2548
                + GKEIHG + R    ++  VSN L++FY KCG +K+A+ VFD M   N ++W +++
Sbjct  269   EYIKGGKEIHGYVLRRGAEMDVTVSNVLIDFYMKCGNVKTARSVFDRMEVKNAISWTTMI  328

Query  2547  SCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVK  2368
             S + Q     E + +F      G +++ F C   L +C SVE L  G  +H   VK  V 
Sbjct  329   SGYMQNSSDWEAISMFRDLNGLGWILDRFACSSVLISCGSVEALELGRQVHAYTVKANVD  388

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
              D+YV   L++ Y KC   G A   F++    ++ ++ A+I GC+ Q +  EA +LF ++
Sbjct  389   SDEYVKNSLIDMYAKCNSFGDARKVFDIMGDHDVISYNAVIEGCLTQNRLYEAFDLFAEM  448

Query  2187  LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
               + + PS  T+ S+LGA       ++  QLH   IK GF++  FVC+ LVD YSK   +
Sbjct  449   RENLIPPSLLTFVSLLGASASLFSLELSKQLHGLTIKFGFSADMFVCSILVDVYSKCLSI  508

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
               + ++F EM E DIV WN+++ GYI+    E+A+KL   +     +PN  T+  +++  
Sbjct  509   GYARQVFNEMNEKDIVVWNSMLFGYIQQCENEEALKLFLLLRQSLQKPNTLTFVALIAAS  568

Query  1827  GDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWN  1648
              +L ++  G Q H +I+K G D ++ V + L+DMY+KCG L +ARK+F+    +++  WN
Sbjct  569   SNLVSLLHGLQFHNQIVKLGLDFDLHVTNALVDMYSKCGSLEEARKMFNSTIQRDVACWN  628

Query  1647  TMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNN  1468
             +M+  YAQHG  KEAL ++  M ++G+KPN++TFVGVLSAC H GL++EG  HF SM   
Sbjct  629   SMISTYAQHGEAKEALNMFEKMIKDGLKPNNVTFVGVLSACSHVGLVKEGFRHFYSMA-G  687

Query  1467  YGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKY  1288
             YGI P   H  CMV+L  R G+  +A + I + P  P  +VWR LLS C       LGKY
Sbjct  688   YGIEPEMEHYVCMVSLLGRAGKLVEATELIETMPIPPAAIVWRSLLSACREAGHIDLGKY  747

Query  1287  AAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIY  1108
             AA   +SIDP D+ +++ LSNI+A  +MW    ++R+ M    + KE GCSW E+ N+++
Sbjct  748   AASMAISIDPKDSGSYILLSNIFASKDMWINVKKLREKMDSSGVVKEKGCSWIEINNEVH  807

Query  1107  CF  1102
              F
Sbjct  808   LF  809


 Score =   288 bits (738),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 172/610 (28%), Positives = 331/610 (54%), Gaps = 8/610 (1%)
 Frame = -2

Query  3150  ATTASLRPA*QSQGSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSD  2971
               ++SL    + +  +I+   R   +  LS+++ + +T       K  H Q+I  G +++
Sbjct  29    TVSSSLHHRSEEENYTIIRRNRRTQRHYLSKLLFTLSTTHC----KEIHTQVILCGFENN  84

Query  2970  VYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSM--  2797
              + NN L+  Y     ++ A+K+FD+MPKR++I+W+++I+ Y+  G+ +++L  F  +  
Sbjct  85    PFLNNILIQSYSIRGCLDYARKVFDKMPKRDMISWSSVITMYTQNGVYDESLSLFAELRR  144

Query  2796  VLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGL  2617
               ++G  PN +     +S C  LG+   G+E+H  + +A      +V   L++FY K   
Sbjct  145   SCKEGEGPNEFVLASVVSCCGRLGSIVKGEELHCFVVKAGFDQFVYVGTSLIDFYSKGRD  204

Query  2616  LKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGA  2437
             + SA+ VFD ++  +T TW ++++     G+ +  L++    L   V  + ++    LGA
Sbjct  205   VGSARRVFDDLVVKSTATWTAIIAACVNVGKSEISLQLLRNMLETDVAPDNYVVSSILGA  264

Query  2436  CASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAW  2257
             C+S+E +  G  IH  +++ G +MD  V   L++FY+KCG +  A + F+        +W
Sbjct  265   CSSLEYIKGGKEIHGYVLRRGAEMDVTVSNVLIDFYMKCGNVKTARSVFDRMEVKNAISW  324

Query  2256  TALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIK  2077
             T +I G +Q     EA+++F  L   G        +SVL +    +  ++G Q+H++ +K
Sbjct  325   TTMISGYMQNSSDWEAISMFRDLNGLGWILDRFACSSVLISCGSVEALELGRQVHAYTVK  384

Query  2076  LGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKL  1897
                +S  +V N+L+D Y+K N   ++ K+F  M ++D++++NA+I G +      +A  L
Sbjct  385   ANVDSDEYVKNSLIDMYAKCNSFGDARKVFDIMGDHDVISYNAVIEGCLTQNRLYEAFDL  444

Query  1896  LQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAK  1717
               EM    + P+L T+  +L     L ++E  KQ+H   +K GF +++ V S L+D+Y+K
Sbjct  445   FAEMRENLIPPSLLTFVSLLGASASLFSLELSKQLHGLTIKFGFSADMFVCSILVDVYSK  504

Query  1716  CGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGV  1537
             C  +G AR+VF+ +  K++V WN+ML GY Q    +EAL+++ +++++  KPN +TFV +
Sbjct  505   CLSIGYARQVFNEMNEKDIVVWNSMLFGYIQQCENEEALKLFLLLRQSLQKPNTLTFVAL  564

Query  1536  LSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKP  1357
             ++A  +   L  GL   N +    G+    +    +V+++++ G  ++A     S  ++ 
Sbjct  565   IAASSNLVSLLHGLQFHNQIV-KLGLDFDLHVTNALVDMYSKCGSLEEARKMFNSTIQR-  622

Query  1356  DKVVWRCLLS  1327
             D   W  ++S
Sbjct  623   DVACWNSMIS  632



>ref|NP_001061590.1| Os08g0340900 [Oryza sativa Japonica Group]
 dbj|BAD01706.1| PPR-repeat protein-like [Oryza sativa Japonica Group]
 dbj|BAD03655.1| PPR-repeat protein-like [Oryza sativa Japonica Group]
 dbj|BAF23504.1| Os08g0340900 [Oryza sativa Japonica Group]
 dbj|BAG90841.1| unnamed protein product [Oryza sativa Japonica Group]
Length=819

 Score =   463 bits (1191),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 245/693 (35%), Positives = 394/693 (57%), Gaps = 1/693 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +  L+ ++R+CT +K++  G+  H   +K    ++VY    L+++Y     ++ A  +
Sbjct  118   PNEFLLASVLRACTQSKAVSLGEQVHGIAVKLDLDANVYVGTALINLYAKLGCMDEAMLV  177

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F  +P R  +TW T+I+ Y+ +G    AL  F  M +E G  P+ +    A+SACS LG 
Sbjct  178   FHALPVRTPVTWNTVITGYAQIGCGGVALELFDRMGIE-GVRPDRFVLASAVSACSALGF  236

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G++IHG  +R+    +  V N L++ Y KC  L +A+ +FD M   N V+W +++S 
Sbjct  237   LEGGRQIHGYAYRSATETDTSVINVLIDLYCKCSRLSAARKLFDCMEYRNLVSWTTMISG  296

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q     E + +F    +AG   + F C   L +C S+  +  G  IH  ++K  ++ D
Sbjct  297   YMQNSFNAEAITMFWNMTQAGWQPDGFACTSILNSCGSLAAIWQGRQIHAHVIKADLEAD  356

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
             +YV   L++ Y KC  L  A   F+  +  +  ++ A+I G  +     EAVN+F ++  
Sbjct  357   EYVKNALIDMYAKCEHLTEARAVFDALAEDDAISYNAMIEGYSKNRDLAEAVNIFQRMRF  416

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
               L+PS  T+ S+LG  +     ++  Q+H  IIK G +   +  +AL+D YSK +L+++
Sbjct  417   FSLRPSLLTFVSLLGVSSSQLAIELSKQIHGLIIKSGTSLDLYAASALIDVYSKCSLVND  476

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F  +   D+V WN++I G+ ++   E+AIKL  ++L  G+ PN  T+  ++++   
Sbjct  477   AKTVFNMLHYKDMVIWNSMIFGHAQNEQGEEAIKLFNQLLLSGMAPNEFTFVALVTVAST  536

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L ++  G+Q H  I+K G D++  V + LIDMYAKCG + + R +F+    ++++ WN+M
Sbjct  537   LASMFHGQQFHAWIIKAGVDNDPHVSNALIDMYAKCGFIKEGRMLFESTCGEDVICWNSM  596

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +  YAQHG  +EAL+++ +M E  V+PN +TFVGVLSAC H G + EGLNHFNSMK+NY 
Sbjct  597   ITTYAQHGHAEEALQVFRLMGEAEVEPNYVTFVGVLSACAHAGFVGEGLNHFNSMKSNYD  656

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I P   H A +VNLF R G+   A +FI   P KP   VWR LLS C++  +  +G+YAA
Sbjct  657   IEPGIEHYASVVNLFGRSGKLHAAKEFIERMPIKPAAAVWRSLLSACHLFGNAEIGRYAA  716

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             E  L  DP D+  +V LSNIYA   +W +   +R+ M      KETGCSW E+  +++ F
Sbjct  717   EMALLADPTDSGPYVLLSNIYASKGLWADVHNLRQQMDSSGTVKETGCSWIEVTKEVHTF  776

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDT  1003
                         +  +L  LT+ + + GYVPDT
Sbjct  777   IVRGREHPEAELIYSVLDELTSLIKNLGYVPDT  809


 Score =   287 bits (734),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 158/516 (31%), Positives = 270/516 (52%), Gaps = 3/516 (1%)
 Frame = -2

Query  3069  SLSQIIRSCTT---NKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLF  2899
             SL++++ SC     ++      A HA+    G   D++  N LL  Y     +  A+ LF
Sbjct  17    SLARVLLSCLPTGGDRLRRLNPAIHARATVAGRLDDLFLTNLLLRGYSNLGRLRDARHLF  76

Query  2898  DEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAA  2719
             D MP RN+++W ++IS Y+  G  + A+  F +        PN +     L AC+   A 
Sbjct  77    DRMPHRNLVSWGSVISMYTQHGRDDCAISLFVAFQKASCEVPNEFLLASVLRACTQSKAV  136

Query  2718  RTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCH  2539
               G+++HG   + +   N +V   L+N Y K G +  A LVF A+     VTW ++++ +
Sbjct  137   SLGEQVHGIAVKLDLDANVYVGTALINLYAKLGCMDEAMLVFHALPVRTPVTWNTVITGY  196

Query  2538  CQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQ  2359
              Q G     L +F R    GV  + F+   A+ AC+++  L  G  IH    +   + D 
Sbjct  197   AQIGCGGVALELFDRMGIEGVRPDRFVLASAVSACSALGFLEGGRQIHGYAYRSATETDT  256

Query  2358  YVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSS  2179
              V+  L++ Y KC +L  A   F+      L +WT +I G +Q     EA+ +F  +  +
Sbjct  257   SVINVLIDLYCKCSRLSAARKLFDCMEYRNLVSWTTMISGYMQNSFNAEAITMFWNMTQA  316

Query  2178  GLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDES  1999
             G +P      S+L +         G Q+H+ +IK    +  +V NAL+D Y+K   L E+
Sbjct  317   GWQPDGFACTSILNSCGSLAAIWQGRQIHAHVIKADLEADEYVKNALIDMYAKCEHLTEA  376

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDL  1819
               +F  + E D +++NA+I GY ++    +A+ + Q M F  L P+L T+  +L +    
Sbjct  377   RAVFDALAEDDAISYNAMIEGYSKNRDLAEAVNIFQRMRFFSLRPSLLTFVSLLGVSSSQ  436

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
              AIE  KQ+H  I+K G   ++   S LID+Y+KC  + DA+ VF++L  K++V WN+M+
Sbjct  437   LAIELSKQIHGLIIKSGTSLDLYAASALIDVYSKCSLVNDAKTVFNMLHYKDMVIWNSMI  496

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLS  1531
              G+AQ+  G+EA+++++ +  +G+ PN+ TFV +++
Sbjct  497   FGHAQNEQGEEAIKLFNQLLLSGMAPNEFTFVALVT  532


 Score = 89.0 bits (219),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 101/195 (52%), Gaps = 8/195 (4%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF  2929
             + +L +   P + +   ++   +T  S+  G+  HA +IK G  +D + +N L+ MY   
Sbjct  513   NQLLLSGMAPNEFTFVALVTVASTLASMFHGQQFHAWIIKAGVDNDPHVSNALIDMYAKC  572

Query  2928  HEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGA  2749
               I+  + LF+     +VI W ++I++Y+  G +E+AL  FR M  E    PN+ T+VG 
Sbjct  573   GFIKEGRMLFESTCGEDVICWNSMITTYAQHGHAEEALQVFRLMG-EAEVEPNYVTFVGV  631

Query  2748  LSACSCLGAARTGKEIHGRI---FRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAM-L  2581
             LSAC+  G    G      +   +  E  + ++ S  +VN +G+ G L +A+   + M +
Sbjct  632   LSACAHAGFVGEGLNHFNSMKSNYDIEPGIEHYAS--VVNLFGRSGKLHAAKEFIERMPI  689

Query  2580  EPNTVTWASLLS-CH  2539
             +P    W SLLS CH
Sbjct  690   KPAAAVWRSLLSACH  704



>gb|KDP36856.1| hypothetical protein JCGZ_08147 [Jatropha curcas]
Length=707

 Score =   459 bits (1181),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 260/697 (37%), Positives = 395/697 (57%), Gaps = 7/697 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   SL   I  CT  KS+  G+A H Q+IK  S S +Y  N L++ Y     +  A+ +
Sbjct  5     PQSRSLFNSILECTHQKSLQRGRALHGQIIKSASSSCIYLANSLVNFYAKCGNLPKAKLV  64

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKAL--GSFRSMVLEDGFTPNHYTYVGALSACSCL  2728
             F+ +  ++VI+W  LI+SYS  G +  +L    F+SM  E+ F PN +T+ G  +A S L
Sbjct  65    FERIRDKDVISWNCLINSYSQQGPAGYSLVMELFKSMRAENTF-PNAHTFAGVFTAASNL  123

Query  2727  GAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLL  2548
              +   G++      R     + FV + L+N Y K GLL  A+ VFD M E N+VTWA+++
Sbjct  124   SSVFCGQQAQALAIRTVSFYDVFVGSSLLNMYCKAGLLLEARKVFDEMPERNSVTWATMI  183

Query  2547  SCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVK  2368
             S +       E L IF    R    +NEF+   AL A A  + +  G  IHCL VK G+ 
Sbjct  184   SGYAIQRLAGEALGIFELMRREDEGLNEFVFTSALSALAIPDFIDSGKQIHCLAVKNGLL  243

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
                 V+  LV  Y KCG L  +   F M+S  +   W+A+I G  Q G   +A+ LF ++
Sbjct  244   AFVSVLNALVTMYAKCGGLDDSLQVFEMSSDKDSITWSAMITGYAQSGDSHKALKLFSRM  303

Query  2187  LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
               +G+ PSE T   VL A +D    + G Q+H++++KLGF    ++  ALVD Y+K    
Sbjct  304   HFAGINPSEFTLVGVLNACSDIGAVEEGKQVHNYLVKLGFEFQMYIMTALVDMYAKCGCT  363

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
              +++K F  + E DI+ W ++IAGY+++G  E A+ L  +M  +G+ PN  T + +L  C
Sbjct  364   ADAWKGFNYLQEPDIILWTSMIAGYVQNGENEDALSLYCKMQMQGVLPNELTMASVLKAC  423

Query  1827  GDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWN  1648
               L A++ G+Q+H R +K G    V +GS L  MYAKCG L +   VF  +P +++VSWN
Sbjct  424   SSLAALDQGRQIHARTIKYGLSLAVPIGSALSTMYAKCGSLEEGTLVFRRMPERDVVSWN  483

Query  1647  TMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNN  1468
              M+ G +Q+G+G+EALE++  M+  G KP+D+TFV VLSAC H GL+E G  +F  M + 
Sbjct  484   AMISGVSQNGYGREALELFEEMRREGTKPDDVTFVNVLSACSHMGLVERGWVYFKMMLDE  543

Query  1467  YGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKY  1288
             +GI P   H ACMV++ +R G   +A +FI S        +WR LL  C    ++ LG Y
Sbjct  544   FGIVPGVEHYACMVDVLSRAGNLSEAKEFIESAKVDHGLCLWRILLGACRNYHNYELGAY  603

Query  1287  AAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIY  1108
             A E+++ +   ++SA+V LS+IY  LN  ++  +IR MM+ + + KE GCSW EL++ ++
Sbjct  604   AGEKLMELGSQESSAYVLLSSIYTALNRPEDVERIRSMMRIRGVSKEPGCSWIELKSCVH  663

Query  1107  CFSSSYNM--LLGEVSMKKLLIGLTAQLLDAGYVPDT  1003
              F     M   +GE+  +  +  L+ Q+ D G  PD+
Sbjct  664   VFVVGDQMHPQIGEI--RAEIRRLSKQMKDKGCRPDS  698


 Score =   138 bits (347),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 148/287 (52%), Gaps = 6/287 (2%)
 Frame = -2

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             L P  R+  + +   T  K  Q G  LH  IIK   +S  ++ N+LV+FY+K   L ++ 
Sbjct  3     LPPQSRSLFNSILECTHQKSLQRGRALHGQIIKSASSSCIYLANSLVNFYAKCGNLPKAK  62

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGH--YEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
              +F+ + + D+++WN LI  Y + G   Y   ++L + M  E   PN HT++ + +   +
Sbjct  63    LVFERIRDKDVISWNCLINSYSQQGPAGYSLVMELFKSMRAENTFPNAHTFAGVFTAASN  122

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L ++  G+Q     ++     +V VGS+L++MY K G L +ARKVFD +P +N V+W TM
Sbjct  123   LSSVFCGQQAQALAIRTVSFYDVFVGSSLLNMYCKAGLLLEARKVFDEMPERNSVTWATM  182

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNY  1465
             + GYA      EAL I+ +M+      N+  F   LSA      ++ G   H  ++KN  
Sbjct  183   ISGYAIQRLAGEALGIFELMRREDEGLNEFVFTSALSALAIPDFIDSGKQIHCLAVKN--  240

Query  1464  GITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
             G+    + L  +V ++A+ G    +        +K D + W  +++G
Sbjct  241   GLLAFVSVLNALVTMYAKCGGLDDSLQVFEMSSDK-DSITWSAMITG  286



>ref|XP_010107584.1| hypothetical protein L484_024440 [Morus notabilis]
 gb|EXC16266.1| hypothetical protein L484_024440 [Morus notabilis]
Length=762

 Score =   461 bits (1185),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 237/684 (35%), Positives = 401/684 (59%), Gaps = 3/684 (0%)
 Frame = -2

Query  3069  SLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM  2890
             + + +I +C++ +S+  GK  H  ++      D+   NH+L+MY     ++ A K+FDEM
Sbjct  70    TYAHLISACSSLRSLEHGKKLHNHILTSKCDPDIVLRNHVLNMYGKCGSVKDALKVFDEM  129

Query  2889  PKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTG  2710
             P+RN+++WT++IS  S  G  + A+  +  M    G+ P+ +T+   + ACS +G    G
Sbjct  130   PQRNIVSWTSVISGCSQNGQDKDAVELYFRM-RRAGYVPDQFTFGSVIKACSGVGDPWLG  188

Query  2709  KEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQC  2530
             +++H  + +++   +    N L+  Y + G +  A  VF  +   + ++W S+++   Q 
Sbjct  189   RQLHAHVVKSKCGDHLIAQNALIAMYTRFGRIDDASNVFSRIATRDLISWGSMIAGSSQL  248

Query  2529  GEYDEGLRIFLRSLRAGVL-VNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
             G   E L  F   LR G    NEF+   A   C+S+    +G  IH + +K  +  D + 
Sbjct  249   GYELEALHHFKEMLRQGAYKPNEFVFASAFSTCSSLLQPEYGRQIHGMCLKFSLGRDIFA  308

Query  2352  VTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
                L + Y KCG L  A   FN   +P+L +W  +I G    G   EA++ F ++   G 
Sbjct  309   GCSLCDMYAKCGFLECAKTVFNHIESPDLVSWNVIISGFASIGDANEAISFFNEMRYMGF  368

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
              P++ T  S+L A         G+Q+HS+++K GFNS+  VCN L+  Y+K + L ++FK
Sbjct  369   IPNDVTVISLLSACRIPSTIFQGIQIHSYVVKHGFNSYVPVCNTLLTTYAKGSALSDAFK  428

Query  1992  IFQEM-TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
             +F+++ +  D V+WNA++   ++    E   +L + MLF  + P+  T S +++ C  + 
Sbjct  429   VFEDVKSRADPVSWNAILTASVQHNQAEDVFRLFRTMLFSHIRPDHITLSNLIAACAIIA  488

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             ++E G QVHC  MK G   NV V + LIDMY KCG L  ARK+F+++   ++VSW+++++
Sbjct  489   SLEVGNQVHCFSMKSGLVLNVSVTNGLIDMYTKCGSLETARKLFNLMENPDIVSWSSLIV  548

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             GYAQ G+GKEALE++ +M++ G +PN+ITFVGVL+ACGH GL++EG   + +M+  +GI+
Sbjct  549   GYAQSGYGKEALELFRIMKDFGTRPNEITFVGVLTACGHVGLVQEGWKIYRTMQMEHGIS  608

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             P   H ACMV+L AR G   +A DFI+  P +PD VVW+ LL+ C  +++  +GK AAE 
Sbjct  609   PTREHCACMVDLLARAGLLYEAEDFIKQMPFEPDIVVWKTLLAACKTHRNVDIGKRAAEN  668

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSS  1096
             ++ IDP++++AHV L +I+A    W++ A++R +MK++ ++K  G SW E + + + F +
Sbjct  669   LVKIDPSNSAAHVLLCSIHASSGNWEDVARLRSLMKERGVRKVPGQSWIETKGRAHIFFA  728

Query  1095  SYNMLLGEVSMKKLLIGLTAQLLD  1024
                +      + ++L  L  Q+LD
Sbjct  729   EDTLHPERERVYEVLNELWLQMLD  752


 Score =   231 bits (588),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 153/536 (29%), Positives = 256/536 (48%), Gaps = 7/536 (1%)
 Frame = -2

Query  2916  CAQKLFDEMPKRNVITWTT---LISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGAL  2746
             C +  F +    N+ T  +    I S S     ++AL +F  +     F  +  TY   +
Sbjct  16    CTKPSFQQRNFPNLTTEQSSNEYIKSLSVQKRHKEALEAFGFIEKTTDFRISPSTYAHLI  75

Query  2745  SACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTV  2566
             SACS L +   GK++H  I  ++   +  + N ++N YGKCG +K A  VFD M + N V
Sbjct  76    SACSSLRSLEHGKKLHNHILTSKCDPDIVLRNHVLNMYGKCGSVKDALKVFDEMPQRNIV  135

Query  2565  TWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLI  2386
             +W S++S   Q G+  + + ++ R  RAG + ++F  G  + AC+ V     G  +H  +
Sbjct  136   SWTSVISGCSQNGQDKDAVELYFRMRRAGYVPDQFTFGSVIKACSGVGDPWLGRQLHAHV  195

Query  2385  VKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAV  2206
             VK            L+  Y + G++  A N F+  +  +L +W ++I G  Q G   EA+
Sbjct  196   VKSKCGDHLIAQNALIAMYTRFGRIDDASNVFSRIATRDLISWGSMIAGSSQLGYELEAL  255

Query  2205  NLFCKLLSSG-LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDF  2029
             + F ++L  G  KP+E  +AS     +   + + G Q+H   +K       F   +L D 
Sbjct  256   HHFKEMLRQGAYKPNEFVFASAFSTCSSLLQPEYGRQIHGMCLKFSLGRDIFAGCSLCDM  315

Query  2028  YSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTY  1849
             Y+K   L+ +  +F  +   D+V+WN +I+G+   G   +AI    EM + G  PN  T 
Sbjct  316   YAKCGFLECAKTVFNHIESPDLVSWNVIISGFASIGDANEAISFFNEMRYMGFIPNDVTV  375

Query  1848  SCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVF-DILP  1672
               +LS C     I  G Q+H  ++K GF+S V V +TL+  YAK   L DA KVF D+  
Sbjct  376   ISLLSACRIPSTIFQGIQIHSYVVKHGFNSYVPVCNTLLTTYAKGSALSDAFKVFEDVKS  435

Query  1671  CKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN  1492
               + VSWN +L    QH   ++   ++  M  + ++P+ IT   +++AC       E  N
Sbjct  436   RADPVSWNAILTASVQHNQAEDVFRLFRTMLFSHIRPDHITLSNLIAACA-IIASLEVGN  494

Query  1491  HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
               +      G+    +    +++++ + G  + A     +  E PD V W  L+ G
Sbjct  495   QVHCFSMKSGLVLNVSVTNGLIDMYTKCGSLETARKLF-NLMENPDIVSWSSLIVG  549


 Score =   229 bits (583),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 138/501 (28%), Positives = 245/501 (49%), Gaps = 6/501 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +   +I++C+       G+  HA ++K      +   N L++MY  F  I+ A  +
Sbjct  167   PDQFTFGSVIKACSGVGDPWLGRQLHAHVVKSKCGDHLIAQNALIAMYTRFGRIDDASNV  226

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F  +  R++I+W ++I+  S +G   +AL  F+ M+ +  + PN + +  A S CS L  
Sbjct  227   FSRIATRDLISWGSMIAGSSQLGYELEALHHFKEMLRQGAYKPNEFVFASAFSTCSSLLQ  286

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G++IHG   +     + F    L + Y KCG L+ A+ VF+ +  P+ V+W  ++S 
Sbjct  287   PEYGRQIHGMCLKFSLGRDIFAGCSLCDMYAKCGFLECAKTVFNHIESPDLVSWNVIISG  346

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
                 G+ +E +  F      G + N+      L AC     +  G+ IH  +VK G    
Sbjct  347   FASIGDANEAISFFNEMRYMGFIPNDVTVISLLSACRIPSTIFQGIQIHSYVVKHGFNSY  406

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTF-NMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
               V   L+  Y K   L  A+  F ++ S  +  +W A++   VQ  +  +   LF  +L
Sbjct  407   VPVCNTLLTTYAKGSALSDAFKVFEDVKSRADPVSWNAILTASVQHNQAEDVFRLFRTML  466

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
              S ++P   T ++++ A       +VG Q+H F +K G      V N L+D Y+K   L+
Sbjct  467   FSHIRPDHITLSNLIAACAIIASLEVGNQVHCFSMKSGLVLNVSVTNGLIDMYTKCGSLE  526

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
              + K+F  M   DIV+W++LI GY +SG+ ++A++L + M   G  PN  T+  +L+ CG
Sbjct  527   TARKLFNLMENPDIVSWSSLIVGYAQSGYGKEALELFRIMKDFGTRPNEITFVGVLTACG  586

Query  1824  DLPAIEWGKQVHCRI-MKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-NLVSW  1651
              +  ++ G +++  + M+ G        + ++D+ A+ G L +A      +P + ++V W
Sbjct  587   HVGLVQEGWKIYRTMQMEHGISPTREHCACMVDLLARAGLLYEAEDFIKQMPFEPDIVVW  646

Query  1650  NTMLIGYAQH---GFGKEALE  1597
              T+L     H     GK A E
Sbjct  647   KTLLAACKTHRNVDIGKRAAE  667



>ref|XP_010249162.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial isoform X1 [Nelumbo nucifera]
 ref|XP_010249163.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial isoform X1 [Nelumbo nucifera]
Length=834

 Score =   462 bits (1189),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 243/687 (35%), Positives = 397/687 (58%), Gaps = 2/687 (0%)
 Frame = -2

Query  3063  SQIIRSCTTN-KSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMP  2887
             +++++ C  N ++   G   H  ++K G   D++  N LL+MYV    +  A++LFDE+ 
Sbjct  61    ARLLQDCDCNGEASRRGMGVHCDILKRGGCLDLFAWNILLNMYVKSDLLLEARRLFDELR  120

Query  2886  KRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGK  2707
             +RN +++ TLI  Y+      +A+  FR +  E G   N + +   L     +  A  G 
Sbjct  121   ERNTVSFVTLIHGYAQSHQFTEAMELFRRLHRE-GNELNPFVFTTILKLLVSMELAELGW  179

Query  2706  EIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCG  2527
             ++H  I +     N FV+  L++ Y  CGL+  A+ VFD ++E + ++W+ +++C+ +  
Sbjct  180   QVHASILKLGHDSNAFVATALIDAYSVCGLVHGAREVFDNIVEKDMISWSGMIACYAEND  239

Query  2526  EYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVT  2347
              ++E L +F +  + G+  N F    +L ACA +  L  G  +H   +K   ++D YV  
Sbjct  240   YFEEALEVFHQMRKVGLKPNNFTFASSLKACAGLASLDLGKSLHGCALKTRYELDPYVGV  299

Query  2346  GLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKP  2167
              L+  Y KCG +  A   F      ++  W+ +I    Q  +  EA+ LFC++  + + P
Sbjct  300   SLLELYTKCGDVDDAQMVFEEMPHKDVILWSFMIARYSQSNRSEEAMKLFCQMKQAFVVP  359

Query  2166  SERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
             ++ T+ASVL A    ++ ++G Q+H  + K+G +S  FV NAL+D Y+K   ++++ ++F
Sbjct  360   NQYTFASVLQACATMEDLELGKQIHGHVRKVGLDSDIFVKNALMDVYAKCGRMEDAMELF  419

Query  1986  QEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIE  1807
              +    + VTWN +I GY++ G+ E+A++L  EM  + ++    TYS +L  C +L A+E
Sbjct  420   GKSHLRNDVTWNTVIVGYVQLGYGEEALRLFSEMHNDQIQSTQVTYSSVLRACANLTALE  479

Query  1806  WGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYA  1627
              G Q+H  I++  FD ++VV + LIDMYAKCG + DAR VFD +  ++ VS+N+M+ GY+
Sbjct  480   PGVQIHSLIVRTFFDKDMVVDNALIDMYAKCGSIKDARLVFDTMHDRDEVSYNSMISGYS  539

Query  1626  QHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRT  1447
              HG   +AL I+  M+E  +KPN ITFVGVLSAC + GL+ +G ++FNSM   YGI P  
Sbjct  540   LHGLSDDALRIFERMREEDIKPNKITFVGVLSACSNTGLVYQGQSYFNSMVQEYGIEPCI  599

Query  1446  NHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILS  1267
              H  CMV L  R G+  +A  FI   P +P  +VWR LL    I+ D  LG+ +A+ +L 
Sbjct  600   EHYTCMVWLLGRAGRLNEAVKFIEEIPFEPSVMVWRALLGASVIHNDIELGRVSAQHVLD  659

Query  1266  IDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYN  1087
             ++P+D +AHV LSN+YA    WD  A IRK MK+K +KKE G SW E Q+ ++ F+    
Sbjct  660   MEPHDEAAHVLLSNMYATARRWDNVASIRKYMKRKGVKKEPGLSWIENQSGVHYFTVGDR  719

Query  1086  MLLGEVSMKKLLIGLTAQLLDAGYVPD  1006
                   ++  +L  L  ++ +AGYVP+
Sbjct  720   SHPDIRAINGMLEWLKMKIKNAGYVPN  746


 Score =   169 bits (428),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/419 (27%), Positives = 199/419 (47%), Gaps = 7/419 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + +  +++C    S+  GK+ H   +K   + D Y    LL +Y    +++ AQ +
Sbjct  258   PNNFTFASSLKACAGLASLDLGKSLHGCALKTRYELDPYVGVSLLELYTKCGDVDDAQMV  317

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGF-TPNHYTYVGALSACSCLG  2725
             F+EMP ++VI W+ +I+ YS    SE+A+  F  M  +  F  PN YT+   L AC+ + 
Sbjct  318   FEEMPHKDVILWSFMIARYSQSNRSEEAMKLFCQM--KQAFVVPNQYTFASVLQACATME  375

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
                 GK+IHG + +     + FV N L++ Y KCG ++ A  +F      N VTW +++ 
Sbjct  376   DLELGKQIHGHVRKVGLDSDIFVKNALMDVYAKCGRMEDAMELFGKSHLRNDVTWNTVIV  435

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
              + Q G  +E LR+F       +   +      L ACA++  L  G+ IH LIV+     
Sbjct  436   GYVQLGYGEEALRLFSEMHNDQIQSTQVTYSSVLRACANLTALEPGVQIHSLIVRTFFDK  495

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
             D  V   L++ Y KCG +  A   F+     +  ++ ++I G    G   +A+ +F ++ 
Sbjct  496   DMVVDNALIDMYAKCGSIKDARLVFDTMHDRDEVSYNSMISGYSLHGLSDDALRIFERMR  555

Query  2184  SSGLKPSERTYASVLGAFTDTK-EFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
                +KP++ T+  VL A ++T   +Q     +S + + G          +V    ++  L
Sbjct  556   EEDIKPNKITFVGVLSACSNTGLVYQGQSYFNSMVQEYGIEPCIEHYTCMVWLLGRAGRL  615

Query  2007  DESFKIFQEMT-EYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILS  1834
             +E+ K  +E+  E  ++ W AL+   +     E      Q +L   +EP+      +LS
Sbjct  616   NEAVKFIEEIPFEPSVMVWRALLGASVIHNDIELGRVSAQHVL--DMEPHDEAAHVLLS  672



>ref|XP_010653538.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial [Vitis vinifera]
 ref|XP_010653539.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial [Vitis vinifera]
Length=755

 Score =   459 bits (1181),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 255/688 (37%), Positives = 393/688 (57%), Gaps = 3/688 (0%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             +I +C+  +S+  GK  H  ++K  S  D+   NH+L+MY     ++ AQK+FD MP+RN
Sbjct  69    LISACSYLRSLEHGKKIHDHMLKSKSHPDLTLQNHILNMYGKCKSLKDAQKVFDAMPERN  128

Query  2877  VITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
             V++WT++I+ YS  G    AL  F   +L+ G  P+ +T+   + ACS LG    G+++H
Sbjct  129   VVSWTSVIAGYSQNGQGGNAL-EFYFQMLQSGVMPDQFTFGSIIKACSSLGDIGLGRQLH  187

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
               + ++E   +    N L++ Y K  L+  A  VF  M   + ++W S+++   Q G   
Sbjct  188   AHVLKSEFGAHIIAQNALISMYTKSNLIIDALDVFSRMATRDLISWGSMIAGFSQLGYEL  247

Query  2517  EGLRIFLRSLRAGV-LVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGL  2341
             E L  F   L  GV L NEF+ G    AC+S+    +G  +H + +K G+  D +    L
Sbjct  248   EALCYFKEMLHQGVYLPNEFIFGSVFSACSSLLQPEYGRQLHGMSIKFGLGRDVFAGCSL  307

Query  2340  VNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSE  2161
              + Y KCG L  A   F     P+L AW A+I G    G  +EA+  F ++   GL P E
Sbjct  308   CDMYAKCGLLSCARVVFYQIGRPDLVAWNAIIAGFAYGGDAKEAIAFFSQMRHQGLIPDE  367

Query  2160  RTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQE  1981
              T  S+L A T   E   GMQ+H +I K+G +    VCN L+  Y+K + L ++   F+E
Sbjct  368   ITVRSLLCACTSPSELYQGMQVHGYINKMGLDLDVPVCNTLLTMYAKCSELRDAIFFFEE  427

Query  1980  MT-EYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEW  1804
             M    D+V+WNA++   +R    E+  +LL+ M      P+  T + +L    +  +IE 
Sbjct  428   MRCNADLVSWNAILTACMRHDQAEEVFRLLKLMCISQHRPDYITLTNVLGASAETVSIEI  487

Query  1803  GKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQ  1624
             G QVHC  +K G + +  V + LID+YAKCG L  A K+FD +   ++VSW+++++GYAQ
Sbjct  488   GNQVHCYALKTGLNCDTSVTNGLIDLYAKCGSLKTAHKIFDSMINPDVVSWSSLILGYAQ  547

Query  1623  HGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTN  1444
              G+G+EAL+++  M+   VKPN +TFVGVL+AC H GL+EEG   + +M+  +GI P   
Sbjct  548   FGYGEEALKLFKTMRRLDVKPNHVTFVGVLTACSHVGLVEEGWKLYGTMEKEFGIAPTRE  607

Query  1443  HLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSI  1264
             H +CMV+L AR G   +A  FI      PD VVW+ LL+ C  + +  +GK AAE IL I
Sbjct  608   HCSCMVDLLARAGCLNEAEGFIHQMAFDPDIVVWKTLLAACKTHGNVDVGKRAAENILKI  667

Query  1263  DPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNM  1084
             DP++++AHV L NIYA    W++ A++R +MKQ+ ++K  G SW E++++I+ F    ++
Sbjct  668   DPSNSAAHVLLCNIYASKGNWEDVARLRSLMKQRGVRKVPGQSWIEVKDRIHVFFVEDSL  727

Query  1083  LLGEVSMKKLLIGLTAQLLDAGYVPDTK  1000
                   +  +L  L  Q+LDAGYVP  K
Sbjct  728   HPERNKIYTMLEELLLQMLDAGYVPFQK  755


 Score =   243 bits (620),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 160/513 (31%), Positives = 257/513 (50%), Gaps = 4/513 (1%)
 Frame = -2

Query  2856  ISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAE  2677
             I+S     L  +A+ +F  +  + GF     TY   +SACS L +   GK+IH  + +++
Sbjct  34    ITSLCKQKLFNEAIKAFEFLQKKTGFCLTLSTYAYLISACSYLRSLEHGKKIHDHMLKSK  93

Query  2676  ETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFL  2497
                +  + N ++N YGKC  LK AQ VFDAM E N V+W S+++ + Q G+    L  + 
Sbjct  94    SHPDLTLQNHILNMYGKCKSLKDAQKVFDAMPERNVVSWTSVIAGYSQNGQGGNALEFYF  153

Query  2496  RSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCG  2317
             + L++GV+ ++F  G  + AC+S+  +G G  +H  ++K            L++ Y K  
Sbjct  154   QMLQSGVMPDQFTFGSIIKACSSLGDIGLGRQLHAHVLKSEFGAHIIAQNALISMYTKSN  213

Query  2316  QLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLK-PSERTYASVL  2140
              +  A + F+  +  +L +W ++I G  Q G   EA+  F ++L  G+  P+E  + SV 
Sbjct  214   LIIDALDVFSRMATRDLISWGSMIAGFSQLGYELEALCYFKEMLHQGVYLPNEFIFGSVF  273

Query  2139  GAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIV  1960
              A +   + + G QLH   IK G     F   +L D Y+K  LL  +  +F ++   D+V
Sbjct  274   SACSSLLQPEYGRQLHGMSIKFGLGRDVFAGCSLCDMYAKCGLLSCARVVFYQIGRPDLV  333

Query  1959  TWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRI  1780
              WNA+IAG+   G  ++AI    +M  +GL P+  T   +L  C     +  G QVH  I
Sbjct  334   AWNAIIAGFAYGGDAKEAIAFFSQMRHQGLIPDEITVRSLLCACTSPSELYQGMQVHGYI  393

Query  1779  MKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-NLVSWNTMLIGYAQHGFGKEA  1603
              K G D +V V +TL+ MYAKC  L DA   F+ + C  +LVSWN +L    +H   +E 
Sbjct  394   NKMGLDLDVPVCNTLLTMYAKCSELRDAIFFFEEMRCNADLVSWNAILTACMRHDQAEEV  453

Query  1602  LEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVN  1423
               +  +M  +  +P+ IT   VL A     +  E  N  +      G+   T+    +++
Sbjct  454   FRLLKLMCISQHRPDYITLTNVLGASAE-TVSIEIGNQVHCYALKTGLNCDTSVTNGLID  512

Query  1422  LFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
             L+A+ G  K A+    S    PD V W  L+ G
Sbjct  513   LYAKCGSLKTAHKIFDSMI-NPDVVSWSSLILG  544


 Score =   236 bits (603),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 151/512 (29%), Positives = 255/512 (50%), Gaps = 14/512 (3%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L +   P + +   II++C++   I  G+  HA ++K    + +   N L+SMY   + 
Sbjct  155   MLQSGVMPDQFTFGSIIKACSSLGDIGLGRQLHAHVLKSEFGAHIIAQNALISMYTKSNL  214

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
             I  A  +F  M  R++I+W ++I+ +S +G   +AL  F+ M+ +  + PN + +    S
Sbjct  215   IIDALDVFSRMATRDLISWGSMIAGFSQLGYELEALCYFKEMLHQGVYLPNEFIFGSVFS  274

Query  2742  ACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVT  2563
             ACS L     G+++HG   +     + F    L + Y KCGLL  A++VF  +  P+ V 
Sbjct  275   ACSSLLQPEYGRQLHGMSIKFGLGRDVFAGCSLCDMYAKCGLLSCARVVFYQIGRPDLVA  334

Query  2562  WASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIV  2383
             W ++++     G+  E +  F +    G++ +E      L AC S   L  GM +H  I 
Sbjct  335   WNAIIAGFAYGGDAKEAIAFFSQMRHQGLIPDEITVRSLLCACTSPSELYQGMQVHGYIN  394

Query  2382  KCGVKMDQYVVTGLVNFYVKCGQLGLAYNTF-NMASAPELHAWTALIGGCVQQGKGREAV  2206
             K G+ +D  V   L+  Y KC +L  A   F  M    +L +W A++  C++  +  E  
Sbjct  395   KMGLDLDVPVCNTLLTMYAKCSELRDAIFFFEEMRCNADLVSWNAILTACMRHDQAEEVF  454

Query  2205  NLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFY  2026
              L   +  S  +P   T  +VLGA  +T   ++G Q+H + +K G N  T V N L+D Y
Sbjct  455   RLLKLMCISQHRPDYITLTNVLGASAETVSIEIGNQVHCYALKTGLNCDTSVTNGLIDLY  514

Query  2025  SKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYS  1846
             +K   L  + KIF  M   D+V+W++LI GY + G+ E+A+KL + M    ++PN  T+ 
Sbjct  515   AKCGSLKTAHKIFDSMINPDVVSWSSLILGYAQFGYGEEALKLFKTMRRLDVKPNHVTFV  574

Query  1845  CILSICGDLPAIEWGKQVHCRIMKP-GFDSNVVVGSTLIDMYAKCGRLGDA-----RKVF  1684
              +L+ C  +  +E G +++  + K  G        S ++D+ A+ G L +A     +  F
Sbjct  575   GVLTACSHVGLVEEGWKLYGTMEKEFGIAPTREHCSCMVDLLARAGCLNEAEGFIHQMAF  634

Query  1683  DILPCKNLVSWNTMLIGYAQHG---FGKEALE  1597
             D     ++V W T+L     HG    GK A E
Sbjct  635   D----PDIVVWKTLLAACKTHGNVDVGKRAAE  662



>ref|XP_002284799.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Vitis vinifera]
 emb|CBI18896.3| unnamed protein product [Vitis vinifera]
Length=703

 Score =   457 bits (1177),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 258/697 (37%), Positives = 391/697 (56%), Gaps = 8/697 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   S    +   T N+S+  GKA HAQ+IK  S S VY  N L+++Y     +  A+ +
Sbjct  4     PSNRSFFTALLQYTHNRSLQKGKALHAQIIK-SSSSCVYIANSLVNLYAKCQRLREAKFV  62

Query  2901  FDEMPKRNVITWTTLISSYSHMGLS--EKALGSFRSMVLEDGFTPNHYTYVGALSACSCL  2728
             F+ +  ++V++W  +I+ YS  G S     +  F+ M  E+   PN +T+ G  +A S L
Sbjct  63    FERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENT-APNAHTFAGVFTAASTL  121

Query  2727  GAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLL  2548
               A  G+  H    + +   + FV + L+N Y K GL   A+ VFD M E N+V+WA+++
Sbjct  122   VDAAGGRLAHAVAIKMDSCRDVFVGSSLMNMYCKAGLTPEARKVFDTMPERNSVSWATMI  181

Query  2547  SCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVK  2368
             S +       E L +F    R     NEF+    L A    E +  G  IHC+ VK G+ 
Sbjct  182   SGYASQKLAAEALGLFRLMRREEEGENEFVFTSVLSALTLPELVNNGKQIHCIAVKNGLL  241

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
                 V   LV  Y KCG L  A  TF  +S      W+A+I G  Q G   +A+ LF  +
Sbjct  242   SIVSVGNALVTMYAKCGSLDDALQTFETSSDKNSITWSAMITGYAQSGDSDKALKLFSSM  301

Query  2187  LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
               SG++PSE T+  V+ A +D      G Q+H +++KLGF S  +V  ALVD Y+K + +
Sbjct  302   HLSGIRPSEFTFVGVINACSDLGAAWEGKQVHDYLLKLGFESQIYVMTALVDMYAKCSSI  361

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
              ++ K F  + E DIV W ++I GY+++G  E A+ L   M  EG+ PN  T + +L  C
Sbjct  362   VDARKGFDYLQEPDIVLWTSMIGGYVQNGENEDALSLYGRMEMEGILPNELTMASVLKAC  421

Query  1827  GDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWN  1648
               L A+E GKQ+H R +K GF   V +GS L  MYAKCG L D   VF  +P ++++SWN
Sbjct  422   SSLAALEQGKQIHARTVKYGFGLEVPIGSALSTMYAKCGCLKDGTLVFRRMPARDVISWN  481

Query  1647  TMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNN  1468
              M+ G +Q+G GKEALE++  MQ  G KP+ +TFV +LSAC H GL+E G  +F  M + 
Sbjct  482   AMISGLSQNGCGKEALELFEEMQLEGTKPDYVTFVNILSACSHMGLVERGWGYFRMMFDE  541

Query  1467  YGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKY  1288
             +G+ PR  H ACMV++ +R G+ K+A +F  S        +WR +L  C   +++ LG Y
Sbjct  542   FGMDPRVEHYACMVDILSRAGKLKEAIEFTESATIDHGMCLWRIILGACRNYRNYELGAY  601

Query  1287  AAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIY  1108
             A E+++ +   ++SA+V LS+IY+ L  W++  ++R+MMK + + KE GCSW EL++ ++
Sbjct  602   AGEKLMELGSQESSAYVLLSSIYSALGRWEDVERVRRMMKLRGVSKEPGCSWIELKSGVH  661

Query  1107  CFSSSYNM--LLGEVSMKKLLIGLTAQLLDAGYVPDT  1003
              F     M   +G++ ++  L  L+ Q+ D GY P T
Sbjct  662   VFVVKDQMHPQIGDIHVE--LRQLSKQMKDEGYEPAT  696


 Score =   179 bits (454),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 115/393 (29%), Positives = 193/393 (49%), Gaps = 3/393 (1%)
 Frame = -2

Query  3084  GPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQK  2905
             G  +   + ++ + T  + + +GK  H   +K G  S V   N L++MY     ++ A +
Sbjct  206   GENEFVFTSVLSALTLPELVNNGKQIHCIAVKNGLLSIVSVGNALVTMYAKCGSLDDALQ  265

Query  2904  LFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
              F+    +N ITW+ +I+ Y+  G S+KAL  F SM L  G  P+ +T+VG ++ACS LG
Sbjct  266   TFETSSDKNSITWSAMITGYAQSGDSDKALKLFSSMHL-SGIRPSEFTFVGVINACSDLG  324

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
             AA  GK++H  + +       +V   LV+ Y KC  +  A+  FD + EP+ V W S++ 
Sbjct  325   AAWEGKQVHDYLLKLGFESQIYVMTALVDMYAKCSSIVDARKGFDYLQEPDIVLWTSMIG  384

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
              + Q GE ++ L ++ R    G+L NE      L AC+S+  L  G  IH   VK G  +
Sbjct  385   GYVQNGENEDALSLYGRMEMEGILPNELTMASVLKACSSLAALEQGKQIHARTVKYGFGL  444

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
             +  + + L   Y KCG L      F    A ++ +W A+I G  Q G G+EA+ LF ++ 
Sbjct  445   EVPIGSALSTMYAKCGCLKDGTLVFRRMPARDVISWNAMISGLSQNGCGKEALELFEEMQ  504

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFII-KLGFNSFTFVCNALVDFYSKSNLL  2008
               G KP   T+ ++L A +     + G      +  + G +        +VD  S++  L
Sbjct  505   LEGTKPDYVTFVNILSACSHMGLVERGWGYFRMMFDEFGMDPRVEHYACMVDILSRAGKL  564

Query  2007  DESFKIFQEMT-EYDIVTWNALIAGYIRSGHYE  1912
              E+ +  +  T ++ +  W  ++       +YE
Sbjct  565   KEAIEFTESATIDHGMCLWRIILGACRNYRNYE  597


 Score =   110 bits (275),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 99/203 (49%), Gaps = 1/203 (0%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF  2929
             SS+  +   P + +   +I +C+   +   GK  H  L+K G +S +Y    L+ MY   
Sbjct  299   SSMHLSGIRPSEFTFVGVINACSDLGAAWEGKQVHDYLLKLGFESQIYVMTALVDMYAKC  358

Query  2928  HEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGA  2749
               I  A+K FD + + +++ WT++I  Y   G +E AL  +  M +E G  PN  T    
Sbjct  359   SSIVDARKGFDYLQEPDIVLWTSMIGGYVQNGENEDALSLYGRMEME-GILPNELTMASV  417

Query  2748  LSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNT  2569
             L ACS L A   GK+IH R  +    L   + + L   Y KCG LK   LVF  M   + 
Sbjct  418   LKACSSLAALEQGKQIHARTVKYGFGLEVPIGSALSTMYAKCGCLKDGTLVFRRMPARDV  477

Query  2568  VTWASLLSCHCQCGEYDEGLRIF  2500
             ++W +++S   Q G   E L +F
Sbjct  478   ISWNAMISGLSQNGCGKEALELF  500



>ref|XP_010249165.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial isoform X3 [Nelumbo nucifera]
 ref|XP_010249166.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial isoform X3 [Nelumbo nucifera]
Length=757

 Score =   459 bits (1181),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 240/667 (36%), Positives = 387/667 (58%), Gaps = 1/667 (0%)
 Frame = -2

Query  3006  HAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLS  2827
             H  ++K G   D++  N LL+MYV    +  A++LFDE+ +RN +++ TLI  Y+     
Sbjct  4     HCDILKRGGCLDLFAWNILLNMYVKSDLLLEARRLFDELRERNTVSFVTLIHGYAQSHQF  63

Query  2826  EKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNC  2647
              +A+  FR +  E G   N + +   L     +  A  G ++H  I +     N FV+  
Sbjct  64    TEAMELFRRLHRE-GNELNPFVFTTILKLLVSMELAELGWQVHASILKLGHDSNAFVATA  122

Query  2646  LVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVN  2467
             L++ Y  CGL+  A+ VFD ++E + ++W+ +++C+ +   ++E L +F +  + G+  N
Sbjct  123   LIDAYSVCGLVHGAREVFDNIVEKDMISWSGMIACYAENDYFEEALEVFHQMRKVGLKPN  182

Query  2466  EFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFN  2287
              F    +L ACA +  L  G  +H   +K   ++D YV   L+  Y KCG +  A   F 
Sbjct  183   NFTFASSLKACAGLASLDLGKSLHGCALKTRYELDPYVGVSLLELYTKCGDVDDAQMVFE  242

Query  2286  MASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQV  2107
                  ++  W+ +I    Q  +  EA+ LFC++  + + P++ T+ASVL A    ++ ++
Sbjct  243   EMPHKDVILWSFMIARYSQSNRSEEAMKLFCQMKQAFVVPNQYTFASVLQACATMEDLEL  302

Query  2106  GMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIR  1927
             G Q+H  + K+G +S  FV NAL+D Y+K   ++++ ++F +    + VTWN +I GY++
Sbjct  303   GKQIHGHVRKVGLDSDIFVKNALMDVYAKCGRMEDAMELFGKSHLRNDVTWNTVIVGYVQ  362

Query  1926  SGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVV  1747
              G+ E+A++L  EM  + ++    TYS +L  C +L A+E G Q+H  I++  FD ++VV
Sbjct  363   LGYGEEALRLFSEMHNDQIQSTQVTYSSVLRACANLTALEPGVQIHSLIVRTFFDKDMVV  422

Query  1746  GSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGV  1567
              + LIDMYAKCG + DAR VFD +  ++ VS+N+M+ GY+ HG   +AL I+  M+E  +
Sbjct  423   DNALIDMYAKCGSIKDARLVFDTMHDRDEVSYNSMISGYSLHGLSDDALRIFERMREEDI  482

Query  1566  KPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAY  1387
             KPN ITFVGVLSAC + GL+ +G ++FNSM   YGI P   H  CMV L  R G+  +A 
Sbjct  483   KPNKITFVGVLSACSNTGLVYQGQSYFNSMVQEYGIEPCIEHYTCMVWLLGRAGRLNEAV  542

Query  1386  DFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLN  1207
              FI   P +P  +VWR LL    I+ D  LG+ +A+ +L ++P+D +AHV LSN+YA   
Sbjct  543   KFIEEIPFEPSVMVWRALLGASVIHNDIELGRVSAQHVLDMEPHDEAAHVLLSNMYATAR  602

Query  1206  MWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGEVSMKKLLIGLTAQLL  1027
              WD  A IRK MK+K +KKE G SW E Q+ ++ F+          ++  +L  L  ++ 
Sbjct  603   RWDNVASIRKYMKRKGVKKEPGLSWIENQSGVHYFTVGDRSHPDIRAINGMLEWLKMKIK  662

Query  1026  DAGYVPD  1006
             +AGYVP+
Sbjct  663   NAGYVPN  669


 Score =   239 bits (611),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 126/395 (32%), Positives = 218/395 (55%), Gaps = 0/395 (0%)
 Frame = -2

Query  2703  IHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGE  2524
             +H  I +    L+ F  N L+N Y K  LL  A+ +FD + E NTV++ +L+  + Q  +
Sbjct  3     VHCDILKRGGCLDLFAWNILLNMYVKSDLLLEARRLFDELRERNTVSFVTLIHGYAQSHQ  62

Query  2523  YDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTG  2344
             + E + +F R  R G  +N F+    L    S+E    G  +H  I+K G   + +V T 
Sbjct  63    FTEAMELFRRLHREGNELNPFVFTTILKLLVSMELAELGWQVHASILKLGHDSNAFVATA  122

Query  2343  LVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPS  2164
             L++ Y  CG +  A   F+     ++ +W+ +I    +     EA+ +F ++   GLKP+
Sbjct  123   LIDAYSVCGLVHGAREVFDNIVEKDMISWSGMIACYAENDYFEEALEVFHQMRKVGLKPN  182

Query  2163  ERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQ  1984
               T+AS L A        +G  LH   +K  +    +V  +L++ Y+K   +D++  +F+
Sbjct  183   NFTFASSLKACAGLASLDLGKSLHGCALKTRYELDPYVGVSLLELYTKCGDVDDAQMVFE  242

Query  1983  EMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEW  1804
             EM   D++ W+ +IA Y +S   E+A+KL  +M    + PN +T++ +L  C  +  +E 
Sbjct  243   EMPHKDVILWSFMIARYSQSNRSEEAMKLFCQMKQAFVVPNQYTFASVLQACATMEDLEL  302

Query  1803  GKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQ  1624
             GKQ+H  + K G DS++ V + L+D+YAKCGR+ DA ++F     +N V+WNT+++GY Q
Sbjct  303   GKQIHGHVRKVGLDSDIFVKNALMDVYAKCGRMEDAMELFGKSHLRNDVTWNTVIVGYVQ  362

Query  1623  HGFGKEALEIYSMMQENGVKPNDITFVGVLSACGH  1519
              G+G+EAL ++S M  + ++   +T+  VL AC +
Sbjct  363   LGYGEEALRLFSEMHNDQIQSTQVTYSSVLRACAN  397


 Score =   235 bits (600),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 142/544 (26%), Positives = 272/544 (50%), Gaps = 24/544 (4%)
 Frame = -2

Query  3018  GKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSH  2839
             G   HA ++K G  S+ +    L+  Y     +  A+++FD + ++++I+W+ +I+ Y+ 
Sbjct  101   GWQVHASILKLGHDSNAFVATALIDAYSVCGLVHGAREVFDNIVEKDMISWSGMIACYAE  160

Query  2838  MGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNF  2659
                 E+AL  F  M  + G  PN++T+  +L AC+ L +   GK +HG   +    L+ +
Sbjct  161   NDYFEEALEVFHQM-RKVGLKPNNFTFASSLKACAGLASLDLGKSLHGCALKTRYELDPY  219

Query  2658  VSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAG  2479
             V   L+  Y KCG +  AQ+VF+ M   + + W+ +++ + Q    +E +++F +  +A 
Sbjct  220   VGVSLLELYTKCGDVDDAQMVFEEMPHKDVILWSFMIARYSQSNRSEEAMKLFCQMKQAF  279

Query  2478  VLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAY  2299
             V+ N++     L ACA++E L  G  IH  + K G+  D +V   L++ Y KCG++  A 
Sbjct  280   VVPNQYTFASVLQACATMEDLELGKQIHGHVRKVGLDSDIFVKNALMDVYAKCGRMEDAM  339

Query  2298  NTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTK  2119
               F  +       W  +I G VQ G G EA+ LF ++ +  ++ ++ TY+SVL A  +  
Sbjct  340   ELFGKSHLRNDVTWNTVIVGYVQLGYGEEALRLFSEMHNDQIQSTQVTYSSVLRACANLT  399

Query  2118  EFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIA  1939
               + G+Q+HS I++  F+    V NAL+D Y+K   + ++  +F  M + D V++N++I+
Sbjct  400   ALEPGVQIHSLIVRTFFDKDMVVDNALIDMYAKCGSIKDARLVFDTMHDRDEVSYNSMIS  459

Query  1938  GYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQ-VHCRIMKPGFD  1762
             GY   G  + A+++ + M  E ++PN  T+  +LS C +   +  G+   +  + + G +
Sbjct  460   GYSLHGLSDDALRIFERMREEDIKPNKITFVGVLSACSNTGLVYQGQSYFNSMVQEYGIE  519

Query  1761  SNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-NLVSWNTMLIGYAQHGFGKEALEIYSM  1585
               +   + ++ +  + GRL +A K  + +P + +++ W  +L     H            
Sbjct  520   PCIEHYTCMVWLLGRAGRLNEAVKFIEEIPFEPSVMVWRALLGASVIH------------  567

Query  1584  MQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKG  1405
                N ++   ++   VL    H             + N Y    R +++A +     RKG
Sbjct  568   ---NDIELGRVSAQHVLDMEPHDEAAHVL------LSNMYATARRWDNVASIRKYMKRKG  618

Query  1404  QTKK  1393
               K+
Sbjct  619   VKKE  622


 Score =   179 bits (454),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 168/295 (57%), Gaps = 0/295 (0%)
 Frame = -2

Query  2406  MGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQ  2227
             MG+HC I+K G  +D +    L+N YVK   L  A   F+        ++  LI G  Q 
Sbjct  1     MGVHCDILKRGGCLDLFAWNILLNMYVKSDLLLEARRLFDELRERNTVSFVTLIHGYAQS  60

Query  2226  GKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVC  2047
              +  EA+ LF +L   G + +   + ++L      +  ++G Q+H+ I+KLG +S  FV 
Sbjct  61    HQFTEAMELFRRLHREGNELNPFVFTTILKLLVSMELAELGWQVHASILKLGHDSNAFVA  120

Query  2046  NALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLE  1867
              AL+D YS   L+  + ++F  + E D+++W+ +IA Y  + ++E+A+++  +M   GL+
Sbjct  121   TALIDAYSVCGLVHGAREVFDNIVEKDMISWSGMIACYAENDYFEEALEVFHQMRKVGLK  180

Query  1866  PNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKV  1687
             PN  T++  L  C  L +++ GK +H   +K  ++ +  VG +L+++Y KCG + DA+ V
Sbjct  181   PNNFTFASSLKACAGLASLDLGKSLHGCALKTRYELDPYVGVSLLELYTKCGDVDDAQMV  240

Query  1686  FDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACG  1522
             F+ +P K+++ W+ M+  Y+Q    +EA++++  M++  V PN  TF  VL AC 
Sbjct  241   FEEMPHKDVILWSFMIARYSQSNRSEEAMKLFCQMKQAFVVPNQYTFASVLQACA  295


 Score =   169 bits (428),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 113/419 (27%), Positives = 199/419 (47%), Gaps = 7/419 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + +  +++C    S+  GK+ H   +K   + D Y    LL +Y    +++ AQ +
Sbjct  181   PNNFTFASSLKACAGLASLDLGKSLHGCALKTRYELDPYVGVSLLELYTKCGDVDDAQMV  240

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGF-TPNHYTYVGALSACSCLG  2725
             F+EMP ++VI W+ +I+ YS    SE+A+  F  M  +  F  PN YT+   L AC+ + 
Sbjct  241   FEEMPHKDVILWSFMIARYSQSNRSEEAMKLFCQM--KQAFVVPNQYTFASVLQACATME  298

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
                 GK+IHG + +     + FV N L++ Y KCG ++ A  +F      N VTW +++ 
Sbjct  299   DLELGKQIHGHVRKVGLDSDIFVKNALMDVYAKCGRMEDAMELFGKSHLRNDVTWNTVIV  358

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
              + Q G  +E LR+F       +   +      L ACA++  L  G+ IH LIV+     
Sbjct  359   GYVQLGYGEEALRLFSEMHNDQIQSTQVTYSSVLRACANLTALEPGVQIHSLIVRTFFDK  418

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
             D  V   L++ Y KCG +  A   F+     +  ++ ++I G    G   +A+ +F ++ 
Sbjct  419   DMVVDNALIDMYAKCGSIKDARLVFDTMHDRDEVSYNSMISGYSLHGLSDDALRIFERMR  478

Query  2184  SSGLKPSERTYASVLGAFTDTK-EFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
                +KP++ T+  VL A ++T   +Q     +S + + G          +V    ++  L
Sbjct  479   EEDIKPNKITFVGVLSACSNTGLVYQGQSYFNSMVQEYGIEPCIEHYTCMVWLLGRAGRL  538

Query  2007  DESFKIFQEMT-EYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILS  1834
             +E+ K  +E+  E  ++ W AL+   +     E      Q +L   +EP+      +LS
Sbjct  539   NEAVKFIEEIPFEPSVMVWRALLGASVIHNDIELGRVSAQHVL--DMEPHDEAAHVLLS  595



>gb|EYU32070.1| hypothetical protein MIMGU_mgv1a017635mg, partial [Erythranthe 
guttata]
Length=728

 Score =   458 bits (1178),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 233/645 (36%), Positives = 374/645 (58%), Gaps = 8/645 (1%)
 Frame = -2

Query  2913  AQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACS  2734
             A++LF++ PKR  ITW++L+S Y  +G   ++   F  M  E G+ P+ +T    L  CS
Sbjct  5     ARQLFEKTPKRTAITWSSLVSGYCKIGCEVESFQLFYEMQYE-GYRPSQFTLGSVLRLCS  63

Query  2733  CLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLE-PNTVTWA  2557
               G     ++IHG   +     + FV   L++ Y KC  +  A+ +FD + +  N VTW 
Sbjct  64    IKGLLSRAEQIHGFAVKTHFDTDVFVVTGLIDVYAKCSRIIEAESLFDKISDGKNHVTWT  123

Query  2556  SLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKC  2377
             ++++ +   G++   ++ F      G   N++     L AC ++  LGFG  +H  IV  
Sbjct  124   AMINGYSLNGDFVRAIQCFKGMRENGSEANQYTFPGVLSACTALSNLGFGAQVHGCIVNG  183

Query  2376  GVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLF  2197
             G   + +V + LV+ Y KCG L  A+         ++ +W A+I GCV+QG   +A++LF
Sbjct  184   GFSANVFVQSSLVDMYTKCGDLSSAWRVIESMEVNDVISWNAMIVGCVRQGFSDKALSLF  243

Query  2196  CKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKS  2017
              ++ S  +K  E TY SVL A     + + G  LHS +IK GF S+T V NAL+D Y+K 
Sbjct  244   REMHSKDMKLDEFTYPSVLNALASKNDAKNGYSLHSLVIKSGFGSYTLVSNALIDMYAKQ  303

Query  2016  NLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCIL  1837
             N LD ++K+F  + E D+++W +LI GY  +G +E+A+KL  EM   G  P+    S +L
Sbjct  304   NNLDSAYKLFDFLVEKDLISWTSLITGYAHNGSHEEALKLFCEMRVNGTHPDQVVASSVL  363

Query  1836  SICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLV  1657
             S C +L  ++ G+Q+H   +K G DS++ V ++L+ +YA CG L  A +VF+ +  +N++
Sbjct  364   SSCAELACLDLGQQIHGIAIKSGHDSSLSVDNSLLSLYAHCGYLEYADRVFNFMKVRNVI  423

Query  1656  SWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSM  1477
             SW  ++IGYAQ+G G  +L++Y  M  +GVKP+ +TF+G+L AC H GL E+G + F SM
Sbjct  424   SWTALIIGYAQNGKGVNSLQLYDQMIASGVKPDYVTFIGLLFACSHAGLTEQGQSFFESM  483

Query  1476  KNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVL  1297
               NYGITP  +H ACMV+L  R G+ ++A D +   P  PD  VW+ LL+ C ++ +  L
Sbjct  484   STNYGITPGPDHYACMVDLLGRSGKFQEAEDLLGKMPVVPDATVWKSLLAACRLHGNVEL  543

Query  1296  GKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQN  1117
              K A+  ++ +DP D+ ++V LSN Y+ +  W EAA +R+ MK K ++KE GCSW E+  
Sbjct  544   AKRASTALIELDPQDSVSYVMLSNTYSAVGKWKEAAHVRRKMKSKGVRKEPGCSWMEVNG  603

Query  1116  KIYCFSSSYNMLLGEVSMKKLLIG---LTAQLLDAGYVPDTKLSF  991
             +++ F S      G  S  ++ +    +  ++ + GYVPD   + 
Sbjct  604   RVHVFMSEDR---GHPSTNEIFLKIEEIITRIKEVGYVPDVSFAL  645


 Score =   214 bits (544),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 137/495 (28%), Positives = 239/495 (48%), Gaps = 12/495 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +L  ++R C+    +   +  H   +K    +DV+    L+ +Y     I  A+ L
Sbjct  50    PSQFTLGSVLRLCSIKGLLSRAEQIHGFAVKTHFDTDVFVVTGLIDVYAKCSRIIEAESL  109

Query  2901  FDEMPK-RNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             FD++   +N +TWT +I+ YS  G   +A+  F+ M  E+G   N YT+ G LSAC+ L 
Sbjct  110   FDKISDGKNHVTWTAMINGYSLNGDFVRAIQCFKGM-RENGSEANQYTFPGVLSACTALS  168

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
                 G ++HG I     + N FV + LV+ Y KCG L SA  V ++M   + ++W +++ 
Sbjct  169   NLGFGAQVHGCIVNGGFSANVFVQSSLVDMYTKCGDLSSAWRVIESMEVNDVISWNAMIV  228

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
                + G  D+ L +F       + ++EF     L A AS      G  +H L++K G   
Sbjct  229   GCVRQGFSDKALSLFREMHSKDMKLDEFTYPSVLNALASKNDAKNGYSLHSLVIKSGFGS  288

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
                V   L++ Y K   L  AY  F+     +L +WT+LI G    G   EA+ LFC++ 
Sbjct  289   YTLVSNALIDMYAKQNNLDSAYKLFDFLVEKDLISWTSLITGYAHNGSHEEALKLFCEMR  348

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
              +G  P +   +SVL +  +     +G Q+H   IK G +S   V N+L+  Y+    L+
Sbjct  349   VNGTHPDQVVASSVLSSCAELACLDLGQQIHGIAIKSGHDSSLSVDNSLLSLYAHCGYLE  408

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
              + ++F  M   ++++W ALI GY ++G    +++L  +M+  G++P+  T+  +L  C 
Sbjct  409   YADRVFNFMKVRNVISWTALIIGYAQNGKGVNSLQLYDQMIASGVKPDYVTFIGLLFACS  468

Query  1824  DLPAIEWGKQVHCRI-----MKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILP-CKN  1663
                  E G+     +     + PG D      + ++D+  + G+  +A  +   +P   +
Sbjct  469   HAGLTEQGQSFFESMSTNYGITPGPDHY----ACMVDLLGRSGKFQEAEDLLGKMPVVPD  524

Query  1662  LVSWNTMLIGYAQHG  1618
                W ++L     HG
Sbjct  525   ATVWKSLLAACRLHG  539


 Score =   161 bits (407),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 114/428 (27%), Positives = 196/428 (46%), Gaps = 8/428 (2%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             ++ +CT   ++  G   H  ++  G  ++V+  + L+ MY    ++  A ++ + M   +
Sbjct  160   VLSACTALSNLGFGAQVHGCIVNGGFSANVFVQSSLVDMYTKCGDLSSAWRVIESMEVND  219

Query  2877  VITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
             VI+W  +I      G S+KAL  FR M  +D    + +TY   L+A +    A+ G  +H
Sbjct  220   VISWNAMIVGCVRQGFSDKALSLFREMHSKD-MKLDEFTYPSVLNALASKNDAKNGYSLH  278

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
               + ++       VSN L++ Y K   L SA  +FD ++E + ++W SL++ +   G ++
Sbjct  279   SLVIKSGFGSYTLVSNALIDMYAKQNNLDSAYKLFDFLVEKDLISWTSLITGYAHNGSHE  338

Query  2517  EGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLV  2338
             E L++F      G   ++ +    L +CA + CL  G  IH + +K G      V   L+
Sbjct  339   EALKLFCEMRVNGTHPDQVVASSVLSSCAELACLDLGQQIHGIAIKSGHDSSLSVDNSLL  398

Query  2337  NFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSER  2158
             + Y  CG L  A   FN      + +WTALI G  Q GKG  ++ L+ ++++SG+KP   
Sbjct  399   SLYAHCGYLEYADRVFNFMKVRNVISWTALIIGYAQNGKGVNSLQLYDQMIASGVKPDYV  458

Query  2157  TYASVLGAFTDTKEFQVGMQ-LHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQE  1981
             T+  +L A +     + G     S     G          +VD   +S    E+  +  +
Sbjct  459   TFIGLLFACSHAGLTEQGQSFFESMSTNYGITPGPDHYACMVDLLGRSGKFQEAEDLLGK  518

Query  1980  MTEY-DIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAI-E  1807
             M    D   W +L+A     G+ E A K     L E L+P       +LS      A+ +
Sbjct  519   MPVVPDATVWKSLLAACRLHGNVELA-KRASTALIE-LDPQDSVSYVMLS--NTYSAVGK  574

Query  1806  WGKQVHCR  1783
             W +  H R
Sbjct  575   WKEAAHVR  582


 Score =   120 bits (302),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 123/229 (54%), Gaps = 3/229 (1%)
 Frame = -2

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
             E+ ++F++  +   +TW++L++GY + G   ++ +L  EM +EG  P+  T   +L +C 
Sbjct  4     EARQLFEKTPKRTAITWSSLVSGYCKIGCEVESFQLFYEMQYEGYRPSQFTLGSVLRLCS  63

Query  1824  DLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFD-ILPCKNLVSWN  1648
                 +   +Q+H   +K  FD++V V + LID+YAKC R+ +A  +FD I   KN V+W 
Sbjct  64    IKGLLSRAEQIHGFAVKTHFDTDVFVVTGLIDVYAKCSRIIEAESLFDKISDGKNHVTWT  123

Query  1647  TMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNN  1468
              M+ GY+ +G    A++ +  M+ENG + N  TF GVLSAC     L  G      + N 
Sbjct  124   AMINGYSLNGDFVRAIQCFKGMRENGSEANQYTFPGVLSACTALSNLGFGAQVHGCIVNG  183

Query  1467  YGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGC  1321
              G +      + +V+++ + G    A+  I S  E  D + W  ++ GC
Sbjct  184   -GFSANVFVQSSLVDMYTKCGDLSSAWRVIESM-EVNDVISWNAMIVGC  230



>ref|XP_008805366.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Phoenix dactylifera]
 ref|XP_008805367.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Phoenix dactylifera]
Length=1089

 Score =   467 bits (1202),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 238/692 (34%), Positives = 395/692 (57%), Gaps = 1/692 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P    LS ++ +CT       GK  HAQ+IK G  S+ +  N L+++Y     +  A+++
Sbjct  311   PTPYVLSSVLSACTKTDHFEHGKQIHAQVIKQGFSSETFVGNALVTLYSRCGSLRMAEEI  370

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F EMP  + +T+ TLIS ++  G SE A+  F+ M L  GF P+  T    L+AC+ +G 
Sbjct  371   FSEMPNHDGVTYNTLISGHAQNGNSESAIEIFKEMQL-SGFKPDSVTIASLLTACASIGD  429

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
              R GK++H  +F+   +    +   L++ Y KC  +++A   F+     N V W  +L  
Sbjct  430   IRKGKQLHSYVFKTGLSSEYIIEGSLLDLYVKCAAIETALEFFNTTDRENVVLWNVMLVA  489

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q G   +   +F +    GV  N++     L  C  V  L  G  IH L +K G +++
Sbjct  490   YGQMGNLRKSFDLFYQMQVEGVQPNQYTYPSILRTCTYVGALDLGEQIHTLTIKTGFELN  549

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              YV + L++ Y KCGQL  A       +  ++ +WTA+I G  Q     EA+  F ++  
Sbjct  550   VYVSSVLIDMYSKCGQLKSARAILERLTEKDVVSWTAMIAGYAQHELYVEALRTFEEMQI  609

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              G++P     AS + A    K  + G+Q+H+     G+++   V NAL++ Y++   ++E
Sbjct  610   HGIRPDNIGLASAISACAGIKAIEQGLQIHAQACISGYSTDISVGNALINLYARCGRIEE  669

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             ++   + +   D ++WN LI+G  +SGH E+A+K+  +M  EG++ +  T+   +S   +
Sbjct  670   AYSALETVEVKDEISWNGLISGLAQSGHCEEALKVFLQMDREGVKASSFTFGSAVSASAN  729

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             +  I+ GKQ+H RI+K GFDS + V + L+ +YAKCG + DA+  F  +  +N VSWN M
Sbjct  730   MADIKQGKQIHARIIKTGFDSEIEVSNALVSLYAKCGSIEDAKMGFFGMSGRNEVSWNAM  789

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             + GY+QHG G+EAL+++  M++  +KPN +TF+GVL+AC H GL+ EGL++F SM   +G
Sbjct  790   ITGYSQHGCGREALKLFEKMKQEDLKPNGVTFIGVLAACSHVGLVNEGLDYFKSMDAEHG  849

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I PR  H AC+V++  R GQ  +A +FI   P  PD +VWR LLS C ++K+  +G+ AA
Sbjct  850   IVPRPEHYACVVDILGRAGQLDRAREFIEEMPIAPDAMVWRTLLSACTVHKNMEIGELAA  909

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             + +L ++P+D++ +V LSN+YA    W++  Q+R+MMK + +KKE G SW  ++N+++ F
Sbjct  910   QHLLELEPHDSATYVLLSNLYAVAGKWNQRDQVRQMMKDRRVKKEPGRSWIGVKNEVHAF  969

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPD  1006
                  +      + + L  L  + ++ GY  D
Sbjct  970   FVGDRLHPLADMIYEFLKDLNERAVEIGYRQD  1001


 Score =   310 bits (793),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 178/584 (30%), Positives = 298/584 (51%), Gaps = 10/584 (2%)
 Frame = -2

Query  3063  SQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPK  2884
             + ++ +C  + S++  K  H +++K G   +    N L+  Y+ F E   A  +FD+M  
Sbjct  114   ASLLDNCLNSGSLVYAKRIHGKILKLGFDRETRLCNRLIDAYLAFGEFVDAVSMFDDMAH  173

Query  2883  RNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR---T  2713
             R V +W T+I  +S        L  F  M+ E    PN   +  AL AC+  G  R    
Sbjct  174   RTVASWNTMIMRFSQRKEHRLVLAFFARMMRE-CRDPNPVAFANALRACN--GNNRYWPL  230

Query  2712  GKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQ  2533
              ++IH +I R     +  V N L++ Y K G +  A+LVF+ +   + V+W +++S   Q
Sbjct  231   VQQIHAKIIRYGFRGDFLVGNPLIDLYAKNGYVDLARLVFEELYSKDNVSWVAMVSGFSQ  290

Query  2532  CGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
              G   E L ++ +  R+G++   ++    L AC   +    G  IH  ++K G   + +V
Sbjct  291   NGLGAEALHLYSQMHRSGIVPTPYVLSSVLSACTKTDHFEHGKQIHAQVIKQGFSSETFV  350

Query  2352  VTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
                LV  Y +CG L +A   F+     +   +  LI G  Q G    A+ +F ++  SG 
Sbjct  351   GNALVTLYSRCGSLRMAEEIFSEMPNHDGVTYNTLISGHAQNGNSESAIEIFKEMQLSGF  410

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             KP   T AS+L A     + + G QLHS++ K G +S   +  +L+D Y K   ++ + +
Sbjct  411   KPDSVTIASLLTACASIGDIRKGKQLHSYVFKTGLSSEYIIEGSLLDLYVKCAAIETALE  470

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPA  1813
              F      ++V WN ++  Y + G+  ++  L  +M  EG++PN +TY  IL  C  + A
Sbjct  471   FFNTTDRENVVLWNVMLVAYGQMGNLRKSFDLFYQMQVEGVQPNQYTYPSILRTCTYVGA  530

Query  1812  IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIG  1633
             ++ G+Q+H   +K GF+ NV V S LIDMY+KCG+L  AR + + L  K++VSW  M+ G
Sbjct  531   LDLGEQIHTLTIKTGFELNVYVSSVLIDMYSKCGQLKSARAILERLTEKDVVSWTAMIAG  590

Query  1632  YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSAC-GHgglleegLNHFNSMKNNYGIT  1456
             YAQH    EAL  +  MQ +G++P++I     +SAC G   + +    H  +  + Y   
Sbjct  591   YAQHELYVEALRTFEEMQIHGIRPDNIGLASAISACAGIKAIEQGLQIHAQACISGYSTD  650

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
                 +   ++NL+AR G+ ++AY  + +  E  D++ W  L+SG
Sbjct  651   ISVGN--ALINLYARCGRIEEAYSALETV-EVKDEISWNGLISG  691


 Score =   299 bits (765),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 170/598 (28%), Positives = 307/598 (51%), Gaps = 8/598 (1%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILS-GKAAHAQLIKYGSKSDVYTNNHLLSMYVT  2932
             + ++   R P  ++ +  +R+C  N       +  HA++I+YG + D    N L+ +Y  
Sbjct  200   ARMMRECRDPNPVAFANALRACNGNNRYWPLVQQIHAKIIRYGFRGDFLVGNPLIDLYAK  259

Query  2931  FHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVG  2752
                ++ A+ +F+E+  ++ ++W  ++S +S  GL  +AL  +  M    G  P  Y    
Sbjct  260   NGYVDLARLVFEELYSKDNVSWVAMVSGFSQNGLGAEALHLYSQM-HRSGIVPTPYVLSS  318

Query  2751  ALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPN  2572
              LSAC+       GK+IH ++ +   +   FV N LV  Y +CG L+ A+ +F  M   +
Sbjct  319   VLSACTKTDHFEHGKQIHAQVIKQGFSSETFVGNALVTLYSRCGSLRMAEEIFSEMPNHD  378

Query  2571  TVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHC  2392
              VT+ +L+S H Q G  +  + IF     +G   +       L ACAS+  +  G  +H 
Sbjct  379   GVTYNTLISGHAQNGNSESAIEIFKEMQLSGFKPDSVTIASLLTACASIGDIRKGKQLHS  438

Query  2391  LIVKCGVKMDQYVVTG-LVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGR  2215
              + K G+   +Y++ G L++ YVKC  +  A   FN      +  W  ++    Q G  R
Sbjct  439   YVFKTGLS-SEYIIEGSLLDLYVKCAAIETALEFFNTTDRENVVLWNVMLVAYGQMGNLR  497

Query  2214  EAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALV  2035
             ++ +LF ++   G++P++ TY S+L   T      +G Q+H+  IK GF    +V + L+
Sbjct  498   KSFDLFYQMQVEGVQPNQYTYPSILRTCTYVGALDLGEQIHTLTIKTGFELNVYVSSVLI  557

Query  2034  DFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLH  1855
             D YSK   L  +  I + +TE D+V+W A+IAGY +   Y +A++  +EM   G+ P+  
Sbjct  558   DMYSKCGQLKSARAILERLTEKDVVSWTAMIAGYAQHELYVEALRTFEEMQIHGIRPDNI  617

Query  1854  TYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDIL  1675
               +  +S C  + AIE G Q+H +    G+ +++ VG+ LI++YA+CGR+ +A    + +
Sbjct  618   GLASAISACAGIKAIEQGLQIHAQACISGYSTDISVGNALINLYARCGRIEEAYSALETV  677

Query  1674  PCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegL  1495
               K+ +SWN ++ G AQ G  +EAL+++  M   GVK +  TF   +SA  +   +++G 
Sbjct  678   EVKDEISWNGLISGLAQSGHCEEALKVFLQMDREGVKASSFTFGSAVSASANMADIKQGK  737

Query  1494  N-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
               H   +K  +      ++   +V+L+A+ G  + A         + ++V W  +++G
Sbjct  738   QIHARIIKTGFDSEIEVSN--ALVSLYAKCGSIEDAKMGFFGMSGR-NEVSWNAMITG  792


 Score =   245 bits (626),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 158/523 (30%), Positives = 266/523 (51%), Gaps = 7/523 (1%)
 Frame = -2

Query  2808  FRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYG  2629
             F  ++ E G   +  TY   L  C   G+    K IHG+I +        + N L++ Y 
Sbjct  97    FLHLMEERGVRADCSTYASLLDNCLNSGSLVYAKRIHGKILKLGFDRETRLCNRLIDAYL  156

Query  2628  KCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGI  2449
               G    A  +FD M      +W +++    Q  E+   L  F R +R     N      
Sbjct  157   AFGEFVDAVSMFDDMAHRTVASWNTMIMRFSQRKEHRLVLAFFARMMRECRDPNPVAFAN  216

Query  2448  ALGAC-ASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAP  2272
             AL AC  +         IH  I++ G + D  V   L++ Y K G + LA   F    + 
Sbjct  217   ALRACNGNNRYWPLVQQIHAKIIRYGFRGDFLVGNPLIDLYAKNGYVDLARLVFEELYSK  276

Query  2271  ELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLH  2092
             +  +W A++ G  Q G G EA++L+ ++  SG+ P+    +SVL A T T  F+ G Q+H
Sbjct  277   DNVSWVAMVSGFSQNGLGAEALHLYSQMHRSGIVPTPYVLSSVLSACTKTDHFEHGKQIH  336

Query  2091  SFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYE  1912
             + +IK GF+S TFV NALV  YS+   L  + +IF EM  +D VT+N LI+G+ ++G+ E
Sbjct  337   AQVIKQGFSSETFVGNALVTLYSRCGSLRMAEEIFSEMPNHDGVTYNTLISGHAQNGNSE  396

Query  1911  QAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLI  1732
              AI++ +EM   G +P+  T + +L+ C  +  I  GKQ+H  + K G  S  ++  +L+
Sbjct  397   SAIEIFKEMQLSGFKPDSVTIASLLTACASIGDIRKGKQLHSYVFKTGLSSEYIIEGSLL  456

Query  1731  DMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDI  1552
             D+Y KC  +  A + F+    +N+V WN ML+ Y Q G  +++ +++  MQ  GV+PN  
Sbjct  457   DLYVKCAAIETALEFFNTTDRENVVLWNVMLVAYGQMGNLRKSFDLFYQMQVEGVQPNQY  516

Query  1551  TFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIR  1375
             T+  +L  C + G L+ G   H  ++K  + +    +  + +++++++ GQ K A   + 
Sbjct  517   TYPSILRTCTYVGALDLGEQIHTLTIKTGFELNVYVS--SVLIDMYSKCGQLKSARAILE  574

Query  1374  SFPEKPDKVVWRCLLSGCNINKDFV--LGKYAAEEILSIDPND  1252
                EK D V W  +++G   ++ +V  L  +   +I  I P++
Sbjct  575   RLTEK-DVVSWTAMIAGYAQHELYVEALRTFEEMQIHGIRPDN  616


 Score = 79.7 bits (195),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 91/201 (45%), Gaps = 5/201 (2%)
 Frame = -2

Query  1908  AIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLID  1729
             A   L  M   G+  +  TY+ +L  C +  ++ + K++H +I+K GFD    + + LID
Sbjct  94    AFFFLHLMEERGVRADCSTYASLLDNCLNSGSLVYAKRIHGKILKLGFDRETRLCNRLID  153

Query  1728  MYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDIT  1549
              Y   G   DA  +FD +  + + SWNTM++ ++Q    +  L  ++ M      PN + 
Sbjct  154   AYLAFGEFVDAVSMFDDMAHRTVASWNTMIMRFSQRKEHRLVLAFFARMMRECRDPNPVA  213

Query  1548  FVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLA--CMVNLFARKGQTKKAYDFIR  1375
             F   L AC         +   ++    YG   R + L    +++L+A+ G    A     
Sbjct  214   FANALRACNGNNRYWPLVQQIHAKIIRYGF--RGDFLVGNPLIDLYAKNGYVDLARLVFE  271

Query  1374  SFPEKPDKVVWRCLLSGCNIN  1312
                 K D V W  ++SG + N
Sbjct  272   ELYSK-DNVSWVAMVSGFSQN  291



>emb|CAN67343.1| hypothetical protein VITISV_038220 [Vitis vinifera]
Length=732

 Score =   456 bits (1174),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 245/693 (35%), Positives = 387/693 (56%), Gaps = 2/693 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +  L+ +IR+CT    +  G   H  +++ G   DVY    L+  Y    +IE A+ +
Sbjct  35    PNEFVLASVIRACTQLGVVEKGAQLHGFVVRSGFDQDVYVGTSLIDFYSKNGBIEVARLV  94

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD++ ++  +TWTT+I+ Y+  G S  +L  F  M  E    P+ Y     LSACS L  
Sbjct  95    FDQLLEKTAVTWTTIIAGYTKCGRSXVSLELFAQM-RETNVVPDRYVVSSVLSACSMLEF  153

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IH  + R    ++  V N L++FY KC  +K+ + +FD M+  N ++W +++S 
Sbjct  154   LEGGKQIHAYVLRRGTEMDVSVVNVLIDFYTKCNRVKAGRKLFDQMVVKNIISWTTMISG  213

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q     E +++F    R G   + F C   L +C S+E L  G  +H   +K  ++ +
Sbjct  214   YMQNSFDWEAMKLFGEMNRLGWKPDGFACTSVLTSCGSLEALEQGRQVHAYTIKANLESN  273

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
             ++V  GL++ Y K   L  A   F++ +   + ++ A+I G   Q K  EA+ LF ++  
Sbjct  274   EFVKNGLIDMYAKSNLLXDAKKVFDVMAEQNVISYNAMIEGYSSQEKLSEALELFHEMRV  333

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
                 PS  T+ S+LG        ++  Q+H  IIK G +   F  +AL+D YSK + + +
Sbjct  334   RLFPPSLLTFVSLLGVSASLFALELSKQIHGLIIKXGVSLDLFAGSALIDVYSKCSYVKD  393

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F+EM E DIV WNA+  GY +    E+A+KL   + F   +PN  T++ +++   +
Sbjct  394   ARHVFEEMNEKDIVVWNAMFFGYTQHLENEEALKLYSTLQFSRQKPNEFTFAALITAASN  453

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L ++  G+Q H +++K G D    V + L+DMYAKCG + +ARK+F+    +++V WN+M
Sbjct  454   LASLRHGQQFHNQLVKMGLDFCPFVTNALVDMYAKCGSIEEARKMFNSSIWRDVVCWNSM  513

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +  +AQHG  +EAL ++  M + G++PN +TFV VLSAC H G +E+GLNHFNSM   +G
Sbjct  514   ISTHAQHGEAEEALGMFREMMKEGIQPNYVTFVAVLSACSHAGXVEDGLNHFNSMP-GFG  572

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I P T H AC+V+L  R G+  +A +FI   P +P  +VWR LLS C I  +  LGKYAA
Sbjct  573   IKPGTEHYACVVSLLGRSGKLFEAKEFIEKMPIEPAAIVWRSLLSACRIAGNVELGKYAA  632

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             E  +S DP D+ +++ LSNI+A   MW +  ++R  M   E+ KE G SW E+ NK+  F
Sbjct  633   EMAISTDPKDSGSYILLSNIFASKGMWADVKKVRDRMDSSEVVKEPGRSWIEVNNKVNVF  692

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDT  1003
              +          +  +L  L   +  AGYVPD 
Sbjct  693   IARXTTHREADMIGSVLDILIQHIKGAGYVPDA  725


 Score =   293 bits (751),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 163/504 (32%), Positives = 269/504 (53%), Gaps = 4/504 (1%)
 Frame = -2

Query  2835  GLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFV  2656
             G SE+AL  F  +  + G  PN +     + AC+ LG    G ++HG + R+    + +V
Sbjct  15    GYSEEALMVFVDLQRKSGEHPNEFVLASVIRACTQLGVVEKGAQLHGFVVRSGFDQDVYV  74

Query  2655  SNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGV  2476
                L++FY K G ++ A+LVFD +LE   VTW ++++ + +CG     L +F +     V
Sbjct  75    GTSLIDFYSKNGBIEVARLVFDQLLEKTAVTWTTIIAGYTKCGRSXVSLELFAQMRETNV  134

Query  2475  LVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYN  2296
             + + ++    L AC+ +E L  G  IH  +++ G +MD  VV  L++FY KC ++     
Sbjct  135   VPDRYVVSSVLSACSMLEFLEGGKQIHAYVLRRGTEMDVSVVNVLIDFYTKCNRVKAGRK  194

Query  2295  TFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKE  2116
              F+      + +WT +I G +Q     EA+ LF ++   G KP      SVL +    + 
Sbjct  195   LFDQMVVKNIISWTTMISGYMQNSFDWEAMKLFGEMNRLGWKPDGFACTSVLTSCGSLEA  254

Query  2115  FQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAG  1936
              + G Q+H++ IK    S  FV N L+D Y+KSNLL ++ K+F  M E +++++NA+I G
Sbjct  255   LEQGRQVHAYTIKANLESNEFVKNGLIDMYAKSNLLXDAKKVFDVMAEQNVISYNAMIEG  314

Query  1935  YIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSN  1756
             Y       +A++L  EM      P+L T+  +L +   L A+E  KQ+H  I+K G   +
Sbjct  315   YSSQEKLSEALELFHEMRVRLFPPSLLTFVSLLGVSASLFALELSKQIHGLIIKXGVSLD  374

Query  1755  VVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQE  1576
             +  GS LID+Y+KC  + DAR VF+ +  K++V WN M  GY QH   +EAL++YS +Q 
Sbjct  375   LFAGSALIDVYSKCSYVKDARHVFEEMNEKDIVVWNAMFFGYTQHLENEEALKLYSTLQF  434

Query  1575  NGVKPNDITFVGVLSACGHgglleegLNHFNSM-KNNYGITPRTNHLACMVNLFARKGQT  1399
             +  KPN+ TF  +++A  +   L  G    N + K      P   +   +V+++A+ G  
Sbjct  435   SRQKPNEFTFAALITAASNLASLRHGQQFHNQLVKMGLDFCPFVTN--ALVDMYAKCGSI  492

Query  1398  KKAYDFIRSFPEKPDKVVWRCLLS  1327
             ++A     S   + D V W  ++S
Sbjct  493   EEARKMFNSSIWR-DVVCWNSMIS  515


 Score = 97.1 bits (240),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 102/203 (50%), Gaps = 28/203 (14%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF  2929
             S++  + + P + + + +I + +   S+  G+  H QL+K G     +  N L+ MY   
Sbjct  430   STLQFSRQKPNEFTFAALITAASNLASLRHGQQFHNQLVKMGLDFCPFVTNALVDMYAKC  489

Query  2928  HEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGA  2749
               IE A+K+F+    R+V+ W ++IS+++  G +E+ALG FR M +++G  PN+ T+V  
Sbjct  490   GSIEEARKMFNSSIWRDVVCWNSMISTHAQHGEAEEALGMFREM-MKEGIQPNYVTFVAV  548

Query  2748  LSACSCLGAARTGKEIHGRIFRAEETLNNFVS-------------NCLVNFYGKCGLLKS  2608
             LSACS  G    G             LN+F S              C+V+  G+ G L  
Sbjct  549   LSACSHAGXVEDG-------------LNHFNSMPGFGIKPGTEHYACVVSLLGRSGKLFE  595

Query  2607  AQLVFDAM-LEPNTVTWASLLSC  2542
             A+   + M +EP  + W SLLS 
Sbjct  596   AKEFIEKMPIEPAAIVWRSLLSA  618



>ref|XP_010243341.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 
[Nelumbo nucifera]
Length=851

 Score =   460 bits (1183),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 243/693 (35%), Positives = 392/693 (57%), Gaps = 1/693 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +  L+ ++ +CT  +++      H   I+ G   DVY    L+  Y    +++ A+ +
Sbjct  153   PNEFILASVVCACTQLRAVAQATQVHGFAIRSGFDQDVYVGTSLIDFYSKNGDMQDARLV  212

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD +P +  +TWT +I+ YS  G SE +L  F  M   D   P+ Y     ++ACS LG 
Sbjct  213   FDGLPIKTAVTWTAIITGYSQSGKSEISLQLFDQMRKTD-VLPDRYVLSSVINACSLLGF  271

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IH  + R     +  V N L++FY KC ++K+ + +FD M+  N VTW ++ + 
Sbjct  272   LGGGKQIHAYVLRNGIQTDTSVMNTLIDFYLKCHMVKNGKKLFDLMIVKNVVTWTTMTAG  331

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + +     + +++F      G+  + + C   L +C S+E L  G  +H   VK  +  D
Sbjct  332   YMKNSCDLDAMKLFSEMTHLGLKPDSYACTSILTSCGSLEALSQGKQVHSYTVKTNLDFD  391

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
             ++V   L++ Y KC  L  A   F+      + ++ A+I G  +Q +  EA++LF  +  
Sbjct  392   EFVSNSLIDMYAKCNSLADARKAFDDMDEHNVISYNAMIEGYARQERLYEALDLFQGMRL  451

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
               + PS  T  S+ G         +  Q+H  I+K+GF+   +  +ALVD YSK   + +
Sbjct  452   RSVNPSLLTCVSLFGLSASLSIIDLSKQIHGLIVKVGFSLDLYAGSALVDVYSKCLCIKD  511

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F+EM E D V WNA++ GY ++G  E+A+KL  EM F  ++P+  T+  +++   D
Sbjct  512   ARLVFEEMNERDTVVWNAMVLGYTQNGQGEEALKLFLEMQFSRIKPDEFTFVGLVTAASD  571

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L ++  G+Q H  ++K G D +  V + L+DMYAKCG + +AR  FD    K++  WN+M
Sbjct  572   LASLIHGQQFHDHLIKTGLDMDPYVCNALVDMYAKCGSIEEARTTFDGSYQKDVACWNSM  631

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +  YA+HG  +EAL ++  M++ G++PN +TFVGVLSAC H GL+E GL HF+SM + +G
Sbjct  632   ISRYAEHGHAEEALRMFECMEDEGIEPNYVTFVGVLSACSHVGLVETGLLHFDSMTSKFG  691

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I P T H AC+V+L  R G+  +A +FI   P KP  +VWR LLS C I  +  +GKYAA
Sbjct  692   IKPGTEHYACVVSLLGRAGKLCEAKEFIDQMPIKPAAIVWRSLLSACKIACNVEMGKYAA  751

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             E  +S DPN++ ++V LSNI+A  +MWD+  ++RK M  K + KE G SW ++ +K++ F
Sbjct  752   EMAISSDPNESGSYVLLSNIFASRSMWDDVEKVRKRMDCKGVVKEPGHSWIQINSKVHVF  811

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDT  1003
              +          +  +L  LT Q+ + GY+PDT
Sbjct  812   IARDKAHSQAGLIYSILGRLTKQIKEVGYIPDT  844


 Score =   318 bits (815),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 181/587 (31%), Positives = 317/587 (54%), Gaps = 10/587 (2%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             +  L+Q+++S   N+  L  K  HAQ+I  G  SD++  N LL  Y     +  A+ LFD
Sbjct  53    RRELAQLLQSFGPNEPHLYHKNVHAQIIVLGFHSDIFLTNLLLKSYSKSSCLRSARLLFD  112

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALG---SFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
              MP+RN+ITW++LIS Y+     E AL     F+   LE+   PN +     + AC+ L 
Sbjct  113   AMPQRNLITWSSLISMYTQHFRGEDALTLFLEFQKYSLEN---PNEFILASVVCACTQLR  169

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
             A     ++HG   R+    + +V   L++FY K G ++ A+LVFD +     VTW ++++
Sbjct  170   AVAQATQVHGFAIRSGFDQDVYVGTSLIDFYSKNGDMQDARLVFDGLPIKTAVTWTAIIT  229

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
              + Q G+ +  L++F +  +  VL + ++    + AC+ +  LG G  IH  +++ G++ 
Sbjct  230   GYSQSGKSEISLQLFDQMRKTDVLPDRYVLSSVINACSLLGFLGGGKQIHAYVLRNGIQT  289

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
             D  V+  L++FY+KC  +      F++     +  WT +  G ++     +A+ LF ++ 
Sbjct  290   DTSVMNTLIDFYLKCHMVKNGKKLFDLMIVKNVVTWTTMTAGYMKNSCDLDAMKLFSEMT  349

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
               GLKP      S+L +    +    G Q+HS+ +K   +   FV N+L+D Y+K N L 
Sbjct  350   HLGLKPDSYACTSILTSCGSLEALSQGKQVHSYTVKTNLDFDEFVSNSLIDMYAKCNSLA  409

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
             ++ K F +M E++++++NA+I GY R     +A+ L Q M    + P+L T   +  +  
Sbjct  410   DARKAFDDMDEHNVISYNAMIEGYARQERLYEALDLFQGMRLRSVNPSLLTCVSLFGLSA  469

Query  1824  DLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNT  1645
              L  I+  KQ+H  I+K GF  ++  GS L+D+Y+KC  + DAR VF+ +  ++ V WN 
Sbjct  470   SLSIIDLSKQIHGLIVKVGFSLDLYAGSALVDVYSKCLCIKDARLVFEEMNERDTVVWNA  529

Query  1644  MLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNN  1468
             M++GY Q+G G+EAL+++  MQ + +KP++ TFVG+++A      L  G   H + +K  
Sbjct  530   MVLGYTQNGQGEEALKLFLEMQFSRIKPDEFTFVGLVTAASDLASLIHGQQFHDHLIKTG  589

Query  1467  YGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLS  1327
               + P   +   +V+++A+ G  ++A        +K D   W  ++S
Sbjct  590   LDMDPYVCN--ALVDMYAKCGSIEEARTTFDGSYQK-DVACWNSMIS  633


 Score =   136 bits (343),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 120/217 (55%), Gaps = 1/217 (0%)
 Frame = -2

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             +   R  A +L +F   +       +H+ II LGF+S  F+ N L+  YSKS+ L  +  
Sbjct  50    RAKRRELAQLLQSFGPNEPHLYHKNVHAQIIVLGFHSDIFLTNLLLKSYSKSSCLRSARL  109

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLE-PNLHTYSCILSICGDLP  1816
             +F  M + +++TW++LI+ Y +    E A+ L  E     LE PN    + ++  C  L 
Sbjct  110   LFDAMPQRNLITWSSLISMYTQHFRGEDALTLFLEFQKYSLENPNEFILASVVCACTQLR  169

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             A+    QVH   ++ GFD +V VG++LID Y+K G + DAR VFD LP K  V+W  ++ 
Sbjct  170   AVAQATQVHGFAIRSGFDQDVYVGTSLIDFYSKNGDMQDARLVFDGLPIKTAVTWTAIIT  229

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSAC  1525
             GY+Q G  + +L+++  M++  V P+      V++AC
Sbjct  230   GYSQSGKSEISLQLFDQMRKTDVLPDRYVLSSVINAC  266



>gb|AHB18406.1| pentatricopeptide repeat-containing protein [Gossypium hirsutum]
Length=775

 Score =   457 bits (1176),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 253/726 (35%), Positives = 388/726 (53%), Gaps = 4/726 (1%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             +++ C  N   +S    H +++K G+  D++  N LL++YV    +  A+ LFD MP+RN
Sbjct  5     LLQRCLQNDDPISAMGLHCKILKRGNCLDLFATNILLNVYVKAELLSEAEILFDVMPERN  64

Query  2877  VITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
              +++ TL+  Y+      +A+G F  +  E G   N + +   L     +  A  G  +H
Sbjct  65    TVSFVTLVQGYAQCLQFSEAVGLFTRLHRE-GHELNPFVFTSILKVLVSMECAELGWNLH  123

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
               I++     N F+   L++ Y  CG +  A+ VFD +   + VTW  +++C+ +   + 
Sbjct  124   ACIYKLGHESNAFIGTALIDAYSVCGCVDFAREVFDGIRCKDMVTWTGMVACYAENHFFQ  183

Query  2517  EGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLV  2338
             E L  F +    G   N F       AC  +E L    G+H  ++K   + D YV   L+
Sbjct  184   EALEAFSQMRLVGFKPNNFTFTGVFKACIGLEALDIAKGVHGCVLKTRYEYDLYVGVALL  243

Query  2337  NFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSER  2158
               Y KCG +G     F      ++  W+ +I    Q  +  +AVNLFC++  S + P++ 
Sbjct  244   ELYTKCGDIGDVQQIFEEIPKTDVIPWSFMISRFAQSDQSEKAVNLFCRMRQSFVVPNQY  303

Query  2157  TYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEM  1978
             T+AS L A     +  +G Q+HS ++K+  ++  FV NAL+D Y+K   +++S ++F++ 
Sbjct  304   TFASALQACATLGDLDLGKQMHSLVLKVRLDADVFVSNALMDVYAKCGRIEDSLELFEKS  363

Query  1977  TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGK  1798
                + V+WN +I GY+  G  E+A+ L  EML    +    TYS +L     L A+E G 
Sbjct  364   LNRNDVSWNTMIVGYVNCGDAEKALSLFLEMLENRAQATEVTYSGVLCASAGLTALELGT  423

Query  1797  QVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHG  1618
             Q+H    K  +  N VV + LIDMY+KCGR+  AR VFD++  ++ VSWNTM+ GY+ HG
Sbjct  424   QIHSLTFKTNYAENTVVHNALIDMYSKCGRIRHARLVFDMMNERDEVSWNTMISGYSMHG  483

Query  1617  FGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHL  1438
              G EAL+I+ MMQ+ G KPN +TFVGVLSAC + GLL+EG  +F+SM   YGI P   H 
Sbjct  484   LGMEALKIFQMMQDRGHKPNTLTFVGVLSACSNSGLLDEGQAYFSSMLQEYGIEPCIEHY  543

Query  1437  ACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDP  1258
             +CMV L  R G   KA   I   P KP  +VWR LL  C I+K+  LG+ +A+ IL ++P
Sbjct  544   SCMVRLLGRSGHLHKALKLIEEIPFKPSVMVWRALLGACVIHKNVELGRMSAQRILEMEP  603

Query  1257  NDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLL  1078
              D + HV LSN+YA    WD    IR+ MK+K +KKE G SW E Q +++ FS+      
Sbjct  604   EDDATHVLLSNMYATARRWDNVTAIRQSMKKKGMKKEPGLSWIENQGRVHYFSAGDTSHP  663

Query  1077  GEVSMKKLLIGLTAQLLDAGYVPDTK---LSFDYGD*LGLSIRHLSRFVKFDPPISTTGG  907
                 +  +L  L  +   AG+VPD     L  D  +   L   H  R         T+ G
Sbjct  664   DMKVINGILEWLNVRTRRAGFVPDCNAVLLDVDTKEKEHLLWVHSERLALAFALFRTSSG  723

Query  906   SKLAVV  889
             S++ ++
Sbjct  724   SQIRII  729


 Score =   186 bits (471),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 131/465 (28%), Positives = 215/465 (46%), Gaps = 49/465 (11%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + + + ++C   +++   K  H  ++K   + D+Y    LL +Y    +I   Q++
Sbjct  199   PNNFTFTGVFKACIGLEALDIAKGVHGCVLKTRYEYDLYVGVALLELYTKCGDIGDVQQI  258

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F+E+PK +VI W+ +IS ++    SEKA+  F  M  +    PN YT+  AL AC+ LG 
Sbjct  259   FEEIPKTDVIPWSFMISRFAQSDQSEKAVNLFCRM-RQSFVVPNQYTFASALQACATLGD  317

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK++H  + +     + FVSN L++ Y KCG ++ +  +F+  L  N V+W +++  
Sbjct  318   LDLGKQMHSLVLKVRLDADVFVSNALMDVYAKCGRIEDSLELFEKSLNRNDVSWNTMIVG  377

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             +  CG+ ++ L +FL  L       E      L A A +  L  G  IH L  K     +
Sbjct  378   YVNCGDAEKALSLFLEMLENRAQATEVTYSGVLCASAGLTALELGTQIHSLTFKTNYAEN  437

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
               V   L++ Y KCG++  A   F+M +  +  +W  +I G    G G EA+ +F  +  
Sbjct  438   TVVHNALIDMYSKCGRIRHARLVFDMMNERDEVSWNTMISGYSMHGLGMEALKIFQMMQD  497

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              G KP+  T+  VL A                            C       S S LLDE
Sbjct  498   RGHKPNTLTFVGVLSA----------------------------C-------SNSGLLDE  522

Query  2001  SFKIFQEM-TEYDIVT----WNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCIL  1837
                 F  M  EY I      ++ ++    RSGH  +A+KL++E+ F   +P++  +  +L
Sbjct  523   GQAYFSSMLQEYGIEPCIEHYSCMVRLLGRSGHLHKALKLIEEIPF---KPSVMVWRALL  579

Query  1836  SICGDLPAIEWGKQVHCRI--MKPGFDSNVVVGSTLIDMYAKCGR  1708
               C     +E G+    RI  M+P  D+  V+   L +MYA   R
Sbjct  580   GACVIHKNVELGRMSAQRILEMEPEDDATHVL---LSNMYATARR  621



>ref|XP_008675521.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 
[Zea mays]
 ref|XP_008675522.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 
[Zea mays]
 ref|XP_008675523.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 
[Zea mays]
 ref|XP_008675524.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 
[Zea mays]
 ref|XP_008675525.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 
[Zea mays]
 ref|XP_008675526.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 
[Zea mays]
 ref|XP_008675527.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 
[Zea mays]
Length=820

 Score =   458 bits (1179),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 245/697 (35%), Positives = 401/697 (58%), Gaps = 1/697 (0%)
 Frame = -2

Query  3096  TTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIE  2917
             ++   P +  L+ ++R+C  ++ +  G+  H ++I  G   ++Y    L+++Y     ++
Sbjct  114   SSDEAPNEFVLASVVRACMQSRDVPFGEQVHGKIINLGLDVNLYVGTALVNLYAKVACMD  173

Query  2916  CAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSAC  2737
              A ++F  +P +N +TWT +I+ YS +G  E ALG F++MV + G  P+ +    A+SAC
Sbjct  174   AAMRVFHALPTKNPVTWTAIITGYSRIGHGELALGLFQTMVAQ-GVQPDRFVLASAVSAC  232

Query  2736  SCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWA  2557
             S L   + G++IHG  +R+   ++  V N L++ Y KC     A+ +FD M   N V+W 
Sbjct  233   SALAFLQGGRQIHGYAYRSAAEVDASVINALIDLYCKCSRPLVARKLFDRMKNHNLVSWT  292

Query  2556  SLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKC  2377
             ++++ + Q     E +++F +  +AG   + F C   L +C S+E +  G  IH   +K 
Sbjct  293   TMIAGYMQNSLDAEAIQMFWQMCQAGWQPDAFACTSILNSCGSMEAISQGTQIHAHAIKV  352

Query  2376  GVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLF  2197
              ++ D+YV   L++ Y KC  L  A   F+  +  ++ ++ A+I G  +QG   EAV++F
Sbjct  353   NLENDEYVKNALIDMYAKCAHLTAARVAFDALAHDDVVSYNAMIEGYARQGDLTEAVHIF  412

Query  2196  CKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKS  2017
              K+    ++P+  T+ S+LG  +     +   Q+H  IIK G +   +V +AL+D YSKS
Sbjct  413   RKMKYYSIRPNLLTFVSLLGMSSLLSSIEWSKQIHGLIIKSGTSVDLYVGSALIDAYSKS  472

Query  2016  NLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCIL  1837
             +L+D++  +F  M   D+  WNA+I G+ ++   E+A+KL  ++   G+ PN  T+  ++
Sbjct  473   SLVDDAKAVFFMMQNRDMAIWNAMIFGHTQNEQGEEAVKLFNQVRVSGMTPNEFTFVALV  532

Query  1836  SICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLV  1657
             ++  +L ++  G+Q H +I+K G D N  V + L+DMYAKCG + +   +F+    K+++
Sbjct  533   TVASNLASMFHGQQFHAQIIKAGCDINPHVSNALVDMYAKCGFIKEGWMLFESTCGKDVI  592

Query  1656  SWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSM  1477
              WN+M+  YAQHG  +EAL  + +M+E  V+PN +TFVGVLSAC H GL++EGL+HFNSM
Sbjct  593   CWNSMITMYAQHGHAEEALCAFQLMREAKVEPNYVTFVGVLSACAHAGLVDEGLHHFNSM  652

Query  1476  KNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVL  1297
             K+ YGI P T H A +VNL  R G+   A +FI   P KP   VWR LLS C +  +  +
Sbjct  653   KSKYGIDPGTEHYASVVNLLGRSGKLHSAQEFIEKMPIKPAAAVWRSLLSACRLFGNVQI  712

Query  1296  GKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQN  1117
             G+YAAE  L  DP+D+  +V LSNIYA   +W +  Q+R  M      KE G SW E+  
Sbjct  713   GRYAAEMALLEDPSDSGPYVLLSNIYASKGLWVDVQQLRLRMDYAGAVKEPGYSWIEVMK  772

Query  1116  KIYCFSSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPD  1006
             +++ F +          +  +L  LT  L D GY PD
Sbjct  773   EVHMFIARGTEHPQAELIYAVLDELTGLLKDFGYHPD  809


 Score =   286 bits (731),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 167/585 (29%), Positives = 303/585 (52%), Gaps = 9/585 (2%)
 Frame = -2

Query  3069  SLSQII---RSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLF  2899
             SL+Q++   R+ +  + +L   AAHA+ I       ++  N LL  Y     I  A++LF
Sbjct  20    SLAQVLLSGRAGSRLRRVL--PAAHARAIISDGLGFLFLANLLLDGYSKLGRIHDARRLF  77

Query  2898  DEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAA  2719
             D MP RN+++W++ IS Y+  G   +AL  F +        PN +     + AC      
Sbjct  78    DGMPHRNLVSWSSAISMYAQHGADGQALALFAAFRRSSDEAPNEFVLASVVRACMQSRDV  137

Query  2718  RTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCH  2539
               G+++HG+I      +N +V   LVN Y K   + +A  VF A+   N VTW ++++ +
Sbjct  138   PFGEQVHGKIINLGLDVNLYVGTALVNLYAKVACMDAAMRVFHALPTKNPVTWTAIITGY  197

Query  2538  CQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQ  2359
              + G  +  L +F   +  GV  + F+   A+ AC+++  L  G  IH    +   ++D 
Sbjct  198   SRIGHGELALGLFQTMVAQGVQPDRFVLASAVSACSALAFLQGGRQIHGYAYRSAAEVDA  257

Query  2358  YVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSS  2179
              V+  L++ Y KC +  +A   F+      L +WT +I G +Q     EA+ +F ++  +
Sbjct  258   SVINALIDLYCKCSRPLVARKLFDRMKNHNLVSWTTMIAGYMQNSLDAEAIQMFWQMCQA  317

Query  2178  GLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDES  1999
             G +P      S+L +    +    G Q+H+  IK+   +  +V NAL+D Y+K   L  +
Sbjct  318   GWQPDAFACTSILNSCGSMEAISQGTQIHAHAIKVNLENDEYVKNALIDMYAKCAHLTAA  377

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDL  1819
                F  +   D+V++NA+I GY R G   +A+ + ++M +  + PNL T+  +L +   L
Sbjct  378   RVAFDALAHDDVVSYNAMIEGYARQGDLTEAVHIFRKMKYYSIRPNLLTFVSLLGMSSLL  437

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
              +IEW KQ+H  I+K G   ++ VGS LID Y+K   + DA+ VF ++  +++  WN M+
Sbjct  438   SSIEWSKQIHGLIIKSGTSVDLYVGSALIDAYSKSSLVDDAKAVFFMMQNRDMAIWNAMI  497

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYG  1462
              G+ Q+  G+EA+++++ ++ +G+ PN+ TFV +++   +   +  G   H   +K    
Sbjct  498   FGHTQNEQGEEAVKLFNQVRVSGMTPNEFTFVALVTVASNLASMFHGQQFHAQIIKAGCD  557

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLS  1327
             I P  ++   +V+++A+ G  K+ +    S   K D + W  +++
Sbjct  558   INPHVSN--ALVDMYAKCGFIKEGWMLFESTCGK-DVICWNSMIT  599



>ref|XP_008787073.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Phoenix dactylifera]
Length=929

 Score =   461 bits (1187),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 245/695 (35%), Positives = 387/695 (56%), Gaps = 13/695 (2%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +L  ++++C+ +   ++G   HA  I  G +SD +  N L+ MY  F  +  ++KLFD
Sbjct  153   EFTLPTVLKACSASSDFIAGTQIHAVAIVTGFESDAFVANTLIVMYARFGLLSDSRKLFD  212

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              +  RNV++W  +++ +      E+A+G F  M +  G  PN + +   L+AC+     R
Sbjct  213   GIAGRNVVSWNAMLAGHVKNDRCEEAVGLFSEMAMS-GIRPNEFGFSCVLNACTGSQDLR  271

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G+E+HG + R     + F +N LV+ Y K G +++A  VF  +  P+ V+W ++++   
Sbjct  272   HGREVHGYLTRLGYDSDPFTANALVDMYAKLGNIEAAATVFKGIARPDIVSWNAIIAGCV  331

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
               G     L++FL    +G+L N F     L ACA    L  G  IH  ++K G   D +
Sbjct  332   LHGHDSWALKLFLDMRHSGMLPNVFTLSSILKACAGTGMLFLGQQIHGNLIKSGSDSDMF  391

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V  G+V+ Y KC  LG A   F++    +L +W ALI GC   G  +EA++LF K+   G
Sbjct  392   VGVGIVDMYAKCDHLGDAKKAFDLIPEQDLISWNALISGCSHSGSDQEALSLFSKMRMEG  451

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             L  +  T ++VL +    +   V  ++H+  +K GF S   V N L+D Y K N ++E+ 
Sbjct  452   LSFNRTTLSAVLKSIASLRATNVNKEVHALALKAGFLSDPHVANGLIDAYGKCNCIEEAA  511

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
              IF+E    D+V + ++I  +  SG  E+A+KL  EML   L+P+    S +L+ C  L 
Sbjct  512   GIFREHPFGDVVAFTSIITAHSLSGQGEEAMKLFYEMLNRELKPDSFALSSLLNACASLS  571

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             A E GKQ+H  ++K GF S+V  G+ L++MYAKCG + DA   F  +P + +VSW+ M+ 
Sbjct  572   AYEQGKQIHVHVLKMGFMSDVFSGNALVNMYAKCGSIEDASLAFSEVPERGVVSWSAMIG  631

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             G AQHG GKEAL ++  M + GV PN IT   VLSAC H GL++E   +F SM   +GI 
Sbjct  632   GLAQHGHGKEALNLFHKMLDEGVAPNHITLTSVLSACNHAGLVDEAEQYFESMVELFGIE  691

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
                 H ACMV+L  R G+  +A + + S P + +  VW  LL    ++++  LG+ AAE 
Sbjct  692   RTHEHYACMVDLLGRAGRLNEAMELVDSMPFEANASVWGALLGASRVHRNIELGRKAAEM  751

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSS  1096
             + S++P  +  HV L+NIYA   MWD+ A+ R++MK   +KKE G SW E+++++Y F  
Sbjct  752   LFSLEPEKSGTHVLLANIYASAGMWDDVAKARRLMKDSSVKKEPGMSWMEVKDRVYTF--  809

Query  1095  SYNMLLGEVSMKKL------LIGLTAQLLDAGYVP  1009
                 ++G+ S ++       L  L   +  +GYVP
Sbjct  810   ----IVGDRSHERTTEIYAKLEELGELMNKSGYVP  840


 Score =   275 bits (702),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 184/613 (30%), Positives = 302/613 (49%), Gaps = 16/613 (3%)
 Frame = -2

Query  3003  AQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSE  2824
             AQL K G  S      HLL +       + A+K+FD +P  ++++W+ LIS+Y   GL+ 
Sbjct  76    AQLTKSGFSSVPLVRRHLLPLRPDSRSPDLARKVFDVIPHPDLVSWSALISNYVRGGLTR  135

Query  2823  KALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCL  2644
             +AL +F+ M    G   N +T    L ACS       G +IH          + FV+N L
Sbjct  136   EALLAFQKM-QSLGIRSNEFTLPTVLKACSASSDFIAGTQIHAVAIVTGFESDAFVANTL  194

Query  2643  VNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNE  2464
             +  Y + GLL  ++ +FD +   N V+W ++L+ H +    +E + +F     +G+  NE
Sbjct  195   IVMYARFGLLSDSRKLFDGIAGRNVVSWNAMLAGHVKNDRCEEAVGLFSEMAMSGIRPNE  254

Query  2463  FLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNM  2284
             F     L AC   + L  G  +H  + + G   D +    LV+ Y K G +  A   F  
Sbjct  255   FGFSCVLNACTGSQDLRHGREVHGYLTRLGYDSDPFTANALVDMYAKLGNIEAAATVFKG  314

Query  2283  ASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVG  2104
              + P++ +W A+I GCV  G    A+ LF  +  SG+ P+  T +S+L A   T    +G
Sbjct  315   IARPDIVSWNAIIAGCVLHGHDSWALKLFLDMRHSGMLPNVFTLSSILKACAGTGMLFLG  374

Query  2103  MQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRS  1924
              Q+H  +IK G +S  FV   +VD Y+K + L ++ K F  + E D+++WNALI+G   S
Sbjct  375   QQIHGNLIKSGSDSDMFVGVGIVDMYAKCDHLGDAKKAFDLIPEQDLISWNALISGCSHS  434

Query  1923  GHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVG  1744
             G  ++A+ L  +M  EGL  N  T S +L     L A    K+VH   +K GF S+  V 
Sbjct  435   GSDQEALSLFSKMRMEGLSFNRTTLSAVLKSIASLRATNVNKEVHALALKAGFLSDPHVA  494

Query  1743  STLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVK  1564
             + LID Y KC  + +A  +F   P  ++V++ +++  ++  G G+EA++++  M    +K
Sbjct  495   NGLIDAYGKCNCIEEAAGIFREHPFGDVVAFTSIITAHSLSGQGEEAMKLFYEMLNRELK  554

Query  1563  PNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAY  1387
             P+      +L+AC      E+G   H + +K   G          +VN++A+ G  + A 
Sbjct  555   PDSFALSSLLNACASLSAYEQGKQIHVHVLK--MGFMSDVFSGNALVNMYAKCGSIEDAS  612

Query  1386  DFIRSFPEKPDK--VVWRCLLSGCNINKDFVLGKYAAEEILS-IDPNDTSAHVTLSNIYA  1216
                 +F E P++  V W  ++ G   +     GK A       +D      H+TL+++ +
Sbjct  613   ---LAFSEVPERGVVSWSAMIGGLAQHGH---GKEALNLFHKMLDEGVAPNHITLTSVLS  666

Query  1215  RLN---MWDEAAQ  1186
               N   + DEA Q
Sbjct  667   ACNHAGLVDEAEQ  679


 Score =   233 bits (595),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 144/508 (28%), Positives = 252/508 (50%), Gaps = 7/508 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +   S ++ +CT ++ +  G+  H  L + G  SD +T N L+ MY     IE A  +
Sbjct  252   PNEFGFSCVLNACTGSQDLRHGREVHGYLTRLGYDSDPFTANALVDMYAKLGNIEAAATV  311

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F  + + ++++W  +I+     G    AL  F  M    G  PN +T    L AC+  G 
Sbjct  312   FKGIARPDIVSWNAIIAGCVLHGHDSWALKLFLDM-RHSGMLPNVFTLSSILKACAGTGM  370

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G++IHG + ++    + FV   +V+ Y KC  L  A+  FD + E + ++W +L+S 
Sbjct  371   LFLGQQIHGNLIKSGSDSDMFVGVGIVDMYAKCDHLGDAKKAFDLIPEQDLISWNALISG  430

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
                 G   E L +F +    G+  N       L + AS+        +H L +K G   D
Sbjct  431   CSHSGSDQEALSLFSKMRMEGLSFNRTTLSAVLKSIASLRATNVNKEVHALALKAGFLSD  490

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              +V  GL++ Y KC  +  A   F      ++ A+T++I      G+G EA+ LF ++L+
Sbjct  491   PHVANGLIDAYGKCNCIEEAAGIFREHPFGDVVAFTSIITAHSLSGQGEEAMKLFYEMLN  550

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
               LKP     +S+L A      ++ G Q+H  ++K+GF S  F  NALV+ Y+K   +++
Sbjct  551   RELKPDSFALSSLLNACASLSAYEQGKQIHVHVLKMGFMSDVFSGNALVNMYAKCGSIED  610

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +   F E+ E  +V+W+A+I G  + GH ++A+ L  +ML EG+ PN  T + +LS C  
Sbjct  611   ASLAFSEVPERGVVSWSAMIGGLAQHGHGKEALNLFHKMLDEGVAPNHITLTSVLSACNH  670

Query  1821  LPAIEWGKQVHCRIMKP-GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-NLVSWN  1648
                ++  +Q    +++  G +      + ++D+  + GRL +A ++ D +P + N   W 
Sbjct  671   AGLVDEAEQYFESMVELFGIERTHEHYACMVDLLGRAGRLNEAMELVDSMPFEANASVWG  730

Query  1647  TMLIGYAQH---GFGKEALE-IYSMMQE  1576
              +L     H     G++A E ++S+  E
Sbjct  731   ALLGASRVHRNIELGRKAAEMLFSLEPE  758



>ref|XP_010905005.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Elaeis guineensis]
 ref|XP_010905006.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Elaeis guineensis]
 ref|XP_010905007.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Elaeis guineensis]
 ref|XP_010905008.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Elaeis guineensis]
Length=1089

 Score =   465 bits (1197),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 239/692 (35%), Positives = 395/692 (57%), Gaps = 1/692 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P    LS ++ +CT   +   GK  HAQ+IK G  S+ +  N L+++Y     +  A+++
Sbjct  311   PTPYVLSSVLSACTKTDNFEHGKQIHAQVIKQGFSSETFVGNALVTLYSRCGSLRRAEEI  370

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F +MP  + +T+ TLIS ++  G SE A+  F+ M L  GF P+  T    L+AC+ +G 
Sbjct  371   FSDMPHHDGVTYNTLISGHAQNGNSENAIEIFKEMQL-SGFKPDSVTIASLLTACASIGD  429

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
              R GK++H  +F++  +    +   L++ Y KC  +++A   F+     N V W  +L  
Sbjct  430   IRKGKQLHSYVFKSGLSSEYIIEGSLLDLYVKCAAIETAHEFFNTTDRENVVLWNVMLVA  489

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q G   +   +F      GV  N+F     L  C  V  L  G  IH L +K G +++
Sbjct  490   YGQMGNLGKSFDLFYEMQVEGVQPNQFTYPSILRTCTYVGALDLGEQIHTLTIKTGFELN  549

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              YV + L++ Y KCGQL  A       +  ++ +WTA+I G  Q     EA+  F ++  
Sbjct  550   VYVSSVLIDMYSKCGQLKSARAILERITEKDVVSWTAMIAGYAQHELYVEALRTFEEMQI  609

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              G++P     AS + A    K  + G+Q+H+     G+++   V NAL++ Y+K   ++E
Sbjct  610   HGIQPDNIGLASAISACAGIKAIEQGLQIHAQACISGYSTDISVGNALINLYAKCGRIEE  669

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             ++  F+ +   D ++WN LI+G+ +SGH E+A+K+  +M   G++ N  T+  ++S   +
Sbjct  670   AYSAFETVEVKDEISWNGLISGFAQSGHCEEALKVFVQMDRAGVKSNSFTFGSVVSASAN  729

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             +  I+ GKQ+H RI+K G+DS + V + L+ +YAKCG + DA+  F  +  +N VSWN M
Sbjct  730   MADIKQGKQIHARIIKTGYDSEIEVNNALVSLYAKCGSIEDAKMGFFGMSERNEVSWNAM  789

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             + G +QHG G+EAL+++  M++  +KPN +TF+GVL+AC H GL+ EGL++F SM   +G
Sbjct  790   ITGCSQHGCGREALKLFEKMKQEDLKPNYVTFIGVLAACSHVGLVNEGLDYFYSMSEEHG  849

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I PR  H AC+V++  R GQ   A +FI   P  PD +VWR LLS C ++K+   G+ AA
Sbjct  850   IVPRPEHYACVVDILGRAGQLDHAREFIEEMPVVPDSMVWRTLLSACTVHKNIHTGELAA  909

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             + +L ++P+D++ +V LSN+YA    W+   Q+R+MMK + +KKE G SW E++N+++ F
Sbjct  910   QHLLELEPHDSATYVLLSNLYAVAGKWNHRDQVRQMMKDRGVKKEPGRSWIEVKNEVHAF  969

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPD  1006
                  +      + + L  L  + ++ GY  D
Sbjct  970   FVGDRLHPLADMIYEFLKDLNKRAVEIGYRQD  1001


 Score =   315 bits (806),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 176/599 (29%), Positives = 311/599 (52%), Gaps = 6/599 (1%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILS-GKAAHAQLIKYGSKSDVYTNNHLLSMYVT  2932
             + ++   R P  ++ +  +R+C  N       +  HA++I+YG   D    N L+ +Y  
Sbjct  200   ARMMRECRDPNPVAFANALRACNGNNRYWPFVQQIHAKIIRYGFGCDFLVGNPLIDLYAK  259

Query  2931  FHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVG  2752
                ++ A+ +F+E+  ++ ++W  ++S +S  GL E+AL  +  M    G  P  Y    
Sbjct  260   NGYVDLARLVFEELYSKDNVSWVAMVSGFSQNGLGEEALHLYSQM-HRSGIIPTPYVLSS  318

Query  2751  ALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPN  2572
              LSAC+       GK+IH ++ +   +   FV N LV  Y +CG L+ A+ +F  M   +
Sbjct  319   VLSACTKTDNFEHGKQIHAQVIKQGFSSETFVGNALVTLYSRCGSLRRAEEIFSDMPHHD  378

Query  2571  TVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHC  2392
              VT+ +L+S H Q G  +  + IF     +G   +       L ACAS+  +  G  +H 
Sbjct  379   GVTYNTLISGHAQNGNSENAIEIFKEMQLSGFKPDSVTIASLLTACASIGDIRKGKQLHS  438

Query  2391  LIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGRE  2212
              + K G+  +  +   L++ YVKC  +  A+  FN      +  W  ++    Q G   +
Sbjct  439   YVFKSGLSSEYIIEGSLLDLYVKCAAIETAHEFFNTTDRENVVLWNVMLVAYGQMGNLGK  498

Query  2211  AVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVD  2032
             + +LF ++   G++P++ TY S+L   T      +G Q+H+  IK GF    +V + L+D
Sbjct  499   SFDLFYEMQVEGVQPNQFTYPSILRTCTYVGALDLGEQIHTLTIKTGFELNVYVSSVLID  558

Query  2031  FYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHT  1852
              YSK   L  +  I + +TE D+V+W A+IAGY +   Y +A++  +EM   G++P+   
Sbjct  559   MYSKCGQLKSARAILERITEKDVVSWTAMIAGYAQHELYVEALRTFEEMQIHGIQPDNIG  618

Query  1851  YSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILP  1672
              +  +S C  + AIE G Q+H +    G+ +++ VG+ LI++YAKCGR+ +A   F+ + 
Sbjct  619   LASAISACAGIKAIEQGLQIHAQACISGYSTDISVGNALINLYAKCGRIEEAYSAFETVE  678

Query  1671  CKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN  1492
              K+ +SWN ++ G+AQ G  +EAL+++  M   GVK N  TF  V+SA  +   +++G  
Sbjct  679   VKDEISWNGLISGFAQSGHCEEALKVFVQMDRAGVKSNSFTFGSVVSASANMADIKQGKQ  738

Query  1491  -HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCN  1318
              H   +K  Y      N+   +V+L+A+ G  + A        E+ ++V W  +++GC+
Sbjct  739   IHARIIKTGYDSEIEVNN--ALVSLYAKCGSIEDAKMGFFGMSER-NEVSWNAMITGCS  794


 Score =   301 bits (770),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 175/586 (30%), Positives = 296/586 (51%), Gaps = 10/586 (2%)
 Frame = -2

Query  3069  SLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM  2890
             + + ++  C ++ S+   K  H +++K G   + +  N L+  Y+   E   A ++FD+M
Sbjct  112   TYASLLDDCLSSGSLAGAKRIHGKILKLGFDRESHLCNRLIDAYLAAGEFSDAVRMFDDM  171

Query  2889  PKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTG  2710
               R V +W ++I   S        L  F  M+ E    PN   +  AL AC+  G  R  
Sbjct  172   AHRTVASWNSMIMGLSRRKEHHNVLALFARMMRE-CRDPNPVAFANALRACN--GNNRYW  228

Query  2709  ---KEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCH  2539
                ++IH +I R     +  V N L++ Y K G +  A+LVF+ +   + V+W +++S  
Sbjct  229   PFVQQIHAKIIRYGFGCDFLVGNPLIDLYAKNGYVDLARLVFEELYSKDNVSWVAMVSGF  288

Query  2538  CQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQ  2359
              Q G  +E L ++ +  R+G++   ++    L AC   +    G  IH  ++K G   + 
Sbjct  289   SQNGLGEEALHLYSQMHRSGIIPTPYVLSSVLSACTKTDNFEHGKQIHAQVIKQGFSSET  348

Query  2358  YVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSS  2179
             +V   LV  Y +CG L  A   F+     +   +  LI G  Q G    A+ +F ++  S
Sbjct  349   FVGNALVTLYSRCGSLRRAEEIFSDMPHHDGVTYNTLISGHAQNGNSENAIEIFKEMQLS  408

Query  2178  GLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDES  1999
             G KP   T AS+L A     + + G QLHS++ K G +S   +  +L+D Y K   ++ +
Sbjct  409   GFKPDSVTIASLLTACASIGDIRKGKQLHSYVFKSGLSSEYIIEGSLLDLYVKCAAIETA  468

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDL  1819
              + F      ++V WN ++  Y + G+  ++  L  EM  EG++PN  TY  IL  C  +
Sbjct  469   HEFFNTTDRENVVLWNVMLVAYGQMGNLGKSFDLFYEMQVEGVQPNQFTYPSILRTCTYV  528

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
              A++ G+Q+H   +K GF+ NV V S LIDMY+KCG+L  AR + + +  K++VSW  M+
Sbjct  529   GALDLGEQIHTLTIKTGFELNVYVSSVLIDMYSKCGQLKSARAILERITEKDVVSWTAMI  588

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSAC-GHgglleegLNHFNSMKNNYG  1462
              GYAQH    EAL  +  MQ +G++P++I     +SAC G   + +    H  +  + Y 
Sbjct  589   AGYAQHELYVEALRTFEEMQIHGIQPDNIGLASAISACAGIKAIEQGLQIHAQACISGYS  648

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
                   +   ++NL+A+ G+ ++AY    +  E  D++ W  L+SG
Sbjct  649   TDISVGN--ALINLYAKCGRIEEAYSAFETV-EVKDEISWNGLISG  691


 Score =   250 bits (638),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 157/521 (30%), Positives = 267/521 (51%), Gaps = 7/521 (1%)
 Frame = -2

Query  2802  SMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKC  2623
             +++ E G   +  TY   L  C   G+    K IHG+I +      + + N L++ Y   
Sbjct  99    NLMEERGVRADCSTYASLLDDCLSSGSLAGAKRIHGKILKLGFDRESHLCNRLIDAYLAA  158

Query  2622  GLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIAL  2443
             G    A  +FD M      +W S++    +  E+   L +F R +R     N      AL
Sbjct  159   GEFSDAVRMFDDMAHRTVASWNSMIMGLSRRKEHHNVLALFARMMRECRDPNPVAFANAL  218

Query  2442  GAC-ASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPEL  2266
              AC  +     F   IH  I++ G   D  V   L++ Y K G + LA   F    + + 
Sbjct  219   RACNGNNRYWPFVQQIHAKIIRYGFGCDFLVGNPLIDLYAKNGYVDLARLVFEELYSKDN  278

Query  2265  HAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSF  2086
              +W A++ G  Q G G EA++L+ ++  SG+ P+    +SVL A T T  F+ G Q+H+ 
Sbjct  279   VSWVAMVSGFSQNGLGEEALHLYSQMHRSGIIPTPYVLSSVLSACTKTDNFEHGKQIHAQ  338

Query  2085  IIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQA  1906
             +IK GF+S TFV NALV  YS+   L  + +IF +M  +D VT+N LI+G+ ++G+ E A
Sbjct  339   VIKQGFSSETFVGNALVTLYSRCGSLRRAEEIFSDMPHHDGVTYNTLISGHAQNGNSENA  398

Query  1905  IKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDM  1726
             I++ +EM   G +P+  T + +L+ C  +  I  GKQ+H  + K G  S  ++  +L+D+
Sbjct  399   IEIFKEMQLSGFKPDSVTIASLLTACASIGDIRKGKQLHSYVFKSGLSSEYIIEGSLLDL  458

Query  1725  YAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITF  1546
             Y KC  +  A + F+    +N+V WN ML+ Y Q G   ++ +++  MQ  GV+PN  T+
Sbjct  459   YVKCAAIETAHEFFNTTDRENVVLWNVMLVAYGQMGNLGKSFDLFYEMQVEGVQPNQFTY  518

Query  1545  VGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSF  1369
               +L  C + G L+ G   H  ++K  + +    +  + +++++++ GQ K A   +   
Sbjct  519   PSILRTCTYVGALDLGEQIHTLTIKTGFELNVYVS--SVLIDMYSKCGQLKSARAILERI  576

Query  1368  PEKPDKVVWRCLLSGCNINKDFV--LGKYAAEEILSIDPND  1252
              EK D V W  +++G   ++ +V  L  +   +I  I P++
Sbjct  577   TEK-DVVSWTAMIAGYAQHELYVEALRTFEEMQIHGIQPDN  616


 Score = 78.2 bits (191),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/200 (26%), Positives = 88/200 (44%), Gaps = 1/200 (1%)
 Frame = -2

Query  1911  QAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLI  1732
              A  LL  M   G+  +  TY+ +L  C    ++   K++H +I+K GFD    + + LI
Sbjct  93    DAFFLLNLMEERGVRADCSTYASLLDDCLSSGSLAGAKRIHGKILKLGFDRESHLCNRLI  152

Query  1731  DMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDI  1552
             D Y   G   DA ++FD +  + + SWN+M++G ++       L +++ M      PN +
Sbjct  153   DAYLAAGEFSDAVRMFDDMAHRTVASWNSMIMGLSRRKEHHNVLALFARMMRECRDPNPV  212

Query  1551  TFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRS  1372
              F   L AC         +   ++    YG          +++L+A+ G    A      
Sbjct  213   AFANALRACNGNNRYWPFVQQIHAKIIRYGFGCDFLVGNPLIDLYAKNGYVDLARLVFEE  272

Query  1371  FPEKPDKVVWRCLLSGCNIN  1312
                K D V W  ++SG + N
Sbjct  273   LYSK-DNVSWVAMVSGFSQN  291



>gb|KCW57624.1| hypothetical protein EUGRSUZ_H00390 [Eucalyptus grandis]
Length=723

 Score =   454 bits (1167),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 245/692 (35%), Positives = 385/692 (56%), Gaps = 2/692 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +  L+ +IR C  +  +  G   H  ++K G   DVY    L+ +Y     I+ A+ +
Sbjct  26    PNEYILASLIRGCAQSGGLDGGAQVHGFVVKAGLGQDVYVGTSLVFLYANNGGIDGARSV  85

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD +  +  +TWT +IS +   G SE +L  F  MV   G  P+ Y     LSACS L  
Sbjct  86    FDSLLDKTDVTWTAIISGHVKCGRSEVSLQLFSQMV-NAGLLPDKYVISSVLSACSALEF  144

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IH  I R E  ++  V N L++ Y K G+ ++A+ +FD M   N ++W +++S 
Sbjct  145   VEGGKQIHAHILRREAEMDISVINVLIDCYTKSGMARTARRLFDHMEVRNMISWTTMISG  204

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q     E L++F          + F C   L +C S+E L  G  +H   +K  ++ D
Sbjct  205   YMQNSYDKEALKLFAEMTELDWNPDAFACTSVLTSCGSLEALIQGKQVHAYTIKANLEFD  264

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              +V  GL++ Y KC  L  A   F++     + ++ A+I G  +  K  EA++LF  +  
Sbjct  265   DFVKNGLIDMYAKCNALEDARKLFDVMEGKNVVSYNAMIEGYSRLEKLEEALDLFHSMRL  324

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
             +   PS  T+ S+LG        ++  Q+H  + K G +   F  ++L+D YSKS+L+ +
Sbjct  325   ASFSPSPLTFVSILGLSAALFALELSKQVHGLLSKSGISMDLFAGSSLIDVYSKSSLVRD  384

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F+EM + DIV WNA+  GY +    E+  KL  E+      PN  T++ +++   +
Sbjct  385   ARLVFEEMNDRDIVVWNAMFFGYSQQMDNEETFKLFLELQLSEQRPNDFTFASLITASSN  444

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L +++ G+Q H +I+K G D +  V + L+DMYAKCG + +ARK FD+  C+++  WN+M
Sbjct  445   LASLQHGQQFHSQIIKRGLDFDPFVTNALVDMYAKCGSIQEARKAFDLAICEDVACWNSM  504

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +  YAQHG  + AL+I+  M   GVKPN IT+VG+LSAC H GL+E+GL+H+NSM+   G
Sbjct  505   ITTYAQHGEAQAALQIFEEMIITGVKPNYITYVGILSACSHAGLVEDGLHHYNSMR-GLG  563

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I P T H AC+V++F R G+ K A DFI + P +P  +VWR LLS C    +  LGKYAA
Sbjct  564   IEPGTEHYACVVSVFGRAGRLKDAVDFIETMPIQPMALVWRSLLSACRNAGNSELGKYAA  623

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             E  +S+DP D+ ++  LSNI+A   MW +  ++R+ M +  + KE G SW E+ N+ + F
Sbjct  624   EMAISLDPTDSGSYTLLSNIFASKGMWFDVKKVRQRMDETGVLKEPGRSWIEVNNEAHVF  683

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPD  1006
              +          +  +L  L  Q  + GYVP+
Sbjct  684   VARDQTHYEADLIYSVLNYLILQTKEIGYVPN  715


 Score =   145 bits (367),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 124/217 (57%), Gaps = 0/217 (0%)
 Frame = -2

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             +P+E   AS++     +     G Q+H F++K G     +V  +LV  Y+ +  +D +  
Sbjct  25    RPNEYILASLIRGCAQSGGLDGGAQVHGFVVKAGLGQDVYVGTSLVFLYANNGGIDGARS  84

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPA  1813
             +F  + +   VTW A+I+G+++ G  E +++L  +M+  GL P+ +  S +LS C  L  
Sbjct  85    VFDSLLDKTDVTWTAIISGHVKCGRSEVSLQLFSQMVNAGLLPDKYVISSVLSACSALEF  144

Query  1812  IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIG  1633
             +E GKQ+H  I++   + ++ V + LID Y K G    AR++FD +  +N++SW TM+ G
Sbjct  145   VEGGKQIHAHILRREAEMDISVINVLIDCYTKSGMARTARRLFDHMEVRNMISWTTMISG  204

Query  1632  YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACG  1522
             Y Q+ + KEAL++++ M E    P+      VL++CG
Sbjct  205   YMQNSYDKEALKLFAEMTELDWNPDAFACTSVLTSCG  241



>ref|XP_006349117.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like 
[Solanum tuberosum]
Length=871

 Score =   458 bits (1179),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 247/695 (36%), Positives = 404/695 (58%), Gaps = 12/695 (2%)
 Frame = -2

Query  3072  MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDE  2893
             +SLS I++       +  GK  H   +K G   +V     L+ MY+    ++  QK+FDE
Sbjct  97    LSLSCILKVSACLFDLFFGKQVHTLCVKSGYFDNVSVGTSLVDMYMKMENVDDGQKMFDE  156

Query  2892  MP-KRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
             M   +NV+TWT+L+S YS   L ++AL  FR M++  G  PN +T+   L   +      
Sbjct  157   MEDNKNVVTWTSLLSGYSCNKLVDRALEVFRVMLV-GGVKPNAFTFATVLGVLADKCVVE  215

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G ++H  + +        V N L+N Y K G+++ A  VF+ M + N V+W  +++   
Sbjct  216   KGIQVHSMVIKCGFEATTSVGNSLINMYLKSGMVREATAVFEGMGDRNEVSWNGMIAGLV  275

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
               G Y E L++F     AGV +   +   A+  C  ++ L F   +H  ++K G   D  
Sbjct  276   TNGLYSEALKLFHMMRLAGVELTRSIYVTAVKLCTKLKELVFARQLHGRVMKNGFYFDNN  335

Query  2355  VVTGLVNFYVKCGQLGLAYNTFN-MASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSS  2179
             + T L+  Y KCG++  A+  F+ M     + +WTA+IGG +Q  +  +A NLFC++   
Sbjct  336   IRTALMVSYTKCGEMDDAFKLFSIMHKFRNVVSWTAMIGGYMQNNRQEQAANLFCQMKKD  395

Query  2178  GLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDES  1999
             G++P++ TY+++L A      FQV    H+ +IK  + S   V  AL+D Y K+   DE+
Sbjct  396   GIRPNDFTYSTILAAHPSISLFQV----HAEVIKTEYQSSPTVGTALLDAYVKTGDTDEA  451

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC-GD  1822
              K+F+E+ E DI+ W+A+++GY + G+ + A+++ ++++ +G+ PN  T+S +++ C   
Sbjct  452   AKVFEEIDEKDIIAWSAMLSGYAQKGNIQGAVRVFRQLVKDGVRPNEFTFSSVINACVTS  511

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             + ++E GKQ HC  +K G  + + V S L+ MYAK G +  A ++F   P ++LVSWN+M
Sbjct  512   MASVEQGKQFHCSAIKSGHSNALCVSSALVTMYAKRGNIESANEIFKRQPERDLVSWNSM  571

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             + GYAQHG+G++AL+I+  M++  +  ++ITF+GV+SAC H GLL EG  +F  M N++ 
Sbjct  572   ISGYAQHGYGRKALKIFEEMRKRNLDMDNITFIGVISACTHAGLLNEGQTYFEMMVNDFH  631

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I+P+    +CMV+L++R G   KA   I   P     +VWR LL+   ++++  LGK AA
Sbjct  632   ISPKMEIYSCMVDLYSRAGMLDKAMALINEMPFPAGAIVWRTLLAASRVHRNVELGKLAA  691

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             E ++S+ P D++A+V LSN+YA    W E A++RK+M  +++KKE G SW E++NK Y F
Sbjct  692   ENLISLQPQDSAAYVLLSNLYAATGDWQERAKVRKLMDVRKVKKEIGYSWIEVKNKTYSF  751

Query  1101  --SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDT  1003
                 + + L   + MK  L  L  +L DAGY PDT
Sbjct  752   MAGDASHPLSDSIYMK--LEELRGRLKDAGYQPDT  784


 Score =   237 bits (605),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 160/532 (30%), Positives = 265/532 (50%), Gaps = 9/532 (2%)
 Frame = -2

Query  2913  AQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACS  2734
             A ++FDE  ++ V     L+  YS    + +AL  F   +  +GF+ +  +    L   +
Sbjct  50    AHQVFDEKSQK-VSLNNHLLFEYSRNSFNVEALNLFVG-IHRNGFSIDGLSLSCILKVSA  107

Query  2733  CLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLE-PNTVTWA  2557
             CL     GK++H    ++    N  V   LV+ Y K   +   Q +FD M +  N VTW 
Sbjct  108   CLFDLFFGKQVHTLCVKSGYFDNVSVGTSLVDMYMKMENVDDGQKMFDEMEDNKNVVTWT  167

Query  2556  SLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKC  2377
             SLLS +      D  L +F   L  GV  N F     LG  A    +  G+ +H +++KC
Sbjct  168   SLLSGYSCNKLVDRALEVFRVMLVGGVKPNAFTFATVLGVLADKCVVEKGIQVHSMVIKC  227

Query  2376  GVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLF  2197
             G +    V   L+N Y+K G +  A   F         +W  +I G V  G   EA+ LF
Sbjct  228   GFEATTSVGNSLINMYLKSGMVREATAVFEGMGDRNEVSWNGMIAGLVTNGLYSEALKLF  287

Query  2196  CKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKS  2017
               +  +G++ +   Y + +   T  KE     QLH  ++K GF     +  AL+  Y+K 
Sbjct  288   HMMRLAGVELTRSIYVTAVKLCTKLKELVFARQLHGRVMKNGFYFDNNIRTALMVSYTKC  347

Query  2016  NLLDESFKIFQEMTEY-DIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCI  1840
               +D++FK+F  M ++ ++V+W A+I GY+++   EQA  L  +M  +G+ PN  TYS I
Sbjct  348   GEMDDAFKLFSIMHKFRNVVSWTAMIGGYMQNNRQEQAANLFCQMKKDGIRPNDFTYSTI  407

Query  1839  LSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNL  1660
             L+     P+I    QVH  ++K  + S+  VG+ L+D Y K G   +A KVF+ +  K++
Sbjct  408   LAAH---PSISLF-QVHAEVIKTEYQSSPTVGTALLDAYVKTGDTDEAAKVFEEIDEKDI  463

Query  1659  VSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNS  1480
             ++W+ ML GYAQ G  + A+ ++  + ++GV+PN+ TF  V++AC       E    F+ 
Sbjct  464   IAWSAMLSGYAQKGNIQGAVRVFRQLVKDGVRPNEFTFSSVINACVTSMASVEQGKQFHC  523

Query  1479  MKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
                  G +      + +V ++A++G  + A +  +  PE+ D V W  ++SG
Sbjct  524   SAIKSGHSNALCVSSALVTMYAKRGNIESANEIFKRQPER-DLVSWNSMISG  574


 Score =   134 bits (336),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 101/387 (26%), Positives = 182/387 (47%), Gaps = 36/387 (9%)
 Frame = -2

Query  2214  EAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALV  2035
             EA+NLF  +  +G      + + +L       +   G Q+H+  +K G+     V  +LV
Sbjct  79    EALNLFVGIHRNGFSIDGLSLSCILKVSACLFDLFFGKQVHTLCVKSGYFDNVSVGTSLV  138

Query  2034  DFYSKSNLLDESFKIFQEMTE-YDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNL  1858
             D Y K   +D+  K+F EM +  ++VTW +L++GY  +   ++A+++ + ML  G++PN 
Sbjct  139   DMYMKMENVDDGQKMFDEMEDNKNVVTWTSLLSGYSCNKLVDRALEVFRVMLVGGVKPNA  198

Query  1857  HTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDI  1678
              T++ +L +  D   +E G QVH  ++K GF++   VG++LI+MY K G + +A  VF+ 
Sbjct  199   FTFATVLGVLADKCVVEKGIQVHSMVIKCGFEATTSVGNSLINMYLKSGMVREATAVFEG  258

Query  1677  LPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleeg  1498
             +  +N VSWN M+ G   +G   EAL+++ MM+  GV+     +V  +  C     L   
Sbjct  259   MGDRNEVSWNGMIAGLVTNGLYSEALKLFHMMRLAGVELTRSIYVTAVKLCTKLKELVFA  318

Query  1497  LN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG-  1324
                H   MKN +         A MV+ + + G+   A+       +  + V W  ++ G 
Sbjct  319   RQLHGRVMKNGFYFDNNI-RTALMVS-YTKCGEMDDAFKLFSIMHKFRNVVSWTAMIGGY  376

Query  1323  -------------CNINKDFV------------------LGKYAAEEILSIDPNDTSAHV  1237
                          C + KD +                  L +  AE I +   +  +   
Sbjct  377   MQNNRQEQAANLFCQMKKDGIRPNDFTYSTILAAHPSISLFQVHAEVIKTEYQSSPTVGT  436

Query  1236  TLSNIYARLNMWDEAAQIRKMMKQKEL  1156
              L + Y +    DEAA++ + + +K++
Sbjct  437   ALLDAYVKTGDTDEAAKVFEEIDEKDI  463


 Score = 96.7 bits (239),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 76/262 (29%), Positives = 131/262 (50%), Gaps = 12/262 (5%)
 Frame = -2

Query  2094  HSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHY  1915
             HSF I        F   A    +  SN L  + ++F E ++  +   N L+  Y R+   
Sbjct  27    HSFAID-------FEEEAQTKSFESSNYL-PAHQVFDEKSQ-KVSLNNHLLFEYSRNSFN  77

Query  1914  EQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTL  1735
              +A+ L   +   G   +  + SCIL +   L  + +GKQVH   +K G+  NV VG++L
Sbjct  78    VEALNLFVGIHRNGFSIDGLSLSCILKVSACLFDLFFGKQVHTLCVKSGYFDNVSVGTSL  137

Query  1734  IDMYAKCGRLGDARKVFDILP-CKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPN  1558
             +DMY K   + D +K+FD +   KN+V+W ++L GY+ +     ALE++ +M   GVKPN
Sbjct  138   VDMYMKMENVDDGQKMFDEMEDNKNVVTWTSLLSGYSCNKLVDRALEVFRVMLVGGVKPN  197

Query  1557  DITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFI  1378
               TF  VL       ++E+G+   +SM    G    T+    ++N++ + G  ++A    
Sbjct  198   AFTFATVLGVLADKCVVEKGI-QVHSMVIKCGFEATTSVGNSLINMYLKSGMVREATAVF  256

Query  1377  RSFPEKPDKVVWRCLLSGCNIN  1312
                 ++ ++V W  +++G   N
Sbjct  257   EGMGDR-NEVSWNGMIAGLVTN  277



>gb|KDO77668.1| hypothetical protein CISIN_1g046775mg, partial [Citrus sinensis]
Length=771

 Score =   455 bits (1170),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 244/684 (36%), Positives = 387/684 (57%), Gaps = 3/684 (0%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             ++++CT+ K +  G   H  ++  G  SD +  N L+ MY        +++LFD +P+R+
Sbjct  1     VLKACTSKKDLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERS  60

Query  2877  VITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
             V++W +L S Y H    E+A+  F+ MVL  G  PN ++    ++AC+  G +  G++IH
Sbjct  61    VVSWNSLFSCYVHCDFLEEAVCFFKEMVLS-GIRPNEFSLSSMINACAGSGDSLLGRKIH  119

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEY-  2521
             G   +     + F +N LV+ Y K G L+ A  VF  +  P+ V+W ++++  C   E+ 
Sbjct  120   GYSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAG-CVLHEHN  178

Query  2520  DEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGL  2341
             D  L++F +   + +  N F    AL ACA +E    G  +HC ++K  +K D  V  GL
Sbjct  179   DWALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGL  238

Query  2340  VNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSE  2161
             V+ Y KCG +  A   F++     L AW  +I G +Q G   EA +LF  +   G+   +
Sbjct  239   VDMYAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQ  298

Query  2160  RTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQE  1981
              T ++VL +    +   V  Q+H+  +K  F S  ++ N+L+D Y K   ++++ KIF+E
Sbjct  299   TTLSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKE  358

Query  1980  MTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWG  1801
              +  D+V   ++I  Y + G  E+A+KL  EM    + P+    S +L+ C +L A E G
Sbjct  359   SSAVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQG  418

Query  1800  KQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQH  1621
             KQVH  I+K GF S+   G++L++MYAKCG + DA + F  +P + +VSW+ M+ G AQH
Sbjct  419   KQVHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQH  478

Query  1620  GFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNH  1441
             G GKEAL+++  M E+GV PN IT V VL AC H GL+ E  +HF SM+  +GI P   H
Sbjct  479   GRGKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEH  538

Query  1440  LACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSID  1261
              ACM+++  R G+ ++A + + + P + +  VW  LL    I K+  +G++AAE + +I+
Sbjct  539   YACMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIE  598

Query  1260  PNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNML  1081
             P  +S HV LSNIYA   MWD  A++R+ MK  +LKKE G SW E+++K+Y F+      
Sbjct  599   PEKSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSWIEVKDKVYTFTVGDRSH  658

Query  1080  LGEVSMKKLLIGLTAQLLDAGYVP  1009
                  +   L  ++  L  AGYVP
Sbjct  659   ARSKEIYAKLDEVSDLLNKAGYVP  682


 Score =   235 bits (600),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 142/484 (29%), Positives = 245/484 (51%), Gaps = 5/484 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + SLS +I +C  +   L G+  H   IK G  SD+++ N L+ MY     +E A  +
Sbjct  94    PNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDSDMFSANALVDMYAKVGNLEDAVAV  153

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F ++   ++++W  +I+       ++ AL  F+ M   +   PN +TY  AL AC+ +  
Sbjct  154   FKDIEHPDIVSWNAVIAGCVLHEHNDWALKLFQQMKSSE-INPNMFTYTSALKACAGMEL  212

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G+++H  + + E   +  V   LV+ Y KCG +  A+++F  M E N + W  ++S 
Sbjct  213   KELGRQLHCSLIKMEIKSDPIVGVGLVDMYAKCGSMDEARMIFHLMPEKNLIAWNIVISG  272

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             H Q G   E   +F    R GV  ++      L + AS + +G    +H L VK   + D
Sbjct  273   HLQNGGDMEAASLFPWMYREGVGFDQTTLSTVLKSVASFQAIGVCKQVHALSVKTAFESD  332

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              Y+V  L++ Y KCG +  A   F  +SA +L A T++I    Q G G EA+ L+ ++  
Sbjct  333   DYIVNSLIDAYGKCGHVEDAVKIFKESSAVDLVACTSMITAYAQFGLGEEALKLYLEMQD  392

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
               + P     +S+L A  +   ++ G Q+H  IIK GF S TF  N+LV+ Y+K   +D+
Sbjct  393   REINPDSFVCSSLLNACANLSAYEQGKQVHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDD  452

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             + + F E+ +  IV+W+A+I G  + G  ++A+++  +ML +G+ PN  T   +L  C  
Sbjct  453   ADRAFSEIPDRGIVSWSAMIGGLAQHGRGKEALQMFGQMLEDGVLPNHITLVSVLCACNH  512

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVG--STLIDMYAKCGRLGDARKVFDILPCK-NLVSW  1651
                +   K  H   M+  F    +    + +ID+  + G+  +A ++ D +P + N   W
Sbjct  513   AGLVAEAKH-HFESMEKKFGIQPMQEHYACMIDILGRAGKFQEAMELVDTMPFQANASVW  571

Query  1650  NTML  1639
               +L
Sbjct  572   GALL  575



>gb|KDP37589.1| hypothetical protein JCGZ_07935 [Jatropha curcas]
Length=879

 Score =   458 bits (1178),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 259/726 (36%), Positives = 411/726 (57%), Gaps = 16/726 (2%)
 Frame = -2

Query  3045  CTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITW  2866
             C  +K I  G  AH   +K G   DV     L+ MY+    +E  +++FDEM +RNV++W
Sbjct  117   CLFDKHI--GIQAHNYCVKSGFLEDVSVGTSLVDMYLKNGSVEEGRRMFDEMEERNVVSW  174

Query  2865  TTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIF  2686
             T+L++ Y+  GL+ +AL  F  M  E G  PN +T+   L A +    A  G ++H  + 
Sbjct  175   TSLLTGYAQNGLNVEALKCFFRMQAE-GIKPNPFTFATVLGALADKAMAEKGIKVHTMVV  233

Query  2685  RAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLR  2506
             +     N FV N L+N Y K G++  A+ +F++M + + +TW S+++ +   G Y E   
Sbjct  234   KNGFEENRFVCNSLINMYSKSGMVGEARAIFESMADRDIITWHSMVTGYVTNGLYSEAFE  293

Query  2505  IFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYV  2326
              F     AG+ +   L    + +CA+++ LGF   +HC ++K G   D  V T L+  Y 
Sbjct  294   TFYHLRLAGLKLTSMLFASVIKSCANIKELGFARQLHCQVLKGGFDFDHNVRTALMVAYS  353

Query  2325  KCGQLGLAYNTFN-MASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYA  2149
             K  ++  A+  F+ M     + +WTA+I G +Q G+ ++A+NLFC++   G++P+  TY+
Sbjct  354   KSKEMDDAFKIFSAMHEFRNVVSWTAMISGYLQNGREKQALNLFCQMSRDGVRPNNYTYS  413

Query  2148  SVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEY  1969
             ++L A      F++    H+  IK  +     V  AL+D Y K   L E+ K+F+ + E 
Sbjct  414   TILAAQQVVSPFEI----HAQAIKSNYEKSASVGTALLDAYVKLGYLVEASKVFERIDEK  469

Query  1968  DIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG-DLPAIEWGKQV  1792
             DIV W+A+IAGY + G  E A+K+  +M  EG+EPN +T+S +++ C     A+E GK  
Sbjct  470   DIVAWSAMIAGYAQIGDTEGAVKIFIQMAKEGVEPNEYTFSSVINACAVPTAAVEQGKPF  529

Query  1791  HCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFG  1612
             H   +K  F+  + V S L+ MYAK G +  A +VF     +++VSWN+M+ GYAQHG G
Sbjct  530   HAWSIKSRFNDALCVSSALVTMYAKRGDIESASEVFKRQEVRDIVSWNSMVSGYAQHGHG  589

Query  1611  KEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLAC  1432
              +ALE++  MQ   ++ +D+TF GVL+AC H GL+EEG  HFN M  ++ I P+  H +C
Sbjct  590   TKALEVFKEMQRLKLELDDVTFTGVLTACTHAGLVEEGQRHFNIMVKSHHIEPKIEHYSC  649

Query  1431  MVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPND  1252
             MV+L++R G   KA D I S P       WR LL+   ++ +  LGK AAE+++++ P  
Sbjct  650   MVDLYSRAGMLGKAMDVINSMPFPAGATEWRTLLAASRLHHNVDLGKLAAEKLITLQPQH  709

Query  1251  TSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF--SSSYNMLL  1078
             ++A+V LSN+YA    W E A+IRK+M ++++KKE G SW E++ K Y F  +   + + 
Sbjct  710   SAAYVLLSNLYAAQGNWQERAKIRKLMDERKVKKEAGYSWIEVKKKTYSFLAADVSHPMS  769

Query  1077  GEVSMKKLLIGLTAQLLDAGYVPDTKLSF-DYGD*LGLSI--RHLSRFVKFDPPISTTGG  907
              E+  K  L  L+ +L +AGY PDT     D  D    ++  +H  R       I+T  G
Sbjct  770   DEIYSK--LAELSIRLKNAGYQPDTNYVLQDIDDEHKETVLSQHSERLAIAYGLIATPAG  827

Query  906   SKLAVV  889
             + L +V
Sbjct  828   TPLQIV  833


 Score =   223 bits (567),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 124/430 (29%), Positives = 229/430 (53%), Gaps = 7/430 (2%)
 Frame = -2

Query  2610  SAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACA  2431
             +A  VFD   +   +    LL  + +   + E + +F+   R+G+L++       L AC 
Sbjct  57    AAHHVFDKSPQQGLLQCNHLLFEYSRNNSHHEVVNLFVGIHRSGILIDGSTLSCVLKACG  116

Query  2430  SVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTA  2251
              +     G+  H   VK G   D  V T LV+ Y+K G +      F+      + +WT+
Sbjct  117   CLFDKHIGIQAHNYCVKSGFLEDVSVGTSLVDMYLKNGSVEEGRRMFDEMEERNVVSWTS  176

Query  2250  LIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLG  2071
             L+ G  Q G   EA+  F ++ + G+KP+  T+A+VLGA  D    + G+++H+ ++K G
Sbjct  177   LLTGYAQNGLNVEALKCFFRMQAEGIKPNPFTFATVLGALADKAMAEKGIKVHTMVVKNG  236

Query  2070  FNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQ  1891
             F    FVCN+L++ YSKS ++ E+  IF+ M + DI+TW++++ GY+ +G Y +A +   
Sbjct  237   FEENRFVCNSLINMYSKSGMVGEARAIFESMADRDIITWHSMVTGYVTNGLYSEAFETFY  296

Query  1890  EMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCG  1711
              +   GL+     ++ ++  C ++  + + +Q+HC+++K GFD +  V + L+  Y+K  
Sbjct  297   HLRLAGLKLTSMLFASVIKSCANIKELGFARQLHCQVLKGGFDFDHNVRTALMVAYSKSK  356

Query  1710  RLGDARKVFDIL-PCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVL  1534
              + DA K+F  +   +N+VSW  M+ GY Q+G  K+AL ++  M  +GV+PN+ T+  +L
Sbjct  357   EMDDAFKIFSAMHEFRNVVSWTAMISGYLQNGREKQALNLFCQMSRDGVRPNNYTYSTIL  416

Query  1533  SACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPD  1354
             +A     ++     H  ++K+NY  +        +++ + + G   +A        EK D
Sbjct  417   AA---QQVVSPFEIHAQAIKSNYEKSASVG--TALLDAYVKLGYLVEASKVFERIDEK-D  470

Query  1353  KVVWRCLLSG  1324
              V W  +++G
Sbjct  471   IVAWSAMIAG  480


 Score =   142 bits (359),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 116/443 (26%), Positives = 197/443 (44%), Gaps = 26/443 (6%)
 Frame = -2

Query  3072  MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDE  2893
             M  + +I+SC   K +   +  H Q++K G   D      L+  Y    E++ A K+F  
Sbjct  308   MLFASVIKSCANIKELGFARQLHCQVLKGGFDFDHNVRTALMVAYSKSKEMDDAFKIFSA  367

Query  2892  MPK-RNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
             M + RNV++WT +IS Y   G  ++AL  F  M   DG  PN+YTY   L+A   +    
Sbjct  368   MHEFRNVVSWTAMISGYLQNGREKQALNLFCQMS-RDGVRPNNYTYSTILAAQQVVSPF-  425

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
                EIH +  ++    +  V   L++ Y K G L  A  VF+ + E + V W+++++ + 
Sbjct  426   ---EIHAQAIKSNYEKSASVGTALLDAYVKLGYLVEASKVFERIDEKDIVAWSAMIAGYA  482

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACA-SVECLGFGMGIHCLIVKCGVKMDQ  2359
             Q G+ +  ++IF++  + GV  NE+     + ACA     +  G   H   +K       
Sbjct  483   QIGDTEGAVKIFIQMAKEGVEPNEYTFSSVINACAVPTAAVEQGKPFHAWSIKSRFNDAL  542

Query  2358  YVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSS  2179
              V + LV  Y K G +  A   F      ++ +W +++ G  Q G G +A+ +F ++   
Sbjct  543   CVSSALVTMYAKRGDIESASEVFKRQEVRDIVSWNSMVSGYAQHGHGTKALEVFKEMQRL  602

Query  2178  GLKPSERTYASVLGAFTDT-------KEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSK  2020
              L+  + T+  VL A T         + F + ++ H    K+   S       +VD YS+
Sbjct  603   KLELDDVTFTGVLTACTHAGLVEEGQRHFNIMVKSHHIEPKIEHYS------CMVDLYSR  656

Query  2019  SNLLDESFKIFQEMT-EYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSC  1843
             + +L ++  +   M        W  L+A   R  H     KL  E L   L+P    +S 
Sbjct  657   AGMLGKAMDVINSMPFPAGATEWRTLLAAS-RLHHNVDLGKLAAEKLIT-LQPQ---HSA  711

Query  1842  ILSICGDLPAIEWGKQVHCRIMK  1774
                +  +L A +   Q   +I K
Sbjct  712   AYVLLSNLYAAQGNWQERAKIRK  734



>ref|XP_010652859.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 
[Vitis vinifera]
Length=847

 Score =   457 bits (1176),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 247/693 (36%), Positives = 387/693 (56%), Gaps = 3/693 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +  L+ +IR+CT    +  G   H  +++ G   DVY    L+  Y     IE A+ +
Sbjct  149   PNEFVLASVIRACTQLGVVEKGAQLHGFVVRSGFDQDVYVGTSLIDFYSKNGNIEEARLV  208

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD++ ++  +TWTT+I+ Y+  G S  +L  F  M  E    P+ Y     LSACS L  
Sbjct  209   FDQLSEKTAVTWTTIIAGYTKCGRSAVSLELFAQM-RETNVVPDRYVVSSVLSACSMLEF  267

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IH  + R    ++  V N L++FY KC  +K+ + +FD M+  N ++W +++S 
Sbjct  268   LEGGKQIHAYVLRRGTEMDVSVVNVLIDFYTKCNRVKAGRKLFDQMVVKNIISWTTMISG  327

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q     E +++F    R G   + F C   L +C S E L  G  +H   +K  ++ D
Sbjct  328   YMQNSFDWEAMKLFGEMNRLGWKPDGFACTSVLTSCGSREALEQGRQVHAYTIKANLESD  387

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
             ++V  GL++ Y K   L  A   F++ +   + ++ A+I G   Q K  EA+ LF ++  
Sbjct  388   EFVKNGLIDMYAKSNLLIDAKKVFDVMAEQNVISYNAMIEGYSSQEKLSEALELFHEMRV  447

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
                 PS  T+ S+LG        ++  Q+H  IIK G +   F  +AL+D YSK + + +
Sbjct  448   RLFPPSLLTFVSLLGVSASLFALELSKQIHGLIIKFGVSLDLFAGSALIDVYSKCSYVKD  507

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F+EM E DIV WNA+  GY +    E+A+KL   + F   +PN  T++ +++   +
Sbjct  508   ARHVFEEMNEKDIVVWNAMFFGYTQHLENEEALKLYSTLQFSRQKPNEFTFAALITAASN  567

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L ++  G+Q H +++K G D    V + L+DMYAKCG + +ARK+F+    +++V WN+M
Sbjct  568   LASLRHGQQFHNQLVKMGLDFCPFVTNALVDMYAKCGSIEEARKMFNSSIWRDVVCWNSM  627

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +  +AQHG  +EAL ++  M + G++PN +TFV VLSAC H G +E+GLNHFNSM   +G
Sbjct  628   ISTHAQHGEAEEALGMFREMMKEGIQPNYVTFVAVLSACSHAGRVEDGLNHFNSMP-GFG  686

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I P T H AC+V+L  R G+  +A +FI   P +P  +VWR LLS C I  +  LGKYAA
Sbjct  687   IKPGTEHYACVVSLLGRSGKLFEAKEFIEKMPIEPAAIVWRSLLSACRIAGNVELGKYAA  746

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             E  +S DP D+ +++ LSNI+A   MW +  ++R  M   E+ KE G SW E+ NK+  F
Sbjct  747   EMAISTDPKDSGSYILLSNIFASKGMWADVKKVRDRMDSSEVVKEPGRSWIEVNNKVNVF  806

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDT  1003
              +  +    E  +  +L  L   +  AGYVPD 
Sbjct  807   IAR-DTTHREADIGSVLDILIQHIKGAGYVPDA  838


 Score =   339 bits (870),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 185/586 (32%), Positives = 315/586 (54%), Gaps = 4/586 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +   + +++   +   I+  K  H Q+I  G +SD +  N L+++      ++ A+ +
Sbjct  47    PKRREFANLLQLSISRNPIIHYKIIHGQIIVSGLQSDTFLANILINVCSKSDRVDNARVV  106

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD+MP +N+ITW++++S YS  G SE+AL  F  +  + G  PN +     + AC+ LG 
Sbjct  107   FDKMPHKNLITWSSMVSMYSQQGYSEEALMVFVDLQRKSGEHPNEFVLASVIRACTQLGV  166

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G ++HG + R+    + +V   L++FY K G ++ A+LVFD + E   VTW ++++ 
Sbjct  167   VEKGAQLHGFVVRSGFDQDVYVGTSLIDFYSKNGNIEEARLVFDQLSEKTAVTWTTIIAG  226

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + +CG     L +F +     V+ + ++    L AC+ +E L  G  IH  +++ G +MD
Sbjct  227   YTKCGRSAVSLELFAQMRETNVVPDRYVVSSVLSACSMLEFLEGGKQIHAYVLRRGTEMD  286

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
               VV  L++FY KC ++      F+      + +WT +I G +Q     EA+ LF ++  
Sbjct  287   VSVVNVLIDFYTKCNRVKAGRKLFDQMVVKNIISWTTMISGYMQNSFDWEAMKLFGEMNR  346

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              G KP      SVL +    +  + G Q+H++ IK    S  FV N L+D Y+KSNLL +
Sbjct  347   LGWKPDGFACTSVLTSCGSREALEQGRQVHAYTIKANLESDEFVKNGLIDMYAKSNLLID  406

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             + K+F  M E +++++NA+I GY       +A++L  EM      P+L T+  +L +   
Sbjct  407   AKKVFDVMAEQNVISYNAMIEGYSSQEKLSEALELFHEMRVRLFPPSLLTFVSLLGVSAS  466

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L A+E  KQ+H  I+K G   ++  GS LID+Y+KC  + DAR VF+ +  K++V WN M
Sbjct  467   LFALELSKQIHGLIIKFGVSLDLFAGSALIDVYSKCSYVKDARHVFEEMNEKDIVVWNAM  526

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSM-KNNY  1465
               GY QH   +EAL++YS +Q +  KPN+ TF  +++A  +   L  G    N + K   
Sbjct  527   FFGYTQHLENEEALKLYSTLQFSRQKPNEFTFAALITAASNLASLRHGQQFHNQLVKMGL  586

Query  1464  GITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLS  1327
                P   +   +V+++A+ G  ++A     S   + D V W  ++S
Sbjct  587   DFCPFVTN--ALVDMYAKCGSIEEARKMFNSSIWR-DVVCWNSMIS  629


 Score = 99.4 bits (246),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 104/203 (51%), Gaps = 28/203 (14%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF  2929
             S++  + + P + + + +I + +   S+  G+  H QL+K G     +  N L+ MY   
Sbjct  544   STLQFSRQKPNEFTFAALITAASNLASLRHGQQFHNQLVKMGLDFCPFVTNALVDMYAKC  603

Query  2928  HEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGA  2749
               IE A+K+F+    R+V+ W ++IS+++  G +E+ALG FR M +++G  PN+ T+V  
Sbjct  604   GSIEEARKMFNSSIWRDVVCWNSMISTHAQHGEAEEALGMFREM-MKEGIQPNYVTFVAV  662

Query  2748  LSACSCLGAARTGKEIHGRIFRAEETLNNFVS-------------NCLVNFYGKCGLLKS  2608
             LSACS  G             R E+ LN+F S              C+V+  G+ G L  
Sbjct  663   LSACSHAG-------------RVEDGLNHFNSMPGFGIKPGTEHYACVVSLLGRSGKLFE  709

Query  2607  AQLVFDAM-LEPNTVTWASLLSC  2542
             A+   + M +EP  + W SLLS 
Sbjct  710   AKEFIEKMPIEPAAIVWRSLLSA  732


 Score = 76.3 bits (186),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 94/184 (51%), Gaps = 3/184 (2%)
 Frame = -2

Query  1872  LEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDAR  1693
             L P    ++ +L +      I   K +H +I+  G  S+  + + LI++ +K  R+ +AR
Sbjct  45    LRPKRREFANLLQLSISRNPIIHYKIIHGQIIVSGLQSDTFLANILINVCSKSDRVDNAR  104

Query  1692  KVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIY-SMMQENGVKPNDITFVGVLSACGHg  1516
              VFD +P KNL++W++M+  Y+Q G+ +EAL ++  + +++G  PN+     V+ AC   
Sbjct  105   VVFDKMPHKNLITWSSMVSMYSQQGYSEEALMVFVDLQRKSGEHPNEFVLASVIRACTQL  164

Query  1515  glleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRC  1336
             G++E+G    +      G          +++ +++ G  ++A        EK   V W  
Sbjct  165   GVVEKGA-QLHGFVVRSGFDQDVYVGTSLIDFYSKNGNIEEARLVFDQLSEKT-AVTWTT  222

Query  1335  LLSG  1324
             +++G
Sbjct  223   IIAG  226



>emb|CDP06710.1| unnamed protein product [Coffea canephora]
Length=759

 Score =   454 bits (1167),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 245/687 (36%), Positives = 399/687 (58%), Gaps = 3/687 (0%)
 Frame = -2

Query  3063  SQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPK  2884
             + +I SC + + +  G+  H  ++    ++D+   NH+L+MY     +  A+K+FDEM +
Sbjct  71    THMISSCASLRFLERGRKIHKHILMSNFQADMILQNHILNMYGKCGSVTDARKVFDEMAE  130

Query  2883  RNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKE  2704
             RNV++WT++I+SYS      +A+  +  M L+ G  P+ YT+   + ACS L     G++
Sbjct  131   RNVVSWTSVIASYSQNDQEIEAINLYSQM-LQAGLLPDQYTFGSIIKACSSLSEVMLGRQ  189

Query  2703  IHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGE  2524
             +H  + ++E   +    N L+  Y K GL+  AQ VF  +   + ++W+S+++   Q G 
Sbjct  190   LHAHVIKSEHGSHLIAQNALITMYTKFGLIIDAQDVFLRIKLKDLISWSSMIAGFSQLGY  249

Query  2523  YDEGLRIFLRSLR-AGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVT  2347
               E L  F   LR +    NEF+ G    AC  +    +G  IH + +K G + + Y   
Sbjct  250   ELEALYCFREMLRQSNCEPNEFVFGSVFTACGRLIQPEYGRQIHGVSIKFGFERNAYSGC  309

Query  2346  GLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKP  2167
              + + Y KCG  G +   F     P++ +W A+I G    G+  +A++ F ++ +  LKP
Sbjct  310   AVTDMYGKCGLFGASETAFFQIEDPDVVSWNAIISGFAYGGESNKALSTFSQMRNLNLKP  369

Query  2166  SERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
              + T  S+L AFT         Q+HS+IIK GF+    VCN L+  Y+  + + E+FKIF
Sbjct  370   DDVTIRSLLCAFTSPSYLFQAKQIHSYIIKTGFDLDVPVCNTLLSIYASCSDVAEAFKIF  429

Query  1986  QEMT-EYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAI  1810
              E+  + D+V+WNA+I+  +++   E+A  LL  ML    +P+  T   +L  CG + ++
Sbjct  430   YEIQCKADLVSWNAIISVCMQNDRAEKAFSLLNLMLLSPNKPDHITVVNVLVCCGKVTSL  489

Query  1809  EWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGY  1630
             E G Q HC   K     ++ + + L+DMY KCG L +A+K+FD +   ++V W+++++GY
Sbjct  490   EMGDQTHCYACKTALKQDLAIMNGLVDMYVKCGSLENAQKLFDCIENPDVVLWSSLIVGY  549

Query  1629  AQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPR  1450
             AQ G+G+ AL++++ M+ +GVKPN++TFVGVL+AC H GL+EEG + FN+M+  + I P 
Sbjct  550   AQFGYGEAALKLFTRMRNSGVKPNEVTFVGVLTACSHVGLVEEGWHLFNTMEMQHRIAPT  609

Query  1449  TNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEIL  1270
               H +C+V+L AR G   +A  FI      PD VVW+ LL+ C  +K+  +GK AAE IL
Sbjct  610   REHCSCVVDLLARAGCIDEAEAFINQMAFDPDIVVWKTLLAACRTHKNIEIGKRAAENIL  669

Query  1269  SIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSY  1090
              IDP +++AHV LS+IYA    W + A +R +MKQK ++K  G SW E+++KI+ FS+  
Sbjct  670   KIDPYNSTAHVLLSSIYASTGYWKDFAALRNLMKQKGVRKVPGQSWIEVKDKIHVFSAED  729

Query  1089  NMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
              +      +  +L  +  Q+LDAGYVP
Sbjct  730   GLHPERGKIYIMLEEMFLQMLDAGYVP  756


 Score =   217 bits (553),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 151/517 (29%), Positives = 253/517 (49%), Gaps = 12/517 (2%)
 Frame = -2

Query  2856  ISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAE  2677
             ISS     L ++AL +F  +     +     TY   +S+C+ L     G++IH  I  + 
Sbjct  38    ISSLCKQKLFKEALKAFDFIEKSTSYNVYPSTYTHMISSCASLRFLERGRKIHKHILMSN  97

Query  2676  ETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFL  2497
                +  + N ++N YGKCG +  A+ VFD M E N V+W S+++ + Q  +  E + ++ 
Sbjct  98    FQADMILQNHILNMYGKCGSVTDARKVFDEMAERNVVSWTSVIASYSQNDQEIEAINLYS  157

Query  2496  RSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCG  2317
             + L+AG+L +++  G  + AC+S+  +  G  +H  ++K            L+  Y K G
Sbjct  158   QMLQAGLLPDQYTFGSIIKACSSLSEVMLGRQLHAHVIKSEHGSHLIAQNALITMYTKFG  217

Query  2316  QLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL-SSGLKPSERTYASVL  2140
              +  A + F      +L +W+++I G  Q G   EA+  F ++L  S  +P+E  + SV 
Sbjct  218   LIIDAQDVFLRIKLKDLISWSSMIAGFSQLGYELEALYCFREMLRQSNCEPNEFVFGSVF  277

Query  2139  GAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIV  1960
              A     + + G Q+H   IK GF    +   A+ D Y K  L   S   F ++ + D+V
Sbjct  278   TACGRLIQPEYGRQIHGVSIKFGFERNAYSGCAVTDMYGKCGLFGASETAFFQIEDPDVV  337

Query  1959  TWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRI  1780
             +WNA+I+G+   G   +A+    +M    L+P+  T   +L        +   KQ+H  I
Sbjct  338   SWNAIISGFAYGGESNKALSTFSQMRNLNLKPDDVTIRSLLCAFTSPSYLFQAKQIHSYI  397

Query  1779  MKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-NLVSWNTMLIGYAQHGFGKEA  1603
             +K GFD +V V +TL+ +YA C  + +A K+F  + CK +LVSWN ++    Q+   ++A
Sbjct  398   IKTGFDLDVPVCNTLLSIYASCSDVAEAFKIFYEIQCKADLVSWNAIISVCMQNDRAEKA  457

Query  1602  LEIYSMMQENGVKPNDITFVGVLSACGHggllee-gLNHFNSMKNNYGITPRTNHLACM-  1429
               + ++M  +  KP+ IT V VL  CG    LE     H  + K     T     LA M 
Sbjct  458   FSLLNLMLLSPNKPDHITVVNVLVCCGKVTSLEMGDQTHCYACK-----TALKQDLAIMN  512

Query  1428  --VNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
               V+++ + G  + A        E PD V+W  L+ G
Sbjct  513   GLVDMYVKCGSLENAQKLFDCI-ENPDVVLWSSLIVG  548


 Score =   209 bits (531),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 140/515 (27%), Positives = 244/515 (47%), Gaps = 16/515 (3%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF  2929
             S +L     P + +   II++C++   ++ G+  HA +IK    S +   N L++MY  F
Sbjct  157   SQMLQAGLLPDQYTFGSIIKACSSLSEVMLGRQLHAHVIKSEHGSHLIAQNALITMYTKF  216

Query  2928  HEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGA  2749
               I  AQ +F  +  +++I+W+++I+ +S +G   +AL  FR M+ +    PN + +   
Sbjct  217   GLIIDAQDVFLRIKLKDLISWSSMIAGFSQLGYELEALYCFREMLRQSNCEPNEFVFGSV  276

Query  2748  LSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNT  2569
              +AC  L     G++IHG   +     N +    + + YGKCGL  +++  F  + +P+ 
Sbjct  277   FTACGRLIQPEYGRQIHGVSIKFGFERNAYSGCAVTDMYGKCGLFGASETAFFQIEDPDV  336

Query  2568  VTWASLLSCHCQCGEYDEGLRIF--LRSLR---AGVLVNEFLCGIALGACASVECLGFGM  2404
             V+W +++S     GE ++ L  F  +R+L      V +   LC     A  S   L    
Sbjct  337   VSWNAIISGFAYGGESNKALSTFSQMRNLNLKPDDVTIRSLLC-----AFTSPSYLFQAK  391

Query  2403  GIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTF-NMASAPELHAWTALIGGCVQQ  2227
              IH  I+K G  +D  V   L++ Y  C  +  A+  F  +    +L +W A+I  C+Q 
Sbjct  392   QIHSYIIKTGFDLDVPVCNTLLSIYASCSDVAEAFKIFYEIQCKADLVSWNAIISVCMQN  451

Query  2226  GKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVC  2047
              +  +A +L   +L S  KP   T  +VL         ++G Q H +  K        + 
Sbjct  452   DRAEKAFSLLNLMLLSPNKPDHITVVNVLVCCGKVTSLEMGDQTHCYACKTALKQDLAIM  511

Query  2046  NALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLE  1867
             N LVD Y K   L+ + K+F  +   D+V W++LI GY + G+ E A+KL   M   G++
Sbjct  512   NGLVDMYVKCGSLENAQKLFDCIENPDVVLWSSLIVGYAQFGYGEAALKLFTRMRNSGVK  571

Query  1866  PNLHTYSCILSICGDLPAIEWGKQVHCRI-MKPGFDSNVVVGSTLIDMYAKCGRLGDARK  1690
             PN  T+  +L+ C  +  +E G  +   + M+          S ++D+ A+ G + +A  
Sbjct  572   PNEVTFVGVLTACSHVGLVEEGWHLFNTMEMQHRIAPTREHCSCVVDLLARAGCIDEAEA  631

Query  1689  VFDILPCK-NLVSWNTMLIGYAQHG---FGKEALE  1597
               + +    ++V W T+L     H     GK A E
Sbjct  632   FINQMAFDPDIVVWKTLLAACRTHKNIEIGKRAAE  666


 Score =   139 bits (351),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/331 (28%), Positives = 169/331 (51%), Gaps = 17/331 (5%)
 Frame = -2

Query  2214  EAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALV  2035
             +A +   K  S  + PS  TY  ++ +    +  + G ++H  I+   F +   + N ++
Sbjct  52    KAFDFIEKSTSYNVYPS--TYTHMISSCASLRFLERGRKIHKHILMSNFQADMILQNHIL  109

Query  2034  DFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLH  1855
             + Y K   + ++ K+F EM E ++V+W ++IA Y ++    +AI L  +ML  GL P+ +
Sbjct  110   NMYGKCGSVTDARKVFDEMAERNVVSWTSVIASYSQNDQEIEAINLYSQMLQAGLLPDQY  169

Query  1854  TYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDIL  1675
             T+  I+  C  L  +  G+Q+H  ++K    S+++  + LI MY K G + DA+ VF  +
Sbjct  170   TFGSIIKACSSLSEVMLGRQLHAHVIKSEHGSHLIAQNALITMYTKFGLIIDAQDVFLRI  229

Query  1674  PCKNLVSWNTMLIGYAQHGFGKEALEIY-SMMQENGVKPNDITFVGVLSACGHgglleeg  1498
               K+L+SW++M+ G++Q G+  EAL  +  M++++  +PN+  F  V +ACG     E G
Sbjct  230   KLKDLISWSSMIAGFSQLGYELEALYCFREMLRQSNCEPNEFVFGSVFTACGRLIQPEYG  289

Query  1497  LN-HFNSMKNNYGITPRTNHLACMVNLFARK----GQTKKAYDFIRSFPEKPDKVVWRCL  1333
                H  S+K  +    R  +  C V     K    G ++ A+  I    E PD V W  +
Sbjct  290   RQIHGVSIKFGF---ERNAYSGCAVTDMYGKCGLFGASETAFFQI----EDPDVVSWNAI  342

Query  1332  LSGCNI--NKDFVLGKYAAEEILSIDPNDTS  1246
             +SG       +  L  ++    L++ P+D +
Sbjct  343   ISGFAYGGESNKALSTFSQMRNLNLKPDDVT  373



>ref|XP_004971430.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like 
isoform X1 [Setaria italica]
 ref|XP_004971431.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like 
isoform X2 [Setaria italica]
Length=822

 Score =   456 bits (1172),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 238/693 (34%), Positives = 400/693 (58%), Gaps = 1/693 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +  L+ ++R+CT ++++  G+  H    K G   +++    L+++Y     ++ A ++
Sbjct  121   PNEFLLASVLRACTQSRAVPFGEQVHGTAFKLGLDVNLFVGTALINLYAKLVCMDAAMRV  180

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F  +P +N +TWT +I+ YS +G    +L  F+ M L+ G  P+ +    A+SACS L  
Sbjct  181   FHALPAKNPVTWTVVITGYSQIGQGGLSLDLFQKMGLQ-GVRPDRFVLASAVSACSGLAF  239

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
              + G++IHG  +R+   ++  V N L++ Y KC     A+ +FD     N V+W ++++ 
Sbjct  240   LQGGRQIHGYAYRSAAGMDASVINALIDLYCKCSRPLVARKLFDCTENHNLVSWTTMIAG  299

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q     E + +F +  RAG   + F     L +C S+E +  G  IH   +K  ++ D
Sbjct  300   YMQNSLDAEAMDMFWQMCRAGWQPDVFAFTSILNSCGSLEAIWQGRQIHAHAIKANLETD  359

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
             +YV   L++ Y KC  L  A + F+  +  +  ++ A+I G  +QG  +EA+++F ++  
Sbjct  360   EYVKNALIDMYAKCDHLTAARSVFDALAHDDAVSYNAMIEGYARQGDLKEALHIFRRMRY  419

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
               L+P+  T+ S+LG  +     ++  Q+H  II+ G +   +V +AL+D YSK +L+D+
Sbjct  420   CSLRPNLLTFVSLLGVSSFQSAIELSKQIHGLIIRSGTSVDLYVGSALIDAYSKCSLVDD  479

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F  M   D+  WNA+I G+ ++   E+A+KL  ++   G+ PN  T+  ++++  +
Sbjct  480   AKAVFLMMQNRDMAIWNAMIFGHAQNEQGEEAVKLFSQLRASGVTPNEFTFVALVTVASN  539

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L ++  G+Q H +I+K G D N  V + LIDMYAKCG + +   +F+    K+++ WN+M
Sbjct  540   LASMFHGQQFHAQIIKAGADINPHVSNALIDMYAKCGFIKEGWLLFESTCGKDVICWNSM  599

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +  Y+QHG  +EAL ++ +M+E GV+PN +TFVGVL+AC H GL++EGL+HFNSMK  YG
Sbjct  600   ISTYSQHGHAEEALRVFQLMREAGVEPNYVTFVGVLAACAHAGLVDEGLHHFNSMKTEYG  659

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I P T H A +VN+  R G+   A +FI   P KP   VWR LLS C +  +  +G+YAA
Sbjct  660   IEPGTEHYASVVNILGRSGKLHSAKEFIERMPIKPAAAVWRSLLSACRLFGNVEIGRYAA  719

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             E  L +DP D+  +V LSNIYA   +W +  ++R  M    + KE G SW E+  +++ F
Sbjct  720   EMALLVDPLDSGPYVLLSNIYASKGLWADVQKLRLGMDYAGMMKEPGYSWIEVMMEVHTF  779

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDT  1003
              +         S+  +L  LT+ L D GY+PDT
Sbjct  780   IARGTEHPQAESIYAVLDNLTSLLKDFGYLPDT  812


 Score =   301 bits (770),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 178/600 (30%), Positives = 306/600 (51%), Gaps = 17/600 (3%)
 Frame = -2

Query  3084  GPLKMSLSQIIRSCTTNK------SILSGK-------AAHAQLIKYGSKSDVYTNNHLLS  2944
             GPL  + S +  SC          S L+G        AAHA+ +      D++  N LL 
Sbjct  5     GPLSRAPSSVASSCQARSLAQTLLSCLAGDRLRRLLPAAHARAVVSEGLDDLFLANLLLR  64

Query  2943  MYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHY  2764
              Y  F  +  A++LFD M  RN+++W++ IS Y+  G  E+AL  F +        PN +
Sbjct  65    GYSKFGLLHDARRLFDGMLHRNLVSWSSAISMYAQHGGDEQALVLFAAFRKSFDEVPNEF  124

Query  2763  TYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAM  2584
                  L AC+   A   G+++HG  F+    +N FV   L+N Y K   + +A  VF A+
Sbjct  125   LLASVLRACTQSRAVPFGEQVHGTAFKLGLDVNLFVGTALINLYAKLVCMDAAMRVFHAL  184

Query  2583  LEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGM  2404
                N VTW  +++ + Q G+    L +F +    GV  + F+   A+ AC+ +  L  G 
Sbjct  185   PAKNPVTWTVVITGYSQIGQGGLSLDLFQKMGLQGVRPDRFVLASAVSACSGLAFLQGGR  244

Query  2403  GIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQG  2224
              IH    +    MD  V+  L++ Y KC +  +A   F+      L +WT +I G +Q  
Sbjct  245   QIHGYAYRSAAGMDASVINALIDLYCKCSRPLVARKLFDCTENHNLVSWTTMIAGYMQNS  304

Query  2223  KGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCN  2044
                EA+++F ++  +G +P    + S+L +    +    G Q+H+  IK    +  +V N
Sbjct  305   LDAEAMDMFWQMCRAGWQPDVFAFTSILNSCGSLEAIWQGRQIHAHAIKANLETDEYVKN  364

Query  2043  ALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEP  1864
             AL+D Y+K + L  +  +F  +   D V++NA+I GY R G  ++A+ + + M +  L P
Sbjct  365   ALIDMYAKCDHLTAARSVFDALAHDDAVSYNAMIEGYARQGDLKEALHIFRRMRYCSLRP  424

Query  1863  NLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVF  1684
             NL T+  +L +     AIE  KQ+H  I++ G   ++ VGS LID Y+KC  + DA+ VF
Sbjct  425   NLLTFVSLLGVSSFQSAIELSKQIHGLIIRSGTSVDLYVGSALIDAYSKCSLVDDAKAVF  484

Query  1683  DILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglle  1504
              ++  +++  WN M+ G+AQ+  G+EA++++S ++ +GV PN+ TFV +++   +   + 
Sbjct  485   LMMQNRDMAIWNAMIFGHAQNEQGEEAVKLFSQLRASGVTPNEFTFVALVTVASNLASMF  544

Query  1503  egLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLS  1327
              G   H   +K    I P  ++   +++++A+ G  K+ +    S   K D + W  ++S
Sbjct  545   HGQQFHAQIIKAGADINPHVSN--ALIDMYAKCGFIKEGWLLFESTCGK-DVICWNSMIS  601



>ref|XP_009413852.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 
[Musa acuminata subsp. malaccensis]
Length=816

 Score =   455 bits (1170),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 245/695 (35%), Positives = 391/695 (56%), Gaps = 1/695 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +  L+ ++R+C   ++          ++K G  SDV+    L++ Y     ++ A  +
Sbjct  115   PNEFILASVLRACVQLRADSFACQVQDLVVKTGFCSDVFVGTALINFYAKIGCMDEAMLI  174

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FDE+P RN +TWT +I+ YS +G S  +L  F  M  E G  P+ +     +SACS    
Sbjct  175   FDELPVRNSVTWTAVITGYSQVGKSWISLELFDEM-RESGVEPDRFVLSSVISACSAEDF  233

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G++IHG ++R    ++  ++N L++ Y KC  +++A+ +FD M   N V+W ++++ 
Sbjct  234   LEGGRQIHGHLYRGGTDMDISINNVLIDLYCKCDRVRTARGLFDRMCVRNLVSWTTMIAG  293

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q     E + +F    + G   + F C   L +C S+  L  G  +H   +K  +  D
Sbjct  294   YMQNSLDSEAIDLFSEMTQLGWQADRFACTSVLSSCGSLMALLQGKQVHGYAIKANLDAD  353

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
             +YV  GL++ Y KC  L  A   F++     + ++ A+I G  +  K  EAV+LF ++ S
Sbjct  354   EYVKNGLLDMYAKCNSLDCARVVFDVIFEHNVISFNAMIEGYARHEKLVEAVSLFNRMRS  413

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
               L P+  T+ S+LG    +    +  Q HS +IK G     F  +ALVD YSK + +D+
Sbjct  414   GTLNPTLLTFVSLLGVSASSSAVDLSKQFHSLMIKFGAALDLFAGSALVDVYSKCSFVDD  473

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  IF EM   D+V WNA+I GY ++G  E+A+KL  ++    L P   T+  ++++  +
Sbjct  474   ARAIFDEMENKDLVVWNAMIYGYTQNGQGEEALKLFHQLQVSSLTPTEFTFVALVTVASN  533

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L ++  G Q H  I+K G D +  V + L+DMYAKCG + +A ++FD    +++V WN+M
Sbjct  534   LASLFHGLQFHSLIIKAGVDLDPHVSNALVDMYAKCGCIIEAWRLFDSTRGRDVVCWNSM  593

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +  YAQHG  +EAL+I+ +M +  ++PN +TFVGVLSAC H GL+EEGL+HF SM++ YG
Sbjct  594   ISRYAQHGQAEEALKIFQLMHDEEIEPNYVTFVGVLSACSHAGLVEEGLHHFYSMRDKYG  653

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             + P   H A +V+L  R G+  +A +FI   P +P  ++WR LLS C ++ D  LGKYAA
Sbjct  654   VVPGIEHYASVVSLLGRAGKVLEAKEFIEQMPIEPAAIIWRSLLSACQVSGDVELGKYAA  713

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             E  +S +P D+  +V LSNI+A   MW +A ++RK M      KE G SW E+  +++ F
Sbjct  714   EMAISANPKDSGPYVLLSNIFASKGMWVDAEKVRKGMDCSLASKEPGYSWIEVMKEVHVF  773

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDTKL  997
              +          +  +L GLT  + D GYVPD  L
Sbjct  774   IARGREHRQADLIYFMLDGLTKLIKDVGYVPDITL  808


 Score =   279 bits (714),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 172/586 (29%), Positives = 302/586 (52%), Gaps = 3/586 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSG-KAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQK  2905
             P   +L ++++SC ++++        HAQ +  G +SD++ NN LL+ Y     +  A++
Sbjct  12    PRAQNLVRLLQSCISDRTHRRRLPPIHAQSVVAGVESDLFLNNLLLNGYSKAGRLREARQ  71

Query  2904  LFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             LFD MP+ N+I+W+T+IS  +  G  E+A+  F          PN +     L AC  L 
Sbjct  72    LFDRMPRTNLISWSTMISMCAQHGREEEAIALFSRFRRSSFGCPNEFILASVLRACVQLR  131

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
             A     ++   + +     + FV   L+NFY K G +  A L+FD +   N+VTW ++++
Sbjct  132   ADSFACQVQDLVVKTGFCSDVFVGTALINFYAKIGCMDEAMLIFDELPVRNSVTWTAVIT  191

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
              + Q G+    L +F     +GV  + F+    + AC++ + L  G  IH  + + G  M
Sbjct  192   GYSQVGKSWISLELFDEMRESGVEPDRFVLSSVISACSAEDFLEGGRQIHGHLYRGGTDM  251

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
             D  +   L++ Y KC ++  A   F+      L +WT +I G +Q     EA++LF ++ 
Sbjct  252   DISINNVLIDLYCKCDRVRTARGLFDRMCVRNLVSWTTMIAGYMQNSLDSEAIDLFSEMT  311

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
               G +       SVL +         G Q+H + IK   ++  +V N L+D Y+K N LD
Sbjct  312   QLGWQADRFACTSVLSSCGSLMALLQGKQVHGYAIKANLDADEYVKNGLLDMYAKCNSLD  371

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
              +  +F  + E++++++NA+I GY R     +A+ L   M    L P L T+  +L +  
Sbjct  372   CARVVFDVIFEHNVISFNAMIEGYARHEKLVEAVSLFNRMRSGTLNPTLLTFVSLLGVSA  431

Query  1824  DLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNT  1645
                A++  KQ H  ++K G   ++  GS L+D+Y+KC  + DAR +FD +  K+LV WN 
Sbjct  432   SSSAVDLSKQFHSLMIKFGAALDLFAGSALVDVYSKCSFVDDARAIFDEMENKDLVVWNA  491

Query  1644  MLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNY  1465
             M+ GY Q+G G+EAL+++  +Q + + P + TFV +++   +   L  GL  F+S+    
Sbjct  492   MIYGYTQNGQGEEALKLFHQLQVSSLTPTEFTFVALVTVASNLASLFHGL-QFHSLIIKA  550

Query  1464  GITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLS  1327
             G+    +    +V+++A+ G   +A+    S   + D V W  ++S
Sbjct  551   GVDLDPHVSNALVDMYAKCGCIIEAWRLFDSTRGR-DVVCWNSMIS  595



>ref|XP_006449392.1| hypothetical protein CICLE_v10018358mg [Citrus clementina]
 gb|ESR62632.1| hypothetical protein CICLE_v10018358mg [Citrus clementina]
Length=942

 Score =   459 bits (1180),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 244/690 (35%), Positives = 390/690 (57%), Gaps = 3/690 (0%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +   ++++CT+ K +  G   H  ++  G +SD +  N L+ MY        +++LFD
Sbjct  166   EFTFPSVLKACTSKKDLFLGLQVHGIVVVTGFESDEFVANSLVVMYAKCGNFIDSRRLFD  225

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              +P+R+V++W +L S Y H    E+A+  F+ MVL  G  PN ++    ++AC+  G + 
Sbjct  226   AIPERSVVSWNSLFSCYVHCDFLEEAVCFFKEMVLS-GIRPNEFSLSSMINACAGSGDSL  284

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G++IHG   +     + F  N LV+ Y K G L+ A  VF  +  P+ V+W ++++  C
Sbjct  285   LGRKIHGYSIKLGYDWDMFSVNALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAG-C  343

Query  2535  QCGEY-DEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQ  2359
                E+ D  L++F +   + +  N F    AL ACA +E    G  +HC ++K  +K D 
Sbjct  344   VLHEHNDWALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMDIKSDP  403

Query  2358  YVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSS  2179
              V  GLV+ Y KCG    A   F++     L AW  +I G +Q G+  EA +LF  +   
Sbjct  404   IVGVGLVDMYAKCGSTDEARMIFHLMPEKNLIAWNTVISGHLQNGEDMEAASLFPWMYRE  463

Query  2178  GLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDES  1999
             G+   + T ++VL +    +   V  Q+H+  +K  F S  ++ N+L+D Y K   ++++
Sbjct  464   GVGFDQTTLSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDA  523

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDL  1819
              KIF+E +  D+V + ++I  Y + G  E+A+KL  EM    + P+    S +L+ C +L
Sbjct  524   VKIFKESSAVDLVAFTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANL  583

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
              A E GKQVH  I+K GF S+   G++L++MYAKCG + DA + F  +P + +VSW+ M+
Sbjct  584   SAYEQGKQVHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMI  643

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGI  1459
              G AQHG GKEAL+++  M E+GV PN IT V VL AC H GL+ E  +HF SM+  +GI
Sbjct  644   GGLAQHGRGKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGI  703

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAE  1279
              P   H ACM+++  R G+ ++A + + + P + +  VW  LL    I K+  +G++AAE
Sbjct  704   QPMQEHYACMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAE  763

Query  1278  EILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFS  1099
              + +I+P  +S HV LSNIYA   MWD  A++R+ MK  +LKKE G SW E+++K+Y F+
Sbjct  764   MLFAIEPQKSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSWIEVKDKVYTFT  823

Query  1098  SSYNMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
                        +   L  ++  L  AGYVP
Sbjct  824   VGDRSHARSKEIYAKLDEVSDLLNKAGYVP  853


 Score =   318 bits (814),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 195/589 (33%), Positives = 304/589 (52%), Gaps = 9/589 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P  +  S+++  CT +KS+  GK  HA LI++G   D    N+L++ Y        A+KL
Sbjct  63    PTSIRYSKLLSQCTISKSVNLGKEIHAHLIRFGLLKDPKNKNNLINFYAKLQFFLYARKL  122

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
              DE P+ ++++W+ LIS Y+  GL E+A  +F+ M L  G   N +T+   L AC+    
Sbjct  123   VDESPEPDLVSWSALISGYAQNGLGEEAALAFQKMHLL-GLKCNEFTFPSVLKACTSKKD  181

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G ++HG +       + FV+N LV  Y KCG    ++ +FDA+ E + V+W SL SC
Sbjct  182   LFLGLQVHGIVVVTGFESDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVSWNSLFSC  241

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             +  C   +E +  F   + +G+  NEF     + ACA       G  IH   +K G   D
Sbjct  242   YVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDWD  301

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              + V  LV+ Y K G L  A   F     P++ +W A+I GCV       A+ LF ++ S
Sbjct  302   MFSVNALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDWALKLFQQMKS  361

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
             S + P+  TY S L A    +  ++G QLH  +IK+   S   V   LVD Y+K    DE
Sbjct  362   SEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMDIKSDPIVGVGLVDMYAKCGSTDE  421

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  IF  M E +++ WN +I+G++++G   +A  L   M  EG+  +  T S +L     
Sbjct  422   ARMIFHLMPEKNLIAWNTVISGHLQNGEDMEAASLFPWMYREGVGFDQTTLSTVLKSVAS  481

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
               AI   KQVH   +K  F+S+  + ++LID Y KCG + DA K+F      +LV++ +M
Sbjct  482   FQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESSAVDLVAFTSM  541

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNY  1465
             +  YAQ G G+EAL++Y  MQ+  + P+      +L+AC +    E+G   H + +K  +
Sbjct  542   ITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQVHVHIIK--F  599

Query  1464  GITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDK--VVWRCLLSG  1324
             G    T     +VN++A+ G      D  R+F E PD+  V W  ++ G
Sbjct  600   GFMSDTFAGNSLVNMYAKCGSID---DADRAFSEIPDRGIVSWSAMIGG  645


 Score =   260 bits (665),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 168/564 (30%), Positives = 273/564 (48%), Gaps = 34/564 (6%)
 Frame = -2

Query  2781  FTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQ  2602
             FTP    Y   LS C+   +   GKEIH  + R     +    N L+NFY K      A+
Sbjct  61    FTPTSIRYSKLLSQCTISKSVNLGKEIHAHLIRFGLLKDPKNKNNLINFYAKLQFFLYAR  120

Query  2601  LVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVE  2422
              + D   EP+ V+W++L+S + Q G  +E    F +    G+  NEF     L AC S +
Sbjct  121   KLVDESPEPDLVSWSALISGYAQNGLGEEAALAFQKMHLLGLKCNEFTFPSVLKACTSKK  180

Query  2421  CLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIG  2242
              L  G+ +H ++V  G + D++V   LV  Y KCG    +   F+      + +W +L  
Sbjct  181   DLFLGLQVHGIVVVTGFESDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVSWNSLFS  240

Query  2241  GCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNS  2062
               V      EAV  F +++ SG++P+E + +S++ A   + +  +G ++H + IKLG++ 
Sbjct  241   CYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDW  300

Query  2061  FTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEML  1882
               F  NALVD Y+K   L+++  +F+++   DIV+WNA+IAG +   H + A+KL Q+M 
Sbjct  301   DMFSVNALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDWALKLFQQMK  360

Query  1881  FEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLG  1702
                + PN+ TY+  L  C  +   E G+Q+HC ++K    S+ +VG  L+DMYAKCG   
Sbjct  361   SSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMDIKSDPIVGVGLVDMYAKCGSTD  420

Query  1701  DARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACG  1522
             +AR +F ++P KNL++WNT++ G+ Q+G   EA  ++  M   GV  +  T   VL +  
Sbjct  421   EARMIFHLMPEKNLIAWNTVISGHLQNGEDMEAASLFPWMYREGVGFDQTTLSTVLKSVA  480

Query  1521  -----------HgglleegLNH----FNSMKNNYGITPRTNH---------------LAC  1432
                        H   ++          NS+ + YG                         
Sbjct  481   SFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESSAVDLVAFTS  540

Query  1431  MVNLFARKGQTKKAYDFIRSFPEK---PDKVVWRCLLSGCNINKDFVLGKYAAEEILSID  1261
             M+  +A+ G  ++A        ++   PD  V   LL+ C     +  GK     I+   
Sbjct  541   MITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQVHVHIIKFG  600

Query  1260  -PNDTSAHVTLSNIYARLNMWDEA  1192
               +DT A  +L N+YA+    D+A
Sbjct  601   FMSDTFAGNSLVNMYAKCGSIDDA  624



>gb|AEB39778.1| pentatricopeptide repeat protein 77 [Funaria hygrometrica]
Length=1161

 Score =   464 bits (1193),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 238/686 (35%), Positives = 396/686 (58%), Gaps = 1/686 (0%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             ++ +C+T+K++ +G+  H+ + + G  SDV   N L+SMY    ++  A++LF+ MPKR+
Sbjct  391   VLNACSTSKALGAGELIHSHISEVGHSSDVQIGNSLISMYARCGDLPRARELFNTMPKRD  450

Query  2877  VITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
             +I+W  +I+ Y+      +A+  ++ M  E G  P   T++  LSAC+   A   GK IH
Sbjct  451   LISWNAIIAGYARREDRGEAMKLYKQMQSE-GVKPGRVTFLHLLSACTNSSAYSDGKMIH  509

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
               I R+    N  ++N L+N Y +CG +  AQ VF+     + ++W S+++ H Q G Y+
Sbjct  510   EDILRSGIKSNGHLANALMNMYRRCGSIMEAQNVFEGTRARDIISWNSMIAGHAQHGSYE  569

Query  2517  EGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLV  2338
                ++FL   + G+  ++      L  C + E L  G  IH LI++ G+++D  +   L+
Sbjct  570   AAYKLFLEMKKEGLEPDKITFASVLVGCKNPEALELGRQIHMLIIESGLQLDVNLGNALI  629

Query  2337  NFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSER  2158
             N Y++CG L  AY  F+      + +WTA+IGG   QG+ R+A  LF ++ + G KP + 
Sbjct  630   NMYIRCGSLQDAYEVFHSLRHRNVMSWTAMIGGFADQGEDRKAFELFWQMQNDGFKPVKS  689

Query  2157  TYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEM  1978
             T++S+L A   +     G ++ + I+  G+   T V NAL+  YSKS  + ++ K+F +M
Sbjct  690   TFSSILKACMSSACLDEGKKVIAHILNSGYELDTGVGNALISAYSKSGSMTDARKVFDKM  749

Query  1977  TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGK  1798
                DI++WN +IAGY ++G    A++   +M  +G+  N  ++  IL+ C    A+E GK
Sbjct  750   PNRDIMSWNKMIAGYAQNGLGGTALQFAYQMQEQGVVLNKFSFVSILNACSSFSALEEGK  809

Query  1797  QVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHG  1618
             +VH  I+K     +V VG+ LI MYAKCG L +A++VFD    KN+V+WN M+  YAQHG
Sbjct  810   RVHAEIVKRKMQGDVRVGAALISMYAKCGSLEEAQEVFDNFTEKNVVTWNAMINAYAQHG  869

Query  1617  FGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHL  1438
                +AL+ ++ M + G+KP+  TF  +LSAC H GL+ EG   F+S+++ +G++P   H 
Sbjct  870   LASKALDFFNCMDKEGIKPDGSTFTSILSACNHSGLVMEGNRIFSSLESQHGLSPTIEHY  929

Query  1437  ACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDP  1258
              C+V L  R G+ ++A   I   P  PD  VW  LL  C I+ +  L ++AA   L ++ 
Sbjct  930   GCLVGLLGRAGRFQEAETLINQMPFPPDAAVWETLLGACRIHGNVALAEHAANNALKLNA  989

Query  1257  NDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLL  1078
              + + +V LSN+YA    WD+ A+IR++M+ + ++KE G SW E+ N I+ F ++     
Sbjct  990   RNPAVYVLLSNVYAAAGRWDDVAKIRRVMEGRGIRKEPGRSWIEVDNIIHEFIAADRSHP  1049

Query  1077  GEVSMKKLLIGLTAQLLDAGYVPDTK  1000
                 + + L  L+ ++  AGY PDT+
Sbjct  1050  ETAEIYEELKRLSLEMERAGYSPDTQ  1075


 Score =   308 bits (790),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 175/578 (30%), Positives = 306/578 (53%), Gaps = 3/578 (1%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             ++++CT  +S+   K  HAQ+++ G   D++ +N L++MYV    +  A ++F +MP+R+
Sbjct  88    LVQNCTRKRSLAEAKRIHAQMVEAGVGPDIFLSNLLINMYVKCRSVSDAHQVFLKMPRRD  147

Query  2877  VITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
             VI+W +LIS Y+  G  +KA   F  M    GF P+  TY+  L+AC        GK+IH
Sbjct  148   VISWNSLISCYAQQGFKKKAFQLFEEMQTA-GFIPSKITYISILTACCSPAELEYGKKIH  206

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
              +I  A    +  V N L+N YGKC  L SA+ VF  +   + V++ ++L  + Q    +
Sbjct  207   SKIIEAGYQRDPRVQNSLLNMYGKCEDLPSARQVFSGIYRRDVVSYNTMLGLYAQKAYVE  266

Query  2517  EGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLV  2338
             E + +F +    G+  ++      L A  +   L  G  IH L V  G+  D  V T L 
Sbjct  267   ECIGLFGQMSSEGIPPDKVTYINLLDAFTTPSMLDEGKRIHKLAVNEGLNSDIRVGTALA  326

Query  2337  NFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSER  2158
               +V+CG +  A       +  ++  + ALI    Q G   EA   + ++ S G+  +  
Sbjct  327   TMFVRCGDVAGAKQALEAFADRDVVVYNALIAALAQHGHYEEAFEQYYQMRSDGVVMNRT  386

Query  2157  TYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEM  1978
             TY SVL A + +K    G  +HS I ++G +S   + N+L+  Y++   L  + ++F  M
Sbjct  387   TYLSVLNACSTSKALGAGELIHSHISEVGHSSDVQIGNSLISMYARCGDLPRARELFNTM  446

Query  1977  TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGK  1798
              + D+++WNA+IAGY R     +A+KL ++M  EG++P   T+  +LS C +  A   GK
Sbjct  447   PKRDLISWNAIIAGYARREDRGEAMKLYKQMQSEGVKPGRVTFLHLLSACTNSSAYSDGK  506

Query  1797  QVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHG  1618
              +H  I++ G  SN  + + L++MY +CG + +A+ VF+    ++++SWN+M+ G+AQHG
Sbjct  507   MIHEDILRSGIKSNGHLANALMNMYRRCGSIMEAQNVFEGTRARDIISWNSMIAGHAQHG  566

Query  1617  FGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHL  1438
               + A +++  M++ G++P+ ITF  VL  C +     E     + +    G+    N  
Sbjct  567   SYEAAYKLFLEMKKEGLEPDKITFASVLVGCKN-PEALELGRQIHMLIIESGLQLDVNLG  625

Query  1437  ACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
               ++N++ R G  + AY+   S   + + + W  ++ G
Sbjct  626   NALINMYIRCGSLQDAYEVFHSLRHR-NVMSWTAMIGG  662


 Score =   295 bits (756),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 163/521 (31%), Positives = 278/521 (53%), Gaps = 5/521 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P K++   I+ +C +   +  GK  H+++I+ G + D    N LL+MY    ++  A+++
Sbjct  181   PSKITYISILTACCSPAELEYGKKIHSKIIEAGYQRDPRVQNSLLNMYGKCEDLPSARQV  240

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F  + +R+V+++ T++  Y+     E+ +G F  M  E G  P+  TY+  L A +    
Sbjct  241   FSGIYRRDVVSYNTMLGLYAQKAYVEECIGLFGQMSSE-GIPPDKVTYINLLDAFTTPSM  299

Query  2721  ARTGKEIHGRIFRAEETLNN--FVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLL  2548
                GK IH       E LN+   V   L   + +CG +  A+   +A  + + V + +L+
Sbjct  300   LDEGKRIHK--LAVNEGLNSDIRVGTALATMFVRCGDVAGAKQALEAFADRDVVVYNALI  357

Query  2547  SCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVK  2368
             +   Q G Y+E    + +    GV++N       L AC++ + LG G  IH  I + G  
Sbjct  358   AALAQHGHYEEAFEQYYQMRSDGVVMNRTTYLSVLNACSTSKALGAGELIHSHISEVGHS  417

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
              D  +   L++ Y +CG L  A   FN     +L +W A+I G  ++    EA+ L+ ++
Sbjct  418   SDVQIGNSLISMYARCGDLPRARELFNTMPKRDLISWNAIIAGYARREDRGEAMKLYKQM  477

Query  2187  LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
              S G+KP   T+  +L A T++  +  G  +H  I++ G  S   + NAL++ Y +   +
Sbjct  478   QSEGVKPGRVTFLHLLSACTNSSAYSDGKMIHEDILRSGIKSNGHLANALMNMYRRCGSI  537

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
              E+  +F+     DI++WN++IAG+ + G YE A KL  EM  EGLEP+  T++ +L  C
Sbjct  538   MEAQNVFEGTRARDIISWNSMIAGHAQHGSYEAAYKLFLEMKKEGLEPDKITFASVLVGC  597

Query  1827  GDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWN  1648
              +  A+E G+Q+H  I++ G   +V +G+ LI+MY +CG L DA +VF  L  +N++SW 
Sbjct  598   KNPEALELGRQIHMLIIESGLQLDVNLGNALINMYIRCGSLQDAYEVFHSLRHRNVMSWT  657

Query  1647  TMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSAC  1525
              M+ G+A  G  ++A E++  MQ +G KP   TF  +L AC
Sbjct  658   AMIGGFADQGEDRKAFELFWQMQNDGFKPVKSTFSSILKAC  698


 Score =   244 bits (624),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 258/508 (51%), Gaps = 12/508 (2%)
 Frame = -2

Query  2826  EKALGSFRSMVLEDGFTP-----NHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNN  2662
             E+  GS R   L + + P     N   YV  +  C+   +    K IH ++  A    + 
Sbjct  59    EQHRGSERE-DLSNAYQPRPTETNRAAYVDLVQNCTRKRSLAEAKRIHAQMVEAGVGPDI  117

Query  2661  FVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRA  2482
             F+SN L+N Y KC  +  A  VF  M   + ++W SL+SC+ Q G   +  ++F     A
Sbjct  118   FLSNLLINMYVKCRSVSDAHQVFLKMPRRDVISWNSLISCYAQQGFKKKAFQLFEEMQTA  177

Query  2481  GVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLA  2302
             G + ++      L AC S   L +G  IH  I++ G + D  V   L+N Y KC  L  A
Sbjct  178   GFIPSKITYISILTACCSPAELEYGKKIHSKIIEAGYQRDPRVQNSLLNMYGKCEDLPSA  237

Query  2301  YNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDT  2122
                F+     ++ ++  ++G   Q+    E + LF ++ S G+ P + TY ++L AFT  
Sbjct  238   RQVFSGIYRRDVVSYNTMLGLYAQKAYVEECIGLFGQMSSEGIPPDKVTYINLLDAFTTP  297

Query  2121  KEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALI  1942
                  G ++H   +  G NS   V  AL   + +   +  + +  +   + D+V +NALI
Sbjct  298   SMLDEGKRIHKLAVNEGLNSDIRVGTALATMFVRCGDVAGAKQALEAFADRDVVVYNALI  357

Query  1941  AGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFD  1762
             A   + GHYE+A +   +M  +G+  N  TY  +L+ C    A+  G+ +H  I + G  
Sbjct  358   AALAQHGHYEEAFEQYYQMRSDGVVMNRTTYLSVLNACSTSKALGAGELIHSHISEVGHS  417

Query  1761  SNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMM  1582
             S+V +G++LI MYA+CG L  AR++F+ +P ++L+SWN ++ GYA+     EA+++Y  M
Sbjct  418   SDVQIGNSLISMYARCGDLPRARELFNTMPKRDLISWNAIIAGYARREDRGEAMKLYKQM  477

Query  1581  QENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLA-CMVNLFARK  1408
             Q  GVKP  +TF+ +LSAC +     +G   H + +++  GI     HLA  ++N++ R 
Sbjct  478   QSEGVKPGRVTFLHLLSACTNSSAYSDGKMIHEDILRS--GIKS-NGHLANALMNMYRRC  534

Query  1407  GQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
             G   +A +       + D + W  +++G
Sbjct  535   GSIMEAQNVFEGTRAR-DIISWNSMIAG  561


 Score =   128 bits (322),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 112/429 (26%), Positives = 187/429 (44%), Gaps = 25/429 (6%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P+K + S I+++C ++  +  GK   A ++  G + D    N L+S Y     +  A+K+
Sbjct  686   PVKSTFSSILKACMSSACLDEGKKVIAHILNSGYELDTGVGNALISAYSKSGSMTDARKV  745

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD+MP R++++W  +I+ Y+  GL   AL  F   + E G   N +++V  L+ACS   A
Sbjct  746   FDKMPNRDIMSWNKMIAGYAQNGLGGTAL-QFAYQMQEQGVVLNKFSFVSILNACSSFSA  804

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK +H  I + +   +  V   L++ Y KCG L+ AQ VFD   E N VTW ++++ 
Sbjct  805   LEEGKRVHAEIVKRKMQGDVRVGAALISMYAKCGSLEEAQEVFDNFTEKNVVTWNAMINA  864

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGI-HCLIVKCGVKM  2365
             + Q G   + L  F    + G+  +       L AC     +  G  I   L  + G+  
Sbjct  865   YAQHGLASKALDFFNCMDKEGIKPDGSTFTSILSACNHSGLVMEGNRIFSSLESQHGLSP  924

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFN-MASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
                    LV    + G+   A    N M   P+   W  L+G C   G     V L    
Sbjct  925   TIEHYGCLVGLLGRAGRFQEAETLINQMPFPPDAAVWETLLGACRIHGN----VALAEHA  980

Query  2187  LSSGLKPSERTYA---------SVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALV  2035
              ++ LK + R  A         +  G + D  + +  M+      + G  S+  V N + 
Sbjct  981   ANNALKLNARNPAVYVLLSNVYAAAGRWDDVAKIRRVMEGRGIRKEPG-RSWIEVDNIIH  1039

Query  2034  DFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLH  1855
             +F +      E+ +I++E+    +       AGY     Y     +L  +  E  E +L 
Sbjct  1040  EFIAADRSHPETAEIYEELKRLSLEMER---AGYSPDTQY-----VLHNLDKEHQETSLC  1091

Query  1854  TYSCILSIC  1828
             T+S  L+I 
Sbjct  1092  THSERLAIA  1100



>ref|XP_010661558.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g15130 [Vitis vinifera]
 ref|XP_010661559.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g15130 [Vitis vinifera]
 ref|XP_010661560.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g15130 [Vitis vinifera]
Length=814

 Score =   454 bits (1168),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 245/688 (36%), Positives = 387/688 (56%), Gaps = 12/688 (2%)
 Frame = -2

Query  2958  NHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGF  2779
             N ++  Y     +  A+KLF E P R+ ITW++LIS Y   G   +AL  F  M  E G 
Sbjct  76    NTMIGAYANSGRLNEARKLFYETPIRSCITWSSLISGYCRYGCDVEALELFWEMQYE-GE  134

Query  2778  TPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQL  2599
              PN +T+   L  CS       GK+IH    + +   N FV   LV+ Y KC  +  A+ 
Sbjct  135   RPNQFTWGSVLRVCSMYVLLEKGKQIHAHAIKTQFDSNAFVVTGLVDMYAKCKCILEAEY  194

Query  2598  VFD-AMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRA-GVLVNEFLCGIALGACASV  2425
             +F+ A  + N V W ++++ + Q G+  + +  F R +R  G+  N+F     L AC S+
Sbjct  195   LFELAPDKRNHVLWTAMVTGYSQNGDGHKAIECF-RDMRGEGIECNQFTFPSILTACGSI  253

Query  2424  ECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALI  2245
                GFG  +H  IV+ G   + +V + LV+ Y KCG L  A          +  +W ++I
Sbjct  254   SACGFGAQVHGCIVRSGFGANVFVGSALVDMYSKCGDLSNARRMLETMEVDDPVSWNSMI  313

Query  2244  GGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFN  2065
              GCV+QG G EA++LF  +    +K  E TY SVL  F+   + +  M +HS I+K GF 
Sbjct  314   VGCVRQGLGEEALSLFRIMHLRHMKIDEFTYPSVLNCFSFVMDMRNAMSVHSLIVKTGFE  373

Query  2064  SFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEM  1885
             ++  V NALVD Y+K    D +F +F++MT+ D+++W +L+ G + +G YE+A++L  EM
Sbjct  374   AYKLVNNALVDMYAKRGYFDYAFDVFEKMTDKDVISWTSLVTGCVHNGSYEEALRLFCEM  433

Query  1884  LFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRL  1705
                G+ P+    + +LS C +L  +E+GKQVH   +K G  S++ V ++L+ MYAKCG +
Sbjct  434   RIMGIHPDQIVIAAVLSACAELTVLEFGKQVHANFLKSGLGSSLSVDNSLVSMYAKCGCI  493

Query  1704  GDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSAC  1525
              DA KVFD +  +++++W  +++GYAQ+G G+E+L  Y+ M  +GVKP+ ITF+G+L AC
Sbjct  494   EDANKVFDSMEIQDVITWTALIVGYAQNGRGRESLNFYNDMIASGVKPDFITFIGLLFAC  553

Query  1524  GHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVV  1345
              H GL+E G ++F SM+  YGI P   H ACM++L  R G+  +A + +     +PD  V
Sbjct  554   SHAGLVEHGRSYFQSMEEVYGIKPGPEHYACMIDLLGRSGKLMEAKELLNQMAVQPDATV  613

Query  1344  WRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQ  1165
             W+ LL+ C ++ +  LG+ AA  +  ++P +   +V LSN+Y+    W+EAA+ R++MK 
Sbjct  614   WKALLAACRVHGNVELGERAANNLFELEPKNAVPYVLLSNLYSAAGKWEEAAKTRRLMKL  673

Query  1164  KELKKETGCSWTELQNKIYCFSSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDTKLSF--  991
             + + KE GCSW E+ +K++ F S          +   +  +   + +AGYVPD   +   
Sbjct  674   RGVSKEPGCSWIEMSSKVHRFMSEDRSHPRTAEIYSKVDEIMILIKEAGYVPDMNFALHD  733

Query  990   --DYGD*LGLSIRHLSRFVKFD----PP  925
               + G  LGL+       V F     PP
Sbjct  734   MDEEGKELGLAYHSEKLAVAFGLLTMPP  761


 Score =   231 bits (589),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 144/495 (29%), Positives = 248/495 (50%), Gaps = 12/495 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +   ++R C+    +  GK  HA  IK    S+ +    L+ MY     I  A+ L
Sbjct  136   PNQFTWGSVLRVCSMYVLLEKGKQIHAHAIKTQFDSNAFVVTGLVDMYAKCKCILEAEYL  195

Query  2901  FDEMP-KRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             F+  P KRN + WT +++ YS  G   KA+  FR M  E G   N +T+   L+AC  + 
Sbjct  196   FELAPDKRNHVLWTAMVTGYSQNGDGHKAIECFRDMRGE-GIECNQFTFPSILTACGSIS  254

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
             A   G ++HG I R+    N FV + LV+ Y KCG L +A+ + + M   + V+W S++ 
Sbjct  255   ACGFGAQVHGCIVRSGFGANVFVGSALVDMYSKCGDLSNARRMLETMEVDDPVSWNSMIV  314

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
                + G  +E L +F       + ++EF     L   + V  +   M +H LIVK G + 
Sbjct  315   GCVRQGLGEEALSLFRIMHLRHMKIDEFTYPSVLNCFSFVMDMRNAMSVHSLIVKTGFEA  374

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
              + V   LV+ Y K G    A++ F   +  ++ +WT+L+ GCV  G   EA+ LFC++ 
Sbjct  375   YKLVNNALVDMYAKRGYFDYAFDVFEKMTDKDVISWTSLVTGCVHNGSYEEALRLFCEMR  434

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
               G+ P +   A+VL A  +    + G Q+H+  +K G  S   V N+LV  Y+K   ++
Sbjct  435   IMGIHPDQIVIAAVLSACAELTVLEFGKQVHANFLKSGLGSSLSVDNSLVSMYAKCGCIE  494

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
             ++ K+F  M   D++TW ALI GY ++G   +++    +M+  G++P+  T+  +L  C 
Sbjct  495   DANKVFDSMEIQDVITWTALIVGYAQNGRGRESLNFYNDMIASGVKPDFITFIGLLFACS  554

Query  1824  DLPAIEWGKQVHCRI-----MKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-N  1663
                 +E G+     +     +KPG +      + +ID+  + G+L +A+++ + +  + +
Sbjct  555   HAGLVEHGRSYFQSMEEVYGIKPGPEHY----ACMIDLLGRSGKLMEAKELLNQMAVQPD  610

Query  1662  LVSWNTMLIGYAQHG  1618
                W  +L     HG
Sbjct  611   ATVWKALLAACRVHG  625


 Score =   157 bits (398),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 110/410 (27%), Positives = 191/410 (47%), Gaps = 13/410 (3%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +   I+ +C +  +   G   H  +++ G  ++V+  + L+ MY    ++  A+++ +
Sbjct  240   QFTFPSILTACGSISACGFGAQVHGCIVRSGFGANVFVGSALVDMYSKCGDLSNARRMLE  299

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              M   + ++W ++I      GL E+AL  FR M L      + +TY   L+  S +   R
Sbjct  300   TMEVDDPVSWNSMIVGCVRQGLGEEALSLFRIMHLRH-MKIDEFTYPSVLNCFSFVMDMR  358

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
                 +H  I +        V+N LV+ Y K G    A  VF+ M + + ++W SL++   
Sbjct  359   NAMSVHSLIVKTGFEAYKLVNNALVDMYAKRGYFDYAFDVFEKMTDKDVISWTSLVTGCV  418

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
               G Y+E LR+F      G+  ++ +    L ACA +  L FG  +H   +K G+     
Sbjct  419   HNGSYEEALRLFCEMRIMGIHPDQIVIAAVLSACAELTVLEFGKQVHANFLKSGLGSSLS  478

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V   LV+ Y KCG +  A   F+     ++  WTALI G  Q G+GRE++N +  +++SG
Sbjct  479   VDNSLVSMYAKCGCIEDANKVFDSMEIQDVITWTALIVGYAQNGRGRESLNFYNDMIASG  538

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHS-----FIIKLGFNSFTFVCNALVDFYSKSNL  2011
             +KP   T+  +L A +     + G          + IK G   +      ++D   +S  
Sbjct  539   VKPDFITFIGLLFACSHAGLVEHGRSYFQSMEEVYGIKPGPEHYA----CMIDLLGRSGK  594

Query  2010  LDESFKIFQEM-TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEP  1864
             L E+ ++  +M  + D   W AL+A     G+ E   +     LFE LEP
Sbjct  595   LMEAKELLNQMAVQPDATVWKALLAACRVHGNVELGERAANN-LFE-LEP  642


 Score = 70.1 bits (170),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 96/223 (43%), Gaps = 44/223 (20%)
 Frame = -2

Query  1863  NLHTYSCILSICGDLPAIEWGKQVH-----CRIMKPGFDSNVVVGSTLIDMYAKCGRLGD  1699
             NL  Y+    +C  L   E    +      C  +    DSN V+ +      +KCGR+ D
Sbjct  5     NLGIYTFSRKVCHQLEHTELNHHIRRFVNSCGTVHSSSDSNWVLSNL-----SKCGRVDD  59

Query  1698  ARKVFDILPCKNLVSWNTM-------------------------------LIGYAQHGFG  1612
             ARK+FD++P ++  SWNTM                               + GY ++G  
Sbjct  60    ARKLFDVMPDRDECSWNTMIGAYANSGRLNEARKLFYETPIRSCITWSSLISGYCRYGCD  119

Query  1611  KEALEIYSMMQENGVKPNDITFVGVLSACG-HgglleegLNHFNSMKNNYGITPRTNHLA  1435
              EALE++  MQ  G +PN  T+  VL  C  +  L +    H +++K  +        + 
Sbjct  120   VEALELFWEMQYEGERPNQFTWGSVLRVCSMYVLLEKGKQIHAHAIKTQFDSNAFV--VT  177

Query  1434  CMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKD  1306
              +V+++A+     +A       P+K + V+W  +++G + N D
Sbjct  178   GLVDMYAKCKCILEAEYLFELAPDKRNHVLWTAMVTGYSQNGD  220



>ref|XP_004163716.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g27610-like [Cucumis sativus]
Length=878

 Score =   456 bits (1173),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 251/702 (36%), Positives = 402/702 (57%), Gaps = 19/702 (3%)
 Frame = -2

Query  3072  MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDE  2893
             ++LS  ++ C      + G+  H Q +K G   DV     L+ MY+   + E  + +FDE
Sbjct  105   LTLSCALKVCGVLFDQVVGRQVHCQSLKSGFLEDVSVGTSLVDMYMKTEDFEDGRGIFDE  164

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAART  2713
             M  +NV++WT+L+S Y+  GL+++ +     M +E G  PN +T+   L A +       
Sbjct  165   MGIKNVVSWTSLLSGYARNGLNDEVIHLINQMQME-GVNPNGFTFATVLGALADESIIEG  223

Query  2712  GKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQ  2533
             G ++H  I +       FV N L+  Y K  ++  A+ VFD+M+  ++VTW  ++  +  
Sbjct  224   GVQVHAMIVKNGFEFTTFVCNALICMYLKSEMVGDAEAVFDSMVVRDSVTWNIMIGGYAA  283

Query  2532  CGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
              G Y EG ++F R   AGV ++  +   AL  C+    L F   +HC +VK G +  Q +
Sbjct  284   IGFYLEGFQMFHRMRLAGVKLSRTVFCTALKLCSQQRELNFTKQLHCGVVKNGYEFAQDI  343

Query  2352  VTGLVNFYVKCGQLGLAYNTFNMASAPE-LHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
              T L+  Y KC  +  A+  F+MA A   +  WTA+IGG VQ    ++AV+LFC++   G
Sbjct  344   RTALMVTYSKCSSVDEAFKLFSMADAAHNVVTWTAMIGGFVQNNNNKKAVDLFCQMSREG  403

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             ++P+  TY++VL      K   +  QLH+ IIK  +     V  AL+D Y K+  + ES 
Sbjct  404   VRPNHFTYSTVLAG----KPSSLLSQLHAQIIKAYYEKVPSVATALLDAYVKTGNVVESA  459

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
             ++F  +   DIV W+A++ G  ++   E+A+++  +++ EG++PN +T+S +++ C    
Sbjct  460   RVFYSIPAKDIVAWSAMLTGLAQTRDSEKAMEVFIQLVKEGVKPNEYTFSSVINACSSSA  519

Query  1815  A-IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
             A +E GKQ+H   +K G  + + V S L+ MY+K G +  A KVF     +++VSWN+M+
Sbjct  520   ATVEHGKQIHATAVKSGKSNALCVSSALLTMYSKKGNIESAEKVFTRQEERDIVSWNSMI  579

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGI  1459
              GY QHG  K+ALE++ +MQ  G+  +D+TF+GVL+AC H GL+EEG  +FN M  +Y I
Sbjct  580   TGYGQHGDAKKALEVFQIMQNQGLPLDDVTFIGVLTACTHAGLVEEGEKYFNIMIKDYHI  639

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAE  1279
               +  H +CMV+L++R G   KA D I   P      +WR LL+ C ++++  LGK AAE
Sbjct  640   DKKXEHYSCMVDLYSRAGMFDKAMDIINGMPFPASPTIWRTLLAACRVHRNLELGKLAAE  699

Query  1278  EILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFS  1099
             +++S+ PND   +V LSNI+A    W+E A +RK+M ++++KKE GCSW E++N+I+ F 
Sbjct  700   KLVSLQPNDAVGYVLLSNIHAVAGNWEEKAHVRKLMDERKVKKEAGCSWIEIKNRIFSF-  758

Query  1098  SSYNMLLGEVS------MKKLLIGLTAQLLDAGYVPDTKLSF  991
                  L G+VS      +   L  L+ +L D GY PDT   F
Sbjct  759   -----LAGDVSHPFSDLVYAKLEELSIKLKDMGYQPDTNYVF  795


 Score =   189 bits (479),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 118/437 (27%), Positives = 205/437 (47%), Gaps = 7/437 (2%)
 Frame = -2

Query  2613  KSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGAC  2434
             + A  +FD     +   +  LL    +     E L +F     +G+ V+      AL  C
Sbjct  55    RYAHQLFDETPLKDISHYNRLLFDFSRNNHDREALHLFKDLHSSGLGVDGLTLSCALKVC  114

Query  2433  ASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWT  2254
               +     G  +HC  +K G   D  V T LV+ Y+K          F+      + +WT
Sbjct  115   GVLFDQVVGRQVHCQSLKSGFLEDVSVGTSLVDMYMKTEDFEDGRGIFDEMGIKNVVSWT  174

Query  2253  ALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKL  2074
             +L+ G  + G   E ++L  ++   G+ P+  T+A+VLGA  D    + G+Q+H+ I+K 
Sbjct  175   SLLSGYARNGLNDEVIHLINQMQMEGVNPNGFTFATVLGALADESIIEGGVQVHAMIVKN  234

Query  2073  GFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLL  1894
             GF   TFVCNAL+  Y KS ++ ++  +F  M   D VTWN +I GY   G Y +  ++ 
Sbjct  235   GFEFTTFVCNALICMYLKSEMVGDAEAVFDSMVVRDSVTWNIMIGGYAAIGFYLEGFQMF  294

Query  1893  QEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKC  1714
               M   G++ +   +   L +C     + + KQ+HC ++K G++    + + L+  Y+KC
Sbjct  295   HRMRLAGVKLSRTVFCTALKLCSQQRELNFTKQLHCGVVKNGYEFAQDIRTALMVTYSKC  354

Query  1713  GRLGDARKVFDIL-PCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGV  1537
               + +A K+F +     N+V+W  M+ G+ Q+   K+A++++  M   GV+PN  T+  V
Sbjct  355   SSVDEAFKLFSMADAAHNVVTWTAMIGGFVQNNNNKKAVDLFCQMSREGVRPNHFTYSTV  414

Query  1536  LSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKP  1357
             L+             H   +K  Y   P       +++ + + G   ++     S P K 
Sbjct  415   LAG---KPSSLLSQLHAQIIKAYYEKVPSV--ATALLDAYVKTGNVVESARVFYSIPAK-  468

Query  1356  DKVVWRCLLSGCNINKD  1306
             D V W  +L+G    +D
Sbjct  469   DIVAWSAMLTGLAQTRD  485


 Score =   174 bits (440),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 130/515 (25%), Positives = 236/515 (46%), Gaps = 15/515 (3%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + + ++ +      I  G   HA ++K G +   +  N L+ MY+    +  A+ +
Sbjct  203   PNGFTFATVLGALADESIIEGGVQVHAMIVKNGFEFTTFVCNALICMYLKSEMVGDAEAV  262

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD M  R+ +TW  +I  Y+ +G   +    F  M L  G   +   +  AL  CS    
Sbjct  263   FDSMVVRDSVTWNIMIGGYAAIGFYLEGFQMFHRMRLA-GVKLSRTVFCTALKLCSQQRE  321

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFD-AMLEPNTVTWASLLS  2545
                 K++H  + +        +   L+  Y KC  +  A  +F  A    N VTW +++ 
Sbjct  322   LNFTKQLHCGVVKNGYEFAQDIRTALMVTYSKCSSVDEAFKLFSMADAAHNVVTWTAMIG  381

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
                Q     + + +F +  R GV  N F     L    S         +H  I+K   + 
Sbjct  382   GFVQNNNNKKAVDLFCQMSREGVRPNHFTYSTVLAGKPS----SLLSQLHAQIIKAYYEK  437

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
                V T L++ YVK G +  +   F    A ++ AW+A++ G  Q     +A+ +F +L+
Sbjct  438   VPSVATALLDAYVKTGNVVESARVFYSIPAKDIVAWSAMLTGLAQTRDSEKAMEVFIQLV  497

Query  2184  SSGLKPSERTYASVLGAFTDTKE-FQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
               G+KP+E T++SV+ A + +    + G Q+H+  +K G ++   V +AL+  YSK   +
Sbjct  498   KEGVKPNEYTFSSVINACSSSAATVEHGKQIHATAVKSGKSNALCVSSALLTMYSKKGNI  557

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
             + + K+F    E DIV+WN++I GY + G  ++A+++ Q M  +GL  +  T+  +L+ C
Sbjct  558   ESAEKVFTRQEERDIVSWNSMITGYGQHGDAKKALEVFQIMQNQGLPLDDVTFIGVLTAC  617

Query  1827  GDLPAIEWGKQVHCRIMKP-GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILP-CKNLVS  1654
                  +E G++    ++K    D      S ++D+Y++ G    A  + + +P   +   
Sbjct  618   THAGLVEEGEKYFNIMIKDYHIDKKXEHYSCMVDLYSRAGMFDKAMDIINGMPFPASPTI  677

Query  1653  WNTMLIGYAQHGFGKEALEIYSMMQEN--GVKPND  1555
             W T+L     H      LE+  +  E    ++PND
Sbjct  678   WRTLLAACRVH----RNLELGKLAAEKLVSLQPND  708


 Score =   124 bits (311),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 91/285 (32%), Positives = 140/285 (49%), Gaps = 13/285 (5%)
 Frame = -2

Query  2157  TYASVLGAFTDTKEFQVGM-QLHSFI--IKLGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
             T  S L    +  +  VG  +L S I  IK   +   F+ +  + F S  +    + ++F
Sbjct  2     TLGSSLRTLQNKAKITVGNGRLQSSIHHIKHFLHPHGFLYHQSLPFISLPSRPRYAHQLF  61

Query  1986  QEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIE  1807
              E    DI  +N L+  + R+ H  +A+ L +++   GL  +  T SC L +CG L    
Sbjct  62    DETPLKDISHYNRLLFDFSRNNHDREALHLFKDLHSSGLGVDGLTLSCALKVCGVLFDQV  121

Query  1806  WGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYA  1627
              G+QVHC+ +K GF  +V VG++L+DMY K     D R +FD +  KN+VSW ++L GYA
Sbjct  122   VGRQVHCQSLKSGFLEDVSVGTSLVDMYMKTEDFEDGRGIFDEMGIKNVVSWTSLLSGYA  181

Query  1626  QHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPR  1450
             ++G   E + + + MQ  GV PN  TF  VL A     ++E G+  H   +KN +  T  
Sbjct  182   RNGLNDEVIHLINQMQMEGVNPNGFTFATVLGALADESIIEGGVQVHAMIVKNGFEFTTF  241

Query  1449  T-NHLACMVNLFARKGQTKKAYD--FIRSFPEKPDKVVWRCLLSG  1324
               N L CM       G  +  +D   +R      D V W  ++ G
Sbjct  242   VCNALICMYLKSEMVGDAEAVFDSMVVR------DSVTWNIMIGG  280



>ref|XP_009398523.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Musa acuminata subsp. malaccensis]
Length=1065

 Score =   461 bits (1185),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 236/692 (34%), Positives = 399/692 (58%), Gaps = 1/692 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P    LS ++ +CT +     G+  HAQ+IK G  S+ +  N L+++Y     +  A+K+
Sbjct  287   PTPYVLSGVLSACTKSDLFEHGELIHAQVIKQGFSSETFVGNALVTLYSRCGSLTLAEKI  346

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F EMP  + +T+ TLIS ++  G SE AL  F  M    G  P+  T  G L+AC  +G 
Sbjct  347   FSEMPCHDRVTYNTLISGHARNGNSESALRIFEQMQWL-GLKPDSVTISGLLTACGSIGD  405

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
              + GK++H  + +A  +    +   +++ Y KC  +++A   F+A    N V W  +L  
Sbjct  406   VQRGKQLHSYVLKAGLSSYYIIEGSVLDLYVKCADIETAHEFFNATDRENVVLWNVMLVA  465

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q G+  +   +F +    G+  N++     L  C  V  +  G  IH L +K G +++
Sbjct  466   YGQMGDLRKSFDLFYQMQVEGMRPNQYTYPSILRTCTYVGAVDLGEQIHTLTIKTGFELN  525

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              YV + L++ Y KCG L +A       +  ++ +WTA+I G  Q     EA+  F ++  
Sbjct  526   VYVSSVLIDMYSKCGNLAMAKEILERLTEKDVVSWTAMIAGYAQHDFCLEALRTFEEMQI  585

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              G++P     AS + A    +  + G+Q+H+     G+ +   + N+L++ Y++   +++
Sbjct  586   CGIRPDNIGLASAISACAGIRAIKQGLQIHAQSCISGYATDISIGNSLINLYARCGRIED  645

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             ++ +F+ +   D ++WN LI+G+ +SG+ E+A+K+ + M   G+E NL T+   LS   +
Sbjct  646   AYSVFKIVEVKDEISWNGLISGFAQSGNCEEALKVFELMDKSGIEANLFTFGSALSAAAN  705

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             +  I+ GKQ+H RI+K G+DS +  G+ L+ +YAKCG + DA+  F  +P +N VSWN M
Sbjct  706   MADIKQGKQIHARIIKTGYDSEIEAGNALVSLYAKCGCIEDAKIEFFGMPERNEVSWNAM  765

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             + GY+QHG G++AL+++  M+    KPN +TF+GVL+AC H GL++EGL++F SM+  YG
Sbjct  766   ITGYSQHGHGRDALKLFEQMKLEKFKPNHVTFIGVLAACSHVGLVDEGLDYFRSMREEYG  825

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             + PR +H AC+V++  R G   +A +FI   P  PD +VWR LLS C +NK+  +G+ AA
Sbjct  826   LLPRPDHYACVVDILGRGGWLNRAREFIEEMPIAPDSMVWRTLLSACTVNKNVEIGELAA  885

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             + +L ++P+D++++V LSNIYA    WD   Q+R+MMK + +KKE G SW E++N ++ F
Sbjct  886   KHLLDLEPDDSASYVLLSNIYAVARKWDYRDQVRQMMKDRGVKKEPGRSWIEVKNVVHPF  945

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPD  1006
                  +     ++ K L  L  + ++ GY  D
Sbjct  946   FVGDRLHAQADAIYKFLEELNNRAVEIGYKQD  977


 Score =   299 bits (766),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 178/573 (31%), Positives = 295/573 (51%), Gaps = 10/573 (2%)
 Frame = -2

Query  3030  SILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLIS  2851
             S+   +  H++++K     + +  N LL++Y+ F E+  A KLFD+M  R V +W  +I+
Sbjct  101   SLFDARRIHSRILKLAFHGEDHLCNRLLALYLAFGEVRDAIKLFDDMSHRGVGSWNRMIA  160

Query  2850  SYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR---TGKEIHGRIFRA  2680
              +       K L  F  MV + G  P+  T   AL ACS  G  R     ++IH +I + 
Sbjct  161   GFLERKEHHKVLTFFTRMVGQCGH-PDPITIAIALRACS--GHDRYWHVVQQIHAKIIKY  217

Query  2679  EETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIF  2500
                 ++ V N L++ Y K G + SA++VF+ +   + V+W +++S   Q G   E LR++
Sbjct  218   GFFGDSNVGNPLIDLYSKNGYVDSARVVFEELWLKDNVSWVAMVSGFSQNGFGAEALRLY  277

Query  2499  LRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKC  2320
                  +G+L   ++    L AC   +    G  IH  ++K G   + +V   LV  Y +C
Sbjct  278   NGMHHSGILPTPYVLSGVLSACTKSDLFEHGELIHAQVIKQGFSSETFVGNALVTLYSRC  337

Query  2319  GQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVL  2140
             G L LA   F+     +   +  LI G  + G    A+ +F ++   GLKP   T + +L
Sbjct  338   GSLTLAEKIFSEMPCHDRVTYNTLISGHARNGNSESALRIFEQMQWLGLKPDSVTISGLL  397

Query  2139  GAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIV  1960
              A     + Q G QLHS+++K G +S+  +  +++D Y K   ++ + + F      ++V
Sbjct  398   TACGSIGDVQRGKQLHSYVLKAGLSSYYIIEGSVLDLYVKCADIETAHEFFNATDRENVV  457

Query  1959  TWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRI  1780
              WN ++  Y + G   ++  L  +M  EG+ PN +TY  IL  C  + A++ G+Q+H   
Sbjct  458   LWNVMLVAYGQMGDLRKSFDLFYQMQVEGMRPNQYTYPSILRTCTYVGAVDLGEQIHTLT  517

Query  1779  MKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEAL  1600
             +K GF+ NV V S LIDMY+KCG L  A+++ + L  K++VSW  M+ GYAQH F  EAL
Sbjct  518   IKTGFELNVYVSSVLIDMYSKCGNLAMAKEILERLTEKDVVSWTAMIAGYAQHDFCLEAL  577

Query  1599  EIYSMMQENGVKPNDITFVGVLSAC-GHgglleegLNHFNSMKNNYGITPRTNHLACMVN  1423
               +  MQ  G++P++I     +SAC G   + +    H  S  + Y       +   ++N
Sbjct  578   RTFEEMQICGIRPDNIGLASAISACAGIRAIKQGLQIHAQSCISGYATDISIGN--SLIN  635

Query  1422  LFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
             L+AR G+ + AY   +   E  D++ W  L+SG
Sbjct  636   LYARCGRIEDAYSVFK-IVEVKDEISWNGLISG  667


 Score =   290 bits (742),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 171/589 (29%), Positives = 312/589 (53%), Gaps = 8/589 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSG-KAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQK  2905
             P  ++++  +R+C+ +       +  HA++IKYG   D    N L+ +Y     ++ A+ 
Sbjct  185   PDPITIAIALRACSGHDRYWHVVQQIHAKIIKYGFFGDSNVGNPLIDLYSKNGYVDSARV  244

Query  2904  LFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             +F+E+  ++ ++W  ++S +S  G   +AL  +  M    G  P  Y   G LSAC+   
Sbjct  245   VFEELWLKDNVSWVAMVSGFSQNGFGAEALRLYNGM-HHSGILPTPYVLSGVLSACTKSD  303

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
                 G+ IH ++ +   +   FV N LV  Y +CG L  A+ +F  M   + VT+ +L+S
Sbjct  304   LFEHGELIHAQVIKQGFSSETFVGNALVTLYSRCGSLTLAEKIFSEMPCHDRVTYNTLIS  363

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
              H + G  +  LRIF +    G+  +       L AC S+  +  G  +H  ++K G+  
Sbjct  364   GHARNGNSESALRIFEQMQWLGLKPDSVTISGLLTACGSIGDVQRGKQLHSYVLKAGLS-  422

Query  2364  DQYVVTG-LVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
               Y++ G +++ YVKC  +  A+  FN      +  W  ++    Q G  R++ +LF ++
Sbjct  423   SYYIIEGSVLDLYVKCADIETAHEFFNATDRENVVLWNVMLVAYGQMGDLRKSFDLFYQM  482

Query  2187  LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
                G++P++ TY S+L   T      +G Q+H+  IK GF    +V + L+D YSK   L
Sbjct  483   QVEGMRPNQYTYPSILRTCTYVGAVDLGEQIHTLTIKTGFELNVYVSSVLIDMYSKCGNL  542

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
               + +I + +TE D+V+W A+IAGY +     +A++  +EM   G+ P+    +  +S C
Sbjct  543   AMAKEILERLTEKDVVSWTAMIAGYAQHDFCLEALRTFEEMQICGIRPDNIGLASAISAC  602

Query  1827  GDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWN  1648
               + AI+ G Q+H +    G+ +++ +G++LI++YA+CGR+ DA  VF I+  K+ +SWN
Sbjct  603   AGIRAIKQGLQIHAQSCISGYATDISIGNSLINLYARCGRIEDAYSVFKIVEVKDEISWN  662

Query  1647  TMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKN  1471
              ++ G+AQ G  +EAL+++ +M ++G++ N  TF   LSA  +   +++G   H   +K 
Sbjct  663   GLISGFAQSGNCEEALKVFELMDKSGIEANLFTFGSALSAAANMADIKQGKQIHARIIKT  722

Query  1470  NYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
              Y       +   +V+L+A+ G  + A       PE+ ++V W  +++G
Sbjct  723   GYDSEIEAGN--ALVSLYAKCGCIEDAKIEFFGMPER-NEVSWNAMITG  768


 Score =   221 bits (563),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 148/520 (28%), Positives = 263/520 (51%), Gaps = 9/520 (2%)
 Frame = -2

Query  2796  VLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGL  2617
             V++ G   +  TY   L      G+    + IH RI +      + + N L+  Y   G 
Sbjct  77    VVDRGARADCSTYASLLGRILNSGSLFDARRIHSRILKLAFHGEDHLCNRLLALYLAFGE  136

Query  2616  LKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGA  2437
             ++ A  +FD M      +W  +++   +  E+ + L  F R +      +     IAL A
Sbjct  137   VRDAIKLFDDMSHRGVGSWNRMIAGFLERKEHHKVLTFFTRMVGQCGHPDPITIAIALRA  196

Query  2436  CASVECLGFGM-GIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHA  2260
             C+  +     +  IH  I+K G   D  V   L++ Y K G +  A   F      +  +
Sbjct  197   CSGHDRYWHVVQQIHAKIIKYGFFGDSNVGNPLIDLYSKNGYVDSARVVFEELWLKDNVS  256

Query  2259  WTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFII  2080
             W A++ G  Q G G EA+ L+  +  SG+ P+    + VL A T +  F+ G  +H+ +I
Sbjct  257   WVAMVSGFSQNGFGAEALRLYNGMHHSGILPTPYVLSGVLSACTKSDLFEHGELIHAQVI  316

Query  2079  KLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIK  1900
             K GF+S TFV NALV  YS+   L  + KIF EM  +D VT+N LI+G+ R+G+ E A++
Sbjct  317   KQGFSSETFVGNALVTLYSRCGSLTLAEKIFSEMPCHDRVTYNTLISGHARNGNSESALR  376

Query  1899  LLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYA  1720
             + ++M + GL+P+  T S +L+ CG +  ++ GKQ+H  ++K G  S  ++  +++D+Y 
Sbjct  377   IFEQMQWLGLKPDSVTISGLLTACGSIGDVQRGKQLHSYVLKAGLSSYYIIEGSVLDLYV  436

Query  1719  KCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVG  1540
             KC  +  A + F+    +N+V WN ML+ Y Q G  +++ +++  MQ  G++PN  T+  
Sbjct  437   KCADIETAHEFFNATDRENVVLWNVMLVAYGQMGDLRKSFDLFYQMQVEGMRPNQYTYPS  496

Query  1539  VLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPE  1363
             +L  C + G ++ G   H  ++K  + +    +  + +++++++ G    A + +    E
Sbjct  497   ILRTCTYVGAVDLGEQIHTLTIKTGFELNVYVS--SVLIDMYSKCGNLAMAKEILERLTE  554

Query  1362  KPDKVVWRCLLSGCNINKDF---VLGKYAAEEILSIDPND  1252
             K D V W  +++G     DF    L  +   +I  I P++
Sbjct  555   K-DVVSWTAMIAG-YAQHDFCLEALRTFEEMQICGIRPDN  592


 Score =   138 bits (348),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 100/330 (30%), Positives = 167/330 (51%), Gaps = 12/330 (4%)
 Frame = -2

Query  2217  REAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNAL  2038
             R+A ++   ++  G +    TYAS+LG   ++       ++HS I+KL F+    +CN L
Sbjct  69    RDAFSVL-NVVDRGARADCSTYASLLGRILNSGSLFDARRIHSRILKLAFHGEDHLCNRL  127

Query  2037  VDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNL  1858
             +  Y     + ++ K+F +M+   + +WN +IAG++    + + +     M+ +   P+ 
Sbjct  128   LALYLAFGEVRDAIKLFDDMSHRGVGSWNRMIAGFLERKEHHKVLTFFTRMVGQCGHPDP  187

Query  1857  HTYSCILSIC-GDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFD  1681
              T +  L  C G        +Q+H +I+K GF  +  VG+ LID+Y+K G +  AR VF+
Sbjct  188   ITIAIALRACSGHDRYWHVVQQIHAKIIKYGFFGDSNVGNPLIDLYSKNGYVDSARVVFE  247

Query  1680  ILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHggllee  1501
              L  K+ VSW  M+ G++Q+GFG EAL +Y+ M  +G+ P      GVLSAC    L E 
Sbjct  248   ELWLKDNVSWVAMVSGFSQNGFGAEALRLYNGMHHSGILPTPYVLSGVLSACTKSDLFEH  307

Query  1500  -gLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKP--DKVVWRCLL  1330
               L H   +K   G +  T     +V L++R G    A    + F E P  D+V +  L+
Sbjct  308   GELIHAQVIKQ--GFSSETFVGNALVTLYSRCGSLTLAE---KIFSEMPCHDRVTYNTLI  362

Query  1329  SGC--NINKDFVLGKYAAEEILSIDPNDTS  1246
             SG   N N +  L  +   + L + P+  +
Sbjct  363   SGHARNGNSESALRIFEQMQWLGLKPDSVT  392



>dbj|BAD67156.2| PpPPR_77 [Physcomitrella patens]
Length=1106

 Score =   461 bits (1187),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 236/686 (34%), Positives = 392/686 (57%), Gaps = 1/686 (0%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             I+ +C+T+K++ +GK  H+ + + G  SDV   N L+SMY    ++  A++LF  MPKR+
Sbjct  336   ILNACSTSKALEAGKLIHSHISEDGHSSDVQIGNALISMYARCGDLPKARELFYTMPKRD  395

Query  2877  VITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
             +I+W  +I+ Y+      +A+  ++ M  E G  P   T++  LSAC+   A   GK IH
Sbjct  396   LISWNAIIAGYARREDRGEAMRLYKQMQSE-GVKPGRVTFLHLLSACANSSAYADGKMIH  454

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
               I R+    N  ++N L+N Y +CG L  AQ VF+     + ++W S+++ H Q G Y+
Sbjct  455   EDILRSGIKSNGHLANALMNMYRRCGSLMEAQNVFEGTQARDVISWNSMIAGHAQHGSYE  514

Query  2517  EGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLV  2338
                ++F       +  +       L  C + E L  G  IH  I + G+++D  +   L+
Sbjct  515   TAYKLFQEMQNEELEPDNITFASVLSGCKNPEALELGKQIHGRITESGLQLDVNLGNALI  574

Query  2337  NFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSER  2158
             N Y++CG L  A N F+     ++ +WTA+IGGC  QG+  +A+ LF ++ + G +P + 
Sbjct  575   NMYIRCGSLQDARNVFHSLQHRDVMSWTAMIGGCADQGEDMKAIELFWQMQNEGFRPVKS  634

Query  2157  TYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEM  1978
             T++S+L   T +     G ++ ++I+  G+   T V NAL+  YSKS  + ++ ++F +M
Sbjct  635   TFSSILKVCTSSACLDEGKKVIAYILNSGYELDTGVGNALISAYSKSGSMTDAREVFDKM  694

Query  1977  TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGK  1798
                DIV+WN +IAGY ++G  + A++   +M  + + PN  ++  +L+ C    A+E GK
Sbjct  695   PSRDIVSWNKIIAGYAQNGLGQTAVEFAYQMQEQDVVPNKFSFVSLLNACSSFSALEEGK  754

Query  1797  QVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHG  1618
             +VH  I+K     +V VG+ LI MYAKCG  G+A++VFD +  KN+V+WN M+  YAQHG
Sbjct  755   RVHAEIVKRKLQGDVRVGAALISMYAKCGSQGEAQEVFDNIIEKNVVTWNAMINAYAQHG  814

Query  1617  FGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHL  1438
                +AL  ++ M++ G+KP+  TF  +LSAC H GL+ EG   F+SM++ YG+ P   H 
Sbjct  815   LASKALGFFNCMEKEGIKPDGSTFTSILSACNHAGLVLEGYQIFSSMESEYGVLPTIEHY  874

Query  1437  ACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDP  1258
              C+V L  R  + ++A   I   P  PD  VW  LL  C I+ +  L ++AA   L ++ 
Sbjct  875   GCLVGLLGRARRFQEAETLINQMPFPPDAAVWETLLGACRIHGNIALAEHAANNALKLNA  934

Query  1257  NDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLL  1078
              + + ++ LSN+YA    WD+ A+IR++M+ + ++KE G SW E+ N I+ F ++     
Sbjct  935   RNPAVYILLSNVYAAAGRWDDVAKIRRVMEGRGIRKEPGRSWIEVDNIIHEFIAADRSHP  994

Query  1077  GEVSMKKLLIGLTAQLLDAGYVPDTK  1000
                 +   L  L+ ++ +AGY PDT+
Sbjct  995   ETAEIYAELKRLSVEMEEAGYFPDTQ  1020


 Score =   314 bits (804),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 179/579 (31%), Positives = 306/579 (53%), Gaps = 3/579 (1%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             ++++CT  + +   K  HAQ+++     D++ +N L++MYV    +  A ++F EMP+R+
Sbjct  33    LLQNCTRKRLLPEAKRIHAQMVEAWVGPDIFLSNLLINMYVKCRSVLDAHQVFKEMPRRD  92

Query  2877  VITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
             VI+W +LIS Y+  G  +KA   F  M    GF PN  TY+  L+AC        GK+IH
Sbjct  93    VISWNSLISCYAQQGFKKKAFQLFEEM-QNAGFIPNKITYISILTACYSPAELENGKKIH  151

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
              +I +A    +  V N L++ YGKCG L  A+ VF  +   + V++ ++L  + Q     
Sbjct  152   SQIIKAGYQRDPRVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYAQKAYVK  211

Query  2517  EGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLV  2338
             E L +F +    G+  ++      L A  +   L  G  IH L V+ G+  D  V T LV
Sbjct  212   ECLGLFGQMSSEGISPDKVTYINLLDAFTTPSMLDEGKRIHKLTVEEGLNSDIRVGTALV  271

Query  2337  NFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSER  2158
                V+CG +  A   F   +  ++  + ALI    Q G   EA   + ++ S G+  +  
Sbjct  272   TMCVRCGDVDSAKQAFKGTADRDVVVYNALIAALAQHGHNVEAFEQYYRMRSDGVALNRT  331

Query  2157  TYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEM  1978
             TY S+L A + +K  + G  +HS I + G +S   + NAL+  Y++   L ++ ++F  M
Sbjct  332   TYLSILNACSTSKALEAGKLIHSHISEDGHSSDVQIGNALISMYARCGDLPKARELFYTM  391

Query  1977  TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGK  1798
              + D+++WNA+IAGY R     +A++L ++M  EG++P   T+  +LS C +  A   GK
Sbjct  392   PKRDLISWNAIIAGYARREDRGEAMRLYKQMQSEGVKPGRVTFLHLLSACANSSAYADGK  451

Query  1797  QVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHG  1618
              +H  I++ G  SN  + + L++MY +CG L +A+ VF+    ++++SWN+M+ G+AQHG
Sbjct  452   MIHEDILRSGIKSNGHLANALMNMYRRCGSLMEAQNVFEGTQARDVISWNSMIAGHAQHG  511

Query  1617  FGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHL  1438
               + A +++  MQ   ++P++ITF  VLS C +     E     +      G+    N  
Sbjct  512   SYETAYKLFQEMQNEELEPDNITFASVLSGCKN-PEALELGKQIHGRITESGLQLDVNLG  570

Query  1437  ACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGC  1321
               ++N++ R G  + A +   S   + D + W  ++ GC
Sbjct  571   NALINMYIRCGSLQDARNVFHSLQHR-DVMSWTAMIGGC  608


 Score =   292 bits (747),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 191/649 (29%), Positives = 324/649 (50%), Gaps = 14/649 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P K++   I+ +C +   + +GK  H+Q+IK G + D    N LLSMY    ++  A+++
Sbjct  126   PNKITYISILTACYSPAELENGKKIHSQIIKAGYQRDPRVQNSLLSMYGKCGDLPRARQV  185

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F  +  R+V+++ T++  Y+     ++ LG F  M  E G +P+  TY+  L A +    
Sbjct  186   FAGISPRDVVSYNTMLGLYAQKAYVKECLGLFGQMSSE-GISPDKVTYINLLDAFTTPSM  244

Query  2721  ARTGKEIHGRIFRAEETLNN--FVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLL  2548
                GK IH      EE LN+   V   LV    +CG + SA+  F    + + V + +L+
Sbjct  245   LDEGKRIHK--LTVEEGLNSDIRVGTALVTMCVRCGDVDSAKQAFKGTADRDVVVYNALI  302

Query  2547  SCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVK  2368
             +   Q G   E    + R    GV +N       L AC++ + L  G  IH  I + G  
Sbjct  303   AALAQHGHNVEAFEQYYRMRSDGVALNRTTYLSILNACSTSKALEAGKLIHSHISEDGHS  362

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
              D  +   L++ Y +CG L  A   F      +L +W A+I G  ++    EA+ L+ ++
Sbjct  363   SDVQIGNALISMYARCGDLPKARELFYTMPKRDLISWNAIIAGYARREDRGEAMRLYKQM  422

Query  2187  LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
              S G+KP   T+  +L A  ++  +  G  +H  I++ G  S   + NAL++ Y +   L
Sbjct  423   QSEGVKPGRVTFLHLLSACANSSAYADGKMIHEDILRSGIKSNGHLANALMNMYRRCGSL  482

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
              E+  +F+     D+++WN++IAG+ + G YE A KL QEM  E LEP+  T++ +LS C
Sbjct  483   MEAQNVFEGTQARDVISWNSMIAGHAQHGSYETAYKLFQEMQNEELEPDNITFASVLSGC  542

Query  1827  GDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWN  1648
              +  A+E GKQ+H RI + G   +V +G+ LI+MY +CG L DAR VF  L  ++++SW 
Sbjct  543   KNPEALELGKQIHGRITESGLQLDVNLGNALINMYIRCGSLQDARNVFHSLQHRDVMSWT  602

Query  1647  TMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNN  1468
              M+ G A  G   +A+E++  MQ  G +P   TF  +L  C     L+EG      + N+
Sbjct  603   AMIGGCADQGEDMKAIELFWQMQNEGFRPVKSTFSSILKVCTSSACLDEGKKVIAYILNS  662

Query  1467  YGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKY  1288
              G    T     +++ +++ G    A +     P + D V W  +++G   N    LG+ 
Sbjct  663   -GYELDTGVGNALISAYSKSGSMTDAREVFDKMPSR-DIVSWNKIIAGYAQNG---LGQT  717

Query  1287  AAEEILSIDPNDTSAH----VTLSNIYARLNMWDEAAQIRKMMKQKELK  1153
             A E    +   D   +    V+L N  +  +  +E  ++   + +++L+
Sbjct  718   AVEFAYQMQEQDVVPNKFSFVSLLNACSSFSALEEGKRVHAEIVKRKLQ  766


 Score =   253 bits (647),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 175/587 (30%), Positives = 274/587 (47%), Gaps = 51/587 (9%)
 Frame = -2

Query  2763  TYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAM  2584
             TYV  L  C+        K IH ++  A    + F+SN L+N Y KC  +  A  VF  M
Sbjct  29    TYVALLQNCTRKRLLPEAKRIHAQMVEAWVGPDIFLSNLLINMYVKCRSVLDAHQVFKEM  88

Query  2583  LEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGM  2404
                + ++W SL+SC+ Q G   +  ++F     AG + N+      L AC S   L  G 
Sbjct  89    PRRDVISWNSLISCYAQQGFKKKAFQLFEEMQNAGFIPNKITYISILTACYSPAELENGK  148

Query  2403  GIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQG  2224
              IH  I+K G + D  V   L++ Y KCG L  A   F   S  ++ ++  ++G   Q+ 
Sbjct  149   KIHSQIIKAGYQRDPRVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYAQKA  208

Query  2223  KGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCN  2044
               +E + LF ++ S G+ P + TY ++L AFT       G ++H   ++ G NS   V  
Sbjct  209   YVKECLGLFGQMSSEGISPDKVTYINLLDAFTTPSMLDEGKRIHKLTVEEGLNSDIRVGT  268

Query  2043  ALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEP  1864
             ALV    +   +D + + F+   + D+V +NALIA   + GH  +A +    M  +G+  
Sbjct  269   ALVTMCVRCGDVDSAKQAFKGTADRDVVVYNALIAALAQHGHNVEAFEQYYRMRSDGVAL  328

Query  1863  NLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVF  1684
             N  TY  IL+ C    A+E GK +H  I + G  S+V +G+ LI MYA+CG L  AR++F
Sbjct  329   NRTTYLSILNACSTSKALEAGKLIHSHISEDGHSSDVQIGNALISMYARCGDLPKARELF  388

Query  1683  DILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglle  1504
               +P ++L+SWN ++ GYA+     EA+ +Y  MQ  GVKP  +TF+ +LSAC +     
Sbjct  389   YTMPKRDLISWNAIIAGYARREDRGEAMRLYKQMQSEGVKPGRVTFLHLLSACANSSAYA  448

Query  1503  --------------egLNHF-NSMKNNYGITPRTNHLACMVNLF----------------  1417
                           +   H  N++ N Y    R   L    N+F                
Sbjct  449   DGKMIHEDILRSGIKSNGHLANALMNMY---RRCGSLMEAQNVFEGTQARDVISWNSMIA  505

Query  1416  --ARKGQTKKAYDFIRSFPE---KPDKVVWRCLLSGCNINKDFVLGK----YAAEEILSI  1264
               A+ G  + AY   +       +PD + +  +LSGC   +   LGK       E  L +
Sbjct  506   GHAQHGSYETAYKLFQEMQNEELEPDNITFASVLSGCKNPEALELGKQIHGRITESGLQL  565

Query  1263  DPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTEL  1123
             D N  +A   L N+Y R     +A  +   ++ +++      SWT +
Sbjct  566   DVNLGNA---LINMYIRCGSLQDARNVFHSLQHRDV-----MSWTAM  604


 Score = 93.2 bits (230),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 94/182 (52%), Gaps = 7/182 (4%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P K S   ++ +C++  ++  GK  HA+++K   + DV     L+SMY        AQ++
Sbjct  732   PNKFSFVSLLNACSSFSALEEGKRVHAEIVKRKLQGDVRVGAALISMYAKCGSQGEAQEV  791

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD + ++NV+TW  +I++Y+  GL+ KALG F  M  E G  P+  T+   LSAC+  G 
Sbjct  792   FDNIIEKNVVTWNAMINAYAQHGLASKALGFFNCMEKE-GIKPDGSTFTSILSACNHAGL  850

Query  2721  ARTGKEIHGRI---FRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAM-LEPNTVTWAS  2554
                G +I   +   +    T+ ++   CLV   G+    + A+ + + M   P+   W +
Sbjct  851   VLEGYQIFSSMESEYGVLPTIEHY--GCLVGLLGRARRFQEAETLINQMPFPPDAAVWET  908

Query  2553  LL  2548
             LL
Sbjct  909   LL  910



>ref|XP_010671697.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 
[Beta vulgaris subsp. vulgaris]
Length=846

 Score =   454 bits (1168),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 237/662 (36%), Positives = 379/662 (57%), Gaps = 1/662 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +  L+ ++R+C    +   G   H   IK G   +VY    L   Y    +I  A+ +
Sbjct  148   PNEFVLASVVRTCVQAGAFEQGIEVHGFAIKSGLSENVYVGTALTDFYAKLGDISDARMV  207

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FDE+ ++++ TWT +++ Y   G S+ +L  F  M+ +    P+ Y     L+AC+ L  
Sbjct  208   FDELKEKSLFTWTIMMTGYVKSGRSDVSLMLFHQMMRDLNVVPDRYVLSSVLNACTMLQY  267

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                 K+IH  + R    L+  V N L++FY KCG +KS + +F+ +   + ++W ++++ 
Sbjct  268   LDGAKQIHAYVLRRRIVLDVSVMNVLMDFYVKCGRVKSGRKLFEQIGAKDAISWTTMIAG  327

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q   + + L++F     +G  V++F+C   L +C S+E L  G  +H  I+K  ++ D
Sbjct  328   YMQNSFHVDALQLFHDMNISGWKVDDFVCSSILNSCGSLEALLPGKQVHAYIIKANLEFD  387

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
             +YV  GL++ Y KC  +  A   F+      + ++ A+I G  + G   EA++LF  +  
Sbjct  388   EYVSNGLIDMYSKCNAVADARRVFDSMIQNNVISYNAMIEGYSRLGSISEALDLFHDMRI  447

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
               L P+  T+ S+LG       +++  Q+H  IIK+G +S  FV +AL+D YSK N L +
Sbjct  448   KLLYPNPLTFVSILGVSALLSYWELSKQIHVHIIKVGLSSNLFVSSALIDVYSKCNFLGD  507

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +   F E+ E DIV WNAL+ GY +    E+A+KL  ++   G + N  T+  +L+   +
Sbjct  508   AKLAFNEIREKDIVVWNALLFGYTQQLENEEALKLYSQLQVAGEKANEFTFVAMLTAASN  567

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L ++  G+Q H ++MK G D++  V + L+DMYAKCG L +A  +F+    +++  WN+M
Sbjct  568   LASLRHGQQFHNQLMKTGLDTDAFVTNALLDMYAKCGCLQEAYLLFNTTQWRDVACWNSM  627

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +  YA HG  KEAL +Y  M ++G++PN +TF+G+LSAC H GL+E GL HFN+M  + G
Sbjct  628   ISTYANHGLAKEALSLYEKMLQDGLQPNYVTFIGLLSACSHAGLVEAGLKHFNTML-SCG  686

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I P   H ACMV+LF R G+   A +FI   P KP  +VWR LLS C ++ D+ LG YAA
Sbjct  687   IEPGMEHYACMVSLFGRAGKLNDAKEFIEKMPVKPTAIVWRSLLSACRVSGDYELGAYAA  746

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             E  +S +P D+ + V LSNIYA   MW E  +IR+ M+   + KE GCSW E+ +++  F
Sbjct  747   EMAISSNPEDSGSFVLLSNIYASKGMWTEVKEIRERMESHLVVKEPGCSWIEINDEVNVF  806

Query  1101  SS  1096
              S
Sbjct  807   VS  808


 Score =   310 bits (793),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 177/572 (31%), Positives = 296/572 (52%), Gaps = 3/572 (1%)
 Frame = -2

Query  3039  TNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTT  2860
             + K I   K  H  L   G   DV+  N L+ +Y     I+ AQ +FD+MPKRN+I+W+T
Sbjct  60    SEKPIFYYKRIHGHLFVSGIGYDVFLGNILMHLYSKLGSIQYAQNVFDKMPKRNLISWST  119

Query  2859  LISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRA  2680
             +++ Y   G +E AL  F          PN +     +  C   GA   G E+HG   ++
Sbjct  120   MVTVYVQHGYAEDALMVFSDFRRSCNERPNEFVLASVVRTCVQAGAFEQGIEVHGFAIKS  179

Query  2679  EETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIF  2500
               + N +V   L +FY K G +  A++VFD + E +  TW  +++ + + G  D  L +F
Sbjct  180   GLSENVYVGTALTDFYAKLGDISDARMVFDELKEKSLFTWTIMMTGYVKSGRSDVSLMLF  239

Query  2499  LRSLRA-GVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVK  2323
              + +R   V+ + ++    L AC  ++ L     IH  +++  + +D  V+  L++FYVK
Sbjct  240   HQMMRDLNVVPDRYVLSSVLNACTMLQYLDGAKQIHAYVLRRRIVLDVSVMNVLMDFYVK  299

Query  2322  CGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASV  2143
             CG++      F    A +  +WT +I G +Q     +A+ LF  +  SG K  +   +S+
Sbjct  300   CGRVKSGRKLFEQIGAKDAISWTTMIAGYMQNSFHVDALQLFHDMNISGWKVDDFVCSSI  359

Query  2142  LGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDI  1963
             L +    +    G Q+H++IIK       +V N L+D YSK N + ++ ++F  M + ++
Sbjct  360   LNSCGSLEALLPGKQVHAYIIKANLEFDEYVSNGLIDMYSKCNAVADARRVFDSMIQNNV  419

Query  1962  VTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCR  1783
             +++NA+I GY R G   +A+ L  +M  + L PN  T+  IL +   L   E  KQ+H  
Sbjct  420   ISYNAMIEGYSRLGSISEALDLFHDMRIKLLYPNPLTFVSILGVSALLSYWELSKQIHVH  479

Query  1782  IMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEA  1603
             I+K G  SN+ V S LID+Y+KC  LGDA+  F+ +  K++V WN +L GY Q    +EA
Sbjct  480   IIKVGLSSNLFVSSALIDVYSKCNFLGDAKLAFNEIREKDIVVWNALLFGYTQQLENEEA  539

Query  1602  LEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVN  1423
             L++YS +Q  G K N+ TFV +L+A  +   L  G    N +    G+         +++
Sbjct  540   LKLYSQLQVAGEKANEFTFVAMLTAASNLASLRHGQQFHNQLMKT-GLDTDAFVTNALLD  598

Query  1422  LFARKGQTKKAYDFIRSFPEKPDKVVWRCLLS  1327
             ++A+ G  ++AY    +  +  D   W  ++S
Sbjct  599   MYAKCGCLQEAYLLFNT-TQWRDVACWNSMIS  629



>gb|KDP35246.1| hypothetical protein JCGZ_09405 [Jatropha curcas]
Length=740

 Score =   451 bits (1159),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 244/676 (36%), Positives = 387/676 (57%), Gaps = 2/676 (0%)
 Frame = -2

Query  3018  GKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSH  2839
             GK  H  ++K G   DVY    L+ +YV   +I+ A+ +FD +  +N +TWTT+++ Y  
Sbjct  64    GKQIHGFVVKGGFYQDVYVGTSLVDLYVKNGQIDEARIVFDGLLVKNAVTWTTIMTGYVK  123

Query  2838  MGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNF  2659
              G SE +L  F  M  E  F P+ Y     LSACS L     G++IH  + R    ++  
Sbjct  124   SGRSEISLELFNQMK-EIDFVPDRYVLSSVLSACSTLEFFAGGEQIHAHVLRKGIEMDVS  182

Query  2658  VSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAG  2479
             V N L++FY KCG +++A+ +FD M+  N ++W ++ + + Q     E +++F+   R G
Sbjct  183   VVNALIDFYVKCGKVQTARKLFDRMVHRNEISWTTMTAGYMQNSLDREAVKLFIEMTRLG  242

Query  2478  VLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAY  2299
              + + F C   L +C S++ L  G  +H   +K  ++ D ++  GL++ Y KCG L  A 
Sbjct  243   EMPDGFACTSILTSCGSLDSLELGRQVHAYSIKANLQFDIFLKNGLIDMYAKCGALNDAR  302

Query  2298  NTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTK  2119
               F++ +   + ++ ALI G     K  EA+NLF  +    L PS  T+ S+LG      
Sbjct  303   RVFDVMTNHNVVSYNALIEGYSSSNKLFEAMNLFHDMRLKMLPPSLLTFVSLLGVSAALS  362

Query  2118  EFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIA  1939
               ++  Q+H+FIIK G     F+ +AL+D YSK   L ++  IF EMTE DIV WNA++ 
Sbjct  363   ALELSKQIHAFIIKFGLCLEIFIGSALIDVYSKCLCLRDARLIFDEMTEKDIVVWNAMLF  422

Query  1938  GYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDS  1759
             GY +    E+A+KL  E+     +PN  T++ +++   +L +++ G Q H +I++ G + 
Sbjct  423   GYTQQLENEEALKLYSELQLSEKKPNGFTFAALVTAASNLASLQIGHQFHTQIIQMGLNF  482

Query  1758  NVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQ  1579
             +  + ++L++MY+KCG   DARK F     +++V WN++++ YA HG  KEAL+++  + 
Sbjct  483   DPFITNSLVNMYSKCGNFEDARKAFGSTSSRDVVCWNSLILMYAHHGEAKEALQMFKKII  542

Query  1578  ENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQT  1399
             E G+KPN +TF+GVLSAC H GL+E+GL++F SM   + + P ++H AC+V+L  R G+ 
Sbjct  543   EKGIKPNYVTFLGVLSACNHAGLIEDGLHYFESMP-KFDVEPGSDHYACVVSLLGRAGKL  601

Query  1398  KKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTLSNIY  1219
              +A + I   P KP   VWR LLS C I+ +  +GKYAAE+ +SID  DT ++  LSNI 
Sbjct  602   YEAKELIEKMPIKPAAAVWRSLLSACRISGNIEIGKYAAEKAISIDSTDTGSYTLLSNIL  661

Query  1218  ARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGEVSMKKLLIGLT  1039
             A   MW +A Q+R+ M    + KE G SW E+  KI+ F +          +  +L  L 
Sbjct  662   ASKGMWVDAKQVRERMDVIGVLKEPGYSWIEVNKKIHVFIARDRNHCDTELIFAVLNYLI  721

Query  1038  AQLLDAGYVPDTKLSF  991
              Q+ + GYVP   LS 
Sbjct  722   LQIKEVGYVPLNNLSL  737


 Score =   280 bits (717),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 169/562 (30%), Positives = 287/562 (51%), Gaps = 38/562 (7%)
 Frame = -2

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR-  2716
             MP++N+I+W++++S YS  G  E+A   F         +PN +     + A   L     
Sbjct  1     MPEKNLISWSSMVSMYSKHGFHEEAFLMFLGFKRYCDDSPNGHILASVIRASGELDGRSG  60

Query  2715  --TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IHG + +     + +V   LV+ Y K G +  A++VFD +L  N VTW ++++ 
Sbjct  61    GCLGKQIHGFVVKGGFYQDVYVGTSLVDLYVKNGQIDEARIVFDGLLVKNAVTWTTIMTG  120

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + + G  +  L +F +      + + ++    L AC+++E    G  IH  +++ G++MD
Sbjct  121   YVKSGRSEISLELFNQMKEIDFVPDRYVLSSVLSACSTLEFFAGGEQIHAHVLRKGIEMD  180

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
               VV  L++FYVKCG++  A   F+        +WT +  G +Q    REAV LF ++  
Sbjct  181   VSVVNALIDFYVKCGKVQTARKLFDRMVHRNEISWTTMTAGYMQNSLDREAVKLFIEMTR  240

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              G  P      S+L +       ++G Q+H++ IK       F+ N L+D Y+K   L++
Sbjct  241   LGEMPDGFACTSILTSCGSLDSLELGRQVHAYSIKANLQFDIFLKNGLIDMYAKCGALND  300

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             + ++F  MT +++V++NALI GY  S    +A+ L  +M  + L P+L T+  +L +   
Sbjct  301   ARRVFDVMTNHNVVSYNALIEGYSSSNKLFEAMNLFHDMRLKMLPPSLLTFVSLLGVSAA  360

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L A+E  KQ+H  I+K G    + +GS LID+Y+KC  L DAR +FD +  K++V WN M
Sbjct  361   LSALELSKQIHAFIIKFGLCLEIFIGSALIDVYSKCLCLRDARLIFDEMTEKDIVVWNAM  420

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACG-----------HgglleegL  1495
             L GY Q    +EAL++YS +Q +  KPN  TF  +++A             H  +++ GL
Sbjct  421   LFGYTQQLENEEALKLYSELQLSEKKPNGFTFAALVTAASNLASLQIGHQFHTQIIQMGL  480

Query  1494  N-----------------HFNSMKNNYGITPRTNHLAC---MVNLFARKGQTKKAYDFIR  1375
             N                 +F   +  +G T  +  + C   ++ ++A  G+ K+A    +
Sbjct  481   NFDPFITNSLVNMYSKCGNFEDARKAFGSTS-SRDVVCWNSLILMYAHHGEAKEALQMFK  539

Query  1374  SFPE---KPDKVVWRCLLSGCN  1318
                E   KP+ V +  +LS CN
Sbjct  540   KIIEKGIKPNYVTFLGVLSACN  561


 Score =   240 bits (613),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 142/487 (29%), Positives = 259/487 (53%), Gaps = 12/487 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +  LS ++ +C+T +    G+  HA +++ G + DV   N L+  YV   +++ A+KL
Sbjct  144   PDRYVLSSVLSACSTLEFFAGGEQIHAHVLRKGIEMDVSVVNALIDFYVKCGKVQTARKL  203

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD M  RN I+WTT+ + Y    L  +A+  F  M    G  P+ +     L++C  L +
Sbjct  204   FDRMVHRNEISWTTMTAGYMQNSLDREAVKLFIEMT-RLGEMPDGFACTSILTSCGSLDS  262

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G+++H    +A    + F+ N L++ Y KCG L  A+ VFD M   N V++ +L+  
Sbjct  263   LELGRQVHAYSIKANLQFDIFLKNGLIDMYAKCGALNDARRVFDVMTNHNVVSYNALIEG  322

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIA-LGACASVECLGFGMGIHCLIVKCGVKM  2365
             +    +  E + +F   +R  +L    L  ++ LG  A++  L     IH  I+K G+ +
Sbjct  323   YSSSNKLFEAMNLF-HDMRLKMLPPSLLTFVSLLGVSAALSALELSKQIHAFIIKFGLCL  381

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
             + ++ + L++ Y KC  L  A   F+  +  ++  W A++ G  QQ +  EA+ L+ +L 
Sbjct  382   EIFIGSALIDVYSKCLCLRDARLIFDEMTEKDIVVWNAMLFGYTQQLENEEALKLYSELQ  441

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
              S  KP+  T+A+++ A ++    Q+G Q H+ II++G N   F+ N+LV+ YSK    +
Sbjct  442   LSEKKPNGFTFAALVTAASNLASLQIGHQFHTQIIQMGLNFDPFITNSLVNMYSKCGNFE  501

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
             ++ K F   +  D+V WN+LI  Y   G  ++A+++ ++++ +G++PN  T+  +LS C 
Sbjct  502   DARKAFGSTSSRDVVCWNSLILMYAHHGEAKEALQMFKKIIEKGIKPNYVTFLGVLSACN  561

Query  1824  DLPAIEWGKQVHCRIMKPGFDSNVVVGST----LIDMYAKCGRLGDARKVFDILPCKNLV  1657
                 IE G  +H     P FD  V  GS     ++ +  + G+L +A+++ + +P K   
Sbjct  562   HAGLIEDG--LHYFESMPKFD--VEPGSDHYACVVSLLGRAGKLYEAKELIEKMPIKPAA  617

Query  1656  S-WNTML  1639
             + W ++L
Sbjct  618   AVWRSLL  624


 Score =   144 bits (364),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 118/441 (27%), Positives = 212/441 (48%), Gaps = 40/441 (9%)
 Frame = -2

Query  2274  PE--LHAWTALIGGCVQQGKGREAVNLFCKLLSSGLK------PSERTYASVLGAFTDTK  2119
             PE  L +W++++    + G   EA  +F      G K      P+    ASV+ A  +  
Sbjct  2     PEKNLISWSSMVSMYSKHGFHEEAFLMFL-----GFKRYCDDSPNGHILASVIRASGELD  56

Query  2118  EFQ---VGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNA  1948
                   +G Q+H F++K GF    +V  +LVD Y K+  +DE+  +F  +   + VTW  
Sbjct  57    GRSGGCLGKQIHGFVVKGGFYQDVYVGTSLVDLYVKNGQIDEARIVFDGLLVKNAVTWTT  116

Query  1947  LIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPG  1768
             ++ GY++SG  E +++L  +M      P+ +  S +LS C  L     G+Q+H  +++ G
Sbjct  117   IMTGYVKSGRSEISLELFNQMKEIDFVPDRYVLSSVLSACSTLEFFAGGEQIHAHVLRKG  176

Query  1767  FDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYS  1588
              + +V V + LID Y KCG++  ARK+FD +  +N +SW TM  GY Q+   +EA++++ 
Sbjct  177   IEMDVSVVNALIDFYVKCGKVQTARKLFDRMVHRNEISWTTMTAGYMQNSLDREAVKLFI  236

Query  1587  MMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNN--YGITPRTNHLACMVNLF  1417
              M   G  P+      +L++CG    LE G   H  S+K N  + I  +      +++++
Sbjct  237   EMTRLGEMPDGFACTSILTSCGSLDSLELGRQVHAYSIKANLQFDIFLKNG----LIDMY  292

Query  1416  ARKG---QTKKAYDFIRSFPEKPDKVVWRCLLSG-CNINKDFVLGKYAAEEILSIDPNDT  1249
             A+ G     ++ +D + +     + V +  L+ G  + NK F       +  L + P   
Sbjct  293   AKCGALNDARRVFDVMTNH----NVVSYNALIEGYSSSNKLFEAMNLFHDMRLKMLPPSL  348

Query  1248  SAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKE--TGCSWTELQNKIYCFSSSYNMLLG  1075
                V+L  + A L+  + + QI   + +  L  E   G +  ++ +K  C   +  ++  
Sbjct  349   LTFVSLLGVSAALSALELSKQIHAFIIKFGLCLEIFIGSALIDVYSKCLCLRDA-RLIFD  407

Query  1074  EVSMKK------LLIGLTAQL  1030
             E++ K       +L G T QL
Sbjct  408   EMTEKDIVVWNAMLFGYTQQL  428


 Score = 90.5 bits (223),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 97/192 (51%), Gaps = 6/192 (3%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF  2929
             S +  + + P   + + ++ + +   S+  G   H Q+I+ G   D +  N L++MY   
Sbjct  438   SELQLSEKKPNGFTFAALVTAASNLASLQIGHQFHTQIIQMGLNFDPFITNSLVNMYSKC  497

Query  2928  HEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGA  2749
                E A+K F     R+V+ W +LI  Y+H G +++AL  F+  ++E G  PN+ T++G 
Sbjct  498   GNFEDARKAFGSTSSRDVVCWNSLILMYAHHGEAKEALQMFKK-IIEKGIKPNYVTFLGV  556

Query  2748  LSACSCLGAARTGKEIHGRI--FRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAM-LE  2578
             LSAC+  G    G      +  F  E   +++   C+V+  G+ G L  A+ + + M ++
Sbjct  557   LSACNHAGLIEDGLHYFESMPKFDVEPGSDHYA--CVVSLLGRAGKLYEAKELIEKMPIK  614

Query  2577  PNTVTWASLLSC  2542
             P    W SLLS 
Sbjct  615   PAAAVWRSLLSA  626



>ref|XP_001780298.1| predicted protein [Physcomitrella patens]
 gb|EDQ54857.1| predicted protein [Physcomitrella patens]
Length=986

 Score =   458 bits (1178),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 247/694 (36%), Positives = 384/694 (55%), Gaps = 2/694 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P K +   ++ +C   +++  G+  +  ++K G  +D++    L++M++   +I  A K+
Sbjct  209   PDKRTFVSMLNACADARNVDKGRELYNLILKAGWDTDLFVGTALINMHIKCGDIGDATKV  268

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD +P R+++TWT++I+  +  G  ++A   F+ M  E+G  P+   +V  L AC+   A
Sbjct  269   FDNLPTRDLVTWTSMITGLARHGRFKQACNLFQRME-EEGVQPDKVAFVSLLRACNHPEA  327

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK++H R+         +V   +++ Y KCG ++ A  VFD +   N V+W ++++ 
Sbjct  328   LEQGKKVHARMKEVGWDTEIYVGTAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAG  387

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
               Q G  DE    F + + +G+  N       LGAC+S   L  G  I   I++ G   D
Sbjct  388   FAQHGRIDEAFLFFNKMIESGIEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSD  447

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
               V T L++ Y KCG L  A+  F   S   + AW A+I   VQ  +   A+  F  LL 
Sbjct  448   DRVRTALLSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQYDNALATFQALLK  507

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              G+KP+  T+ S+L     +   ++G  +H  I+K G  S   V NALV  +     L  
Sbjct  508   EGIKPNSSTFTSILNVCKSSDSLELGKWVHFLIMKAGLESDLHVSNALVSMFVNCGDLMS  567

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F +M + D+V+WN +IAG+++ G  + A    + M   G++P+  T++ +L+ C  
Sbjct  568   AKNLFNDMPKRDLVSWNTIIAGFVQHGKNQVAFDYFKMMQESGIKPDKITFTGLLNACAS  627

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
               A+  G+++H  I +  FD +V+VG+ LI MY KCG + DA +VF  LP KN+ SW +M
Sbjct  628   PEALTEGRRLHALITEAAFDCDVLVGTGLISMYTKCGSIEDAHQVFHKLPKKNVYSWTSM  687

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             + GYAQHG GKEALE++  MQ+ GVKP+ ITFVG LSAC H GL+EEGL+HF SMK  + 
Sbjct  688   ITGYAQHGRGKEALELFYQMQQEGVKPDWITFVGALSACAHAGLIEEGLHHFQSMK-EFN  746

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I PR  H  CMV+LF R G   +A +FI     +PD  VW  LL  C ++ +  L + AA
Sbjct  747   IEPRMEHYGCMVDLFGRAGLLNEAVEFIIKMQVEPDSRVWGALLGACQVHLNVELAEKAA  806

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             ++ L +DPND    V LSNIYA   MW E A++RK+M  + + K+ G SW E+  K++ F
Sbjct  807   QKKLELDPNDNGVFVILSNIYAAAGMWKEVAKMRKVMLDRGVVKKPGQSWIEVDGKVHTF  866

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDTK  1000
              S          +   L  L  ++   GYVPDT+
Sbjct  867   YSDDKTHPQTEEIHAELERLHMEMRQLGYVPDTR  900


 Score =   332 bits (852),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 167/518 (32%), Positives = 292/518 (56%), Gaps = 1/518 (0%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + + S +++ C   K++  G+  +  + K G + D++  N L++MY        A+++FD
Sbjct  110   RQTYSALLQLCIKFKNLGDGERIYNHIKKSGVQPDIFMWNTLINMYAKCGNTISAKQIFD  169

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
             +M +++V +W  L+  Y   GL E+A      MV +D   P+  T+V  L+AC+      
Sbjct  170   DMREKDVYSWNLLLGGYVQHGLYEEAFKLHEQMV-QDSVKPDKRTFVSMLNACADARNVD  228

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G+E++  I +A    + FV   L+N + KCG +  A  VFD +   + VTW S+++   
Sbjct  229   KGRELYNLILKAGWDTDLFVGTALINMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLA  288

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
             + G + +   +F R    GV  ++      L AC   E L  G  +H  + + G   + Y
Sbjct  289   RHGRFKQACNLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIY  348

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V T +++ Y KCG +  A   F++     + +WTA+I G  Q G+  EA   F K++ SG
Sbjct  349   VGTAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRIDEAFLFFNKMIESG  408

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             ++P+  T+ S+LGA +     + G Q+   II+ G+ S   V  AL+  Y+K   L ++ 
Sbjct  409   IEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDDRVRTALLSMYAKCGSLKDAH  468

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
             ++F+++++ ++V WNA+I  Y++   Y+ A+   Q +L EG++PN  T++ IL++C    
Sbjct  469   RVFEKISKQNVVAWNAMITAYVQHEQYDNALATFQALLKEGIKPNSSTFTSILNVCKSSD  528

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             ++E GK VH  IMK G +S++ V + L+ M+  CG L  A+ +F+ +P ++LVSWNT++ 
Sbjct  529   SLELGKWVHFLIMKAGLESDLHVSNALVSMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIA  588

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACG  1522
             G+ QHG  + A + + MMQE+G+KP+ ITF G+L+AC 
Sbjct  589   GFVQHGKNQVAFDYFKMMQESGIKPDKITFTGLLNACA  626


 Score =   238 bits (606),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 139/469 (30%), Positives = 248/469 (53%), Gaps = 10/469 (2%)
 Frame = -2

Query  2643  VNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNE  2464
              +F G+C   K   +VF  +   +T    ++L+   + G+++E +++  R   + + +  
Sbjct  55    TSFSGRCP--KGRCVVFADI--KDTQKANAVLNRLSKAGQFNEAMQVLERVDSSHIQIYR  110

Query  2463  FLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNM  2284
                   L  C   + LG G  I+  I K GV+ D ++   L+N Y KCG    A   F+ 
Sbjct  111   QTYSALLQLCIKFKNLGDGERIYNHIKKSGVQPDIFMWNTLINMYAKCGNTISAKQIFDD  170

Query  2283  ASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVG  2104
                 ++++W  L+GG VQ G   EA  L  +++   +KP +RT+ S+L A  D +    G
Sbjct  171   MREKDVYSWNLLLGGYVQHGLYEEAFKLHEQMVQDSVKPDKRTFVSMLNACADARNVDKG  230

Query  2103  MQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRS  1924
              +L++ I+K G+++  FV  AL++ + K   + ++ K+F  +   D+VTW ++I G  R 
Sbjct  231   RELYNLILKAGWDTDLFVGTALINMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARH  290

Query  1923  GHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVG  1744
             G ++QA  L Q M  EG++P+   +  +L  C    A+E GK+VH R+ + G+D+ + VG
Sbjct  291   GRFKQACNLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIYVG  350

Query  1743  STLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVK  1564
             + ++ MY KCG + DA +VFD++  +N+VSW  M+ G+AQHG   EA   ++ M E+G++
Sbjct  351   TAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRIDEAFLFFNKMIESGIE  410

Query  1563  PNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAY  1387
             PN +TF+ +L AC     L+ G     + ++  YG   R      +++++A+ G  K A+
Sbjct  411   PNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDDRVR--TALLSMYAKCGSLKDAH  468

Query  1386  DFIRSFPEKPDKVVWRCLLSGCNINK--DFVLGKYAAEEILSIDPNDTS  1246
                     K + V W  +++    ++  D  L  + A     I PN ++
Sbjct  469   RVFEKI-SKQNVVAWNAMITAYVQHEQYDNALATFQALLKEGIKPNSST  516



>gb|KDP23280.1| hypothetical protein JCGZ_23113 [Jatropha curcas]
Length=773

 Score =   452 bits (1162),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 259/696 (37%), Positives = 387/696 (56%), Gaps = 4/696 (1%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             ++R+C      ++GKA H ++IK G+  D++ +N LL++YV    +  A KLFDEMP+RN
Sbjct  1     MLRACIQTDDHIAGKALHCEIIKKGNCLDLFGSNILLNLYVKSDALSDASKLFDEMPERN  60

Query  2877  VITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
              +++ TLI  ++       AL  F S +  +G   N + +   L    C+  A     IH
Sbjct  61    TVSFVTLIQGHAQSLQLFGALELF-SRLHREGHELNPFVFTTILKLLVCMEWAELCYCIH  119

Query  2697  GRIFRAEETLNNFVSNCLVNFYG--KCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGE  2524
               IF+     + FV   L++ Y    CG + SA+ VFD++   + V+W  +++C+ +   
Sbjct  120   ACIFKLGLDSDAFVGTALIDSYSVCGCGYVDSARQVFDSIANKDMVSWTGMVACYAENDH  179

Query  2523  YDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTG  2344
             +++ L +F +    G   N F    AL +C  +E    G GIH L +K   ++D YV   
Sbjct  180   FEDSLHLFSQMRMLGFKPNHFTFAGALKSCIGLEAFDVGKGIHGLSIKTRYELDLYVGVS  239

Query  2343  LVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPS  2164
             L++ Y+K G  G A   F      ++  W+ +I    Q  + +EAV+LFC++  + + P+
Sbjct  240   LLDLYIKSGDTGGAVQVFEEMPKIDVIPWSFMIARYAQSNQSKEAVDLFCQMRQAFVLPN  299

Query  2163  ERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQ  1984
             + T+ASVL A    +    G Q+HS I+K+G +   FV NAL+D Y+K   ++ S ++F 
Sbjct  300   QFTFASVLQACATMESLDFGRQIHSHILKVGLDINLFVANALMDVYAKCGRVENSMELFV  359

Query  1983  EMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEW  1804
             E+   + VTWN +I GY++SG  E+A+ L + ML   ++    TYS  L  C  L A+E 
Sbjct  360   ELPNRNDVTWNTMIVGYVQSGSGEKALSLFKTMLECQVQATEVTYSSTLRACASLAAMEP  419

Query  1803  GKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQ  1624
             G Q+H   +K  +D ++VVG+ LIDMYAKCG + DAR +FD+L   + +SWN M+ GY+ 
Sbjct  420   GIQIHSLSVKTLYDKDIVVGNALIDMYAKCGSIKDARLIFDMLSECDKISWNAMISGYST  479

Query  1623  HGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTN  1444
             HG   EAL I+ MMQE   KP+ +TFVGVLSAC   GLL+ G  +F SM  +YGI P   
Sbjct  480   HGLCAEALNIFQMMQETESKPDKLTFVGVLSACSSAGLLDTGQAYFKSMVEDYGIEPCME  539

Query  1443  HLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSI  1264
             H  CMV L  R G   KA   I   P +P   VWR LL  C I+ D  LG+ +AE +L I
Sbjct  540   HYTCMVWLLGRSGHLDKAVKLIEQIPVEPSVTVWRALLGACVIHNDVELGRISAERVLQI  599

Query  1263  DPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNM  1084
             DP D ++HV ++N+YA    W+  A +RK MK+K +KKE G SW E Q  ++ FS     
Sbjct  600   DPQDEASHVLVANMYATARCWENVASVRKTMKKKGVKKEPGLSWIENQGAVHYFSVGDTS  659

Query  1083  LLGEVSMKKLLIGLTAQLLDAGYVPD-TKLSFDYGD  979
                   +  +L  L  +   AGYVPD   + FD  D
Sbjct  660   HPDMKLINGMLEWLNMKTRKAGYVPDLNAVLFDAED  695


 Score =   173 bits (438),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 121/437 (28%), Positives = 206/437 (47%), Gaps = 36/437 (8%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + +  ++SC   ++   GK  H   IK   + D+Y    LL +Y+   +   A ++
Sbjct  197   PNHFTFAGALKSCIGLEAFDVGKGIHGLSIKTRYELDLYVGVSLLDLYIKSGDTGGAVQV  256

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFT-PNHYTYVGALSACSCLG  2725
             F+EMPK +VI W+ +I+ Y+    S++A+  F  M     F  PN +T+   L AC+ + 
Sbjct  257   FEEMPKIDVIPWSFMIARYAQSNQSKEAVDLFCQM--RQAFVLPNQFTFASVLQACATME  314

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
             +   G++IH  I +    +N FV+N L++ Y KCG ++++  +F  +   N VTW +++ 
Sbjct  315   SLDFGRQIHSHILKVGLDINLFVANALMDVYAKCGRVENSMELFVELPNRNDVTWNTMIV  374

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
              + Q G  ++ L +F   L   V   E      L ACAS+  +  G+ IH L VK     
Sbjct  375   GYVQSGSGEKALSLFKTMLECQVQATEVTYSSTLRACASLAAMEPGIQIHSLSVKTLYDK  434

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
             D  V   L++ Y KCG +  A   F+M S  +  +W A+I G    G   EA+N+F  + 
Sbjct  435   DIVVGNALIDMYAKCGSIKDARLIFDMLSECDKISWNAMISGYSTHGLCAEALNIFQMMQ  494

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
              +  KP + T+  VL A +       G                         Y KS +  
Sbjct  495   ETESKPDKLTFVGVLSACSSAGLLDTGQA-----------------------YFKSMV--  529

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
             E + I   M  Y  + W   + G  RSGH ++A+KL++++    +EP++  +  +L  C 
Sbjct  530   EDYGIEPCMEHYTCMVW---LLG--RSGHLDKAVKLIEQI---PVEPSVTVWRALLGACV  581

Query  1824  DLPAIEWGKQVHCRIMK  1774
                 +E G+    R+++
Sbjct  582   IHNDVELGRISAERVLQ  598



>ref|XP_004139569.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like 
[Cucumis sativus]
 gb|KGN64886.1| hypothetical protein Csa_1G145880 [Cucumis sativus]
Length=878

 Score =   455 bits (1170),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 251/702 (36%), Positives = 401/702 (57%), Gaps = 19/702 (3%)
 Frame = -2

Query  3072  MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDE  2893
             ++LS  ++ C      + G+  H Q +K G   DV     L+ MY+   + E  + +FDE
Sbjct  105   LTLSCALKVCGVLFDQVVGRQVHCQSLKSGFLEDVSVGTSLVDMYMKTEDFEDGRGIFDE  164

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAART  2713
             M  +NV++WT+L+S Y+  GL+++ +     M +E G  PN +T+   L A +       
Sbjct  165   MGIKNVVSWTSLLSGYARNGLNDEVIHLINQMQME-GVNPNGFTFATVLGALADESIIEG  223

Query  2712  GKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQ  2533
             G ++H  I +       FV N L+  Y K  ++  A+ VFD+M+  ++VTW  ++  +  
Sbjct  224   GVQVHAMIVKNGFEFTTFVCNALICMYLKSEMVGDAEAVFDSMVVRDSVTWNIMIGGYAA  283

Query  2532  CGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
              G Y EG ++F R   AGV ++  +   AL  C+    L F   +HC +VK G +  Q +
Sbjct  284   IGFYLEGFQMFHRMRLAGVKLSRTVFCTALKLCSQQRELNFTKQLHCGVVKNGYEFAQDI  343

Query  2352  VTGLVNFYVKCGQLGLAYNTFNMASAPE-LHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
              T L+  Y KC  +  A+  F+MA A   +  WTA+IGG VQ     +AV+LFC++   G
Sbjct  344   RTALMVTYSKCSSVDEAFKLFSMADAAHNVVTWTAMIGGFVQNNNNEKAVDLFCQMSREG  403

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             ++P+  TY++VL      K   +  QLH+ IIK  +     V  AL+D Y K+  + ES 
Sbjct  404   VRPNHFTYSTVLAG----KPSSLLSQLHAQIIKAYYEKVPSVATALLDAYVKTGNVVESA  459

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
             ++F  +   DIV W+A++ G  ++   E+A+++  +++ EG++PN +T+S +++ C    
Sbjct  460   RVFYSIPAKDIVAWSAMLTGLAQTRDSEKAMEVFIQLVKEGVKPNEYTFSSVINACSSSA  519

Query  1815  A-IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
             A +E GKQ+H   +K G  + + V S L+ MY+K G +  A KVF     +++VSWN+M+
Sbjct  520   ATVEHGKQIHATAVKSGKSNALCVSSALLTMYSKKGNIESAEKVFTRQEERDIVSWNSMI  579

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGI  1459
              GY QHG  K+ALE++ +MQ  G+  +D+TF+GVL+AC H GL+EEG  +FN M  +Y I
Sbjct  580   TGYGQHGDAKKALEVFQIMQNQGLPLDDVTFIGVLTACTHAGLVEEGEKYFNIMIKDYHI  639

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAE  1279
               +  H +CMV+L++R G   KA D I   P      +WR LL+ C ++++  LGK AAE
Sbjct  640   DKKIEHYSCMVDLYSRAGMFDKAMDIINGMPFPASPTIWRTLLAACRVHRNLELGKLAAE  699

Query  1278  EILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFS  1099
             +++S+ PND   +V LSNI+A    W+E A +RK+M ++++KKE GCSW E++N+I+ F 
Sbjct  700   KLVSLQPNDAVGYVLLSNIHAVAGNWEEKAHVRKLMDERKVKKEAGCSWIEIKNRIFSF-  758

Query  1098  SSYNMLLGEVS------MKKLLIGLTAQLLDAGYVPDTKLSF  991
                  L G+VS      +   L  L+ +L D GY PDT   F
Sbjct  759   -----LAGDVSHPFSDLVYAKLEELSIKLKDMGYQPDTNYVF  795


 Score =   187 bits (475),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 117/437 (27%), Positives = 205/437 (47%), Gaps = 7/437 (2%)
 Frame = -2

Query  2613  KSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGAC  2434
             + A  +FD     +   +  LL    +     E L +F     +G+ V+      AL  C
Sbjct  55    RYAHQLFDETPLKDISHYNRLLFDFSRNNHDREALHLFKDLHSSGLGVDGLTLSCALKVC  114

Query  2433  ASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWT  2254
               +     G  +HC  +K G   D  V T LV+ Y+K          F+      + +WT
Sbjct  115   GVLFDQVVGRQVHCQSLKSGFLEDVSVGTSLVDMYMKTEDFEDGRGIFDEMGIKNVVSWT  174

Query  2253  ALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKL  2074
             +L+ G  + G   E ++L  ++   G+ P+  T+A+VLGA  D    + G+Q+H+ I+K 
Sbjct  175   SLLSGYARNGLNDEVIHLINQMQMEGVNPNGFTFATVLGALADESIIEGGVQVHAMIVKN  234

Query  2073  GFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLL  1894
             GF   TFVCNAL+  Y KS ++ ++  +F  M   D VTWN +I GY   G Y +  ++ 
Sbjct  235   GFEFTTFVCNALICMYLKSEMVGDAEAVFDSMVVRDSVTWNIMIGGYAAIGFYLEGFQMF  294

Query  1893  QEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKC  1714
               M   G++ +   +   L +C     + + KQ+HC ++K G++    + + L+  Y+KC
Sbjct  295   HRMRLAGVKLSRTVFCTALKLCSQQRELNFTKQLHCGVVKNGYEFAQDIRTALMVTYSKC  354

Query  1713  GRLGDARKVFDIL-PCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGV  1537
               + +A K+F +     N+V+W  M+ G+ Q+   ++A++++  M   GV+PN  T+  V
Sbjct  355   SSVDEAFKLFSMADAAHNVVTWTAMIGGFVQNNNNEKAVDLFCQMSREGVRPNHFTYSTV  414

Query  1536  LSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKP  1357
             L+             H   +K  Y   P       +++ + + G   ++     S P K 
Sbjct  415   LAG---KPSSLLSQLHAQIIKAYYEKVPSV--ATALLDAYVKTGNVVESARVFYSIPAK-  468

Query  1356  DKVVWRCLLSGCNINKD  1306
             D V W  +L+G    +D
Sbjct  469   DIVAWSAMLTGLAQTRD  485


 Score =   176 bits (446),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 130/515 (25%), Positives = 238/515 (46%), Gaps = 15/515 (3%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + + ++ +      I  G   HA ++K G +   +  N L+ MY+    +  A+ +
Sbjct  203   PNGFTFATVLGALADESIIEGGVQVHAMIVKNGFEFTTFVCNALICMYLKSEMVGDAEAV  262

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD M  R+ +TW  +I  Y+ +G   +    F  M L  G   +   +  AL  CS    
Sbjct  263   FDSMVVRDSVTWNIMIGGYAAIGFYLEGFQMFHRMRLA-GVKLSRTVFCTALKLCSQQRE  321

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFD-AMLEPNTVTWASLLS  2545
                 K++H  + +        +   L+  Y KC  +  A  +F  A    N VTW +++ 
Sbjct  322   LNFTKQLHCGVVKNGYEFAQDIRTALMVTYSKCSSVDEAFKLFSMADAAHNVVTWTAMIG  381

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
                Q    ++ + +F +  R GV  N F     L    S         +H  I+K   + 
Sbjct  382   GFVQNNNNEKAVDLFCQMSREGVRPNHFTYSTVLAGKPS----SLLSQLHAQIIKAYYEK  437

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
                V T L++ YVK G +  +   F    A ++ AW+A++ G  Q     +A+ +F +L+
Sbjct  438   VPSVATALLDAYVKTGNVVESARVFYSIPAKDIVAWSAMLTGLAQTRDSEKAMEVFIQLV  497

Query  2184  SSGLKPSERTYASVLGAFTDTKE-FQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
               G+KP+E T++SV+ A + +    + G Q+H+  +K G ++   V +AL+  YSK   +
Sbjct  498   KEGVKPNEYTFSSVINACSSSAATVEHGKQIHATAVKSGKSNALCVSSALLTMYSKKGNI  557

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
             + + K+F    E DIV+WN++I GY + G  ++A+++ Q M  +GL  +  T+  +L+ C
Sbjct  558   ESAEKVFTRQEERDIVSWNSMITGYGQHGDAKKALEVFQIMQNQGLPLDDVTFIGVLTAC  617

Query  1827  GDLPAIEWGKQVHCRIMKP-GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILP-CKNLVS  1654
                  +E G++    ++K    D  +   S ++D+Y++ G    A  + + +P   +   
Sbjct  618   THAGLVEEGEKYFNIMIKDYHIDKKIEHYSCMVDLYSRAGMFDKAMDIINGMPFPASPTI  677

Query  1653  WNTMLIGYAQHGFGKEALEIYSMMQEN--GVKPND  1555
             W T+L     H      LE+  +  E    ++PND
Sbjct  678   WRTLLAACRVH----RNLELGKLAAEKLVSLQPND  708


 Score =   145 bits (367),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 108/366 (30%), Positives = 168/366 (46%), Gaps = 9/366 (2%)
 Frame = -2

Query  2304  AYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTD  2125
             A+  F+     ++  +  L+    +    REA++LF  L SSGL     T +  L     
Sbjct  57    AHQLFDETPLKDISHYNRLLFDFSRNNHDREALHLFKDLHSSGLGVDGLTLSCALKVCGV  116

Query  2124  TKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNAL  1945
               +  VG Q+H   +K GF     V  +LVD Y K+   ++   IF EM   ++V+W +L
Sbjct  117   LFDQVVGRQVHCQSLKSGFLEDVSVGTSLVDMYMKTEDFEDGRGIFDEMGIKNVVSWTSL  176

Query  1944  IAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGF  1765
             ++GY R+G  ++ I L+ +M  EG+ PN  T++ +L    D   IE G QVH  I+K GF
Sbjct  177   LSGYARNGLNDEVIHLINQMQMEGVNPNGFTFATVLGALADESIIEGGVQVHAMIVKNGF  236

Query  1764  DSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSM  1585
             +    V + LI MY K   +GDA  VFD +  ++ V+WN M+ GYA  GF  E  +++  
Sbjct  237   EFTTFVCNALICMYLKSEMVGDAEAVFDSMVVRDSVTWNIMIGGYAAIGFYLEGFQMFHR  296

Query  1584  MQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARK  1408
             M+  GVK +   F   L  C     L      H   +KN Y         A MV  +++ 
Sbjct  297   MRLAGVKLSRTVFCTALKLCSQQRELNFTKQLHCGVVKNGYEFAQDIR-TALMVT-YSKC  354

Query  1407  GQTKKAYDFIRSFPEKPDKVVWRCLLSGC--NINKDFVLGKYAAEEILSIDPNDTSAHVT  1234
                 +A+          + V W  ++ G   N N +  +  +       + PN    H T
Sbjct  355   SSVDEAFKLFSMADAAHNVVTWTAMIGGFVQNNNNEKAVDLFCQMSREGVRPN----HFT  410

Query  1233  LSNIYA  1216
              S + A
Sbjct  411   YSTVLA  416


 Score =   124 bits (311),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 91/285 (32%), Positives = 140/285 (49%), Gaps = 13/285 (5%)
 Frame = -2

Query  2157  TYASVLGAFTDTKEFQVGM-QLHSFI--IKLGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
             T  S L    +  +  VG  +L S I  IK   +   F+ +  + F S  +    + ++F
Sbjct  2     TLGSSLRTLQNKAKITVGNGRLQSSIHHIKHFLHPHGFLYHQSLPFISLPSRPRYAHQLF  61

Query  1986  QEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIE  1807
              E    DI  +N L+  + R+ H  +A+ L +++   GL  +  T SC L +CG L    
Sbjct  62    DETPLKDISHYNRLLFDFSRNNHDREALHLFKDLHSSGLGVDGLTLSCALKVCGVLFDQV  121

Query  1806  WGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYA  1627
              G+QVHC+ +K GF  +V VG++L+DMY K     D R +FD +  KN+VSW ++L GYA
Sbjct  122   VGRQVHCQSLKSGFLEDVSVGTSLVDMYMKTEDFEDGRGIFDEMGIKNVVSWTSLLSGYA  181

Query  1626  QHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPR  1450
             ++G   E + + + MQ  GV PN  TF  VL A     ++E G+  H   +KN +  T  
Sbjct  182   RNGLNDEVIHLINQMQMEGVNPNGFTFATVLGALADESIIEGGVQVHAMIVKNGFEFTTF  241

Query  1449  T-NHLACMVNLFARKGQTKKAYD--FIRSFPEKPDKVVWRCLLSG  1324
               N L CM       G  +  +D   +R      D V W  ++ G
Sbjct  242   VCNALICMYLKSEMVGDAEAVFDSMVVR------DSVTWNIMIGG  280



>dbj|BAD67155.1| PpPPR_98 [Physcomitrella patens]
Length=986

 Score =   458 bits (1178),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 247/694 (36%), Positives = 384/694 (55%), Gaps = 2/694 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P K +   ++ +C   +++  G+  +  ++K G  +D++    L++M++   +I  A K+
Sbjct  209   PDKRTFVSMLNACADARNVDKGRELYNLILKAGWDTDLFVGTALINMHIKCGDIGDATKV  268

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD +P R+++TWT++I+  +  G  ++A   F+ M  E+G  P+   +V  L AC+   A
Sbjct  269   FDNLPTRDLVTWTSMITGLARHGRFKQACNLFQRME-EEGVQPDKVAFVSLLRACNHPEA  327

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK++H R+         +V   +++ Y KCG ++ A  VFD +   N V+W ++++ 
Sbjct  328   LEQGKKVHARMKEVGWDTEIYVGTAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAG  387

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
               Q G  DE    F + + +G+  N       LGAC+S   L  G  I   I++ G   D
Sbjct  388   FAQHGRIDEAFLFFNKMIESGIEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSD  447

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
               V T L++ Y KCG L  A+  F   S   + AW A+I   VQ  +   A+  F  LL 
Sbjct  448   DRVRTALLSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQYDNALATFQALLK  507

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              G+KP+  T+ S+L     +   ++G  +H  I+K G  S   V NALV  +     L  
Sbjct  508   EGIKPNSSTFTSILNVCKSSDSLELGKWVHFLIMKAGLESDLHVSNALVSMFVNCGDLMS  567

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F +M + D+V+WN +IAG+++ G  + A    + M   G++P+  T++ +L+ C  
Sbjct  568   AKNLFNDMPKRDLVSWNTIIAGFVQHGKNQVAFDYFKMMQESGIKPDKITFTGLLNACAS  627

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
               A+  G+++H  I +  FD +V+VG+ LI MY KCG + DA +VF  LP KN+ SW +M
Sbjct  628   PEALTEGRRLHALITEAAFDCDVLVGTGLISMYTKCGSIEDAHQVFHKLPKKNVYSWTSM  687

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             + GYAQHG GKEALE++  MQ+ GVKP+ ITFVG LSAC H GL+EEGL+HF SMK  + 
Sbjct  688   IAGYAQHGRGKEALELFYQMQQEGVKPDWITFVGALSACAHAGLIEEGLHHFQSMK-EFN  746

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I PR  H  CMV+LF R G   +A +FI     +PD  VW  LL  C ++ +  L + AA
Sbjct  747   IEPRMEHYGCMVDLFGRAGLLNEAVEFIIKMQVEPDSRVWGALLGACQVHLNVELAEKAA  806

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             ++ L +DPND    V LSNIYA   MW E A++RK+M  + + K+ G SW E+  K++ F
Sbjct  807   QKKLELDPNDNGVFVILSNIYAAAGMWKEVAKMRKVMLDRGVVKKPGQSWIEVDGKVHTF  866

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDTK  1000
              S          +   L  L  ++   GYVPDT+
Sbjct  867   YSDDKTHPQTEEIHAELERLHMEMRQLGYVPDTR  900


 Score =   334 bits (856),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 167/518 (32%), Positives = 292/518 (56%), Gaps = 1/518 (0%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + + S +++ C   K++  G+  +  + K G + D++  N L++MY        A+++FD
Sbjct  110   RQTYSALLQLCIKFKNLGDGERIYNHIKKSGVQPDIFMRNTLINMYAKCGNTISAKQIFD  169

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
             +M +++V +W  L+  Y   GL E+A      MV +D   P+  T+V  L+AC+      
Sbjct  170   DMREKDVYSWNLLLGGYVQHGLYEEAFKLHEQMV-QDSVKPDKRTFVSMLNACADARNVD  228

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G+E++  I +A    + FV   L+N + KCG +  A  VFD +   + VTW S+++   
Sbjct  229   KGRELYNLILKAGWDTDLFVGTALINMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLA  288

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
             + G + +   +F R    GV  ++      L AC   E L  G  +H  + + G   + Y
Sbjct  289   RHGRFKQACNLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIY  348

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V T +++ Y KCG +  A   F++     + +WTA+I G  Q G+  EA   F K++ SG
Sbjct  349   VGTAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRIDEAFLFFNKMIESG  408

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             ++P+  T+ S+LGA +     + G Q+   II+ G+ S   V  AL+  Y+K   L ++ 
Sbjct  409   IEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDDRVRTALLSMYAKCGSLKDAH  468

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
             ++F+++++ ++V WNA+I  Y++   Y+ A+   Q +L EG++PN  T++ IL++C    
Sbjct  469   RVFEKISKQNVVAWNAMITAYVQHEQYDNALATFQALLKEGIKPNSSTFTSILNVCKSSD  528

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             ++E GK VH  IMK G +S++ V + L+ M+  CG L  A+ +F+ +P ++LVSWNT++ 
Sbjct  529   SLELGKWVHFLIMKAGLESDLHVSNALVSMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIA  588

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACG  1522
             G+ QHG  + A + + MMQE+G+KP+ ITF G+L+AC 
Sbjct  589   GFVQHGKNQVAFDYFKMMQESGIKPDKITFTGLLNACA  626


 Score =   238 bits (607),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 139/469 (30%), Positives = 248/469 (53%), Gaps = 10/469 (2%)
 Frame = -2

Query  2643  VNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNE  2464
              +F G+C   K   +VF  +   +T    ++L+   + G+++E +++  R   + + +  
Sbjct  55    TSFSGRCP--KGRCVVFADI--KDTQKANAVLNRLSKAGQFNEAMQVLERVDSSHIQIYR  110

Query  2463  FLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNM  2284
                   L  C   + LG G  I+  I K GV+ D ++   L+N Y KCG    A   F+ 
Sbjct  111   QTYSALLQLCIKFKNLGDGERIYNHIKKSGVQPDIFMRNTLINMYAKCGNTISAKQIFDD  170

Query  2283  ASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVG  2104
                 ++++W  L+GG VQ G   EA  L  +++   +KP +RT+ S+L A  D +    G
Sbjct  171   MREKDVYSWNLLLGGYVQHGLYEEAFKLHEQMVQDSVKPDKRTFVSMLNACADARNVDKG  230

Query  2103  MQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRS  1924
              +L++ I+K G+++  FV  AL++ + K   + ++ K+F  +   D+VTW ++I G  R 
Sbjct  231   RELYNLILKAGWDTDLFVGTALINMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARH  290

Query  1923  GHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVG  1744
             G ++QA  L Q M  EG++P+   +  +L  C    A+E GK+VH R+ + G+D+ + VG
Sbjct  291   GRFKQACNLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIYVG  350

Query  1743  STLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVK  1564
             + ++ MY KCG + DA +VFD++  +N+VSW  M+ G+AQHG   EA   ++ M E+G++
Sbjct  351   TAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRIDEAFLFFNKMIESGIE  410

Query  1563  PNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAY  1387
             PN +TF+ +L AC     L+ G     + ++  YG   R      +++++A+ G  K A+
Sbjct  411   PNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDDRVR--TALLSMYAKCGSLKDAH  468

Query  1386  DFIRSFPEKPDKVVWRCLLSGCNINK--DFVLGKYAAEEILSIDPNDTS  1246
                     K + V W  +++    ++  D  L  + A     I PN ++
Sbjct  469   RVFEKI-SKQNVVAWNAMITAYVQHEQYDNALATFQALLKEGIKPNSST  516



>ref|XP_010277183.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial [Nelumbo nucifera]
 ref|XP_010277184.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial [Nelumbo nucifera]
Length=767

 Score =   451 bits (1160),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 242/691 (35%), Positives = 396/691 (57%), Gaps = 3/691 (0%)
 Frame = -2

Query  3063  SQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPK  2884
             +++I +C++ K +  G+  H  L+K   + D+   NH+LSMY     ++ A+K+FD MP+
Sbjct  70    ARLICACSSLKCLQQGRKVHDHLLKSNVQPDIILLNHILSMYGRCGSLKDARKVFDGMPE  129

Query  2883  RNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKE  2704
             RN ++WT++I+ YS     E A+  +  M  + G  P+ +T+   L ACS L   + G++
Sbjct  130   RNEVSWTSMIAGYSQNSWGEDAIELYFKM-RQSGLMPDQFTFGSILKACSGLSDIKLGRQ  188

Query  2703  IHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGE  2524
             +H  + ++E   +    N LV  Y K   +  A  VFD +   + ++W+S+++   Q   
Sbjct  189   LHSHVIKSEFGSHLIAQNALVAMYTKLDYIDDASTVFDHIAIKDLISWSSMITGFAQHAY  248

Query  2523  YDEGLRIFLRSLRAGVL-VNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVT  2347
               + L +F   L  GV   NEF+ G    AC  +    +G  IH +  K G+  D +   
Sbjct  249   ELKALHLFKEMLSLGVYHPNEFIFGSVFSACNGLLNSEYGRQIHGMSTKFGLGKDVFAGC  308

Query  2346  GLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKP  2167
              L N Y KCG++  A   F     P+L +W A+I G        EA++ FC++  SGL P
Sbjct  309   SLSNMYAKCGRIDYARTAFYQIERPDLVSWNAIIDGFAYIEDANEAMSFFCQMRHSGLVP  368

Query  2166  SERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
              + T   +L +  +T     G Q+HS+I+K+GFN    VCN L+  Y+K + L  +F IF
Sbjct  369   DKTTVICLLCSCRNTSVLFQGQQVHSYIMKMGFNLDISVCNTLLTMYAKCSDLSYAFTIF  428

Query  1986  QEMTE-YDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAI  1810
             +EM    D+V+WNA++   ++    +   +LL+ M      P+  T + +L  C  L  +
Sbjct  429   EEMQSGVDLVSWNAMLTACMQHNQVDDVFQLLKLMHDSTNRPDEVTLTNVLGACAGLAYL  488

Query  1809  EWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGY  1630
             E GKQ+H   +K G        + LIDMYAKCG LG+A+++F+ +   ++VSW+++++GY
Sbjct  489   ELGKQIHVYAVKTGLVFYASSINGLIDMYAKCGALGNAQRLFNSMSNPDVVSWSSLIVGY  548

Query  1629  AQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPR  1450
             AQ G+G+EAL ++  M+  GVKPN +TFVGVLSAC   GL+EEG  ++++M+ ++GI P 
Sbjct  549   AQFGYGEEALNLFRNMRSLGVKPNHVTFVGVLSACSRVGLVEEGCYYYHTMETDHGILPT  608

Query  1449  TNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEIL  1270
               H +CMV+L AR G   +A +FI+  P  PD VVW+ +L+ C    +  +G +AAE I+
Sbjct  609   REHCSCMVDLLARSGHLIEAEEFIKQMPFDPDIVVWKTMLAACRTYGNVEIGNWAAENIM  668

Query  1269  SIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSY  1090
              +DP++++AHV L NIYA   MWD+ A++RK+MK+  ++K  G SW E+++ I+ F +  
Sbjct  669   KLDPSNSAAHVLLCNIYASAGMWDDVARVRKLMKRNGVRKVPGQSWIEVRDGIHIFLAED  728

Query  1089  NMLLGEVSMKKLLIGLTAQLLDAGYVPDTKL  997
                     +  +L  L  Q+++AGYVP+ + 
Sbjct  729   RSHPHMNEIYTVLSDLWLQMVEAGYVPNQRF  759


 Score =   229 bits (584),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 144/514 (28%), Positives = 254/514 (49%), Gaps = 6/514 (1%)
 Frame = -2

Query  2856  ISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAE  2677
             I+S     L  +AL +F  +  E  F  N  TY   + ACS L   + G+++H  + ++ 
Sbjct  37    INSLCKQNLFREALQAFDFLRSETHFRVNLSTYARLICACSSLKCLQQGRKVHDHLLKSN  96

Query  2676  ETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFL  2497
                +  + N +++ YG+CG LK A+ VFD M E N V+W S+++ + Q    ++ + ++ 
Sbjct  97    VQPDIILLNHILSMYGRCGSLKDARKVFDGMPERNEVSWTSMIAGYSQNSWGEDAIELYF  156

Query  2496  RSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCG  2317
             +  ++G++ ++F  G  L AC+ +  +  G  +H  ++K            LV  Y K  
Sbjct  157   KMRQSGLMPDQFTFGSILKACSGLSDIKLGRQLHSHVIKSEFGSHLIAQNALVAMYTKLD  216

Query  2316  QLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL-KPSERTYASVL  2140
              +  A   F+  +  +L +W+++I G  Q     +A++LF ++LS G+  P+E  + SV 
Sbjct  217   YIDDASTVFDHIAIKDLISWSSMITGFAQHAYELKALHLFKEMLSLGVYHPNEFIFGSVF  276

Query  2139  GAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIV  1960
              A       + G Q+H    K G     F   +L + Y+K   +D +   F ++   D+V
Sbjct  277   SACNGLLNSEYGRQIHGMSTKFGLGKDVFAGCSLSNMYAKCGRIDYARTAFYQIERPDLV  336

Query  1959  TWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRI  1780
             +WNA+I G+       +A+    +M   GL P+  T  C+L  C +   +  G+QVH  I
Sbjct  337   SWNAIIDGFAYIEDANEAMSFFCQMRHSGLVPDKTTVICLLCSCRNTSVLFQGQQVHSYI  396

Query  1779  MKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-NLVSWNTMLIGYAQHGFGKEA  1603
             MK GF+ ++ V +TL+ MYAKC  L  A  +F+ +    +LVSWN ML    QH    + 
Sbjct  397   MKMGFNLDISVCNTLLTMYAKCSDLSYAFTIFEEMQSGVDLVSWNAMLTACMQHNQVDDV  456

Query  1602  LEIYSMMQENGVKPNDITFVGVLSAC-GHgglleegLNHFNSMKNNYGITPRTNHLACMV  1426
              ++  +M ++  +P+++T   VL AC G   L      H  ++K   G+    + +  ++
Sbjct  457   FQLLKLMHDSTNRPDEVTLTNVLGACAGLAYLELGKQIHVYAVKT--GLVFYASSINGLI  514

Query  1425  NLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
             +++A+ G    A     S    PD V W  L+ G
Sbjct  515   DMYAKCGALGNAQRLFNSM-SNPDVVSWSSLIVG  547


 Score =   221 bits (563),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 137/509 (27%), Positives = 247/509 (49%), Gaps = 7/509 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +   I+++C+    I  G+  H+ +IK    S +   N L++MY     I+ A  +
Sbjct  165   PDQFTFGSILKACSGLSDIKLGRQLHSHVIKSEFGSHLIAQNALVAMYTKLDYIDDASTV  224

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD +  +++I+W+++I+ ++      KAL  F+ M+    + PN + +    SAC+ L  
Sbjct  225   FDHIAIKDLISWSSMITGFAQHAYELKALHLFKEMLSLGVYHPNEFIFGSVFSACNGLLN  284

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
             +  G++IHG   +     + F    L N Y KCG +  A+  F  +  P+ V+W +++  
Sbjct  285   SEYGRQIHGMSTKFGLGKDVFAGCSLSNMYAKCGRIDYARTAFYQIERPDLVSWNAIIDG  344

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
                  + +E +  F +   +G++ ++      L +C +   L  G  +H  I+K G  +D
Sbjct  345   FAYIEDANEAMSFFCQMRHSGLVPDKTTVICLLCSCRNTSVLFQGQQVHSYIMKMGFNLD  404

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTF-NMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
               V   L+  Y KC  L  A+  F  M S  +L +W A++  C+Q  +  +   L   + 
Sbjct  405   ISVCNTLLTMYAKCSDLSYAFTIFEEMQSGVDLVSWNAMLTACMQHNQVDDVFQLLKLMH  464

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
              S  +P E T  +VLGA       ++G Q+H + +K G   +    N L+D Y+K   L 
Sbjct  465   DSTNRPDEVTLTNVLGACAGLAYLELGKQIHVYAVKTGLVFYASSINGLIDMYAKCGALG  524

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
              + ++F  M+  D+V+W++LI GY + G+ E+A+ L + M   G++PN  T+  +LS C 
Sbjct  525   NAQRLFNSMSNPDVVSWSSLIVGYAQFGYGEEALNLFRNMRSLGVKPNHVTFVGVLSACS  584

Query  1824  DLPAIEWG-KQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-NLVSW  1651
              +  +E G    H      G        S ++D+ A+ G L +A +    +P   ++V W
Sbjct  585   RVGLVEEGCYYYHTMETDHGILPTREHCSCMVDLLARSGHLIEAEEFIKQMPFDPDIVVW  644

Query  1650  NTMLIGYAQHGFGKEALEIYSMMQENGVK  1564
              TML     +G     +EI +   EN +K
Sbjct  645   KTMLAACRTYG----NVEIGNWAAENIMK  669



>ref|XP_010069315.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like 
[Eucalyptus grandis]
Length=848

 Score =   453 bits (1165),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 245/692 (35%), Positives = 385/692 (56%), Gaps = 2/692 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +  L+ +IR C  +  +  G   H  ++K G   DVY    L+ +Y     I+ A+ +
Sbjct  151   PNEYILASLIRGCAQSGGLDGGAQVHGFVVKAGLGQDVYVGTSLVFLYANNGGIDGARSV  210

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD +  +  +TWT +IS +   G SE +L  F  MV   G  P+ Y     LSACS L  
Sbjct  211   FDSLLDKTDVTWTAIISGHVKCGRSEVSLQLFSQMV-NAGLLPDKYVISSVLSACSALEF  269

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IH  I R E  ++  V N L++ Y K G+ ++A+ +FD M   N ++W +++S 
Sbjct  270   VEGGKQIHAHILRREAEMDISVINVLIDCYTKSGMARTARRLFDHMEVRNMISWTTMISG  329

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q     E L++F          + F C   L +C S+E L  G  +H   +K  ++ D
Sbjct  330   YMQNSYDKEALKLFAEMTELDWNPDAFACTSVLTSCGSLEALIQGKQVHAYTIKANLEFD  389

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              +V  GL++ Y KC  L  A   F++     + ++ A+I G  +  K  EA++LF  +  
Sbjct  390   DFVKNGLIDMYAKCNALEDARKLFDVMEGKNVVSYNAMIEGYSRLEKLEEALDLFHSMRL  449

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
             +   PS  T+ S+LG        ++  Q+H  + K G +   F  ++L+D YSKS+L+ +
Sbjct  450   ASFSPSPLTFVSILGLSAALFALELSKQVHGLLSKSGISMDLFAGSSLIDVYSKSSLVRD  509

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F+EM + DIV WNA+  GY +    E+  KL  E+      PN  T++ +++   +
Sbjct  510   ARLVFEEMNDRDIVVWNAMFFGYSQQMDNEETFKLFLELQLSEQRPNDFTFASLITASSN  569

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L +++ G+Q H +I+K G D +  V + L+DMYAKCG + +ARK FD+  C+++  WN+M
Sbjct  570   LASLQHGQQFHSQIIKRGLDFDPFVTNALVDMYAKCGSIQEARKAFDLAICEDVACWNSM  629

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +  YAQHG  + AL+I+  M   GVKPN IT+VG+LSAC H GL+E+GL+H+NSM+   G
Sbjct  630   ITTYAQHGEAQAALQIFEEMIITGVKPNYITYVGILSACSHAGLVEDGLHHYNSMR-GLG  688

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I P T H AC+V++F R G+ K A DFI + P +P  +VWR LLS C    +  LGKYAA
Sbjct  689   IEPGTEHYACVVSVFGRAGRLKDAVDFIETMPIQPMALVWRSLLSACRNAGNSELGKYAA  748

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             E  +S+DP D+ ++  LSNI+A   MW +  ++R+ M +  + KE G SW E+ N+ + F
Sbjct  749   EMAISLDPTDSGSYTLLSNIFASKGMWFDVKKVRQRMDETGVLKEPGRSWIEVNNEAHVF  808

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPD  1006
              +          +  +L  L  Q  + GYVP+
Sbjct  809   VARDQTHYEADLIYSVLNYLILQTKEIGYVPN  840


 Score =   296 bits (759),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 178/613 (29%), Positives = 307/613 (50%), Gaps = 11/613 (2%)
 Frame = -2

Query  3207  RRRSLSVRPSQGAHPPLPPATTASLRPA*QSQGSSILTTARGPLKMSLSQIIRSCTTNKS  3028
             RR S + RPS  A    P  T     P  +++           L         +   ++ 
Sbjct  12    RRISNAARPSSSAFSTFPLETPPRRFPGLRAKRRKF-----AELLQLSPASASASDADEP  66

Query  3027  ILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISS  2848
             +   K  H +++ +G + DV+  N LL  Y     +  A+++FD +P+RN+ITW+T+IS 
Sbjct  67    VRYRKKLHGRIVVWGFQHDVFLANVLLHSYSRSGALRDARRVFDNIPERNLITWSTVISM  126

Query  2847  YSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETL  2668
             Y+  G  ++AL SF          PN Y     +  C+  G    G ++HG + +A    
Sbjct  127   YARYGCCDEALLSFVEFQRGSVDRPNEYILASLIRGCAQSGGLDGGAQVHGFVVKAGLGQ  186

Query  2667  NNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSL  2488
             + +V   LV  Y   G +  A+ VFD++L+   VTW +++S H +CG  +  L++F + +
Sbjct  187   DVYVGTSLVFLYANNGGIDGARSVFDSLLDKTDVTWTAIISGHVKCGRSEVSLQLFSQMV  246

Query  2487  RAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLG  2308
              AG+L ++++    L AC+++E +  G  IH  I++   +MD  V+  L++ Y K G   
Sbjct  247   NAGLLPDKYVISSVLSACSALEFVEGGKQIHAHILRREAEMDISVINVLIDCYTKSGMAR  306

Query  2307  LAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFT  2128
              A   F+      + +WT +I G +Q    +EA+ LF ++      P      SVL +  
Sbjct  307   TARRLFDHMEVRNMISWTTMISGYMQNSYDKEALKLFAEMTELDWNPDAFACTSVLTSCG  366

Query  2127  DTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNA  1948
               +    G Q+H++ IK       FV N L+D Y+K N L+++ K+F  M   ++V++NA
Sbjct  367   SLEALIQGKQVHAYTIKANLEFDDFVKNGLIDMYAKCNALEDARKLFDVMEGKNVVSYNA  426

Query  1947  LIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPG  1768
             +I GY R    E+A+ L   M      P+  T+  IL +   L A+E  KQVH  + K G
Sbjct  427   MIEGYSRLEKLEEALDLFHSMRLASFSPSPLTFVSILGLSAALFALELSKQVHGLLSKSG  486

Query  1767  FDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYS  1588
                ++  GS+LID+Y+K   + DAR VF+ +  +++V WN M  GY+Q    +E  +++ 
Sbjct  487   ISMDLFAGSSLIDVYSKSSLVRDARLVFEEMNDRDIVVWNAMFFGYSQQMDNEETFKLFL  546

Query  1587  MMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFAR  1411
              +Q +  +PND TF  +++A  +   L+ G   H   +K      P   +   +V+++A+
Sbjct  547   ELQLSEQRPNDFTFASLITASSNLASLQHGQQFHSQIIKRGLDFDPFVTN--ALVDMYAK  604

Query  1410  KG---QTKKAYDF  1381
              G   + +KA+D 
Sbjct  605   CGSIQEARKAFDL  617


 Score = 74.3 bits (181),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 84/165 (51%), Gaps = 5/165 (3%)
 Frame = -2

Query  1812  IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIG  1633
             + + K++H RI+  GF  +V + + L+  Y++ G L DAR+VFD +P +NL++W+T++  
Sbjct  67    VRYRKKLHGRIVVWGFQHDVFLANVLLHSYSRSGALRDARRVFDNIPERNLITWSTVISM  126

Query  1632  YAQHGFGKEALEIYSMMQENGV-KPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGI  1459
             YA++G   EAL  +   Q   V +PN+     ++  C   G L+ G   H   +K   G 
Sbjct  127   YARYGCCDEALLSFVEFQRGSVDRPNEYILASLIRGCAQSGGLDGGAQVHGFVVKAGLGQ  186

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
                      +V L+A  G    A     S  +K D V W  ++SG
Sbjct  187   DVYVG--TSLVFLYANNGGIDGARSVFDSLLDKTD-VTWTAIISG  228



>ref|XP_004251045.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Solanum lycopersicum]
 ref|XP_010313344.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Solanum lycopersicum]
 ref|XP_010313345.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Solanum lycopersicum]
 ref|XP_010313346.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Solanum lycopersicum]
Length=871

 Score =   454 bits (1167),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 247/694 (36%), Positives = 402/694 (58%), Gaps = 12/694 (2%)
 Frame = -2

Query  3069  SLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM  2890
             SLS I++       +  GK  H   +K G    V     L+ MY+    ++  QK FDEM
Sbjct  98    SLSCILKVSACVFDLFFGKQVHTLCVKSGYFDHVSVGTSLVDMYMKMENVDDGQKFFDEM  157

Query  2889  P-KRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAART  2713
                +NV+TWT+L+S YS   L ++AL  FR M++  G  PN +T+   L   +       
Sbjct  158   EDNKNVVTWTSLLSGYSCNKLVDRALQVFRVMLV-GGVKPNGFTFATVLGVLADKCVVEE  216

Query  2712  GKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQ  2533
             G ++H  + +        V N L+N Y K G+++ A  VF+ M + N V+W  +++    
Sbjct  217   GIQVHSMVIKCGFEAITSVGNSLINMYLKYGMVREATTVFEVMGDRNEVSWNGMIAGLVT  276

Query  2532  CGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
              G Y E L++F +   AGV +   +   A+  C +++ L F   +H  ++K G   D  +
Sbjct  277   NGLYSEALKLFHKMRLAGVDMTRSIYVTAVKLCTNLKELVFARQLHGRVMKNGFYFDNNI  336

Query  2352  VTGLVNFYVKCGQLGLAYNTFN-MASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
              T L+  Y K G++  A+  F+ M     + +WTA+IGG +Q  +  +A NLFC++   G
Sbjct  337   RTALMVSYTKSGEMDDAFKLFSIMHKFRNVVSWTAMIGGYMQNNRPEQAANLFCQMKKDG  396

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             ++P++ TY+++L A      FQV    H+ +IK  + S   V  AL+D Y K+   DE+ 
Sbjct  397   IRPNDFTYSTILAAHPSISLFQV----HAEVIKTEYQSSPTVGTALLDAYVKTGDTDEAA  452

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC-GDL  1819
             K+F+E+ E DI+TW+A+++GY + G  + A+++ ++++ +G+ PN  T+S +++ C   +
Sbjct  453   KVFEEIDEKDIITWSAMLSGYAQKGDIQGAVRVFRQLVKDGVRPNEFTFSSVINACVTSI  512

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
              ++E GKQ HC  +K G  + + V S L+ MYAK G +  A ++F   P ++LVSWN+M+
Sbjct  513   ASVEQGKQFHCSAIKSGHSNALCVSSALVTMYAKRGNIESANEIFKRQPERDLVSWNSMI  572

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGI  1459
              GYAQHG+G++AL+I+  M++  +  ++ITF+GV+SAC H GLL EG  +F  M N++ I
Sbjct  573   SGYAQHGYGRKALKIFEEMRKRNLDMDNITFIGVISACTHAGLLNEGQKYFEMMVNDFHI  632

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAE  1279
             +P+    +CMV+L++R G   KA   I   P     +VWR LL+   ++++  LGK AAE
Sbjct  633   SPKMEIYSCMVDLYSRAGMLDKAMSLINKMPFPAGAIVWRTLLAASRVHRNVELGKLAAE  692

Query  1278  EILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFS  1099
              ++S+ P D++A+V LSN+YA    W E A++RK+M  +++KKE G SW E++NK Y F 
Sbjct  693   NLISLQPQDSAAYVLLSNLYAATGDWQERAKVRKLMDVRKVKKEIGYSWIEVKNKTYSFM  752

Query  1098  SS--YNMLLGEVSMKKLLIGLTAQLLDAGYVPDT  1003
             +    + L   + MK  L  L  +L DAGY PDT
Sbjct  753   AGDVSHPLSDSIYMK--LEELRGRLKDAGYQPDT  784


 Score =   133 bits (335),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 99/387 (26%), Positives = 180/387 (47%), Gaps = 36/387 (9%)
 Frame = -2

Query  2214  EAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALV  2035
             EA+NLF  +  +G      + + +L       +   G Q+H+  +K G+     V  +LV
Sbjct  79    EALNLFVGIHRNGFLIDGASLSCILKVSACVFDLFFGKQVHTLCVKSGYFDHVSVGTSLV  138

Query  2034  DFYSKSNLLDESFKIFQEMTE-YDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNL  1858
             D Y K   +D+  K F EM +  ++VTW +L++GY  +   ++A+++ + ML  G++PN 
Sbjct  139   DMYMKMENVDDGQKFFDEMEDNKNVVTWTSLLSGYSCNKLVDRALQVFRVMLVGGVKPNG  198

Query  1857  HTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDI  1678
              T++ +L +  D   +E G QVH  ++K GF++   VG++LI+MY K G + +A  VF++
Sbjct  199   FTFATVLGVLADKCVVEEGIQVHSMVIKCGFEAITSVGNSLINMYLKYGMVREATTVFEV  258

Query  1677  LPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleeg  1498
             +  +N VSWN M+ G   +G   EAL+++  M+  GV      +V  +  C +   L   
Sbjct  259   MGDRNEVSWNGMIAGLVTNGLYSEALKLFHKMRLAGVDMTRSIYVTAVKLCTNLKELVFA  318

Query  1497  LN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG-  1324
                H   MKN  G     N    ++  + + G+   A+       +  + V W  ++ G 
Sbjct  319   RQLHGRVMKN--GFYFDNNIRTALMVSYTKSGEMDDAFKLFSIMHKFRNVVSWTAMIGGY  376

Query  1323  -------------CNINKDFV------------------LGKYAAEEILSIDPNDTSAHV  1237
                          C + KD +                  L +  AE I +   +  +   
Sbjct  377   MQNNRPEQAANLFCQMKKDGIRPNDFTYSTILAAHPSISLFQVHAEVIKTEYQSSPTVGT  436

Query  1236  TLSNIYARLNMWDEAAQIRKMMKQKEL  1156
              L + Y +    DEAA++ + + +K++
Sbjct  437   ALLDAYVKTGDTDEAAKVFEEIDEKDI  463


 Score = 87.4 bits (215),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 128/262 (49%), Gaps = 12/262 (5%)
 Frame = -2

Query  2094  HSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHY  1915
             HSF I     + T  C+   ++ S   + DE  +         +   N L+  Y R+   
Sbjct  27    HSFAIDFEEEAQT-SCSVSSNYLSAHQVFDEKSQ--------RVSLNNHLLFEYSRNSFN  77

Query  1914  EQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTL  1735
              +A+ L   +   G   +  + SCIL +   +  + +GKQVH   +K G+  +V VG++L
Sbjct  78    VEALNLFVGIHRNGFLIDGASLSCILKVSACVFDLFFGKQVHTLCVKSGYFDHVSVGTSL  137

Query  1734  IDMYAKCGRLGDARKVFDILP-CKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPN  1558
             +DMY K   + D +K FD +   KN+V+W ++L GY+ +     AL+++ +M   GVKPN
Sbjct  138   VDMYMKMENVDDGQKFFDEMEDNKNVVTWTSLLSGYSCNKLVDRALQVFRVMLVGGVKPN  197

Query  1557  DITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFI  1378
               TF  VL       ++EEG+   +SM    G    T+    ++N++ + G  ++A    
Sbjct  198   GFTFATVLGVLADKCVVEEGI-QVHSMVIKCGFEAITSVGNSLINMYLKYGMVREATTVF  256

Query  1377  RSFPEKPDKVVWRCLLSGCNIN  1312
                 ++ ++V W  +++G   N
Sbjct  257   EVMGDR-NEVSWNGMIAGLVTN  277



>ref|XP_002510620.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF52807.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=708

 Score =   448 bits (1153),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 253/705 (36%), Positives = 395/705 (56%), Gaps = 9/705 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSD-VYTNNHLLSMYVTFHEIECAQK  2905
             P  +S    +   T  KS+  G+A HAQ+IK  S S  +Y  N L++ Y     +  A+ 
Sbjct  5     PQNLSSFNSLVQFTHQKSLQKGRALHAQIIKLASSSSCIYLANSLINFYAKCCHLPKAKL  64

Query  2904  LFDEMPKRNVITWTTLISSYSHMGL--SEKALGSFRSMVLEDGFTPNHYTYVGALSACSC  2731
             +FD +  ++VI+W  LI+ YS  G   S   +  F+ M   D   PN +T+ G  +A S 
Sbjct  65    VFDRIHNKDVISWNCLINGYSQQGPTGSSFVMELFQRM-RADNILPNAHTFSGIFTAASN  123

Query  2730  LGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASL  2551
             L +   G++ H    +     + FV + L+N Y K GLL  A+ VFD M E N VTWA++
Sbjct  124   LSSIFFGQQAHAVAIKMACFYDVFVGSSLLNMYCKAGLLFEAREVFDRMPERNEVTWATM  183

Query  2550  LSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGV  2371
             +S +       E   +F    R    VNEF     L A A  E +  G  IHCL VK G+
Sbjct  184   ISGYAIQRLAGEAFEVFELMRREEEDVNEFAFTSVLSALAVPEFVDSGKQIHCLAVKTGL  243

Query  2370  KMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCK  2191
              +   ++  LV  Y KCG L  +   F M++      W+A+I G  Q G   +A+ LF +
Sbjct  244   LVFLSILNALVTMYAKCGSLDDSLQVFEMSNDKNSITWSAMITGYAQSGDSHKALKLFSR  303

Query  2190  LLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNL  2011
             +  +G+ PSE T   VL A +D    + G Q+H++++KLGF S  ++  ALVD Y+KS +
Sbjct  304   MHFAGINPSEFTLVGVLNACSDACAVEEGKQVHNYLLKLGFESQLYIMTALVDMYAKSGV  363

Query  2010  LDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSI  1831
              +++ K F  + + D+V W ++IAGY+++G  E A+ L   M  EG+ PN  T + +L  
Sbjct  364   TEDARKGFNYLQQPDLVLWTSMIAGYVQNGENEDALSLYCRMQMEGILPNELTMASVLKA  423

Query  1830  CGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSW  1651
             C +L A + G+Q+H R +K G    V +GS L  MYAKCG L +   VF  +P ++++SW
Sbjct  424   CSNLAAFDQGRQIHARTIKYGLGLEVTIGSALSTMYAKCGNLEEGNIVFRRMPERDIISW  483

Query  1650  NTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKN  1471
             N M+ G +Q+G+GKEALE++  M++   KP+D+TFV VLSAC H GL++ G  +F  M +
Sbjct  484   NAMISGLSQNGYGKEALELFEEMRQQDTKPDDVTFVNVLSACSHMGLVDSGWLYFRMMFD  543

Query  1470  NYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGK  1291
              +G+ P+  H ACMV++ +R G+  +A +FI S        +WR LL  C   +++ LG 
Sbjct  544   EFGLLPKVEHYACMVDVLSRAGKLYEAKEFIESTTIDHGLCLWRILLGACRNYRNYELGA  603

Query  1290  YAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKI  1111
             YA E+++ +   ++SA+V LS IY  L   ++  ++R MMK + + KE GCSW EL++ +
Sbjct  604   YAGEKLMELGSQESSAYVLLSGIYTALGRPEDVERVRSMMKVRGVSKEPGCSWIELKSNV  663

Query  1110  YCFSSSYNM--LLGEVSMKKLLIGLTAQLLDAGYVPDTKL-SFDY  985
             + F     M   +GE+  +  ++ L+ Q+ D GY P +   S+D+
Sbjct  664   HVFVVGDQMHPCIGEIRTE--ILRLSKQMKDEGYQPASVTDSYDF  706


 Score =   143 bits (360),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 150/289 (52%), Gaps = 9/289 (3%)
 Frame = -2

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSF-TFVCNALVDFYSKSNLLDES  1999
             L P   +  + L  FT  K  Q G  LH+ IIKL  +S   ++ N+L++FY+K   L ++
Sbjct  3     LHPQNLSSFNSLVQFTHQKSLQKGRALHAQIIKLASSSSCIYLANSLINFYAKCCHLPKA  62

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQA--IKLLQEMLFEGLEPNLHTYSCILSICG  1825
               +F  +   D+++WN LI GY + G    +  ++L Q M  + + PN HT+S I +   
Sbjct  63    KLVFDRIHNKDVISWNCLINGYSQQGPTGSSFVMELFQRMRADNILPNAHTFSGIFTAAS  122

Query  1824  DLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNT  1645
             +L +I +G+Q H   +K     +V VGS+L++MY K G L +AR+VFD +P +N V+W T
Sbjct  123   NLSSIFFGQQAHAVAIKMACFYDVFVGSSLLNMYCKAGLLFEAREVFDRMPERNEVTWAT  182

Query  1644  MLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNY  1465
             M+ GYA      EA E++ +M+      N+  F  VLSA        +     + +    
Sbjct  183   MISGYAIQRLAGEAFEVFELMRREEEDVNEFAFTSVLSALA-VPEFVDSGKQIHCLAVKT  241

Query  1464  GITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDK--VVWRCLLSG  1324
             G+    + L  +V ++A+ G      D ++ F    DK  + W  +++G
Sbjct  242   GLLVFLSILNALVTMYAKCGSLD---DSLQVFEMSNDKNSITWSAMITG  287



>ref|XP_006827122.1| hypothetical protein AMTR_s00010p00246970 [Amborella trichopoda]
 gb|ERM94359.1| hypothetical protein AMTR_s00010p00246970 [Amborella trichopoda]
Length=749

 Score =   450 bits (1157),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 252/705 (36%), Positives = 396/705 (56%), Gaps = 13/705 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +  ++ ++R+C   +++      H  ++K G  +DV+    L+  Y     +E A  +
Sbjct  40    PNQYIIASVLRACANLRALNQASQVHNLVVKLGLGNDVFVGTSLIDSYSKSGYLEFANLV  99

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F+E+P RN +TWTT+I++YS  G SE +L  F  M  +     + Y     LSACS +  
Sbjct  100   FNELPVRNEVTWTTIITAYSQSGKSEISLELFHEM-RQTNVRADRYVISSVLSACSAMEY  158

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IH  I R E  ++  V+N L++ Y KCG L  A+ VF  M   N V+W ++++ 
Sbjct  159   IEGGKQIHSYIVRNEPQVDVSVNNVLMDMYSKCGELGYARRVFYLMSVRNVVSWTTMIAG  218

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
               Q     E L +F+     G   + + C  AL +C ++  L  G  +H   VK  ++ D
Sbjct  219   LMQNFCNSEALHMFMEMHAQGWEPDGYTCTSALSSCGALMGLEQGKQVHSYAVKTNLESD  278

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
             ++V  GLV+ Y KC  L  A   F++     + ++ A+I G    G    AV LF ++ S
Sbjct  279   EFVKNGLVDMYCKCDSLLDARRVFDVMVMRNVVSYNAMIEGYAAHGDLWGAVILFEQMRS  338

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
               + PS  T+ S+LG         +  Q+H+ +IKLG +   +  +ALVD YSK   +D+
Sbjct  339   HYVSPSLLTFVSLLGVSATFSAEHLSKQIHAHMIKLGISLDLYAGSALVDVYSKCFGVDD  398

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F+EM E DIV WNA+++GY ++G  E A KL Q+M  + ++PN  T+  +++   +
Sbjct  399   ARLVFEEMEERDIVVWNAMVSGYAQNGQGEDAFKLYQKMQLKEMKPNDFTFVGLITSASN  458

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L A+  G+Q+H + +K G +S+  VG+ L+DMYAKCG +G+A ++F+ +P +++V WN+M
Sbjct  459   LAALFHGQQLHNQTIKMGIESDPFVGNALVDMYAKCGNIGEAWRLFESMPTRDIVCWNSM  518

Query  1641  LIGYAQHGFGKEALEIYSMM------------QENGVKPNDITFVGVLSACGHgglleeg  1498
             +  YAQHG  KEA+ ++  +            QE  +KPN +TFVGVLSAC H GL+++G
Sbjct  519   ISRYAQHGHAKEAVNLFEQLIKVEVEPNSFIAQEKEIKPNYVTFVGVLSACSHVGLVDKG  578

Query  1497  LNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCN  1318
               +FN MK  + I     H ACM++L  R G+  +A +FI + P +P  +VWR LLS C 
Sbjct  579   FQYFNLMKTVFNIKAGVEHYACMIDLLGRAGKLSEAKEFIETMPIEPTSMVWRSLLSACR  638

Query  1317  INKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGC  1138
                D  +GKYAA+  +SIDP D+ ++V LSNIYA   MW + A +RK M    + KE G 
Sbjct  639   TFGDINIGKYAADRAISIDPKDSGSYVLLSNIYASKGMWVDVANVRKGMSCNGVVKEPGH  698

Query  1137  SWTELQNKIYCFSSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDT  1003
             SW E++ K++ F            +  +L+ LT Q+   GYVPDT
Sbjct  699   SWIEVKKKVHVFVVRDRSRSESDEIDSMLLRLTQQMKGLGYVPDT  743


 Score =   290 bits (742),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 165/523 (32%), Positives = 276/523 (53%), Gaps = 4/523 (1%)
 Frame = -2

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAART  2713
             MP+RN+ITW+ LIS YS  G   +AL  F          PN Y     L AC+ L A   
Sbjct  1     MPQRNIITWSALISGYSQHGHGHRALLLFSQFHRFSETPPNQYIIASVLRACANLRALNQ  60

Query  2712  GKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQ  2533
               ++H  + +     + FV   L++ Y K G L+ A LVF+ +   N VTW ++++ + Q
Sbjct  61    ASQVHNLVVKLGLGNDVFVGTSLIDSYSKSGYLEFANLVFNELPVRNEVTWTTIITAYSQ  120

Query  2532  CGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
              G+ +  L +F    +  V  + ++    L AC+++E +  G  IH  IV+   ++D  V
Sbjct  121   SGKSEISLELFHEMRQTNVRADRYVISSVLSACSAMEYIEGGKQIHSYIVRNEPQVDVSV  180

Query  2352  VTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
                L++ Y KCG+LG A   F + S   + +WT +I G +Q     EA+++F ++ + G 
Sbjct  181   NNVLMDMYSKCGELGYARRVFYLMSVRNVVSWTTMIAGLMQNFCNSEALHMFMEMHAQGW  240

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             +P   T  S L +       + G Q+HS+ +K    S  FV N LVD Y K + L ++ +
Sbjct  241   EPDGYTCTSALSSCGALMGLEQGKQVHSYAVKTNLESDEFVKNGLVDMYCKCDSLLDARR  300

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPA  1813
             +F  M   ++V++NA+I GY   G    A+ L ++M    + P+L T+  +L +     A
Sbjct  301   VFDVMVMRNVVSYNAMIEGYAAHGDLWGAVILFEQMRSHYVSPSLLTFVSLLGVSATFSA  360

Query  1812  IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIG  1633
                 KQ+H  ++K G   ++  GS L+D+Y+KC  + DAR VF+ +  +++V WN M+ G
Sbjct  361   EHLSKQIHAHMIKLGISLDLYAGSALVDVYSKCFGVDDARLVFEEMEERDIVVWNAMVSG  420

Query  1632  YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGIT  1456
             YAQ+G G++A ++Y  MQ   +KPND TFVG++++  +   L  G   H  ++K      
Sbjct  421   YAQNGQGEDAFKLYQKMQLKEMKPNDFTFVGLITSASNLAALFHGQQLHNQTIKMGIESD  480

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLS  1327
             P   +   +V+++A+ G   +A+    S P + D V W  ++S
Sbjct  481   PFVGN--ALVDMYAKCGNIGEAWRLFESMPTR-DIVCWNSMIS  520



>ref|XP_008231644.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Prunus mume]
Length=708

 Score =   447 bits (1151),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 252/688 (37%), Positives = 383/688 (56%), Gaps = 7/688 (1%)
 Frame = -2

Query  3042  TTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWT  2863
             +  K +  GKA HAQ+IK G  S VY  N L+++Y    ++  A+ +F+ +P ++V++W 
Sbjct  21    SRQKDLQKGKALHAQIIKTGPNSCVYIANSLVNLYAKCGDLPKAKLVFEAIPDKDVVSWN  80

Query  2862  TLISSYSHMGL--SEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA-ARTGKEIHGR  2692
             +LI+ YS  G   S   +  F+ M  E+ F PN +T+ G  +A S        G++ H  
Sbjct  81    SLINGYSQQGQNGSSHVMELFQRMRAENAF-PNAHTFAGVFTAASYASPDVFGGRQAHAL  139

Query  2691  IFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEG  2512
               +A+   + FV + L+N Y K GL+  A+ VFD MLE N+V+WA+++S +       + 
Sbjct  140   AIKADSFYDVFVGSSLLNMYCKAGLVLDARKVFDRMLERNSVSWATMISGYAVQRLAGDA  199

Query  2511  LRIF---LRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGL  2341
             L +F    R       VNEF+    L A A  E +G G  IH L VK G+     V   L
Sbjct  200   LALFGLMRRRNEVKEEVNEFVLTGVLSALALPEFVGTGKQIHSLAVKIGLISFVSVENAL  259

Query  2340  VNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSE  2161
             V  Y KCG L  A  TF  +       W+A+I G  Q G  ++A++LF  +  SG+ PSE
Sbjct  260   VTMYAKCGSLDDALRTFKTSGDKNSITWSAMITGFAQSGDSQKALDLFSHMHFSGVMPSE  319

Query  2160  RTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQE  1981
              T+  V+ A +D    + G Q+HS+ +KLGF    ++  ALVD Y+K   + ++ K F  
Sbjct  320   FTFVGVINACSDIGALEEGKQMHSYSLKLGFEFQIYIMTALVDMYAKCGNVSDARKGFDY  379

Query  1980  MTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWG  1801
             + E DIV W ++I GY+++G  E ++ L   M  EG+ PN  T + +L  C  L A E G
Sbjct  380   LREPDIVLWTSMIGGYVQNGENEASLTLYCRMQREGMMPNELTMASVLKACSSLSAFEQG  439

Query  1800  KQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQH  1621
             +Q+H R +K GF   V +GS L  MYAKCG L D   VF  +P ++ VSWN M+ G +Q+
Sbjct  440   RQIHARTIKYGFSLEVPIGSALSTMYAKCGNLEDGNLVFRRMPMRDTVSWNAMISGLSQN  499

Query  1620  GFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNH  1441
             G G EALE++  M+  G KP+ ITFV +LSAC H GL+E G  +FN M N +GI PR +H
Sbjct  500   GRGTEALELFEEMRLEGAKPDYITFVNILSACSHMGLVERGWIYFNMMSNEFGIGPRVDH  559

Query  1440  LACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSID  1261
              ACMV++ +R G+  +A +FI S        +WR LLS C    ++ LG Y  E+++ + 
Sbjct  560   YACMVDVLSRAGKLDEAKEFIESATIDHGMCLWRILLSACRNYHNYELGAYVGEKLMELG  619

Query  1260  PNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNML  1081
               ++SA+V LS+IY  L    +  ++R +MK + + KE GCSW EL+++++ F     M 
Sbjct  620   SQESSAYVLLSSIYTALGSSKDVERVRSLMKLRGVSKEPGCSWIELKSQVHVFVVGDEMH  679

Query  1080  LGEVSMKKLLIGLTAQLLDAGYVPDTKL  997
                 +++  +  L   + D  Y P + +
Sbjct  680   PQIENVRHEIRRLMKHMKDKDYQPSSTI  707


 Score =   144 bits (362),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 93/294 (32%), Positives = 151/294 (51%), Gaps = 12/294 (4%)
 Frame = -2

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
             S L    R+  + L  ++  K+ Q G  LH+ IIK G NS  ++ N+LV+ Y+K   L +
Sbjct  4     SSLPSQYRSLFTTLIQYSRQKDLQKGKALHAQIIKTGPNSCVYIANSLVNLYAKCGDLPK  63

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGH--YEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
             +  +F+ + + D+V+WN+LI GY + G       ++L Q M  E   PN HT++ + +  
Sbjct  64    AKLVFEAIPDKDVVSWNSLINGYSQQGQNGSSHVMELFQRMRAENAFPNAHTFAGVFTAA  123

Query  1827  G-DLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSW  1651
                 P +  G+Q H   +K     +V VGS+L++MY K G + DARKVFD +  +N VSW
Sbjct  124   SYASPDVFGGRQAHALAIKADSFYDVFVGSSLLNMYCKAGLVLDARKVFDRMLERNSVSW  183

Query  1650  NTMLIGYAQHGFGKEALEIYSMM-QENGVKP--NDITFVGVLSACGHgglleegLNHFNS  1480
              TM+ GYA      +AL ++ +M + N VK   N+    GVLSA              +S
Sbjct  184   ATMISGYAVQRLAGDALALFGLMRRRNEVKEEVNEFVLTGVLSALA-LPEFVGTGKQIHS  242

Query  1479  MKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDK--VVWRCLLSG  1324
             +    G+    +    +V ++A+ G      D +R+F    DK  + W  +++G
Sbjct  243   LAVKIGLISFVSVENALVTMYAKCGSLD---DALRTFKTSGDKNSITWSAMITG  293


 Score =   103 bits (258),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 96/194 (49%), Gaps = 1/194 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +   +I +C+   ++  GK  H+  +K G +  +Y    L+ MY     +  A+K 
Sbjct  317   PSEFTFVGVINACSDIGALEEGKQMHSYSLKLGFEFQIYIMTALVDMYAKCGNVSDARKG  376

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD + + +++ WT++I  Y   G +E +L  +  M  E G  PN  T    L ACS L A
Sbjct  377   FDYLREPDIVLWTSMIGGYVQNGENEASLTLYCRMQRE-GMMPNELTMASVLKACSSLSA  435

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G++IH R  +   +L   + + L   Y KCG L+   LVF  M   +TV+W +++S 
Sbjct  436   FEQGRQIHARTIKYGFSLEVPIGSALSTMYAKCGNLEDGNLVFRRMPMRDTVSWNAMISG  495

Query  2541  HCQCGEYDEGLRIF  2500
               Q G   E L +F
Sbjct  496   LSQNGRGTEALELF  509


 Score = 82.8 bits (203),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 92/183 (50%), Gaps = 5/183 (3%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +++++ ++++C++  +   G+  HA+ IKYG   +V   + L +MY     +E    +
Sbjct  418   PNELTMASVLKACSSLSAFEQGRQIHARTIKYGFSLEVPIGSALSTMYAKCGNLEDGNLV  477

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F  MP R+ ++W  +IS  S  G   +AL  F  M LE G  P++ T+V  LSACS +G 
Sbjct  478   FRRMPMRDTVSWNAMISGLSQNGRGTEALELFEEMRLE-GAKPDYITFVNILSACSHMGL  536

Query  2721  ARTGKEIHGRIFRAEETLNNFVSN--CLVNFYGKCGLLKSA-QLVFDAMLEPNTVTWASL  2551
                G  I+  +   E  +   V +  C+V+   + G L  A + +  A ++     W  L
Sbjct  537   VERGW-IYFNMMSNEFGIGPRVDHYACMVDVLSRAGKLDEAKEFIESATIDHGMCLWRIL  595

Query  2550  LSC  2542
             LS 
Sbjct  596   LSA  598



>ref|XP_009794124.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Nicotiana sylvestris]
Length=883

 Score =   453 bits (1165),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 249/707 (35%), Positives = 397/707 (56%), Gaps = 27/707 (4%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +   ++++C+  K +  GK  H  ++  G +SDV+  N L+ MY    E+  ++ LF+
Sbjct  107   EFTFPSVLKACSIGKELFLGKQIHGIVVVTGFESDVFVANTLVVMYAKCSELLDSRMLFE  166

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
             E+P+RNV++W  L S Y+      +A+  F  M++  G  P+ Y+    L+AC+ LG   
Sbjct  167   EIPERNVVSWNALFSCYTQNDFFSEAMCMFGDMIVS-GVRPDEYSLSNILNACTGLGDIV  225

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS---  2545
              GK+IHG + +     + F SN LV+ Y K G LK A  VFD ++ P+ V+W ++++   
Sbjct  226   QGKKIHGCLVKLGYDSDPFSSNALVDMYAKGGNLKDAITVFDEIVVPDIVSWNAIIAGCV  285

Query  2544  ---CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCG  2374
                CH Q  +    +R      R+G+  N F    AL ACA++E  G G G+H L++K  
Sbjct  286   LHKCHHQAIDMLNQMR------RSGIWPNMFTLSSALKACAALELPGLGQGLHSLLIKKD  339

Query  2373  VKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFC  2194
             +  D +V  GL++ Y KC     A   +++    +L A  A+I GC Q       ++LF 
Sbjct  340   IIQDPFVSVGLIDMYCKCDLTKDARLIYDLMPGKDLIALNAMISGCSQNEADNACLDLFV  399

Query  2193  KLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSN  2014
             +  + G+   + T  +VL + T  +   V  Q+H+  +KLGF   TFV N+LVD Y K +
Sbjct  400   QTFTRGIGFDQTTLLAVLNSATGLQAPNVCKQVHALSVKLGFQCDTFVINSLVDSYGKCS  459

Query  2013  LLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILS  1834
              LD++  IF E    D+ ++ +LI  Y   G  E+A+KL  ++   GL+P+    S +L+
Sbjct  460   QLDDAATIFDECPTPDLPSFTSLITAYALLGRGEEAMKLYLKLQGMGLKPDSFVCSSLLN  519

Query  1833  ICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVS  1654
              C +L A E GKQ+H  ++K GF S+V  G++L++MYAKCG + DA   F  +P K +VS
Sbjct  520   ACANLSAYEQGKQIHAHVLKFGFMSDVFAGNSLVNMYAKCGSIEDANCAFSEVPRKGIVS  579

Query  1653  WNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMK  1474
             W+ M+ G AQHG+ K+AL ++  M ++GV PN IT V VL AC H GL+EE   +F +MK
Sbjct  580   WSAMIGGLAQHGYAKKALHLFGEMLKDGVSPNHITLVSVLYACNHAGLVEEAKKYFETMK  639

Query  1473  NNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLG  1294
             +++GI P   H ACM+++  R G+   + D +   P + +  VW  LL    I+K+  +G
Sbjct  640   DSFGIEPTQEHYACMIDVLGRAGKLDDSIDLVNKMPFEANASVWGALLGAARIHKNVEVG  699

Query  1293  KYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNK  1114
             + AAE + ++ P  +  HV L+NIYA + +W + A++R++MK   +KKE G SW E+++ 
Sbjct  700   QRAAEMLFNLQPEKSGTHVLLANIYASVGLWGDVAKVRRLMKDSRVKKEPGMSWIEIKDS  759

Query  1113  IYCFSSSYNMLLGEVSMKK------LLIGLTAQLLDAGYVP--DTKL  997
             IY F      ++G+ S  +       L  L   +  AGYVP  DT L
Sbjct  760   IYTF------IVGDRSHSRSDEIYAKLEELGQLMAKAGYVPMVDTDL  800


 Score =   255 bits (651),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 172/587 (29%), Positives = 290/587 (49%), Gaps = 9/587 (2%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + S ++++   +  KS+         L K G  +D    NHL+++Y      + A KL D
Sbjct  6     RHSYTKLLSQLSQTKSLNPVLQIQTHLTKIGLSNDSKHRNHLINLYSKCGAFDYAWKLLD  65

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
             E P+ ++++W++LIS Y+  G  + A+ +F  M    G   N +T+   L ACS      
Sbjct  66    ESPEPDLVSWSSLISGYAKNGFGKDAIWAFFKM-HSLGLKCNEFTFPSVLKACSIGKELF  124

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              GK+IHG +       + FV+N LV  Y KC  L  ++++F+ + E N V+W +L SC+ 
Sbjct  125   LGKQIHGIVVVTGFESDVFVANTLVVMYAKCSELLDSRMLFEEIPERNVVSWNALFSCYT  184

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
             Q   + E + +F   + +GV  +E+     L AC  +  +  G  IH  +VK G   D +
Sbjct  185   QNDFFSEAMCMFGDMIVSGVRPDEYSLSNILNACTGLGDIVQGKKIHGCLVKLGYDSDPF  244

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
                 LV+ Y K G L  A   F+    P++ +W A+I GCV      +A+++  ++  SG
Sbjct  245   SSNALVDMYAKGGNLKDAITVFDEIVVPDIVSWNAIIAGCVLHKCHHQAIDMLNQMRRSG  304

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             + P+  T +S L A    +   +G  LHS +IK       FV   L+D Y K +L  ++ 
Sbjct  305   IWPNMFTLSSALKACAALELPGLGQGLHSLLIKKDIIQDPFVSVGLIDMYCKCDLTKDAR  364

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
              I+  M   D++  NA+I+G  ++      + L  +    G+  +  T   +L+    L 
Sbjct  365   LIYDLMPGKDLIALNAMISGCSQNEADNACLDLFVQTFTRGIGFDQTTLLAVLNSATGLQ  424

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             A    KQVH   +K GF  +  V ++L+D Y KC +L DA  +FD  P  +L S+ +++ 
Sbjct  425   APNVCKQVHALSVKLGFQCDTFVINSLVDSYGKCSQLDDAATIFDECPTPDLPSFTSLIT  484

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGI  1459
              YA  G G+EA+++Y  +Q  G+KP+      +L+AC +    E+G   H + +K  +G 
Sbjct  485   AYALLGRGEEAMKLYLKLQGMGLKPDSFVCSSLLNACANLSAYEQGKQIHAHVLK--FGF  542

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDK--VVWRCLLSG  1324
                      +VN++A+ G  + A     +F E P K  V W  ++ G
Sbjct  543   MSDVFAGNSLVNMYAKCGSIEDAN---CAFSEVPRKGIVSWSAMIGG  586


 Score =   228 bits (581),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 150/518 (29%), Positives = 260/518 (50%), Gaps = 11/518 (2%)
 Frame = -2

Query  3111  GSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVT  2932
             G  I++  R P + SLS I+ +CT    I+ GK  H  L+K G  SD +++N L+ MY  
Sbjct  197   GDMIVSGVR-PDEYSLSNILNACTGLGDIVQGKKIHGCLVKLGYDSDPFSSNALVDMYAK  255

Query  2931  FHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVG  2752
                ++ A  +FDE+   ++++W  +I+         +A+     M    G  PN +T   
Sbjct  256   GGNLKDAITVFDEIVVPDIVSWNAIIAGCVLHKCHHQAIDMLNQM-RRSGIWPNMFTLSS  314

Query  2751  ALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPN  2572
             AL AC+ L     G+ +H  + + +   + FVS  L++ Y KC L K A+L++D M   +
Sbjct  315   ALKACAALELPGLGQGLHSLLIKKDIIQDPFVSVGLIDMYCKCDLTKDARLIYDLMPGKD  374

Query  2571  TVTWASLLSCHCQCGEYDEG-LRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIH  2395
              +   +++S  C   E D   L +F+++   G+  ++      L +   ++       +H
Sbjct  375   LIALNAMIS-GCSQNEADNACLDLFVQTFTRGIGFDQTTLLAVLNSATGLQAPNVCKQVH  433

Query  2394  CLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGR  2215
              L VK G + D +V+  LV+ Y KC QL  A   F+    P+L ++T+LI      G+G 
Sbjct  434   ALSVKLGFQCDTFVINSLVDSYGKCSQLDDAATIFDECPTPDLPSFTSLITAYALLGRGE  493

Query  2214  EAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALV  2035
             EA+ L+ KL   GLKP     +S+L A  +   ++ G Q+H+ ++K GF S  F  N+LV
Sbjct  494   EAMKLYLKLQGMGLKPDSFVCSSLLNACANLSAYEQGKQIHAHVLKFGFMSDVFAGNSLV  553

Query  2034  DFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLH  1855
             + Y+K   ++++   F E+    IV+W+A+I G  + G+ ++A+ L  EML +G+ PN  
Sbjct  554   NMYAKCGSIEDANCAFSEVPRKGIVSWSAMIGGLAQHGYAKKALHLFGEMLKDGVSPNHI  613

Query  1854  TYSCILSICGDLPAIEWGKQVHCRIMKPGF--DSNVVVGSTLIDMYAKCGRLGDARKVFD  1681
             T   +L  C     +E  K+ +   MK  F  +      + +ID+  + G+L D+  + +
Sbjct  614   TLVSVLYACNHAGLVEEAKK-YFETMKDSFGIEPTQEHYACMIDVLGRAGKLDDSIDLVN  672

Query  1680  ILPCK-NLVSWNTMLIGYAQHG---FGKEALEIYSMMQ  1579
              +P + N   W  +L     H     G+ A E+   +Q
Sbjct  673   KMPFEANASVWGALLGAARIHKNVEVGQRAAEMLFNLQ  710



>ref|XP_006467747.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
[Citrus sinensis]
Length=949

 Score =   455 bits (1170),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 243/690 (35%), Positives = 389/690 (56%), Gaps = 3/690 (0%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +   ++++CT+ K +  G   H  ++  G  SD +  N L+ MY        +++LFD
Sbjct  173   EFTFPSVLKACTSKKDLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFD  232

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              +P+R+V++W +L S Y H    E+A+  F+ MVL  G  PN ++    ++AC+  G + 
Sbjct  233   AIPERSVVSWNSLFSCYVHCDFLEEAVCFFKEMVLS-GIRPNEFSLSSMINACAGSGDSL  291

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G++IHG   +     + F +N LV+ Y K G L+ A  VF  +  P+ V+W ++++  C
Sbjct  292   LGRKIHGYSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAG-C  350

Query  2535  QCGEY-DEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQ  2359
                E+ D  L++F +   + +  N F    AL ACA +E    G  +HC ++K  +K D 
Sbjct  351   VLHEHNDWALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDP  410

Query  2358  YVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSS  2179
              V  GLV+ Y KCG +  A   F++     L AW  +I G +Q G   EA +LF  +   
Sbjct  411   IVGVGLVDMYAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYRE  470

Query  2178  GLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDES  1999
             G+   + T ++VL +    +   V  Q+H+  +K  F S  ++ N+L+D Y K   ++++
Sbjct  471   GVGFDQTTLSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDA  530

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDL  1819
              +IF+E +  D+V   ++I  Y + G  E+A+KL  EM    + P+    S +L+ C +L
Sbjct  531   VQIFKESSAVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANL  590

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
              A E GKQVH  I+K GF S+   G++L++MYAKCG + DA + F  +P + +VSW+ M+
Sbjct  591   SAYEQGKQVHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMI  650

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGI  1459
              G AQHG GKEAL+++  M E+GV PN IT V VL AC H GL+ E  +HF SM+  +GI
Sbjct  651   GGLAQHGRGKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGI  710

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAE  1279
              P   H ACM+++  R G+ ++A + + + P + +  VW  LL    I K+  +G++AAE
Sbjct  711   QPMQEHYACMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAE  770

Query  1278  EILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFS  1099
              + +I+P  +S HV LSNIYA   MWD  A++R+ MK  +LKKE G SW E+++K+Y F+
Sbjct  771   MLFAIEPEKSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSWIEVKDKVYTFT  830

Query  1098  SSYNMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
                        +   L  ++  L  AGYVP
Sbjct  831   VGDRSHARSKEIYAKLDEVSDLLNKAGYVP  860


 Score =   310 bits (794),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 192/589 (33%), Positives = 302/589 (51%), Gaps = 9/589 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P  +  S+++  CT +KS+  GK  HA LI++G   D    N+L++ Y        A+KL
Sbjct  70    PTSIPYSKLLSQCTISKSVNLGKEIHAHLIRFGLLKDPKNKNNLINFYAKLQFFLYARKL  129

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
              DE P+ ++++W+ LIS Y+  G  E+A  +F+ M L  G   N +T+   L AC+    
Sbjct  130   VDESPEPDLVSWSALISGYAQNGRGEEAALAFQKMHLL-GLKCNEFTFPSVLKACTSKKD  188

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G ++HG +       + FV+N LV  Y KCG    ++ +FDA+ E + V+W SL SC
Sbjct  189   LFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVSWNSLFSC  248

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             +  C   +E +  F   + +G+  NEF     + ACA       G  IH   +K G   D
Sbjct  249   YVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDSD  308

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              +    LV+ Y K G L  A   F     P++ +W A+I GCV       A+ LF ++ S
Sbjct  309   MFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDWALKLFQQMKS  368

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
             S + P+  TY S L A    +  ++G QLH  +IK+   S   V   LVD Y+K   +DE
Sbjct  369   SEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVDMYAKCGSMDE  428

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  IF  M E +++ WN +I+G++++G   +A  L   M  EG+  +  T S +L     
Sbjct  429   ARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTTLSTVLKSVAS  488

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
               AI   KQVH   +K  F+S+  + ++LID Y KCG + DA ++F      +LV+  +M
Sbjct  489   FQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVQIFKESSAVDLVACTSM  548

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNY  1465
             +  YAQ G G+EAL++Y  MQ+  + P+      +L+AC +    E+G   H + +K  +
Sbjct  549   ITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQVHVHIIK--F  606

Query  1464  GITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDK--VVWRCLLSG  1324
             G    T     +VN++A+ G      D  R+F E PD+  V W  ++ G
Sbjct  607   GFMSDTFAGNSLVNMYAKCGSID---DADRAFSEIPDRGIVSWSAMIGG  652


 Score =   265 bits (676),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 170/564 (30%), Positives = 278/564 (49%), Gaps = 34/564 (6%)
 Frame = -2

Query  2781  FTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQ  2602
             FTP    Y   LS C+   +   GKEIH  + R     +    N L+NFY K      A+
Sbjct  68    FTPTSIPYSKLLSQCTISKSVNLGKEIHAHLIRFGLLKDPKNKNNLINFYAKLQFFLYAR  127

Query  2601  LVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVE  2422
              + D   EP+ V+W++L+S + Q G  +E    F +    G+  NEF     L AC S +
Sbjct  128   KLVDESPEPDLVSWSALISGYAQNGRGEEAALAFQKMHLLGLKCNEFTFPSVLKACTSKK  187

Query  2421  CLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIG  2242
              L  G+ +H ++V  G   D++V   LV  Y KCG    +   F+      + +W +L  
Sbjct  188   DLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVSWNSLFS  247

Query  2241  GCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNS  2062
               V      EAV  F +++ SG++P+E + +S++ A   + +  +G ++H + IKLG++S
Sbjct  248   CYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDS  307

Query  2061  FTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEML  1882
               F  NALVD Y+K   L+++  +F+++   DIV+WNA+IAG +   H + A+KL Q+M 
Sbjct  308   DMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDWALKLFQQMK  367

Query  1881  FEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLG  1702
                + PN+ TY+  L  C  +   E G+Q+HC ++K    S+ +VG  L+DMYAKCG + 
Sbjct  368   SSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVDMYAKCGSMD  427

Query  1701  DARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACG  1522
             +AR +F ++P KNL++WN ++ G+ Q+G   EA  ++  M   GV  +  T   VL +  
Sbjct  428   EARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTTLSTVLKSVA  487

Query  1521  -----------HgglleegLNH----FNSMKNNYGI-------------TPRTNHLAC--  1432
                        H   ++          NS+ + YG              +   + +AC  
Sbjct  488   SFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVQIFKESSAVDLVACTS  547

Query  1431  MVNLFARKGQTKKAYDFIRSFPEK---PDKVVWRCLLSGCNINKDFVLGKYAAEEILSID  1261
             M+  +A+ G  ++A        ++   PD  V   LL+ C     +  GK     I+   
Sbjct  548   MITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQVHVHIIKFG  607

Query  1260  -PNDTSAHVTLSNIYARLNMWDEA  1192
               +DT A  +L N+YA+    D+A
Sbjct  608   FMSDTFAGNSLVNMYAKCGSIDDA  631



>ref|XP_002305120.2| hypothetical protein POPTR_0004s04740g [Populus trichocarpa]
 gb|EEE85631.2| hypothetical protein POPTR_0004s04740g [Populus trichocarpa]
Length=858

 Score =   451 bits (1161),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 236/690 (34%), Positives = 390/690 (57%), Gaps = 3/690 (0%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +   ++++CT  K ++ GK  H  ++  G  SD +  N L+ +Y        A+ LFD
Sbjct  82    EFAFPSVLKACTVTKDLVLGKQVHGIVVVTGFDSDEFVANSLVILYAKCGGFGDARSLFD  141

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              +P R+V++W  L S Y H  +  +A+  F  MVL  G  PN ++    ++ C+ L  + 
Sbjct  142   AIPDRSVVSWNALFSCYVHSDMHGEAVSLFHDMVLS-GIRPNEFSLSSMINVCTGLEDSV  200

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G++IHG + +     + F +N LV+ Y K G+L+ A  VFD + +P+ V+W ++++  C
Sbjct  201   QGRKIHGYLIKLGYDSDAFSANALVDMYAKVGILEDASSVFDEIAKPDIVSWNAIIAG-C  259

Query  2535  QCGEYDEGLRIFLRSL-RAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQ  2359
                EY       LR + ++G+  N F    AL ACA +     G  +H  ++K  +  D 
Sbjct  260   VLHEYHHRALELLREMNKSGMCPNMFTLSSALKACAGMALRELGRQLHSSLIKMDMGSDS  319

Query  2358  YVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSS  2179
             ++  GL++ Y KC  +  A   F +    ++ AW A+I G  Q  +  EA +LF  + + 
Sbjct  320   FLGVGLIDMYSKCNSMDDARLVFKLMPERDMIAWNAVISGHSQNEEDEEAASLFPLMHTE  379

Query  2178  GLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDES  1999
             G+  ++ T ++VL +    +   +  Q+H+  +K GF    +V N+L+D Y K   ++++
Sbjct  380   GIGFNQTTLSTVLKSIAALQANYMCRQIHALSLKSGFEFDNYVVNSLIDTYGKCGHVEDA  439

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDL  1819
              ++F+E    D+V + +L+  Y + G  E+A++L  EM   G++P+    S +L+ C  L
Sbjct  440   TRVFEESPTVDLVLFTSLVTAYAQDGQGEEALRLYLEMQDRGIKPDSFVCSSLLNACASL  499

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
              A E GKQVH  I+K GF S++  G++L++MYAKCG + DA   F  +P + +VSW+ M+
Sbjct  500   SAYEQGKQVHVHILKFGFMSDIFAGNSLVNMYAKCGSIEDASCAFSRIPVRGIVSWSAMI  559

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGI  1459
              G AQHG+GKEAL+++  M + GV PN IT V VL AC H GL+ E  ++FNSMK  +GI
Sbjct  560   GGLAQHGYGKEALQLFKQMLKVGVPPNHITLVSVLCACNHAGLVAEAKHYFNSMKILFGI  619

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAE  1279
              P   H ACM++L  R G+ + A + +   P + + +VW  LL    I+K+  LG+ AAE
Sbjct  620   EPMQEHYACMIDLLGRAGKLEAAMELVNKMPFQANALVWGALLGAARIHKNIDLGEQAAE  679

Query  1278  EILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFS  1099
              +L+++P  +  HV L+NIYA + MWD+ A++R++MK  ++KKE G SW E+++K+Y F 
Sbjct  680   MLLALEPEKSGTHVLLANIYASVGMWDKVARVRRLMKDGKVKKEPGMSWLEVKDKVYTFI  739

Query  1098  SSYNMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
                        +   L  L+  L  AGYVP
Sbjct  740   VGDRSHSRSTEIYAKLDELSDLLKKAGYVP  769


 Score =   290 bits (742),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 177/562 (31%), Positives = 292/562 (52%), Gaps = 5/562 (1%)
 Frame = -2

Query  3006  HAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLS  2827
             HA++IK+G   D    N+L+++Y        A+KL D   + ++++W+ LIS YS  G  
Sbjct  4     HARVIKFGLSQDPKIRNYLVNLYSKCQLFGYARKLLDRSTEPDLVSWSALISGYSQNGFC  63

Query  2826  EKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNC  2647
             ++A+ +F  M L  G   N + +   L AC+       GK++HG +       + FV+N 
Sbjct  64    QEAVLAFYEMHLL-GIKCNEFAFPSVLKACTVTKDLVLGKQVHGIVVVTGFDSDEFVANS  122

Query  2646  LVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVN  2467
             LV  Y KCG    A+ +FDA+ + + V+W +L SC+     + E + +F   + +G+  N
Sbjct  123   LVILYAKCGGFGDARSLFDAIPDRSVVSWNALFSCYVHSDMHGEAVSLFHDMVLSGIRPN  182

Query  2466  EFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFN  2287
             EF     +  C  +E    G  IH  ++K G   D +    LV+ Y K G L  A + F+
Sbjct  183   EFSLSSMINVCTGLEDSVQGRKIHGYLIKLGYDSDAFSANALVDMYAKVGILEDASSVFD  242

Query  2286  MASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQV  2107
               + P++ +W A+I GCV       A+ L  ++  SG+ P+  T +S L A       ++
Sbjct  243   EIAKPDIVSWNAIIAGCVLHEYHHRALELLREMNKSGMCPNMFTLSSALKACAGMALREL  302

Query  2106  GMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIR  1927
             G QLHS +IK+   S +F+   L+D YSK N +D++  +F+ M E D++ WNA+I+G+ +
Sbjct  303   GRQLHSSLIKMDMGSDSFLGVGLIDMYSKCNSMDDARLVFKLMPERDMIAWNAVISGHSQ  362

Query  1926  SGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVV  1747
             +   E+A  L   M  EG+  N  T S +L     L A    +Q+H   +K GF+ +  V
Sbjct  363   NEEDEEAASLFPLMHTEGIGFNQTTLSTVLKSIAALQANYMCRQIHALSLKSGFEFDNYV  422

Query  1746  GSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGV  1567
              ++LID Y KCG + DA +VF+  P  +LV + +++  YAQ G G+EAL +Y  MQ+ G+
Sbjct  423   VNSLIDTYGKCGHVEDATRVFEESPTVDLVLFTSLVTAYAQDGQGEEALRLYLEMQDRGI  482

Query  1566  KPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKA  1390
             KP+      +L+AC      E+G   H + +K  +G          +VN++A+ G  + A
Sbjct  483   KPDSFVCSSLLNACASLSAYEQGKQVHVHILK--FGFMSDIFAGNSLVNMYAKCGSIEDA  540

Query  1389  YDFIRSFPEKPDKVVWRCLLSG  1324
                    P +   V W  ++ G
Sbjct  541   SCAFSRIPVR-GIVSWSAMIGG  561


 Score =   258 bits (660),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 163/540 (30%), Positives = 272/540 (50%), Gaps = 34/540 (6%)
 Frame = -2

Query  2706  EIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCG  2527
             EIH R+ +   + +  + N LVN Y KC L   A+ + D   EP+ V+W++L+S + Q G
Sbjct  2     EIHARVIKFGLSQDPKIRNYLVNLYSKCQLFGYARKLLDRSTEPDLVSWSALISGYSQNG  61

Query  2526  EYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVT  2347
                E +  F      G+  NEF     L AC   + L  G  +H ++V  G   D++V  
Sbjct  62    FCQEAVLAFYEMHLLGIKCNEFAFPSVLKACTVTKDLVLGKQVHGIVVVTGFDSDEFVAN  121

Query  2346  GLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKP  2167
              LV  Y KCG  G A + F+      + +W AL    V      EAV+LF  ++ SG++P
Sbjct  122   SLVILYAKCGGFGDARSLFDAIPDRSVVSWNALFSCYVHSDMHGEAVSLFHDMVLSGIRP  181

Query  2166  SERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
             +E + +S++   T  ++   G ++H ++IKLG++S  F  NALVD Y+K  +L+++  +F
Sbjct  182   NEFSLSSMINVCTGLEDSVQGRKIHGYLIKLGYDSDAFSANALVDMYAKVGILEDASSVF  241

Query  1986  QEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIE  1807
              E+ + DIV+WNA+IAG +   ++ +A++LL+EM   G+ PN+ T S  L  C  +   E
Sbjct  242   DEIAKPDIVSWNAIIAGCVLHEYHHRALELLREMNKSGMCPNMFTLSSALKACAGMALRE  301

Query  1806  WGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYA  1627
              G+Q+H  ++K    S+  +G  LIDMY+KC  + DAR VF ++P +++++WN ++ G++
Sbjct  302   LGRQLHSSLIKMDMGSDSFLGVGLIDMYSKCNSMDDARLVFKLMPERDMIAWNAVISGHS  361

Query  1626  QHGFGKEALEIYSMMQENGVKPNDITFVGVLSA---------CGHgglleegLNH-----  1489
             Q+   +EA  ++ +M   G+  N  T   VL +         C     L           
Sbjct  362   QNEEDEEAASLFPLMHTEGIGFNQTTLSTVLKSIAALQANYMCRQIHALSLKSGFEFDNY  421

Query  1488  -FNSMKNNYGI-------------TPRTNHL--ACMVNLFARKGQTKKAYDFIRSFPE--  1363
               NS+ + YG              +P  + +    +V  +A+ GQ ++A        +  
Sbjct  422   VVNSLIDTYGKCGHVEDATRVFEESPTVDLVLFTSLVTAYAQDGQGEEALRLYLEMQDRG  481

Query  1362  -KPDKVVWRCLLSGCNINKDFVLGKYAAEEILSID-PNDTSAHVTLSNIYARLNMWDEAA  1189
              KPD  V   LL+ C     +  GK     IL     +D  A  +L N+YA+    ++A+
Sbjct  482   IKPDSFVCSSLLNACASLSAYEQGKQVHVHILKFGFMSDIFAGNSLVNMYAKCGSIEDAS  541


 Score =   231 bits (588),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 143/502 (28%), Positives = 252/502 (50%), Gaps = 8/502 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + SLS +I  CT  +  + G+  H  LIK G  SD ++ N L+ MY     +E A  +
Sbjct  181   PNEFSLSSMINVCTGLEDSVQGRKIHGYLIKLGYDSDAFSANALVDMYAKVGILEDASSV  240

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FDE+ K ++++W  +I+         +AL   R M  + G  PN +T   AL AC+ +  
Sbjct  241   FDEIAKPDIVSWNAIIAGCVLHEYHHRALELLREMN-KSGMCPNMFTLSSALKACAGMAL  299

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G+++H  + + +   ++F+   L++ Y KC  +  A+LVF  M E + + W +++S 
Sbjct  300   RELGRQLHSSLIKMDMGSDSFLGVGLIDMYSKCNSMDDARLVFKLMPERDMIAWNAVISG  359

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             H Q  E +E   +F      G+  N+      L + A+++       IH L +K G + D
Sbjct  360   HSQNEEDEEAASLFPLMHTEGIGFNQTTLSTVLKSIAALQANYMCRQIHALSLKSGFEFD  419

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              YVV  L++ Y KCG +  A   F  +   +L  +T+L+    Q G+G EA+ L+ ++  
Sbjct  420   NYVVNSLIDTYGKCGHVEDATRVFEESPTVDLVLFTSLVTAYAQDGQGEEALRLYLEMQD  479

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              G+KP     +S+L A      ++ G Q+H  I+K GF S  F  N+LV+ Y+K   +++
Sbjct  480   RGIKPDSFVCSSLLNACASLSAYEQGKQVHVHILKFGFMSDIFAGNSLVNMYAKCGSIED  539

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +   F  +    IV+W+A+I G  + G+ ++A++L ++ML  G+ PN  T   +L  C  
Sbjct  540   ASCAFSRIPVRGIVSWSAMIGGLAQHGYGKEALQLFKQMLKVGVPPNHITLVSVLCACNH  599

Query  1821  LPAIEWGKQVHCRIMKP--GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-NLVSW  1651
                +   K  +   MK   G +      + +ID+  + G+L  A ++ + +P + N + W
Sbjct  600   AGLVAEAKH-YFNSMKILFGIEPMQEHYACMIDLLGRAGKLEAAMELVNKMPFQANALVW  658

Query  1650  NTMLIGYAQH---GFGKEALEI  1594
               +L     H     G++A E+
Sbjct  659   GALLGAARIHKNIDLGEQAAEM  680


 Score =   204 bits (520),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 115/368 (31%), Positives = 196/368 (53%), Gaps = 4/368 (1%)
 Frame = -2

Query  2406  MGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQ  2227
             M IH  ++K G+  D  +   LVN Y KC   G A    + ++ P+L +W+ALI G  Q 
Sbjct  1     MEIHARVIKFGLSQDPKIRNYLVNLYSKCQLFGYARKLLDRSTEPDLVSWSALISGYSQN  60

Query  2226  GKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVC  2047
             G  +EAV  F ++   G+K +E  + SVL A T TK+  +G Q+H  ++  GF+S  FV 
Sbjct  61    GFCQEAVLAFYEMHLLGIKCNEFAFPSVLKACTVTKDLVLGKQVHGIVVVTGFDSDEFVA  120

Query  2046  NALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLE  1867
             N+LV  Y+K     ++  +F  + +  +V+WNAL + Y+ S  + +A+ L  +M+  G+ 
Sbjct  121   NSLVILYAKCGGFGDARSLFDAIPDRSVVSWNALFSCYVHSDMHGEAVSLFHDMVLSGIR  180

Query  1866  PNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKV  1687
             PN  + S ++++C  L     G+++H  ++K G+DS+    + L+DMYAK G L DA  V
Sbjct  181   PNEFSLSSMINVCTGLEDSVQGRKIHGYLIKLGYDSDAFSANALVDMYAKVGILEDASSV  240

Query  1686  FDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSAC-GHggl  1510
             FD +   ++VSWN ++ G   H +   ALE+   M ++G+ PN  T    L AC G    
Sbjct  241   FDEIAKPDIVSWNAIIAGCVLHEYHHRALELLREMNKSGMCPNMFTLSSALKACAGMALR  300

Query  1509  leegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLL  1330
                   H + +K + G          +++++++      A    +  PE+ D + W  ++
Sbjct  301   ELGRQLHSSLIKMDMGSDSFLG--VGLIDMYSKCNSMDDARLVFKLMPER-DMIAWNAVI  357

Query  1329  SGCNINKD  1306
             SG + N++
Sbjct  358   SGHSQNEE  365



>ref|XP_011046269.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Populus euphratica]
 ref|XP_011046270.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Populus euphratica]
Length=876

 Score =   452 bits (1163),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 248/706 (35%), Positives = 411/706 (58%), Gaps = 20/706 (3%)
 Frame = -2

Query  3069  SLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM  2890
             +LS ++++C+       G   H   +K G  +DV     LL MY+    ++  ++ FDEM
Sbjct  103   TLSCVLKACSFLFDRNFGTQVHNYSLKSGFLNDVSVGTALLDMYLKNENVKDGRRAFDEM  162

Query  2889  PKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTG  2710
               RNV++WT+L++ Y+  GL+ + L  F  M++E G  PN +T+   + A +  G    G
Sbjct  163   GARNVVSWTSLLTGYAQNGLNLETLKLFLRMLVE-GIKPNPFTFSAVIGALTDEGMVEAG  221

Query  2709  KEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQC  2530
              ++H  + +    +  F SN L+N Y K G++  A+ VF++M + N V+W S+++     
Sbjct  222   IQVHTMVIKNGFGVATFASNSLINMYFKSGMIGDARAVFNSMTDRNDVSWNSMVAGLVTN  281

Query  2529  GEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVV  2350
             G + E L +F     AGV + + +    +  C +++ LGF   +HC ++K G + D+ + 
Sbjct  282   GLHLETLYVFYHMRLAGVKLTKMVFAPVIKLCGNIKELGFSRQLHCQVLKSGFEYDKNIR  341

Query  2349  TGLVNFYVKCGQLGLAYNTFNMAS--APELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             T L+  Y KCG++  A+  F++ S     + +WTA+I G +Q G   +AVNLFC++   G
Sbjct  342   TTLMLAYSKCGEMDNAFKIFSVMSDEVRNVVSWTAMISGYLQNGMAEQAVNLFCQMSREG  401

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             +KP++ TY+++L A      F+    +H+  IK  +     V  AL+D Y K   +DE+ 
Sbjct  402   IKPNDFTYSTILTAQPGVSPFE----MHAQAIKRNYVKSPSVGTALLDAYVKRGNIDEAS  457

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
             K+FQ + E DIV W+A+I GY + G  E A+++  +M  EG++PN +T+S I++ C    
Sbjct  458   KVFQRIEEKDIVAWSAMICGYAQIGETEGAVRIFVQMAKEGIKPNEYTFSGIINACAAPT  517

Query  1815  A-IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
             A +E GKQ+H   +K  F++ + V S L+ MY+K G +  A +VF     ++LVSWN+++
Sbjct  518   AGVEQGKQLHAWSIKSRFNNALCVSSALLTMYSKRGDIESAFEVFKRQRERDLVSWNSII  577

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGI  1459
              GYAQHG+G++ALE++  MQ   ++ + +TF+GV+SAC H GL +EG  +F+ M  ++ I
Sbjct  578   SGYAQHGYGRKALEVFEEMQRQNLEMDGVTFIGVISACTHAGLAKEGQRYFDIMVKDHHI  637

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAE  1279
              PR  H +CMV+L+ R G   KA + I   P      VWR LL+   I+++  +GK AA+
Sbjct  638   EPRMEHYSCMVDLYGRAGMLVKAMEIINEMPFPAGANVWRTLLAASCIHRNLEVGKLAAD  697

Query  1278  EILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFS  1099
             +++S+ P + +++V L+N+YA +  W E A++RK+M++K++KK  G SW E++NK Y F 
Sbjct  698   KLISLQPQNPASYVLLTNMYASVGNWKERAKVRKLMEEKKVKKVAGYSWIEVKNKTYTF-  756

Query  1098  SSYNMLLGEVS------MKKLLIGLTAQLLDAGYVPDTKLSFDYGD  979
                  L G+VS      +   L  L+ QL  AGY PDT   F   D
Sbjct  757   -----LAGDVSHPLSNQIYARLEELSCQLKGAGYQPDTSYVFQDVD  797


 Score =   242 bits (618),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 157/540 (29%), Positives = 275/540 (51%), Gaps = 24/540 (4%)
 Frame = -2

Query  2913  AQKLFDEMPKRNVITWTTLISSYS----HMGLSEKALGSFRSMVLEDGFTPNHYTYVGAL  2746
             A  +F + P++N++ +  L+   S    + G+ +  +G  RS     GF  +  T    L
Sbjct  54    AHPVFCKSPQQNLVYYNHLLFQCSRENRNRGVVDLFVGIHRS-----GFFIDGSTLSCVL  108

Query  2745  SACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTV  2566
              ACS L     G ++H    ++    +  V   L++ Y K   +K  +  FD M   N V
Sbjct  109   KACSFLFDRNFGTQVHNYSLKSGFLNDVSVGTALLDMYLKNENVKDGRRAFDEMGARNVV  168

Query  2565  TWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLI  2386
             +W SLL+ + Q G   E L++FLR L  G+  N F     +GA      +  G+ +H ++
Sbjct  169   SWTSLLTGYAQNGLNLETLKLFLRMLVEGIKPNPFTFSAVIGALTDEGMVEAGIQVHTMV  228

Query  2385  VKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAV  2206
             +K G  +  +    L+N Y K G +G A   FN  +     +W +++ G V  G   E +
Sbjct  229   IKNGFGVATFASNSLINMYFKSGMIGDARAVFNSMTDRNDVSWNSMVAGLVTNGLHLETL  288

Query  2205  NLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFY  2026
              +F  +  +G+K ++  +A V+    + KE     QLH  ++K GF     +   L+  Y
Sbjct  289   YVFYHMRLAGVKLTKMVFAPVIKLCGNIKELGFSRQLHCQVLKSGFEYDKNIRTTLMLAY  348

Query  2025  SKSNLLDESFKIFQEMTE--YDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHT  1852
             SK   +D +FKIF  M++   ++V+W A+I+GY+++G  EQA+ L  +M  EG++PN  T
Sbjct  349   SKCGEMDNAFKIFSVMSDEVRNVVSWTAMISGYLQNGMAEQAVNLFCQMSREGIKPNDFT  408

Query  1851  YSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILP  1672
             YS IL+    +   E    +H + +K  +  +  VG+ L+D Y K G + +A KVF  + 
Sbjct  409   YSTILTAQPGVSPFE----MHAQAIKRNYVKSPSVGTALLDAYVKRGNIDEASKVFQRIE  464

Query  1671  CKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN  1492
              K++V+W+ M+ GYAQ G  + A+ I+  M + G+KPN+ TF G+++AC       E   
Sbjct  465   EKDIVAWSAMICGYAQIGETEGAVRIFVQMAKEGIKPNEYTFSGIINACAAPTAGVEQGK  524

Query  1491  HFNSMKNNYGITPRTNHLAC----MVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
               ++    + I  R N+  C    ++ +++++G  + A++  +   E+ D V W  ++SG
Sbjct  525   QLHA----WSIKSRFNNALCVSSALLTMYSKRGDIESAFEVFKRQRER-DLVSWNSIISG  579


 Score =   187 bits (476),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/492 (25%), Positives = 239/492 (49%), Gaps = 10/492 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + S +I + T    + +G   H  +IK G     + +N L++MY     I  A+ +
Sbjct  200   PNPFTFSAVIGALTDEGMVEAGIQVHTMVIKNGFGVATFASNSLINMYFKSGMIGDARAV  259

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F+ M  RN ++W ++++     GL  + L  F  M L  G       +   +  C  +  
Sbjct  260   FNSMTDRNDVSWNSMVAGLVTNGLHLETLYVFYHMRLA-GVKLTKMVFAPVIKLCGNIKE  318

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEP--NTVTWASLL  2548
                 +++H ++ ++    +  +   L+  Y KCG + +A  +F  M +   N V+W +++
Sbjct  319   LGFSRQLHCQVLKSGFEYDKNIRTTLMLAYSKCGEMDNAFKIFSVMSDEVRNVVSWTAMI  378

Query  2547  SCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVK  2368
             S + Q G  ++ + +F +  R G+  N+F     L A   V        +H   +K    
Sbjct  379   SGYLQNGMAEQAVNLFCQMSREGIKPNDFTYSTILTAQPGVSPF----EMHAQAIKRNYV  434

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
                 V T L++ YVK G +  A   F      ++ AW+A+I G  Q G+   AV +F ++
Sbjct  435   KSPSVGTALLDAYVKRGNIDEASKVFQRIEEKDIVAWSAMICGYAQIGETEGAVRIFVQM  494

Query  2187  LSSGLKPSERTYASVLGA-FTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNL  2011
                G+KP+E T++ ++ A    T   + G QLH++ IK  FN+   V +AL+  YSK   
Sbjct  495   AKEGIKPNEYTFSGIINACAAPTAGVEQGKQLHAWSIKSRFNNALCVSSALLTMYSKRGD  554

Query  2010  LDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSI  1831
             ++ +F++F+   E D+V+WN++I+GY + G+  +A+++ +EM  + LE +  T+  ++S 
Sbjct  555   IESAFEVFKRQRERDLVSWNSIISGYAQHGYGRKALEVFEEMQRQNLEMDGVTFIGVISA  614

Query  1830  CGDLPAIEWGKQVHCRIMKP-GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVS  1654
             C      + G++    ++K    +  +   S ++D+Y + G L  A ++ + +P     +
Sbjct  615   CTHAGLAKEGQRYFDIMVKDHHIEPRMEHYSCMVDLYGRAGMLVKAMEIINEMPFPAGAN  674

Query  1653  -WNTMLIGYAQH  1621
              W T+L     H
Sbjct  675   VWRTLLAASCIH  686


 Score =   108 bits (270),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 121/239 (51%), Gaps = 4/239 (2%)
 Frame = -2

Query  2025  SKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYS  1846
             SK     E+  +F +  + ++V +N L+    R       + L   +   G   +  T S
Sbjct  46    SKPPNRSEAHPVFCKSPQQNLVYYNHLLFQCSRENRNRGVVDLFVGIHRSGFFIDGSTLS  105

Query  1845  CILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK  1666
             C+L  C  L    +G QVH   +K GF ++V VG+ L+DMY K   + D R+ FD +  +
Sbjct  106   CVLKACSFLFDRNFGTQVHNYSLKSGFLNDVSVGTALLDMYLKNENVKDGRRAFDEMGAR  165

Query  1665  NLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-H  1489
             N+VSW ++L GYAQ+G   E L+++  M   G+KPN  TF  V+ A    G++E G+  H
Sbjct  166   NVVSWTSLLTGYAQNGLNLETLKLFLRMLVEGIKPNPFTFSAVIGALTDEGMVEAGIQVH  225

Query  1488  FNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNIN  1312
                +KN +G+    ++   ++N++ + G    A     S  ++ D V W  +++G   N
Sbjct  226   TMVIKNGFGVATFASN--SLINMYFKSGMIGDARAVFNSMTDRND-VSWNSMVAGLVTN  281



>ref|XP_011027784.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Populus euphratica]
Length=951

 Score =   454 bits (1167),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 235/690 (34%), Positives = 392/690 (57%), Gaps = 3/690 (0%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +   ++++CT  K ++ GK  H  ++  G  SD +  N L+ +Y        A++LFD
Sbjct  175   EFAFPSVLKACTVTKDLVLGKQVHGIVVVTGFDSDEFVANSLVILYAKCGGFRDARRLFD  234

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              +P R+V++W  L S Y H  +  +A+G F  MVL  G  PN ++    ++ C+ L    
Sbjct  235   AIPDRSVVSWNALFSCYVHSDMHGEAVGLFHDMVLS-GIRPNEFSLSSMINVCTGLEDIV  293

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G+++HG + +     + F +N LV+ Y K G+L+ A  V D + +P+ V+W ++++  C
Sbjct  294   QGRKVHGYLIKLGYDSDPFSANALVDMYAKVGILEDASSVLDDIAKPDIVSWNAIIAG-C  352

Query  2535  QCGEYDEGLRIFLRSL-RAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQ  2359
                EY       LR + ++G+  N F    AL ACA +     G  +H  ++K  +  D 
Sbjct  353   VLHEYHHRALELLREMNKSGMCPNMFTLSSALKACAGMALRELGRQLHSSLIKMDMGSDS  412

Query  2358  YVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSS  2179
             ++  GL++ Y KC  +  A   F +    ++ AW A+I G  Q  +  EA +LF  + + 
Sbjct  413   FLGVGLIDMYSKCNSMDDARLVFKLMPERDMIAWNAVISGHSQNEEDEEAASLFPLMHTE  472

Query  2178  GLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDES  1999
             G+  ++ T ++VL +    +   +  Q+H+  +K GF   ++V N+L+D Y K   ++++
Sbjct  473   GIGFNQTTLSTVLKSIAALQATYMCRQIHALSLKSGFEFDSYVVNSLIDTYGKCGHVEDA  532

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDL  1819
              ++F+E    D+V + +L+  Y R G  E+A++L  E+   G++P+    S +L+ C  L
Sbjct  533   TRVFKESPIVDLVLFTSLVTAYARDGQGEEALRLYLELQDRGIKPDSFVCSSLLNACASL  592

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
              A E GKQVH  I+K GF S++  G++L++MYAKCG + DA   F  +P + +VSW+ M+
Sbjct  593   SAYEQGKQVHVHILKFGFMSDIFAGNSLVNMYAKCGSIDDASCAFSRIPVRGIVSWSAMI  652

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGI  1459
              G AQHG+GKEAL+++  M ++GV PN IT V VL AC H GL+ E  ++FNSMK  +GI
Sbjct  653   GGLAQHGYGKEALQLFKQMLKDGVPPNHITLVSVLCACNHAGLVAEAKHYFNSMKILFGI  712

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAE  1279
              P   H ACM++L  R G+ + A + +   P + + +VW  LL    I+K+  LG+ AAE
Sbjct  713   EPMQEHYACMIDLLGRAGKLEAAMELVNKMPFQANAMVWGALLGAARIHKNIDLGEKAAE  772

Query  1278  EILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFS  1099
              +L+++P  +  HV L+NIYA + MWD+ A++R++MK  ++KKE G SW E+++K+Y F 
Sbjct  773   MLLALEPEKSGTHVLLANIYASVGMWDKVARVRRLMKDGKVKKEPGMSWLEVKDKVYTFI  832

Query  1098  SSYNMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
                        +   L  L+  L  AGYVP
Sbjct  833   VGDRSHSRSTEIYAKLDELSDLLKKAGYVP  862


 Score =   303 bits (777),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 187/614 (30%), Positives = 316/614 (51%), Gaps = 12/614 (2%)
 Frame = -2

Query  3162  PLPPATTASLRPA*QSQGSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYG  2983
             P P  T ++L     +Q ++  +T   P  +S S+++  CT +KS+  G   HA++IK+G
Sbjct  52    PKPTTTASNL----TTQKTNFYST---PTIISCSKLLSKCTASKSLTPGMEIHARVIKFG  104

Query  2982  SKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFR  2803
                D    N+L+++Y        A+KL D   + ++++W+ LIS YS  G  ++A  +F 
Sbjct  105   LSQDPKIRNYLVNLYSKCQLFGYARKLLDRSTEPDLVSWSALISGYSKNGFCQEAFLAFY  164

Query  2802  SMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKC  2623
              M L  G   N + +   L AC+       GK++HG +       + FV+N LV  Y KC
Sbjct  165   EMHLL-GIKCNEFAFPSVLKACTVTKDLVLGKQVHGIVVVTGFDSDEFVANSLVILYAKC  223

Query  2622  GLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIAL  2443
             G  + A+ +FDA+ + + V+W +L SC+     + E + +F   + +G+  NEF     +
Sbjct  224   GGFRDARRLFDAIPDRSVVSWNALFSCYVHSDMHGEAVGLFHDMVLSGIRPNEFSLSSMI  283

Query  2442  GACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELH  2263
               C  +E +  G  +H  ++K G   D +    LV+ Y K G L  A +  +  + P++ 
Sbjct  284   NVCTGLEDIVQGRKVHGYLIKLGYDSDPFSANALVDMYAKVGILEDASSVLDDIAKPDIV  343

Query  2262  AWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFI  2083
             +W A+I GCV       A+ L  ++  SG+ P+  T +S L A       ++G QLHS +
Sbjct  344   SWNAIIAGCVLHEYHHRALELLREMNKSGMCPNMFTLSSALKACAGMALRELGRQLHSSL  403

Query  2082  IKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAI  1903
             IK+   S +F+   L+D YSK N +D++  +F+ M E D++ WNA+I+G+ ++   E+A 
Sbjct  404   IKMDMGSDSFLGVGLIDMYSKCNSMDDARLVFKLMPERDMIAWNAVISGHSQNEEDEEAA  463

Query  1902  KLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMY  1723
              L   M  EG+  N  T S +L     L A    +Q+H   +K GF+ +  V ++LID Y
Sbjct  464   SLFPLMHTEGIGFNQTTLSTVLKSIAALQATYMCRQIHALSLKSGFEFDSYVVNSLIDTY  523

Query  1722  AKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFV  1543
              KCG + DA +VF   P  +LV + +++  YA+ G G+EAL +Y  +Q+ G+KP+     
Sbjct  524   GKCGHVEDATRVFKESPIVDLVLFTSLVTAYARDGQGEEALRLYLELQDRGIKPDSFVCS  583

Query  1542  GVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFP  1366
              +L+AC      E+G   H + +K  +G          +VN++A+ G    A       P
Sbjct  584   SLLNACASLSAYEQGKQVHVHILK--FGFMSDIFAGNSLVNMYAKCGSIDDASCAFSRIP  641

Query  1365  EKPDKVVWRCLLSG  1324
              +   V W  ++ G
Sbjct  642   VR-GIVSWSAMIGG  654



>gb|KCW44369.1| hypothetical protein EUGRSUZ_L02158 [Eucalyptus grandis]
Length=783

 Score =   449 bits (1154),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 239/691 (35%), Positives = 393/691 (57%), Gaps = 5/691 (1%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +   +++SC+    ++ GK  H  ++  G  SD +  N L+ MY    E    +++F 
Sbjct  7     EFTFPTVLKSCSIRGDLVMGKQVHGVVVVTGYDSDEFVANGLIVMYAKCGEFGDTRRVFC  66

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              +  +NV++W  LISSY       +A   F  M+L  G  P+ ++    L+AC+ LG   
Sbjct  67    SIHVKNVVSWNGLISSYVKSDFLREAKEMFDEMILS-GIRPSEFSLSTILNACAGLGDCI  125

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G++ HG + +     + F  N LV+ Y K G L+ A   F+ +L+P+ V+W ++++   
Sbjct  126   QGRKAHGYLIKLGYESDQFSQNALVDMYAKAGDLEDAITAFEEILQPDIVSWNAIIAGCV  185

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
                   + L+++ +  R+G+  N F    AL ACAS+E       +H +++K   K D +
Sbjct  186   LHERNHQALKLYTQMNRSGIFPNLFTLSSALKACASMELNYLARQLHSIVIKHDTKADSF  245

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V  GLV+ Y KC  +  A   F++ +  +L A  ALI G  Q G+  +AV+LF +   S 
Sbjct  246   VRAGLVDMYSKCSLMDEARMAFDLMAQKDLIALNALISGYSQNGEDVQAVSLFAETYKSE  305

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             +  ++ T + +L + T  +   V MQ+H+  +KLGF++ + V  +L+D YSK   ++E+ 
Sbjct  306   IGFNQTTLSVILKSATSMQAIDVSMQVHAVSLKLGFDNDSQVATSLIDAYSKCGNIEEAA  365

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
               F+     D+V   ++IA Y + G  E+A+KL  E+   GL+P+    S +L+ C +L 
Sbjct  366   TAFEICAAGDLVALTSMIAAYAQCGQGEEAVKLYLEVQRRGLKPDPFVCSSLLNACANLS  425

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             A E GKQ H  ++K GF S+V  G++L++MYAKCG + DA   FD +P + +VSW+ M+ 
Sbjct  426   AYEQGKQAHVHVLKFGFMSDVFAGNSLVNMYAKCGSIDDAICAFDEIPDRGIVSWSAMIG  485

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             G+AQHG GKEAL+ +  M E+G+ PN IT + VL AC H GL+++  ++F SM+  + I 
Sbjct  486   GFAQHGHGKEALQFFDQMLEDGIAPNHITLLSVLCACNHAGLVDKAEHYFKSMEELFAIR  545

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             P   H ACM+++  R G+ ++A D I + P + +  VW  +L    I+K+  LGK AAE 
Sbjct  546   PTQEHYACMIDILGRAGKLEEAVDLIETMPFQANGHVWGAILGAARIHKNVELGKRAAEM  605

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF--  1102
             +  ++P ++  HV LSNIYA   MW + A++R++MK  ++KKE G SW EL++K+Y F  
Sbjct  606   LFLLEPENSGTHVLLSNIYASAGMWGKVAEVRRLMKHSKVKKEPGTSWVELKDKVYTFIV  665

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
               + +   GE+  K  L  L+  +  AGYVP
Sbjct  666   GDTSHPRTGEIYAK--LDELSELMSRAGYVP  694


 Score =   249 bits (637),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 158/491 (32%), Positives = 253/491 (52%), Gaps = 10/491 (2%)
 Frame = -2

Query  2784  GFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSA  2605
             G   N +T+   L +CS  G    GK++HG +       + FV+N L+  Y KCG     
Sbjct  2     GVKGNEFTFPTVLKSCSIRGDLVMGKQVHGVVVVTGYDSDEFVANGLIVMYAKCGEFGDT  61

Query  2604  QLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASV  2425
             + VF ++   N V+W  L+S + +     E   +F   + +G+  +EF     L ACA +
Sbjct  62    RRVFCSIHVKNVVSWNGLISSYVKSDFLREAKEMFDEMILSGIRPSEFSLSTILNACAGL  121

Query  2424  -ECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTAL  2248
              +C+  G   H  ++K G + DQ+    LV+ Y K G L  A   F     P++ +W A+
Sbjct  122   GDCIQ-GRKAHGYLIKLGYESDQFSQNALVDMYAKAGDLEDAITAFEEILQPDIVSWNAI  180

Query  2247  IGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGF  2068
             I GCV   +  +A+ L+ ++  SG+ P+  T +S L A    +   +  QLHS +IK   
Sbjct  181   IAGCVLHERNHQALKLYTQMNRSGIFPNLFTLSSALKACASMELNYLARQLHSIVIKHDT  240

Query  2067  NSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQE  1888
              + +FV   LVD YSK +L+DE+   F  M + D++  NALI+GY ++G   QA+ L  E
Sbjct  241   KADSFVRAGLVDMYSKCSLMDEARMAFDLMAQKDLIALNALISGYSQNGEDVQAVSLFAE  300

Query  1887  MLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGR  1708
                  +  N  T S IL     + AI+   QVH   +K GFD++  V ++LID Y+KCG 
Sbjct  301   TYKSEIGFNQTTLSVILKSATSMQAIDVSMQVHAVSLKLGFDNDSQVATSLIDAYSKCGN  360

Query  1707  LGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSA  1528
             + +A   F+I    +LV+  +M+  YAQ G G+EA+++Y  +Q  G+KP+      +L+A
Sbjct  361   IEEAATAFEICAAGDLVALTSMIAAYAQCGQGEEAVKLYLEVQRRGLKPDPFVCSSLLNA  420

Query  1527  CGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDK  1351
             C +    E+G   H + +K  +G          +VN++A+ G      D I +F E PD+
Sbjct  421   CANLSAYEQGKQAHVHVLK--FGFMSDVFAGNSLVNMYAKCGSID---DAICAFDEIPDR  475

Query  1350  --VVWRCLLSG  1324
               V W  ++ G
Sbjct  476   GIVSWSAMIGG  486


 Score =   240 bits (613),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 146/525 (28%), Positives = 269/525 (51%), Gaps = 9/525 (2%)
 Frame = -2

Query  3135  LRPA*QSQGSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNN  2956
             LR A +     IL+  R P + SLS I+ +C      + G+ AH  LIK G +SD ++ N
Sbjct  89    LREAKEMFDEMILSGIR-PSEFSLSTILNACAGLGDCIQGRKAHGYLIKLGYESDQFSQN  147

Query  2955  HLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFT  2776
              L+ MY    ++E A   F+E+ + ++++W  +I+       + +AL  +  M    G  
Sbjct  148   ALVDMYAKAGDLEDAITAFEEILQPDIVSWNAIIAGCVLHERNHQALKLYTQMN-RSGIF  206

Query  2775  PNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLV  2596
             PN +T   AL AC+ +      +++H  + + +   ++FV   LV+ Y KC L+  A++ 
Sbjct  207   PNLFTLSSALKACASMELNYLARQLHSIVIKHDTKADSFVRAGLVDMYSKCSLMDEARMA  266

Query  2595  FDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECL  2416
             FD M + + +   +L+S + Q GE  + + +F  + ++ +  N+    + L +  S++ +
Sbjct  267   FDLMAQKDLIALNALISGYSQNGEDVQAVSLFAETYKSEIGFNQTTLSVILKSATSMQAI  326

Query  2415  GFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGC  2236
                M +H + +K G   D  V T L++ Y KCG +  A   F + +A +L A T++I   
Sbjct  327   DVSMQVHAVSLKLGFDNDSQVATSLIDAYSKCGNIEEAATAFEICAAGDLVALTSMIAAY  386

Query  2235  VQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFT  2056
              Q G+G EAV L+ ++   GLKP     +S+L A  +   ++ G Q H  ++K GF S  
Sbjct  387   AQCGQGEEAVKLYLEVQRRGLKPDPFVCSSLLNACANLSAYEQGKQAHVHVLKFGFMSDV  446

Query  2055  FVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFE  1876
             F  N+LV+ Y+K   +D++   F E+ +  IV+W+A+I G+ + GH ++A++   +ML +
Sbjct  447   FAGNSLVNMYAKCGSIDDAICAFDEIPDRGIVSWSAMIGGFAQHGHGKEALQFFDQMLED  506

Query  1875  GLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVG--STLIDMYAKCGRLG  1702
             G+ PN  T   +L  C     ++  +  + + M+  F         + +ID+  + G+L 
Sbjct  507   GIAPNHITLLSVLCACNHAGLVDKAEH-YFKSMEELFAIRPTQEHYACMIDILGRAGKLE  565

Query  1701  DARKVFDILPCK-NLVSWNTMLIGYAQHG---FGKEALEIYSMMQ  1579
             +A  + + +P + N   W  +L     H     GK A E+  +++
Sbjct  566   EAVDLIETMPFQANGHVWGAILGAARIHKNVELGKRAAEMLFLLE  610



>ref|XP_001775099.1| predicted protein [Physcomitrella patens]
 gb|EDQ60071.1| predicted protein [Physcomitrella patens]
Length=804

 Score =   449 bits (1156),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 235/688 (34%), Positives = 378/688 (55%), Gaps = 1/688 (0%)
 Frame = -2

Query  3060  QIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKR  2881
             ++++SC   K +  GK  H  +++ G K +VY  N LL +Y     +  A++LFD+   +
Sbjct  33    KLLQSCVKAKDLAVGKQVHEHILRCGVKPNVYITNTLLKLYAHCGSVNEARQLFDKFSNK  92

Query  2880  NVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEI  2701
             +V++W  +IS Y+H GL+++A   F +++ ++   P+ +T+V  LSACS       G+EI
Sbjct  93    SVVSWNVMISGYAHRGLAQEAFNLF-TLMQQERLEPDKFTFVSILSACSSPAVLNWGREI  151

Query  2700  HGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEY  2521
             H R+  A    +  V N L++ Y KCG ++ A+ VFDAM   + V+W +L   + + G  
Sbjct  152   HVRVMEAGLANDTTVGNALISMYAKCGSVRDARRVFDAMASRDEVSWTTLTGAYAESGYG  211

Query  2520  DEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGL  2341
             +E L+ +   L+  V  +       L AC S+  L  G  IH  IV+     D  V T L
Sbjct  212   EESLKTYHAMLQERVRPSRITYMNVLSACGSLAALEKGKQIHAHIVESEYHSDVRVSTAL  271

Query  2340  VNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSE  2161
                Y+KCG    A   F   S  ++ AW  +I G V  G+  EA   F ++L  G+ P  
Sbjct  272   TKMYMKCGAFKDAREVFECLSYRDVIAWNTMIRGFVDSGQLEEAHGTFHRMLEEGVAPDR  331

Query  2160  RTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQE  1981
              TY +VL A         G ++H+   K G  S     NAL++ YSK+  + ++ ++F  
Sbjct  332   ATYTTVLSACARPGGLARGKEIHARAAKDGLVSDVRFGNALINMYSKAGSMKDARQVFDR  391

Query  1980  MTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWG  1801
             M + D+V+W  L+  Y       ++    ++ML +G++ N  TY C+L  C +  A++WG
Sbjct  392   MPKRDVVSWTTLLGRYADCDQVVESFTTFKQMLQQGVKANKITYMCVLKACSNPVALKWG  451

Query  1800  KQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQH  1621
             K++H  ++K G  +++ V + L+ MY KCG + DA +VF+ +  +++V+WNT++ G  Q+
Sbjct  452   KEIHAEVVKAGLLADLAVTNALMSMYFKCGSVEDAIRVFEGMSMRDVVTWNTLIGGLGQN  511

Query  1620  GFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNH  1441
             G G EAL+ Y +M+  G++PN  TFV VLSAC    L+EEG   F  M  +YGI P   H
Sbjct  512   GRGLEALQRYEVMKSEGMRPNAATFVNVLSACRVCNLVEEGRRQFAFMSKDYGIVPTEKH  571

Query  1440  LACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSID  1261
              ACMV++ AR G  ++A D I + P KP   +W  LL+ C I+ +  +G+ AAE  L ++
Sbjct  572   YACMVDILARAGHLREAEDVILTIPLKPSAAMWGALLAACRIHCNVEIGERAAEHCLKLE  631

Query  1260  PNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNML  1081
             P +   +V+LS IYA   MW + A++RK MK++ +KKE G SW E+  +++ F +     
Sbjct  632   PQNAGLYVSLSAIYAAAGMWRDVAKLRKFMKERGVKKEPGRSWIEIAGEVHSFVARDQSH  691

Query  1080  LGEVSMKKLLIGLTAQLLDAGYVPDTKL  997
                  +   L  L  Q+   GYVPDT+ 
Sbjct  692   PRTQEIYAELETLKKQMKSLGYVPDTRF  719


 Score =   248 bits (633),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/420 (31%), Positives = 217/420 (52%), Gaps = 0/420 (0%)
 Frame = -2

Query  2784  GFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSA  2605
             G   + Y YV  L +C        GK++H  I R     N +++N L+  Y  CG +  A
Sbjct  23    GPQVDSYDYVKLLQSCVKAKDLAVGKQVHEHILRCGVKPNVYITNTLLKLYAHCGSVNEA  82

Query  2604  QLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASV  2425
             + +FD     + V+W  ++S +   G   E   +F    +  +  ++F     L AC+S 
Sbjct  83    RQLFDKFSNKSVVSWNVMISGYAHRGLAQEAFNLFTLMQQERLEPDKFTFVSILSACSSP  142

Query  2424  ECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALI  2245
               L +G  IH  +++ G+  D  V   L++ Y KCG +  A   F+  ++ +  +WT L 
Sbjct  143   AVLNWGREIHVRVMEAGLANDTTVGNALISMYAKCGSVRDARRVFDAMASRDEVSWTTLT  202

Query  2244  GGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFN  2065
             G   + G G E++  +  +L   ++PS  TY +VL A       + G Q+H+ I++  ++
Sbjct  203   GAYAESGYGEESLKTYHAMLQERVRPSRITYMNVLSACGSLAALEKGKQIHAHIVESEYH  262

Query  2064  SFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEM  1885
             S   V  AL   Y K     ++ ++F+ ++  D++ WN +I G++ SG  E+A      M
Sbjct  263   SDVRVSTALTKMYMKCGAFKDAREVFECLSYRDVIAWNTMIRGFVDSGQLEEAHGTFHRM  322

Query  1884  LFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRL  1705
             L EG+ P+  TY+ +LS C     +  GK++H R  K G  S+V  G+ LI+MY+K G +
Sbjct  323   LEEGVAPDRATYTTVLSACARPGGLARGKEIHARAAKDGLVSDVRFGNALINMYSKAGSM  382

Query  1704  GDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSAC  1525
              DAR+VFD +P +++VSW T+L  YA      E+   +  M + GVK N IT++ VL AC
Sbjct  383   KDARQVFDRMPKRDVVSWTTLLGRYADCDQVVESFTTFKQMLQQGVKANKITYMCVLKAC  442


 Score =   234 bits (596),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 140/486 (29%), Positives = 241/486 (50%), Gaps = 9/486 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P K +   I+ +C++   +  G+  H ++++ G  +D    N L+SMY     +  A+++
Sbjct  127   PDKFTFVSILSACSSPAVLNWGREIHVRVMEAGLANDTTVGNALISMYAKCGSVRDARRV  186

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD M  R+ ++WTTL  +Y+  G  E++L ++ +M L++   P+  TY+  LSAC  L A
Sbjct  187   FDAMASRDEVSWTTLTGAYAESGYGEESLKTYHAM-LQERVRPSRITYMNVLSACGSLAA  245

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IH  I  +E   +  VS  L   Y KCG  K A+ VF+ +   + + W +++  
Sbjct  246   LEKGKQIHAHIVESEYHSDVRVSTALTKMYMKCGAFKDAREVFECLSYRDVIAWNTMIRG  305

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
                 G+ +E    F R L  GV  +       L ACA    L  G  IH    K G+  D
Sbjct  306   FVDSGQLEEAHGTFHRMLEEGVAPDRATYTTVLSACARPGGLARGKEIHARAAKDGLVSD  365

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
                   L+N Y K G +  A   F+     ++ +WT L+G      +  E+   F ++L 
Sbjct  366   VRFGNALINMYSKAGSMKDARQVFDRMPKRDVVSWTTLLGRYADCDQVVESFTTFKQMLQ  425

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              G+K ++ TY  VL A ++    + G ++H+ ++K G  +   V NAL+  Y K   +++
Sbjct  426   QGVKANKITYMCVLKACSNPVALKWGKEIHAEVVKAGLLADLAVTNALMSMYFKCGSVED  485

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             + ++F+ M+  D+VTWN LI G  ++G   +A++  + M  EG+ PN  T+  +LS C  
Sbjct  486   AIRVFEGMSMRDVVTWNTLIGGLGQNGRGLEALQRYEVMKSEGMRPNAATFVNVLSACRV  545

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGST----LIDMYAKCGRLGDARKVFDILPCK-NLV  1657
                +E G++    + K   D  +V        ++D+ A+ G L +A  V   +P K +  
Sbjct  546   CNLVEEGRRQFAFMSK---DYGIVPTEKHYACMVDILARAGHLREAEDVILTIPLKPSAA  602

Query  1656  SWNTML  1639
              W  +L
Sbjct  603   MWGALL  608


 Score =   221 bits (564),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 125/387 (32%), Positives = 200/387 (52%), Gaps = 4/387 (1%)
 Frame = -2

Query  2487  RAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLG  2308
             R G  V+ +     L +C   + L  G  +H  I++CGVK + Y+   L+  Y  CG + 
Sbjct  21    RKGPQVDSYDYVKLLQSCVKAKDLAVGKQVHEHILRCGVKPNVYITNTLLKLYAHCGSVN  80

Query  2307  LAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFT  2128
              A   F+  S   + +W  +I G   +G  +EA NLF  +    L+P + T+ S+L A +
Sbjct  81    EARQLFDKFSNKSVVSWNVMISGYAHRGLAQEAFNLFTLMQQERLEPDKFTFVSILSACS  140

Query  2127  DTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNA  1948
                    G ++H  +++ G  + T V NAL+  Y+K   + ++ ++F  M   D V+W  
Sbjct  141   SPAVLNWGREIHVRVMEAGLANDTTVGNALISMYAKCGSVRDARRVFDAMASRDEVSWTT  200

Query  1947  LIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPG  1768
             L   Y  SG+ E+++K    ML E + P+  TY  +LS CG L A+E GKQ+H  I++  
Sbjct  201   LTGAYAESGYGEESLKTYHAMLQERVRPSRITYMNVLSACGSLAALEKGKQIHAHIVESE  260

Query  1767  FDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYS  1588
             + S+V V + L  MY KCG   DAR+VF+ L  +++++WNTM+ G+   G  +EA   + 
Sbjct  261   YHSDVRVSTALTKMYMKCGAFKDAREVFECLSYRDVIAWNTMIRGFVDSGQLEEAHGTFH  320

Query  1587  MMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFAR  1411
              M E GV P+  T+  VLSAC   G L  G   H  + K+  G+         ++N++++
Sbjct  321   RMLEEGVAPDRATYTTVLSACARPGGLARGKEIHARAAKD--GLVSDVRFGNALINMYSK  378

Query  1410  KGQTKKAYDFIRSFPEKPDKVVWRCLL  1330
              G  K A       P++ D V W  LL
Sbjct  379   AGSMKDARQVFDRMPKR-DVVSWTTLL  404


 Score =   119 bits (298),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 83/291 (29%), Positives = 136/291 (47%), Gaps = 3/291 (1%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L     P + + + ++ +C     +  GK  HA+  K G  SDV   N L++MY     
Sbjct  322   MLEEGVAPDRATYTTVLSACARPGGLARGKEIHARAAKDGLVSDVRFGNALINMYSKAGS  381

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
             ++ A+++FD MPKR+V++WTTL+  Y+      ++  +F+ M L+ G   N  TY+  L 
Sbjct  382   MKDARQVFDRMPKRDVVSWTTLLGRYADCDQVVESFTTFKQM-LQQGVKANKITYMCVLK  440

Query  2742  ACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVT  2563
             ACS   A + GKEIH  + +A    +  V+N L++ Y KCG ++ A  VF+ M   + VT
Sbjct  441   ACSNPVALKWGKEIHAEVVKAGLLADLAVTNALMSMYFKCGSVEDAIRVFEGMSMRDVVT  500

Query  2562  WASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIV  2383
             W +L+    Q G   E L+ +      G+  N       L AC     +  G      + 
Sbjct  501   WNTLIGGLGQNGRGLEALQRYEVMKSEGMRPNAATFVNVLSACRVCNLVEEGRRQFAFMS  560

Query  2382  K-CGVKMDQYVVTGLVNFYVKCGQLGLAYNT-FNMASAPELHAWTALIGGC  2236
             K  G+   +     +V+   + G L  A +    +   P    W AL+  C
Sbjct  561   KDYGIVPTEKHYACMVDILARAGHLREAEDVILTIPLKPSAAMWGALLAAC  611


 Score =   105 bits (263),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 108/200 (54%), Gaps = 5/200 (3%)
 Frame = -2

Query  1929  RSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVV  1750
             + G Y  A  +LQ +  +G + + + Y  +L  C     +  GKQVH  I++ G   NV 
Sbjct  6     KDGWYAPA-DVLQYLHRKGPQVDSYDYVKLLQSCVKAKDLAVGKQVHEHILRCGVKPNVY  64

Query  1749  VGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENG  1570
             + +TL+ +YA CG + +AR++FD    K++VSWN M+ GYA  G  +EA  ++++MQ+  
Sbjct  65    ITNTLLKLYAHCGSVNEARQLFDKFSNKSVVSWNVMISGYAHRGLAQEAFNLFTLMQQER  124

Query  1569  VKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKK  1393
             ++P+  TFV +LSAC    +L  G   H   M+   G+   T     +++++A+ G  + 
Sbjct  125   LEPDKFTFVSILSACSSPAVLNWGREIHVRVMEA--GLANDTTVGNALISMYAKCGSVRD  182

Query  1392  AYDFIRSFPEKPDKVVWRCL  1333
             A     +   + D+V W  L
Sbjct  183   ARRVFDAMASR-DEVSWTTL  201



>ref|XP_009370649.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Pyrus x bretschneideri]
Length=708

 Score =   446 bits (1146),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 248/674 (37%), Positives = 380/674 (56%), Gaps = 10/674 (1%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF  2929
             +S L +   PL  +++Q  R     K +  GK+ HA LIK GS S VY  N ++++Y   
Sbjct  4     TSQLPSQYRPLFAAVTQYAR----QKDLQKGKSLHAHLIKAGSISCVYIANAVVNLYAKC  59

Query  2928  HEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKAL---GSFRSMVLEDGFTPNHYTY  2758
              ++  A  +FD +P ++V++W +LI+ YS  GL   +L     FR M  E+ F PN +T+
Sbjct  60    GDLPGAHLVFDAIPDKDVVSWNSLINGYSQQGLRASSLVVVELFRRMRAENTF-PNAHTF  118

Query  2757  VGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLE  2578
              G  +A S +     G+++H    +A    + FV + L+N Y K GL+  A+ VFD MLE
Sbjct  119   SGVFTAASNVSDVSCGRQVHALATKAASFYDVFVGSSLLNMYCKAGLVLDARKVFDRMLE  178

Query  2577  PNTVTWASLLSCHCQCGEYDEGLRIF--LRSLRAGVLVNEFLCGIALGACASVECLGFGM  2404
              N+V+WA+++S +       + L +F  +R        NEF+    L A A  E +  G 
Sbjct  179   RNSVSWATMISGYAMQRMAGDALALFGKMRRDVEKEEENEFVLTSVLSALALPEFVDTGK  238

Query  2403  GIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQG  2224
              IHCL VK G+     V   LV  Y KCG L  A  TF ++       W+A+I G  Q G
Sbjct  239   QIHCLSVKDGLIAFVSVENALVTMYAKCGSLDDALRTFKLSGDKNSITWSAMITGFAQSG  298

Query  2223  KGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCN  2044
               ++A++LF  +  +G+ PSE T+  V+ A +D    + G Q+HS+ +K+GF    ++  
Sbjct  299   DSQKALDLFSHMHFAGVIPSEFTFVGVINACSDIGALEEGRQIHSYSLKMGFEFQIYIMT  358

Query  2043  ALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEP  1864
             ALVD Y+K   + ++ K F  + E DIV W ++I GY+++G  E A+ L   M  EG+ P
Sbjct  359   ALVDMYAKCGSVSDARKGFDYLKEPDIVLWTSMIGGYVQNGENEAALSLYCRMQREGMMP  418

Query  1863  NLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVF  1684
             N  T + +L  C  L A E GKQ+H R +K GF   V +GS L  MYAKCG L D   VF
Sbjct  419   NELTMASVLKACSSLSAFEQGKQIHARTVKYGFSLEVPIGSALSTMYAKCGNLEDGNLVF  478

Query  1683  DILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglle  1504
               +  ++ V+WN M+ G +Q+G G EAL+++  M+    KP+ +TFV VLSAC H G +E
Sbjct  479   RRMSMRDAVTWNAMISGLSQNGRGIEALQLFEEMRLEDAKPDYVTFVNVLSACSHMGSVE  538

Query  1503  egLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
              G  +F  M N +GI PR  H ACMV++ +R G+  +A +FI S        +WR LLS 
Sbjct  539   RGWIYFKMMSNEFGIAPRVEHYACMVDILSRAGKLDEAKEFIESATIDHGMCLWRILLSA  598

Query  1323  CNINKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKET  1144
                 +++ LG YA E+++ +   ++SA+V LS+IY  L   ++  ++R +MK + + KE 
Sbjct  599   SRNYRNYELGAYAGEKLMELGSQESSAYVLLSSIYTSLGRREDVERVRSLMKLRGVSKEP  658

Query  1143  GCSWTELQNKIYCF  1102
             GCSW EL+++++ F
Sbjct  659   GCSWIELKSQVHVF  672


 Score =   137 bits (346),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 92/296 (31%), Positives = 153/296 (52%), Gaps = 13/296 (4%)
 Frame = -2

Query  2187  LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
             L+S L    R   + +  +   K+ Q G  LH+ +IK G  S  ++ NA+V+ Y+K   L
Sbjct  3     LTSQLPSQYRPLFAAVTQYARQKDLQKGKSLHAHLIKAGSISCVYIANAVVNLYAKCGDL  62

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQA---IKLLQEMLFEGLEPNLHTYSCIL  1837
               +  +F  + + D+V+WN+LI GY + G    +   ++L + M  E   PN HT+S + 
Sbjct  63    PGAHLVFDAIPDKDVVSWNSLINGYSQQGLRASSLVVVELFRRMRAENTFPNAHTFSGVF  122

Query  1836  SICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLV  1657
             +   ++  +  G+QVH    K     +V VGS+L++MY K G + DARKVFD +  +N V
Sbjct  123   TAASNVSDVSCGRQVHALATKAASFYDVFVGSSLLNMYCKAGLVLDARKVFDRMLERNSV  182

Query  1656  SWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFV--GVLSACGHgglleegLN-HF  1486
             SW TM+ GYA      +AL ++  M+ +  K  +  FV   VLSA      ++ G   H 
Sbjct  183   SWATMISGYAMQRMAGDALALFGKMRRDVEKEEENEFVLTSVLSALALPEFVDTGKQIHC  242

Query  1485  NSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDK--VVWRCLLSG  1324
              S+K+  G+    +    +V ++A+ G      D +R+F    DK  + W  +++G
Sbjct  243   LSVKD--GLIAFVSVENALVTMYAKCGSLD---DALRTFKLSGDKNSITWSAMITG  293



>gb|KCW74539.1| hypothetical protein EUGRSUZ_E03251 [Eucalyptus grandis]
Length=783

 Score =   447 bits (1150),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 240/691 (35%), Positives = 391/691 (57%), Gaps = 5/691 (1%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +   +++SC+    ++ GK  H  ++  G  SD +  N L+ MY    E   ++++F 
Sbjct  7     EFTFPTVLKSCSIRGDLVMGKQVHGVVVVTGYDSDEFVANGLIVMYAKCGEFGDSRRVFC  66

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              +  +NV++W  LISSY       +A   F  M+L  G  P+ ++    L+AC+ LG   
Sbjct  67    SIHVKNVVSWNGLISSYVKSDFLREAKEMFDEMILS-GIRPSEFSLSTILNACAGLGDCI  125

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G++ HG + +     + F  N LV+ Y K G L+ A   F+ +L+P+ V+W ++++   
Sbjct  126   QGRKAHGYLIKLGYESDQFSQNALVDMYAKAGDLEDAITAFEEILQPDIVSWNAIIAGCV  185

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
                   + L+++ +  R+G+  N F    AL ACAS+E       +H +++K   K D +
Sbjct  186   LHERNHQALKLYTQMNRSGIFPNLFTLSSALKACASMELNYLARQMHSIVIKHDTKADSF  245

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V  GLV+ Y KC  +  A   FN+ +  +L A  ALI G  Q G+  +AV+LF +   S 
Sbjct  246   VRAGLVDMYSKCSLMEEARMAFNLMAQKDLIALNALISGYSQNGEDVQAVSLFAETYKSE  305

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             +  ++ T + +L + T  +   V MQ+H+  +KLGF++ + V  +L+D YSK   + E+ 
Sbjct  306   IGFNQTTLSVILKSATGMQAIDVSMQVHAVSLKLGFDNDSQVATSLIDAYSKCGNIGEAA  365

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
               F+     D+V   ++IA Y + G  E+A+KL  E+   GL+P+    S +L+ C +L 
Sbjct  366   TAFEICAAGDLVALTSMIAAYAQCGQGEEAVKLYLEVQRRGLKPDPFVCSSLLNACANLS  425

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             A E GKQ H  ++K GF S+V  G++L++MYAKCG + DA   FD +P + +VSW+ M+ 
Sbjct  426   AYEQGKQAHVHVLKFGFMSDVFAGNSLVNMYAKCGSIDDAICAFDEIPDRGIVSWSAMIG  485

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             G+AQHG GKEAL  +  M E+G+ PN IT + VL AC H GL+++   +F SM+  + I 
Sbjct  486   GFAQHGHGKEALRFFDQMLEDGIAPNHITLLSVLCACNHAGLVDKAERYFKSMEELFAIR  545

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             P   H ACM+++  R G+ ++A D I + P + +  VW  +L    I+K+  LGK AAE 
Sbjct  546   PTQEHYACMIDILGRAGKLEEAVDLIETMPFQANGHVWGAILGAARIHKNVELGKRAAEM  605

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF--  1102
             +  ++P ++  HV LSNIYA   MW + A++R++MK  ++KKE G SW EL++K+Y F  
Sbjct  606   LFLLEPENSGTHVLLSNIYASAGMWGKVAEVRRLMKHSKVKKEPGTSWVELKDKVYTFIV  665

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
               + +   GE+  K  L  L+  +  AGYVP
Sbjct  666   GDTSHPRTGEIYAK--LDELSELMSRAGYVP  694


 Score =   250 bits (638),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 157/491 (32%), Positives = 255/491 (52%), Gaps = 10/491 (2%)
 Frame = -2

Query  2784  GFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSA  2605
             G   N +T+   L +CS  G    GK++HG +       + FV+N L+  Y KCG    +
Sbjct  2     GVKGNEFTFPTVLKSCSIRGDLVMGKQVHGVVVVTGYDSDEFVANGLIVMYAKCGEFGDS  61

Query  2604  QLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASV  2425
             + VF ++   N V+W  L+S + +     E   +F   + +G+  +EF     L ACA +
Sbjct  62    RRVFCSIHVKNVVSWNGLISSYVKSDFLREAKEMFDEMILSGIRPSEFSLSTILNACAGL  121

Query  2424  -ECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTAL  2248
              +C+  G   H  ++K G + DQ+    LV+ Y K G L  A   F     P++ +W A+
Sbjct  122   GDCIQ-GRKAHGYLIKLGYESDQFSQNALVDMYAKAGDLEDAITAFEEILQPDIVSWNAI  180

Query  2247  IGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGF  2068
             I GCV   +  +A+ L+ ++  SG+ P+  T +S L A    +   +  Q+HS +IK   
Sbjct  181   IAGCVLHERNHQALKLYTQMNRSGIFPNLFTLSSALKACASMELNYLARQMHSIVIKHDT  240

Query  2067  NSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQE  1888
              + +FV   LVD YSK +L++E+   F  M + D++  NALI+GY ++G   QA+ L  E
Sbjct  241   KADSFVRAGLVDMYSKCSLMEEARMAFNLMAQKDLIALNALISGYSQNGEDVQAVSLFAE  300

Query  1887  MLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGR  1708
                  +  N  T S IL     + AI+   QVH   +K GFD++  V ++LID Y+KCG 
Sbjct  301   TYKSEIGFNQTTLSVILKSATGMQAIDVSMQVHAVSLKLGFDNDSQVATSLIDAYSKCGN  360

Query  1707  LGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSA  1528
             +G+A   F+I    +LV+  +M+  YAQ G G+EA+++Y  +Q  G+KP+      +L+A
Sbjct  361   IGEAATAFEICAAGDLVALTSMIAAYAQCGQGEEAVKLYLEVQRRGLKPDPFVCSSLLNA  420

Query  1527  CGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDK  1351
             C +    E+G   H + +K  +G          +VN++A+ G      D I +F E PD+
Sbjct  421   CANLSAYEQGKQAHVHVLK--FGFMSDVFAGNSLVNMYAKCGSID---DAICAFDEIPDR  475

Query  1350  --VVWRCLLSG  1324
               V W  ++ G
Sbjct  476   GIVSWSAMIGG  486


 Score =   241 bits (614),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 145/525 (28%), Positives = 271/525 (52%), Gaps = 9/525 (2%)
 Frame = -2

Query  3135  LRPA*QSQGSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNN  2956
             LR A +     IL+  R P + SLS I+ +C      + G+ AH  LIK G +SD ++ N
Sbjct  89    LREAKEMFDEMILSGIR-PSEFSLSTILNACAGLGDCIQGRKAHGYLIKLGYESDQFSQN  147

Query  2955  HLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFT  2776
              L+ MY    ++E A   F+E+ + ++++W  +I+       + +AL  +  M    G  
Sbjct  148   ALVDMYAKAGDLEDAITAFEEILQPDIVSWNAIIAGCVLHERNHQALKLYTQMN-RSGIF  206

Query  2775  PNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLV  2596
             PN +T   AL AC+ +      +++H  + + +   ++FV   LV+ Y KC L++ A++ 
Sbjct  207   PNLFTLSSALKACASMELNYLARQMHSIVIKHDTKADSFVRAGLVDMYSKCSLMEEARMA  266

Query  2595  FDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECL  2416
             F+ M + + +   +L+S + Q GE  + + +F  + ++ +  N+    + L +   ++ +
Sbjct  267   FNLMAQKDLIALNALISGYSQNGEDVQAVSLFAETYKSEIGFNQTTLSVILKSATGMQAI  326

Query  2415  GFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGC  2236
                M +H + +K G   D  V T L++ Y KCG +G A   F + +A +L A T++I   
Sbjct  327   DVSMQVHAVSLKLGFDNDSQVATSLIDAYSKCGNIGEAATAFEICAAGDLVALTSMIAAY  386

Query  2235  VQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFT  2056
              Q G+G EAV L+ ++   GLKP     +S+L A  +   ++ G Q H  ++K GF S  
Sbjct  387   AQCGQGEEAVKLYLEVQRRGLKPDPFVCSSLLNACANLSAYEQGKQAHVHVLKFGFMSDV  446

Query  2055  FVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFE  1876
             F  N+LV+ Y+K   +D++   F E+ +  IV+W+A+I G+ + GH ++A++   +ML +
Sbjct  447   FAGNSLVNMYAKCGSIDDAICAFDEIPDRGIVSWSAMIGGFAQHGHGKEALRFFDQMLED  506

Query  1875  GLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVG--STLIDMYAKCGRLG  1702
             G+ PN  T   +L  C     ++  ++ + + M+  F         + +ID+  + G+L 
Sbjct  507   GIAPNHITLLSVLCACNHAGLVDKAER-YFKSMEELFAIRPTQEHYACMIDILGRAGKLE  565

Query  1701  DARKVFDILPCK-NLVSWNTMLIGYAQHG---FGKEALEIYSMMQ  1579
             +A  + + +P + N   W  +L     H     GK A E+  +++
Sbjct  566   EAVDLIETMPFQANGHVWGAILGAARIHKNVELGKRAAEMLFLLE  610



>ref|XP_010061133.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Eucalyptus grandis]
Length=721

 Score =   445 bits (1145),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 247/681 (36%), Positives = 374/681 (55%), Gaps = 3/681 (0%)
 Frame = -2

Query  3045  CTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITW  2866
             CT  K +  G++ HA+L++ G+ +  Y  N L++ Y     ++ A+ +FD +  R+V++W
Sbjct  18    CTQQKDLRGGQSLHARLVRTGASAVTYLANGLINFYAKCGRLDKAELVFDGVADRDVVSW  77

Query  2865  TTLISSYSHMGL--SEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGR  2692
               LI+ YS  G   S   +G    M  E+   PN +T+ G  +A S       G++ H  
Sbjct  78    NCLINGYSRKGPGGSSLVMGLLLRM-REENVLPNAHTFAGVFTAASNAVDVSGGRQAHAL  136

Query  2691  IFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEG  2512
               +     + FV + L+N Y K GL+  A+ VFD M E N+V+WA+++S +       E 
Sbjct  137   TIKTASFGDVFVGSSLLNMYCKAGLVADARKVFDRMHERNSVSWATMVSGYASLRMAAEA  196

Query  2511  LRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNF  2332
             + +FL     G   NEF+    L A  + E +  G  IHCL  K G+     V   LV  
Sbjct  197   VGLFLLMREEGEDQNEFVFTSVLSALTAPESVDCGKQIHCLAAKMGLLSFASVWNALVTM  256

Query  2331  YVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTY  2152
             Y KCG L  A   F  ++A     W+A+I G  Q G+  EA+ LF  +  SG+ PSE T 
Sbjct  257   YAKCGGLEDALQAFEFSTAKNSITWSAMITGYAQSGESHEALKLFSSMHFSGVAPSEFTL  316

Query  2151  ASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTE  1972
               V+ A +D    + G Q H + +KLGF    ++  ALVD Y+K   +D++ K F  + E
Sbjct  317   VGVINACSDIGAVKEGRQAHCYCVKLGFEEQIYIMTALVDMYAKCGCIDDARKGFDYLQE  376

Query  1971  YDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQV  1792
              D+V W ++I GY+++G  E A+ L   M  EG+  N  T + +L  C  L A+E GKQ+
Sbjct  377   PDVVLWTSMIGGYVQNGENESALYLYCRMQSEGIIANELTMASVLKACASLAALEQGKQM  436

Query  1791  HCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFG  1612
             H  I+K G    V +GS L  MYAKCG L D   VF  +P ++++SWN M+ G AQ+GFG
Sbjct  437   HAGIIKHGLGLKVPIGSALSSMYAKCGSLEDGNLVFRRMPSRDVLSWNAMISGLAQNGFG  496

Query  1611  KEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLAC  1432
               ALE++  M+  GVKP+ +TFV VLSAC H GL++ G  ++  M   +GI PR  H AC
Sbjct  497   NAALELFEEMRMEGVKPDYVTFVNVLSACSHMGLVDRGWAYYKMMSEEFGIEPRVEHYAC  556

Query  1431  MVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPND  1252
             MV+L +R G+  +A DFI S        +WR LL  C  ++++ LG YA E+++ +   +
Sbjct  557   MVDLLSRAGKLNEAKDFIESATVDHGLCLWRILLGACRNHRNYDLGVYAGEKLMELGSPE  616

Query  1251  TSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGE  1072
             +SA+V LS+IY  L   D+  ++R++MK + + KE GCSW EL++ ++ F     M    
Sbjct  617   SSAYVLLSSIYTALGKRDDVERVRRLMKAQGVCKEPGCSWIELKSGVHVFVVGDQMHPQI  676

Query  1071  VSMKKLLIGLTAQLLDAGYVP  1009
               ++  L  L+ Q+ D GY P
Sbjct  677   QEIRSELRILSKQMKDEGYQP  697


 Score =   252 bits (643),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 144/471 (31%), Positives = 255/471 (54%), Gaps = 8/471 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + + +  + +    +  G+ AHA  IK  S  DV+  + LL+MY     +  A+K+
Sbjct  109   PNAHTFAGVFTAASNAVDVSGGRQAHALTIKTASFGDVFVGSSLLNMYCKAGLVADARKV  168

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD M +RN ++W T++S Y+ + ++ +A+G F  ++ E+G   N + +   LSA +   +
Sbjct  169   FDRMHERNSVSWATMVSGYASLRMAAEAVGLFL-LMREEGEDQNEFVFTSVLSALTAPES  227

Query  2721  ARTGKEIHGRIFRAEETLNNFVS--NCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLL  2548
                GK+IH     A+  L +F S  N LV  Y KCG L+ A   F+     N++TW++++
Sbjct  228   VDCGKQIH--CLAAKMGLLSFASVWNALVTMYAKCGGLEDALQAFEFSTAKNSITWSAMI  285

Query  2547  SCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVK  2368
             + + Q GE  E L++F     +GV  +EF     + AC+ +  +  G   HC  VK G +
Sbjct  286   TGYAQSGESHEALKLFSSMHFSGVAPSEFTLVGVINACSDIGAVKEGRQAHCYCVKLGFE  345

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
                Y++T LV+ Y KCG +  A   F+    P++  WT++IGG VQ G+   A+ L+C++
Sbjct  346   EQIYIMTALVDMYAKCGCIDDARKGFDYLQEPDVVLWTSMIGGYVQNGENESALYLYCRM  405

Query  2187  LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
              S G+  +E T ASVL A       + G Q+H+ IIK G      + +AL   Y+K   L
Sbjct  406   QSEGIIANELTMASVLKACASLAALEQGKQMHAGIIKHGLGLKVPIGSALSSMYAKCGSL  465

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
             ++   +F+ M   D+++WNA+I+G  ++G    A++L +EM  EG++P+  T+  +LS C
Sbjct  466   EDGNLVFRRMPSRDVLSWNAMISGLAQNGFGNAALELFEEMRMEGVKPDYVTFVNVLSAC  525

Query  1827  GDLPAIEWGKQVHCRIMKP--GFDSNVVVGSTLIDMYAKCGRLGDARKVFD  1681
               +  ++ G   + ++M    G +  V   + ++D+ ++ G+L +A+   +
Sbjct  526   SHMGLVDRG-WAYYKMMSEEFGIEPRVEHYACMVDLLSRAGKLNEAKDFIE  575


 Score =   147 bits (372),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/289 (30%), Positives = 148/289 (51%), Gaps = 9/289 (3%)
 Frame = -2

Query  2175  LKPSERTYASVLGAF---TDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
             L PS   Y SV  A    T  K+ + G  LH+ +++ G ++ T++ N L++FY+K   LD
Sbjct  3     LLPSR--YRSVFNALVECTQQKDLRGGQSLHARLVRTGASAVTYLANGLINFYAKCGRLD  60

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAI--KLLQEMLFEGLEPNLHTYSCILSI  1831
             ++  +F  + + D+V+WN LI GY R G    ++   LL  M  E + PN HT++ + + 
Sbjct  61    KAELVFDGVADRDVVSWNCLINGYSRKGPGGSSLVMGLLLRMREENVLPNAHTFAGVFTA  120

Query  1830  CGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSW  1651
               +   +  G+Q H   +K     +V VGS+L++MY K G + DARKVFD +  +N VSW
Sbjct  121   ASNAVDVSGGRQAHALTIKTASFGDVFVGSSLLNMYCKAGLVADARKVFDRMHERNSVSW  180

Query  1650  NTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKN  1471
              TM+ GYA      EA+ ++ +M+E G   N+  F  VLSA        +     + +  
Sbjct  181   ATMVSGYASLRMAAEAVGLFLLMREEGEDQNEFVFTSVLSAL-TAPESVDCGKQIHCLAA  239

Query  1470  NYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
               G+    +    +V ++A+ G  + A      F    + + W  +++G
Sbjct  240   KMGLLSFASVWNALVTMYAKCGGLEDALQAFE-FSTAKNSITWSAMITG  287


 Score =   103 bits (256),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 134/293 (46%), Gaps = 3/293 (1%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF  2929
             SS+  +   P + +L  +I +C+   ++  G+ AH   +K G +  +Y    L+ MY   
Sbjct  302   SSMHFSGVAPSEFTLVGVINACSDIGAVKEGRQAHCYCVKLGFEEQIYIMTALVDMYAKC  361

Query  2928  HEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGA  2749
               I+ A+K FD + + +V+ WT++I  Y   G +E AL  +  M  E G   N  T    
Sbjct  362   GCIDDARKGFDYLQEPDVVLWTSMIGGYVQNGENESALYLYCRMQSE-GIIANELTMASV  420

Query  2748  LSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNT  2569
             L AC+ L A   GK++H  I +    L   + + L + Y KCG L+   LVF  M   + 
Sbjct  421   LKACASLAALEQGKQMHAGIIKHGLGLKVPIGSALSSMYAKCGSLEDGNLVFRRMPSRDV  480

Query  2568  VTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCL  2389
             ++W +++S   Q G  +  L +F      GV  +       L AC+ +  +  G   + +
Sbjct  481   LSWNAMISGLAQNGFGNAALELFEEMRMEGVKPDYVTFVNVLSACSHMGLVDRGWAYYKM  540

Query  2388  IV-KCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPE-LHAWTALIGGC  2236
             +  + G++        +V+   + G+L  A +    A+    L  W  L+G C
Sbjct  541   MSEEFGIEPRVEHYACMVDLLSRAGKLNEAKDFIESATVDHGLCLWRILLGAC  593



>ref|XP_010915655.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, 
chloroplastic [Elaeis guineensis]
Length=862

 Score =   449 bits (1156),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 249/743 (34%), Positives = 420/743 (57%), Gaps = 16/743 (2%)
 Frame = -2

Query  3183  PSQGAHPPLPPATTASLRPA*QSQGSSILTT-----ARG-PLKM-SLSQIIRSCTTNKSI  3025
             P+   HP L P     +R A + +    L+       RG P  + + S + RSC  ++ +
Sbjct  37    PATNKHPALEPLKHRVIRLADRGRLDDALSALDLMDRRGVPADLVTYSVLFRSCIRSRDL  96

Query  3024  LSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM-PKRNVITWTTLISS  2848
               G+  H +L+      D    N L+++Y    + + A  +F+EM  +RN+++WT +ISS
Sbjct  97    ARGRLLHRRLLDSTLPLDSVVTNSLITLYSKCGDWDAAFCIFEEMGSRRNLVSWTAMISS  156

Query  2847  YSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETL  2668
                 G+ E A+  F  M LE GF+PN +++   + ACS       G+ + G + +     
Sbjct  157   ADQNGMEETAIEMFCEM-LETGFSPNEFSFSSVIQACSNTKFMSVGRVVLGSVIKMGFFP  215

Query  2667  NNFVSNC-LVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRS  2491
              +    C L++ + K   L SA+ VFD ML+ N V W  +++ + Q G   E + +FL  
Sbjct  216   WDVSVGCALIDMFAKTNDLVSARKVFDRMLDRNLVAWTLMITRYGQHGRGKEAISLFLDM  275

Query  2490  LRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQL  2311
             +  G   + F     + AC  +E +  G  +H L ++ G   D YV   LV+ Y KC  +
Sbjct  276   VLDGFEPDRFTISSVISACTVLESIKLGQQLHSLAIRNGFASDTYVGCSLVDMYAKCA-I  334

Query  2310  GL----AYNTFNMASAPELHAWTALIGGCVQQG-KGREAVNLFCKLLSSGLKPSERTYAS  2146
             G+    +   F+  S   + +WTA+I GCVQ G    EA+ LF +++   ++P+  TY+S
Sbjct  335   GVLMDDSRKVFDRMSEHNVMSWTAVISGCVQSGGHDEEAIKLFYEMMQGRVRPNHFTYSS  394

Query  2145  VLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYD  1966
             +L A     + ++G Q+HS ++K G  S  FV N+LV+ Y++S  ++++ K F  + E +
Sbjct  395   ILKACASLSDPEMGEQVHSHVLKSGLASVNFVGNSLVNMYARSGRMEDAIKAFDVLYEKN  454

Query  1965  IVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHC  1786
             I+++NA++ GY+++ + E+A++LL +     +  +  T++ +LS    +  +  G+Q+H 
Sbjct  455   IISYNAIVDGYLKNSNAEEALELLHQTESMDIGVSAFTFASLLSSAASIGMMSKGQQLHA  514

Query  1785  RIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKE  1606
             +++K GF S+  +G++LI MY++CG + DA +VFD +   N++SW +M+ G+A+HG   +
Sbjct  515   QLLKAGFGSDKGIGNSLISMYSRCGDIEDACRVFDDMDDHNVISWTSMITGFAKHGLANQ  574

Query  1605  ALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMV  1426
             AL+++  M   G KPN +T++ VLSACGH GL++EG  HF +M+ ++GI PR  H ACMV
Sbjct  575   ALQLFHEMISTGAKPNGVTYIAVLSACGHAGLVKEGWEHFYTMQRDHGIIPRMEHYACMV  634

Query  1425  NLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTS  1246
             ++  R G   +A + + S P K D +VWR LL  C I+ +  LGK AA+ I+ ++P D +
Sbjct  635   DMLGRSGLLNEAVELVTSMPFKADALVWRTLLGACRIHGNIELGKLAAKNIIELEPQDPA  694

Query  1245  AHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGEVS  1066
             AHV LSN+YA    W++ A+IR  MK+++L KE G SW E++N I+ F +          
Sbjct  695   AHVLLSNLYAAAGKWEDVAKIRIDMKERKLNKEAGLSWMEMENTIHKFHAGDTSHPQAQE  754

Query  1065  MKKLLIGLTAQLLDAGYVPDTKL  997
             +   L  L A++ + GYVPDT  
Sbjct  755   IYAKLNELVAEIKEMGYVPDTNF  777



>ref|XP_007045237.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOY01069.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=716

 Score =   445 bits (1144),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 246/684 (36%), Positives = 384/684 (56%), Gaps = 4/684 (1%)
 Frame = -2

Query  3042  TTNKSILSGKAAHAQLIKYGSKSD-VYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITW  2866
             T  K++  G+A HA++I+ G  S  VY +N L++ Y    ++  A+ +F+ +  ++V++W
Sbjct  17    TKQKNLSRGRAVHARIIRSGGSSSCVYLSNSLVNFYAKCGDLSKAKCVFENIQHKDVVSW  76

Query  2865  TTLISSYSHMG--LSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGR  2692
               LI+ YS  G   S   +  F+ M  E+ + PN +T+ G  +A S L    +G++ H  
Sbjct  77    NCLINGYSQQGPTASTFVMQLFQRMRAEN-YLPNAHTFAGVFTAASNLSDVFSGQQAHSL  135

Query  2691  IFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEG  2512
               + +   + FV + L+N Y K G+L  A+ VFD M + N+V+WA+++S +       + 
Sbjct  136   AIKTDSFDDVFVGSSLLNVYCKSGVLAEARKVFDEMPKKNSVSWATMISGYAMQRSALDA  195

Query  2511  LRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNF  2332
               +F    +    VNE+     L A A  E L  G  IHC  VK G+ +   V   LV  
Sbjct  196   FELFELMRQEEEKVNEYAMSSVLSALADPEFLNTGRQIHCFTVKHGLLVFSSVGNALVTM  255

Query  2331  YVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTY  2152
             Y KCG L  A  TF ++       W+A+I G  Q G   +A+ LF  +  +G+ PSE T 
Sbjct  256   YAKCGSLDDALKTFELSGNKNSITWSAMITGYAQSGDSLKALKLFSSMHFAGIMPSEFTL  315

Query  2151  ASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTE  1972
               VL A +DT   + G Q+H +++KLG+ S  ++  ALVD Y+K      + K F  + E
Sbjct  316   VGVLNACSDTGAVEDGKQVHGYLLKLGYESQVYIMTALVDMYAKCGCTLAARKGFDYLQE  375

Query  1971  YDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQV  1792
              D+V W ++I GY+++G  E A+ L   M  EG+ PN  T + IL  C  L A+E GKQ+
Sbjct  376   PDMVLWTSMIGGYVQNGENENAMLLYGRMQIEGIVPNELTMASILKACSSLAALEQGKQI  435

Query  1791  HCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFG  1612
             H   +K GF   V +GS L  MYAKCG L D   VF  +P +++VSWN+M+ G AQ+G G
Sbjct  436   HACTIKHGFGLEVPIGSALSTMYAKCGNLEDGNLVFRRMPRRDVVSWNSMISGLAQNGHG  495

Query  1611  KEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLAC  1432
              EALE++  M   G +P+ +TFV +LSAC H GL+E G  +FN M + +GI PR  H AC
Sbjct  496   NEALELFEEMLSEGTEPDYVTFVNILSACSHIGLVERGWAYFNMMSDKFGIVPRVEHHAC  555

Query  1431  MVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPND  1252
             MV++  R G+  +A +FI S        +WR LLS C   +++ LG YA E+++ +   +
Sbjct  556   MVDMLGRAGKLDEAKEFIESATIDHGMYLWRILLSACRNFRNYELGAYAGEKLMELGSQE  615

Query  1251  TSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGE  1072
             +SA+V LS+IYA L   ++  ++R+MM+ + + KE GCSW EL+  ++ F     M    
Sbjct  616   SSAYVLLSSIYAALGRLEDVERVRRMMRLRGVNKEPGCSWIELKGGVHVFVVGDQMHPEI  675

Query  1071  VSMKKLLIGLTAQLLDAGYVPDTK  1000
              ++++ +  L+ Q+ D GY P ++
Sbjct  676   KTIREEVQMLSKQMKDEGYQPSSE  699


 Score =   244 bits (622),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 144/471 (31%), Positives = 251/471 (53%), Gaps = 8/471 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + + +  + +    + SG+ AH+  IK  S  DV+  + LL++Y     +  A+K+
Sbjct  108   PNAHTFAGVFTAASNLSDVFSGQQAHSLAIKTDSFDDVFVGSSLLNVYCKSGVLAEARKV  167

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFR--SMVLEDGFTPNHYTYVGALSACSCL  2728
             FDEMPK+N ++W T+IS Y+   +   AL +F    ++ ++    N Y     LSA +  
Sbjct  168   FDEMPKKNSVSWATMISGYA---MQRSALDAFELFELMRQEEEKVNEYAMSSVLSALADP  224

Query  2727  GAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLL  2548
                 TG++IH    +    + + V N LV  Y KCG L  A   F+     N++TW++++
Sbjct  225   EFLNTGRQIHCFTVKHGLLVFSSVGNALVTMYAKCGSLDDALKTFELSGNKNSITWSAMI  284

Query  2547  SCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVK  2368
             + + Q G+  + L++F     AG++ +EF     L AC+    +  G  +H  ++K G +
Sbjct  285   TGYAQSGDSLKALKLFSSMHFAGIMPSEFTLVGVLNACSDTGAVEDGKQVHGYLLKLGYE  344

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
                Y++T LV+ Y KCG    A   F+    P++  WT++IGG VQ G+   A+ L+ ++
Sbjct  345   SQVYIMTALVDMYAKCGCTLAARKGFDYLQEPDMVLWTSMIGGYVQNGENENAMLLYGRM  404

Query  2187  LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
                G+ P+E T AS+L A +     + G Q+H+  IK GF     + +AL   Y+K   L
Sbjct  405   QIEGIVPNELTMASILKACSSLAALEQGKQIHACTIKHGFGLEVPIGSALSTMYAKCGNL  464

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
             ++   +F+ M   D+V+WN++I+G  ++GH  +A++L +EML EG EP+  T+  ILS C
Sbjct  465   EDGNLVFRRMPRRDVVSWNSMISGLAQNGHGNEALELFEEMLSEGTEPDYVTFVNILSAC  524

Query  1827  GDLPAIEWGKQVHCRIM--KPGFDSNVVVGSTLIDMYAKCGRLGDARKVFD  1681
               +  +E G   +  +M  K G    V   + ++DM  + G+L +A++  +
Sbjct  525   SHIGLVERG-WAYFNMMSDKFGIVPRVEHHACMVDMLGRAGKLDEAKEFIE  574


 Score = 84.7 bits (208),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 94/188 (50%), Gaps = 15/188 (8%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +++++ I+++C++  ++  GK  HA  IK+G   +V   + L +MY     +E    +
Sbjct  411   PNELTMASILKACSSLAALEQGKQIHACTIKHGFGLEVPIGSALSTMYAKCGNLEDGNLV  470

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F  MP+R+V++W ++IS  +  G   +AL  F  M L +G  P++ T+V  LSACS +G 
Sbjct  471   FRRMPRRDVVSWNSMISGLAQNGHGNEALELFEEM-LSEGTEPDYVTFVNILSACSHIGL  529

Query  2721  ARTG-------KEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSA-QLVFDAMLEPNTV  2566
                G        +  G + R E         C+V+  G+ G L  A + +  A ++    
Sbjct  530   VERGWAYFNMMSDKFGIVPRVEH------HACMVDMLGRAGKLDEAKEFIESATIDHGMY  583

Query  2565  TWASLLSC  2542
              W  LLS 
Sbjct  584   LWRILLSA  591



>ref|XP_009378828.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Pyrus x bretschneideri]
Length=833

 Score =   448 bits (1153),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 263/725 (36%), Positives = 383/725 (53%), Gaps = 13/725 (2%)
 Frame = -2

Query  3180  SQGAHPPLPPATTASLRPA*QSQGSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHA  3001
             +Q A  PLP  TT    P+     S   + A G L       ++ C  N    S    H 
Sbjct  34    AQAAQLPLPNFTTHPELPS-----SEFDSHAYGVL-------LQHCIRNGDARSAMGLHC  81

Query  3000  QLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEK  2821
             +++K G   D++ +N LL+MYV    +  A  LFDEM KRNVI++ TLI  +S  G    
Sbjct  82    EILKKGGCLDLFADNILLNMYVKAGMLVDAANLFDEMSKRNVISFVTLIQGFSDYGCFVD  141

Query  2820  ALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLV  2641
             A+  F  +  E G   N + +   L      G A     +H  I +     + FV   L+
Sbjct  142   AVELFSGLHRE-GHELNQFVFTTILKLLVRTGWAELVWTVHACIHKLAHGSSAFVGTALI  200

Query  2640  NFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEF  2461
             + Y  CG +  A+ VFD ++  + V W  +++C+ + G  +E L +F R    G   N +
Sbjct  201   DAYSVCGYVNVARDVFDEVVCKDMVAWTGMVACYAENGCSEEALELFSRMRVIGFRPNNY  260

Query  2460  LCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMA  2281
                 AL AC  +E L  G  +H  ++K   + D YV T L++ Y K G +  A   F   
Sbjct  261   TFTGALKACVGLEALNGGKSVHGCVIKSCYEGDLYVGTALLDLYTKFGDIEEARQVFQEM  320

Query  2280  SAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGM  2101
                ++  W+ ++    Q  +  EA++LFC++  + + P++ TYAS L A    +    GM
Sbjct  321   PQNDVVPWSLMVSRYAQSDRCEEALDLFCRMRQAFVVPNQFTYASTLQACATMEHLDFGM  380

Query  2100  QLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSG  1921
             Q+H  I K+G +S  +V NAL+  Y+K   +D+S  +F E    + V+WN +I GY + G
Sbjct  381   QIHCHITKVGIDSDVYVSNALMGVYAKCGKIDDSMDLFVESPNRNDVSWNTMIVGYTQLG  440

Query  1920  HYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGS  1741
               E+A+ L   M+   +E    TYS  L     L A+E G Q+H   +K  +D + VVG+
Sbjct  441   DGEKALMLFSGMIRCQVEATEVTYSSALRASSGLAALESGVQIHSVTVKTVYDKDTVVGN  500

Query  1740  TLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKP  1561
             +LIDMYAKCG + DAR VFD L  ++ VSWNTM+ GY+ HG   EAL+++ MMQE   KP
Sbjct  501   SLIDMYAKCGNIKDARLVFDKLKQRDEVSWNTMISGYSMHGLALEALKVFEMMQETNCKP  560

Query  1560  NDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDF  1381
             N +TFVGVLSAC + GLL++G  +F+SM  +Y + P   H  CMV L  R G   KA   
Sbjct  561   NKLTFVGVLSACSNAGLLDQGQAYFDSMVQDYDVEPCIEHYTCMVWLLGRSGHLDKAVKL  620

Query  1380  IRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMW  1201
             I   P +P  +VWR LL  C I+ D  LG+ AA+ +L +DP D + HV LSNIYA    W
Sbjct  621   INEIPFEPSIMVWRALLGACVIHNDVELGRMAAKHVLEMDPQDEATHVLLSNIYATAKRW  680

Query  1200  DEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGEVSMKKLLIGLTAQLLDA  1021
             D  A +RK MK+K +KKE G SW E Q  ++ F+           +  +L  L  + L A
Sbjct  681   DNVAYVRKNMKRKGVKKEPGLSWIENQGTVHYFTVGDTSHPDMKLINGMLEWLKLRTLKA  740

Query  1020  GYVPD  1006
             G+VP+
Sbjct  741   GHVPN  745



>ref|XP_002306231.2| hypothetical protein POPTR_0004s19560g [Populus trichocarpa]
 gb|EEE86742.2| hypothetical protein POPTR_0004s19560g [Populus trichocarpa]
Length=732

 Score =   445 bits (1144),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 238/664 (36%), Positives = 391/664 (59%), Gaps = 20/664 (3%)
 Frame = -2

Query  2943  MYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHY  2764
             MY+    +E  ++ FDEM  RNV++WT+L++ Y+  GL+ + L  F  M++E G  PN +
Sbjct  1     MYLKNENVEEGRRAFDEMGARNVVSWTSLLTGYAQNGLNVETLKLFLRMLVE-GIKPNPF  59

Query  2763  TYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAM  2584
             T+   + A +  G    G ++H  + +    +  F SN L+N Y K G+++ A+ VFD+M
Sbjct  60    TFSAVIGALTDEGMVEAGIQVHTMVIKNGFGVATFASNSLINMYFKSGMIRDARAVFDSM  119

Query  2583  LEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGM  2404
              + N V+W S+++     G + E L +F     AGV + + +    +  C +++ LGF  
Sbjct  120   TDRNAVSWNSMVAGLVTNGLHLETLDVFYHMRLAGVKLTKMVFAPVIKLCGNIKELGFSR  179

Query  2403  GIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMAS--APELHAWTALIGGCVQ  2230
              +HC ++K G + D+ + T L+  Y KCG++  A+  F++ S     + +WTA+I G +Q
Sbjct  180   QLHCQVLKSGFEYDKNIRTTLMLAYSKCGEMDNAFKIFSVMSDEVRNVVSWTAMISGYLQ  239

Query  2229  QGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFV  2050
              G   +AVNLFC++   G+KP++ TY+++L A      F+    +H+  IK  +     V
Sbjct  240   NGMAEQAVNLFCQMSREGIKPNDFTYSTILTAQPGVSPFE----MHAQAIKRNYVKSPSV  295

Query  2049  CNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGL  1870
               AL+D Y K   +DE+ K+FQ + E DIV W+A+I GY + G  E A+++  +M  E +
Sbjct  296   GTALLDAYVKRGNVDEASKVFQRIEEKDIVAWSAMICGYAQIGDTEGAVRIFVQMAKEKI  355

Query  1869  EPNLHTYSCILSICGDLPA-IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDAR  1693
             +PN +T+S I++ C    A +E GKQ+H   +K  F++ + V S L+ MY+K G +  A 
Sbjct  356   KPNEYTFSGIINACAAPTAGVEQGKQLHAWSIKSRFNNALCVSSALLTMYSKRGDIESAF  415

Query  1692  KVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgg  1513
             +VF     ++LVSWN+++ GYAQHG+G++ALE++  MQ   ++ + +TF+GV+SAC H G
Sbjct  416   EVFKRQRERDLVSWNSIISGYAQHGYGRKALEVFEEMQRQNLEMDGVTFIGVISACTHTG  475

Query  1512  lleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCL  1333
             L  EG  +F+ M  ++ I PR  H +CMV+L+ R G   KA + I   P      VWR L
Sbjct  476   LANEGQRYFDIMVKDHHIEPRMEHYSCMVDLYGRAGMLVKAMEIINEMPFPASANVWRTL  535

Query  1332  LSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELK  1153
             L+   I+++  +GK AA++++S+ P + +++V L+N+YA +  W E A++RK+M++K++K
Sbjct  536   LAASCIHRNLEVGKLAADKLISLQPQNPASYVLLTNMYASVGNWKERAKVRKLMEEKKVK  595

Query  1152  KETGCSWTELQNKIYCFSSSYNMLLGEVS------MKKLLIGLTAQLLDAGYVPDTKLSF  991
             K  G SW E++NK Y F      L G+VS      +   L  L+ QL  AGY PDT   F
Sbjct  596   KVAGYSWIEVKNKTYTF------LAGDVSHPLSNQIYAKLEELSCQLKGAGYQPDTSYVF  649

Query  990   DYGD  979
                D
Sbjct  650   QDVD  653


 Score =   190 bits (482),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 125/492 (25%), Positives = 236/492 (48%), Gaps = 10/492 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + S +I + T    + +G   H  +IK G     + +N L++MY     I  A+ +
Sbjct  56    PNPFTFSAVIGALTDEGMVEAGIQVHTMVIKNGFGVATFASNSLINMYFKSGMIRDARAV  115

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD M  RN ++W ++++     GL  + L  F  M L  G       +   +  C  +  
Sbjct  116   FDSMTDRNAVSWNSMVAGLVTNGLHLETLDVFYHMRLA-GVKLTKMVFAPVIKLCGNIKE  174

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEP--NTVTWASLL  2548
                 +++H ++ ++    +  +   L+  Y KCG + +A  +F  M +   N V+W +++
Sbjct  175   LGFSRQLHCQVLKSGFEYDKNIRTTLMLAYSKCGEMDNAFKIFSVMSDEVRNVVSWTAMI  234

Query  2547  SCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVK  2368
             S + Q G  ++ + +F +  R G+  N+F     L A   V        +H   +K    
Sbjct  235   SGYLQNGMAEQAVNLFCQMSREGIKPNDFTYSTILTAQPGVSPF----EMHAQAIKRNYV  290

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
                 V T L++ YVK G +  A   F      ++ AW+A+I G  Q G    AV +F ++
Sbjct  291   KSPSVGTALLDAYVKRGNVDEASKVFQRIEEKDIVAWSAMICGYAQIGDTEGAVRIFVQM  350

Query  2187  LSSGLKPSERTYASVLGA-FTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNL  2011
                 +KP+E T++ ++ A    T   + G QLH++ IK  FN+   V +AL+  YSK   
Sbjct  351   AKEKIKPNEYTFSGIINACAAPTAGVEQGKQLHAWSIKSRFNNALCVSSALLTMYSKRGD  410

Query  2010  LDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSI  1831
             ++ +F++F+   E D+V+WN++I+GY + G+  +A+++ +EM  + LE +  T+  ++S 
Sbjct  411   IESAFEVFKRQRERDLVSWNSIISGYAQHGYGRKALEVFEEMQRQNLEMDGVTFIGVISA  470

Query  1830  CGDLPAIEWGKQVHCRIMKP-GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVS  1654
             C        G++    ++K    +  +   S ++D+Y + G L  A ++ + +P     +
Sbjct  471   CTHTGLANEGQRYFDIMVKDHHIEPRMEHYSCMVDLYGRAGMLVKAMEIINEMPFPASAN  530

Query  1653  -WNTMLIGYAQH  1621
              W T+L     H
Sbjct  531   VWRTLLAASCIH  542



>ref|XP_011020847.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Populus euphratica]
 ref|XP_011020848.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Populus euphratica]
 ref|XP_011020849.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Populus euphratica]
 ref|XP_011020850.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Populus euphratica]
Length=820

 Score =   447 bits (1150),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 243/684 (36%), Positives = 373/684 (55%), Gaps = 1/684 (0%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             +++SC  N    +GK  H ++IK G+  D++ NN LL+ YV +  +  A KLFDEMP RN
Sbjct  50    LLQSCIRNGDCATGKYLHCEIIKKGNCLDLFANNILLNFYVKYDSLPDAAKLFDEMPDRN  109

Query  2877  VITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
              +++ TLI  YS      +A+G F S +  +G   N + +   L        A+ G  +H
Sbjct  110   TVSFVTLIQGYSQCLRFSEAIGLF-SRLHGEGHELNPFVFSTVLKLLVSAEWAKLGFSVH  168

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
               +++     + FV   L++ Y  CG  + A+ VFDA+   + V+W  +++C+ +   ++
Sbjct  169   ACVYKLGFDSDAFVGTALIDCYSVCGYAECARQVFDAIEYKDMVSWTGMVACYVENECFE  228

Query  2517  EGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLV  2338
             E L++F R    G   N F     L AC  +E    G  +H    K     + +V   L+
Sbjct  229   ESLKLFSRMRIVGFKPNNFTFASVLKACVGLEMFNVGKAVHGCAFKTSYLEELFVGVELI  288

Query  2337  NFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSER  2158
             + Y+K G +  A   F      ++  W+ +I    Q  +  EA+ +FC++    + P++ 
Sbjct  289   DLYIKSGDVDDALQVFEEMPKDDVIPWSFMIARYAQSEQSEEAIEMFCRMRRGLVLPNQF  348

Query  2157  TYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEM  1978
             T AS+L A     + Q+G Q+H  ++K+G +   FV NAL+D Y+K   ++ S ++F E 
Sbjct  349   TLASLLQACASLVDLQLGNQIHCHVVKVGLDMNVFVSNALMDMYAKCGRMENSLQLFSES  408

Query  1977  TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGK  1798
                  V+WN +I GY+++G+ E+A+ L ++ML   ++    TYS +L  C  + A+E G 
Sbjct  409   PNCTDVSWNTVIVGYVQAGNGEKALSLFKDMLECQVQGTEVTYSSVLRACAGIAALEPGS  468

Query  1797  QVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHG  1618
             Q+H   +K  +D N VVG+ LIDMYAKCG + DAR VFD+L   + VSWN M+ GY+ HG
Sbjct  469   QIHSLSVKTIYDKNTVVGNALIDMYAKCGNIKDARLVFDMLREHDQVSWNAMISGYSVHG  528

Query  1617  FGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHL  1438
                EAL+ + +M + G KP+ +TFVG+LSAC + GLL+ G  +F SM   Y I P   H 
Sbjct  529   LYGEALKTFELMLKTGCKPDKVTFVGILSACSNAGLLDRGQAYFKSMVEEYDIEPCAEHY  588

Query  1437  ACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDP  1258
              CMV L  R G   KA   +   P +P  +VWR LLS C I+ D  LG+ +A+ +L I+P
Sbjct  589   TCMVWLLGRSGHLDKAAKLVHEIPFEPSVMVWRALLSACVIHTDVELGRISAQRVLEIEP  648

Query  1257  NDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLL  1078
              D S HV LSNIYA    W   A IR  MK+K ++KE G SW E Q +++ FS       
Sbjct  649   EDDSTHVLLSNIYANARRWGNVASIRTSMKRKGIRKEPGLSWIENQGRVHYFSVGDTSHP  708

Query  1077  GEVSMKKLLIGLTAQLLDAGYVPD  1006
                 +  +L  L  +  + GYVPD
Sbjct  709   DTKLINGMLEWLNMKARNEGYVPD  732


 Score =   261 bits (666),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 157/491 (32%), Positives = 255/491 (52%), Gaps = 10/491 (2%)
 Frame = -2

Query  2772  NHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVF  2593
             N Y Y   L +C   G   TGK +H  I +    L+ F +N L+NFY K   L  A  +F
Sbjct  43    NTYIYGSLLQSCIRNGDCATGKYLHCEIIKKGNCLDLFANNILLNFYVKYDSLPDAAKLF  102

Query  2592  DAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLG  2413
             D M + NTV++ +L+  + QC  + E + +F R    G  +N F+    L    S E   
Sbjct  103   DEMPDRNTVSFVTLIQGYSQCLRFSEAIGLFSRLHGEGHELNPFVFSTVLKLLVSAEWAK  162

Query  2412  FGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCV  2233
              G  +H  + K G   D +V T L++ Y  CG    A   F+     ++ +WT ++   V
Sbjct  163   LGFSVHACVYKLGFDSDAFVGTALIDCYSVCGYAECARQVFDAIEYKDMVSWTGMVACYV  222

Query  2232  QQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTF  2053
             +     E++ LF ++   G KP+  T+ASVL A    + F VG  +H    K  +    F
Sbjct  223   ENECFEESLKLFSRMRIVGFKPNNFTFASVLKACVGLEMFNVGKAVHGCAFKTSYLEELF  282

Query  2052  VCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEG  1873
             V   L+D Y KS  +D++ ++F+EM + D++ W+ +IA Y +S   E+AI++   M    
Sbjct  283   VGVELIDLYIKSGDVDDALQVFEEMPKDDVIPWSFMIARYAQSEQSEEAIEMFCRMRRGL  342

Query  1872  LEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDAR  1693
             + PN  T + +L  C  L  ++ G Q+HC ++K G D NV V + L+DMYAKCGR+ ++ 
Sbjct  343   VLPNQFTLASLLQACASLVDLQLGNQIHCHVVKVGLDMNVFVSNALMDMYAKCGRMENSL  402

Query  1692  KVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSAC-GHg  1516
             ++F   P    VSWNT+++GY Q G G++AL ++  M E  V+  ++T+  VL AC G  
Sbjct  403   QLFSESPNCTDVSWNTVIVGYVQAGNGEKALSLFKDMLECQVQGTEVTYSSVLRACAGIA  462

Query  1515  glleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKA---YDFIRSFPEKPDKVV  1345
              L      H  S+K  Y       +   +++++A+ G  K A   +D +R    + D+V 
Sbjct  463   ALEPGSQIHSLSVKTIYDKNTVVGN--ALIDMYAKCGNIKDARLVFDMLR----EHDQVS  516

Query  1344  WRCLLSGCNIN  1312
             W  ++SG +++
Sbjct  517   WNAMISGYSVH  527


 Score =   171 bits (432),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 129/476 (27%), Positives = 216/476 (45%), Gaps = 57/476 (12%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + + ++++C   +    GKA H    K     +++    L+ +Y+   +++ A ++
Sbjct  244   PNNFTFASVLKACVGLEMFNVGKAVHGCAFKTSYLEELFVGVELIDLYIKSGDVDDALQV  303

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSF----RSMVLEDGFTPNHYTYVGALSACS  2734
             F+EMPK +VI W+ +I+ Y+    SE+A+  F    R +VL     PN +T    L AC+
Sbjct  304   FEEMPKDDVIPWSFMIARYAQSEQSEEAIEMFCRMRRGLVL-----PNQFTLASLLQACA  358

Query  2733  CLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWAS  2554
              L   + G +IH  + +    +N FVSN L++ Y KCG ++++  +F        V+W +
Sbjct  359   SLVDLQLGNQIHCHVVKVGLDMNVFVSNALMDMYAKCGRMENSLQLFSESPNCTDVSWNT  418

Query  2553  LLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCG  2374
             ++  + Q G  ++ L +F   L   V   E      L ACA +  L  G  IH L VK  
Sbjct  419   VIVGYVQAGNGEKALSLFKDMLECQVQGTEVTYSSVLRACAGIAALEPGSQIHSLSVKTI  478

Query  2373  VKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFC  2194
                +  V   L++ Y KCG +  A   F+M    +  +W A+I G    G   EA+  F 
Sbjct  479   YDKNTVVGNALIDMYAKCGNIKDARLVFDMLREHDQVSWNAMISGYSVHGLYGEALKTFE  538

Query  2193  KLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSN  2014
              +L +G KP + T+  +L A                            C       S + 
Sbjct  539   LMLKTGCKPDKVTFVGILSA----------------------------C-------SNAG  563

Query  2013  LLDESFKIFQEMT-EYDIVT----WNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTY  1849
             LLD     F+ M  EYDI      +  ++    RSGH ++A KL+ E+ F   EP++  +
Sbjct  564   LLDRGQAYFKSMVEEYDIEPCAEHYTCMVWLLGRSGHLDKAAKLVHEIPF---EPSVMVW  620

Query  1848  SCILSICGDLPAIEWGKQVHCRIM--KPGFDSNVVVGSTLIDMYAKCGRLGDARKV  1687
               +LS C     +E G+    R++  +P  DS  V+   L ++YA   R G+   +
Sbjct  621   RALLSACVIHTDVELGRISAQRVLEIEPEDDSTHVL---LSNIYANARRWGNVASI  673



>ref|XP_010255496.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Nelumbo nucifera]
Length=842

 Score =   448 bits (1152),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 242/693 (35%), Positives = 391/693 (56%), Gaps = 9/693 (1%)
 Frame = -2

Query  3021  SGKAAHA-QLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSY  2845
             SG+   A QL       D ++ N ++S Y     +  A++LFD+ P +  ITW+ LIS +
Sbjct  82    SGRVDEARQLFDQMPCRDDFSWNTMISAYARLGRLTEARQLFDQTPTQTSITWSALISGH  141

Query  2844  SHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLN  2665
             +  G    AL  F  M   DG  PN YT    L ACS     R G++IH    +    L+
Sbjct  142   ARQGDGLGALELFCQM-RSDGLQPNQYTLGSVLRACSVSFMLRRGEQIHAHAIKTRFDLD  200

Query  2664  NFVSNCLVNFYGKCGLLKSAQLVFDAMLEP-NTVTWASLLSCHCQCGEYDEGLRIFLRSL  2488
              FV   LV+ Y KC  +  A+ +F+ M +  N V W ++++ + Q       ++ F R +
Sbjct  201   IFVVTGLVDMYAKCQQILDAEYLFNMMPDKKNHVLWTAMVTGYSQNNYELRAMQCF-RDM  259

Query  2487  RA-GVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQL  2311
             RA GV  N+F     L ACA++    FGM +H  I++ G  ++ +V + L++ Y KCG L
Sbjct  260   RAEGVRSNQFTFPSVLTACAALLERWFGMQVHGCIIRTGFGVNVFVESALLDMYAKCGDL  319

Query  2310  GLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAF  2131
               A          ++ +W +LI GCV+QG  REA++LF K+    +K  + TY SVL + 
Sbjct  320   NSARRVLESMEVEDIVSWNSLIVGCVRQGFEREAISLFKKMHMRNMKIDDFTYPSVLNSL  379

Query  2130  TDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWN  1951
                 + +    +H  I+K GF ++  V NAL+D Y+K   L+ +F +F  M E D+V+W 
Sbjct  380   ASVMDVEHAKCVHCLIVKTGFEAYKHVSNALIDVYAKQGNLNCAFSVFHRMPEQDVVSWT  439

Query  1950  ALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKP  1771
             +LI GY   G YE A+KL   M   G++P+    + ILS C +L  +E+G+QVH   ++ 
Sbjct  440   SLITGYAHHGFYENALKLFCNMRIVGIDPDQFVIASILSACAELTILEFGRQVHANFIRC  499

Query  1770  GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIY  1591
             G  S++ V ++L+ MYAKCG + DA +VFD +  +++VSW  +++G+AQ+G G+ +L++Y
Sbjct  500   GLKSSLSVDNSLVTMYAKCGCIEDAHQVFDSMLMRDVVSWTALIVGHAQNGRGEHSLKLY  559

Query  1590  SMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFAR  1411
               M  NG++P+ +TF+G+L AC H GL+E+G  +F SM + +GITP   H ACM++L  R
Sbjct  560   DQMILNGIRPDYVTFIGLLFACSHAGLVEDGCRYFESMGDVHGITPGPEHYACMIDLLGR  619

Query  1410  KGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTL  1231
              G+  KA + +     +PD  VW+ +L+ C I+ +  LG+ AA  +  ++P +   +V L
Sbjct  620   SGKIAKAKEILEKMTIRPDATVWKAMLAACRIHGNLELGERAAMNLFELEPANAVPYVLL  679

Query  1230  SNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGEVSMKKLL  1051
              N+++    WD+AA IRK+MK + + KE GCSW E+ +K++ F++          +   +
Sbjct  680   CNMFSAAGRWDDAASIRKLMKSRGICKEPGCSWMEINSKVHTFTAEDRSHSRMSEIYSKV  739

Query  1050  IGLTAQLLDAGYVPDTKLSF----DYGD*LGLS  964
               + + + +AGYVPD   +     + G  LGL+
Sbjct  740   DEIMSLIKEAGYVPDMNFALHDMDEEGKELGLT  772


 Score =   243 bits (619),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 147/516 (28%), Positives = 261/516 (51%), Gaps = 16/516 (3%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +L  ++R+C+ +  +  G+  HA  IK     D++    L+ MY    +I  A+ L
Sbjct  164   PNQYTLGSVLRACSVSFMLRRGEQIHAHAIKTRFDLDIFVVTGLVDMYAKCQQILDAEYL  223

Query  2901  FDEMP-KRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             F+ MP K+N + WT +++ YS      +A+  FR M  E G   N +T+   L+AC+ L 
Sbjct  224   FNMMPDKKNHVLWTAMVTGYSQNNYELRAMQCFRDMRAE-GVRSNQFTFPSVLTACAALL  282

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
                 G ++HG I R    +N FV + L++ Y KCG L SA+ V ++M   + V+W SL+ 
Sbjct  283   ERWFGMQVHGCIIRTGFGVNVFVESALLDMYAKCGDLNSARRVLESMEVEDIVSWNSLIV  342

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
                + G   E + +F +     + +++F     L + ASV  +     +HCLIVK G + 
Sbjct  343   GCVRQGFEREAISLFKKMHMRNMKIDDFTYPSVLNSLASVMDVEHAKCVHCLIVKTGFEA  402

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
              ++V   L++ Y K G L  A++ F+     ++ +WT+LI G    G    A+ LFC + 
Sbjct  403   YKHVSNALIDVYAKQGNLNCAFSVFHRMPEQDVVSWTSLITGYAHHGFYENALKLFCNMR  462

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
               G+ P +   AS+L A  +    + G Q+H+  I+ G  S   V N+LV  Y+K   ++
Sbjct  463   IVGIDPDQFVIASILSACAELTILEFGRQVHANFIRCGLKSSLSVDNSLVTMYAKCGCIE  522

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
             ++ ++F  M   D+V+W ALI G+ ++G  E ++KL  +M+  G+ P+  T+  +L  C 
Sbjct  523   DAHQVFDSMLMRDVVSWTALIVGHAQNGRGEHSLKLYDQMILNGIRPDYVTFIGLLFACS  582

Query  1824  DLPAIEWGKQVHCRIMKPGFDSNVVVG-----STLIDMYAKCGRLGDARKVFDILPCK-N  1663
                 +E G    CR  +   D + +       + +ID+  + G++  A+++ + +  + +
Sbjct  583   HAGLVEDG----CRYFESMGDVHGITPGPEHYACMIDLLGRSGKIAKAKEILEKMTIRPD  638

Query  1662  LVSWNTMLIGYAQHG---FG-KEALEIYSMMQENGV  1567
                W  ML     HG    G + A+ ++ +   N V
Sbjct  639   ATVWKAMLAACRIHGNLELGERAAMNLFELEPANAV  674


 Score =   129 bits (325),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 111/367 (30%), Positives = 171/367 (47%), Gaps = 58/367 (16%)
 Frame = -2

Query  2319  GQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVN-LFCKLLSSGLKPSERTYASV  2143
             G L LA  ++N  S P     +AL  G  + GKG   +N L C+ L S LK       S 
Sbjct  2     GSLSLAVGSWN--STP-----SAL--GTEKAGKG--VMNRLRCRPLCSPLK-------SC  43

Query  2142  LGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDI  1963
             L         Q    LHS      F S  FV N L+D  SKS  +DE+ ++F +M   D 
Sbjct  44    LQRIHLDSVQQTQFPLHS--TAASFPSI-FVSNRLLDDLSKSGRVDEARQLFDQMPCRDD  100

Query  1962  VTWNALIAGYIR--------------------------SGHYEQ-----AIKLLQEMLFE  1876
              +WN +I+ Y R                          SGH  Q     A++L  +M  +
Sbjct  101   FSWNTMISAYARLGRLTEARQLFDQTPTQTSITWSALISGHARQGDGLGALELFCQMRSD  160

Query  1875  GLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDA  1696
             GL+PN +T   +L  C     +  G+Q+H   +K  FD ++ V + L+DMYAKC ++ DA
Sbjct  161   GLQPNQYTLGSVLRACSVSFMLRRGEQIHAHAIKTRFDLDIFVVTGLVDMYAKCQQILDA  220

Query  1695  RKVFDILP-CKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGH  1519
               +F+++P  KN V W  M+ GY+Q+ +   A++ +  M+  GV+ N  TF  VL+AC  
Sbjct  221   EYLFNMMPDKKNHVLWTAMVTGYSQNNYELRAMQCFRDMRAEGVRSNQFTFPSVLTACAA  280

Query  1518  gglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVW  1342
                   G+  H   ++  +G+       + +++++A+ G    A   + S  E  D V W
Sbjct  281   LLERWFGMQVHGCIIRTGFGVNVFVE--SALLDMYAKCGDLNSARRVLESM-EVEDIVSW  337

Query  1341  RCLLSGC  1321
               L+ GC
Sbjct  338   NSLIVGC  344



>ref|XP_007025555.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOY28177.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=946

 Score =   450 bits (1158),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 243/697 (35%), Positives = 390/697 (56%), Gaps = 3/697 (0%)
 Frame = -2

Query  3069  SLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM  2890
             +   ++++CT  + +  G+  HA ++  G + D Y  N L+ MY    E   +++LF++M
Sbjct  172   TFPSVLKACTFTRDLELGRQIHAVVVVTGFECDEYVANSLVVMYAKCGEFGDSRRLFEDM  231

Query  2889  PKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTG  2710
             P+R+V++W  L+S Y       +A+  F  MV   G  PN ++    ++A + L  +  G
Sbjct  232   PERSVVSWNALLSCYVQSDYCGEAVELFHEMV-SSGIKPNEFSLSSMINAYTGLEDSGQG  290

Query  2709  KEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQC  2530
             ++ HG + +     + F  N LV+   K G L+ A  VF+ +  P+ V+W ++++     
Sbjct  291   RKTHGFLIKLGYDSDPFSKNALVDMCAKVGSLEDAVFVFEEIARPDIVSWNAVIAGCVLH  350

Query  2529  GEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVV  2350
               +D  L +F +  R+G   N F    AL ACA       G  +HC ++K  V  D +V 
Sbjct  351   ENHDWALELFGQMRRSGTHPNMFTLSSALKACAGTGHKKLGRQLHCNLIKINVGSDPFVD  410

Query  2349  TGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLK  2170
              GL++ Y K   +  A   FN+    +L AW A+I G  Q G+  EA++LF  +   G+ 
Sbjct  411   VGLIDMYSKTYLMNDARMVFNLMPDKDLIAWNAVISGHSQNGEDMEAISLFPLMYKEGIG  470

Query  2169  PSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKI  1990
              ++ T ++VL +    +   V  Q+H+  +K GF S  +V N+L+D Y K  LL+++ +I
Sbjct  471   FNQTTLSTVLKSIACLQANNVCKQVHALSVKSGFESDNYVVNSLIDAYGKCALLEDATRI  530

Query  1989  FQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAI  1810
             F+E    D+V + ++I  Y +SG  E+A+KL  EML  G+EP+    S +L+ C +L A 
Sbjct  531   FRECLIVDLVAFTSMITAYAQSGQGEEALKLYLEMLDRGIEPDPFVGSSLLNACANLSAY  590

Query  1809  EWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGY  1630
             E GKQVH  I+K GF S++  G++L++MYAKCG + DA +VF  +P + +VSW++M+ G 
Sbjct  591   EQGKQVHVHILKFGFMSDIFAGNSLVNMYAKCGSIDDADRVFSKIPERGIVSWSSMIGGL  650

Query  1629  AQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPR  1450
             AQHG GKEAL +++ M + GV PN IT V VL AC H GL+ E   +F SM+  +G  P 
Sbjct  651   AQHGHGKEALRVFNQMLKYGVSPNQITLVSVLCACNHAGLITEAKRYFGSMRELFGFEPM  710

Query  1449  TNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEIL  1270
               H ACM++L  R G+  +A +   + P + D  VW  LL    I+K+  LG+ AAE + 
Sbjct  711   QEHYACMIDLLGRAGRLDEAMELANTMPFQADASVWGALLGAARIHKNVELGQLAAEMLF  770

Query  1269  SIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSY  1090
             +++P  +  HV L+NIYA + MW+  A++R++MK   +KKE G SW E+++ I+ F    
Sbjct  771   TLEPEKSGTHVLLANIYASVGMWENVAKVRRLMKDCNVKKEPGISWIEVKDMIHTFIVGD  830

Query  1089  NMLLGEVSMKKLLIGLTAQLLDAGYVPDTKLSFDYGD  979
                     +   L  L+ +L  AGYVP   + FD  D
Sbjct  831   RSHARSEEIYAKLDELSERLTKAGYVP--MVEFDLHD  865


 Score =   295 bits (755),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 185/581 (32%), Positives = 298/581 (51%), Gaps = 5/581 (1%)
 Frame = -2

Query  3063  SQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPK  2884
             S+++  C   K+   G   HA  IK+GS  D  + N L+S+Y        A+KL DE P+
Sbjct  73    SKLLSKCNATKNPSPGMQIHAITIKFGSTKDPKSRNLLISLYAKCKLFRYARKLVDESPE  132

Query  2883  RNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKE  2704
              ++++W+ LIS Y+  G  ++A+ +F  M L  G   N +T+   L AC+       G++
Sbjct  133   PDLVSWSALISGYAQNGFGKEAILAFYEMHLL-GVRCNDFTFPSVLKACTFTRDLELGRQ  191

Query  2703  IHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGE  2524
             IH  +       + +V+N LV  Y KCG    ++ +F+ M E + V+W +LLSC+ Q   
Sbjct  192   IHAVVVVTGFECDEYVANSLVVMYAKCGEFGDSRRLFEDMPERSVVSWNALLSCYVQSDY  251

Query  2523  YDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTG  2344
               E + +F   + +G+  NEF     + A   +E  G G   H  ++K G   D +    
Sbjct  252   CGEAVELFHEMVSSGIKPNEFSLSSMINAYTGLEDSGQGRKTHGFLIKLGYDSDPFSKNA  311

Query  2343  LVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPS  2164
             LV+   K G L  A   F   + P++ +W A+I GCV       A+ LF ++  SG  P+
Sbjct  312   LVDMCAKVGSLEDAVFVFEEIARPDIVSWNAVIAGCVLHENHDWALELFGQMRRSGTHPN  371

Query  2163  ERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQ  1984
               T +S L A   T   ++G QLH  +IK+   S  FV   L+D YSK+ L++++  +F 
Sbjct  372   MFTLSSALKACAGTGHKKLGRQLHCNLIKINVGSDPFVDVGLIDMYSKTYLMNDARMVFN  431

Query  1983  EMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEW  1804
              M + D++ WNA+I+G+ ++G   +AI L   M  EG+  N  T S +L     L A   
Sbjct  432   LMPDKDLIAWNAVISGHSQNGEDMEAISLFPLMYKEGIGFNQTTLSTVLKSIACLQANNV  491

Query  1803  GKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQ  1624
              KQVH   +K GF+S+  V ++LID Y KC  L DA ++F      +LV++ +M+  YAQ
Sbjct  492   CKQVHALSVKSGFESDNYVVNSLIDAYGKCALLEDATRIFRECLIVDLVAFTSMITAYAQ  551

Query  1623  HGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRT  1447
              G G+EAL++Y  M + G++P+      +L+AC +    E+G   H + +K  +G     
Sbjct  552   SGQGEEALKLYLEMLDRGIEPDPFVGSSLLNACANLSAYEQGKQVHVHILK--FGFMSDI  609

Query  1446  NHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
                  +VN++A+ G    A       PE+   V W  ++ G
Sbjct  610   FAGNSLVNMYAKCGSIDDADRVFSKIPER-GIVSWSSMIGG  649


 Score =   265 bits (677),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 177/597 (30%), Positives = 290/597 (49%), Gaps = 40/597 (7%)
 Frame = -2

Query  2808  FRSMVLEDGFTPNHYTYVGAL-SACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFY  2632
             F S   E  FTP    Y   L S C+       G +IH    +   T +    N L++ Y
Sbjct  55    FLSSTQEPNFTPISVPYYSKLLSKCNATKNPSPGMQIHAITIKFGSTKDPKSRNLLISLY  114

Query  2631  GKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCG  2452
              KC L + A+ + D   EP+ V+W++L+S + Q G   E +  F      GV  N+F   
Sbjct  115   AKCKLFRYARKLVDESPEPDLVSWSALISGYAQNGFGKEAILAFYEMHLLGVRCNDFTFP  174

Query  2451  IALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAP  2272
               L AC     L  G  IH ++V  G + D+YV   LV  Y KCG+ G +   F      
Sbjct  175   SVLKACTFTRDLELGRQIHAVVVVTGFECDEYVANSLVVMYAKCGEFGDSRRLFEDMPER  234

Query  2271  ELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLH  2092
              + +W AL+   VQ     EAV LF +++SSG+KP+E + +S++ A+T  ++   G + H
Sbjct  235   SVVSWNALLSCYVQSDYCGEAVELFHEMVSSGIKPNEFSLSSMINAYTGLEDSGQGRKTH  294

Query  2091  SFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYE  1912
              F+IKLG++S  F  NALVD  +K   L+++  +F+E+   DIV+WNA+IAG +   +++
Sbjct  295   GFLIKLGYDSDPFSKNALVDMCAKVGSLEDAVFVFEEIARPDIVSWNAVIAGCVLHENHD  354

Query  1911  QAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLI  1732
              A++L  +M   G  PN+ T S  L  C      + G+Q+HC ++K    S+  V   LI
Sbjct  355   WALELFGQMRRSGTHPNMFTLSSALKACAGTGHKKLGRQLHCNLIKINVGSDPFVDVGLI  414

Query  1731  DMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDI  1552
             DMY+K   + DAR VF+++P K+L++WN ++ G++Q+G   EA+ ++ +M + G+  N  
Sbjct  415   DMYSKTYLMNDARMVFNLMPDKDLIAWNAVISGHSQNGEDMEAISLFPLMYKEGIGFNQT  474

Query  1551  TFVGVLS--ACGHgglleegLNHF-------------NSMKNNYG---------------  1462
             T   VL   AC     + + ++               NS+ + YG               
Sbjct  475   TLSTVLKSIACLQANNVCKQVHALSVKSGFESDNYVVNSLIDAYGKCALLEDATRIFREC  534

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEK---PDKVVWRCLLSGCNINKDFVLGK  1291
             +         M+  +A+ GQ ++A        ++   PD  V   LL+ C     +  GK
Sbjct  535   LIVDLVAFTSMITAYAQSGQGEEALKLYLEMLDRGIEPDPFVGSSLLNACANLSAYEQGK  594

Query  1290  YAAEEILSID-PNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTEL  1123
                  IL     +D  A  +L N+YA+    D+A ++   + ++ +      SW+ +
Sbjct  595   QVHVHILKFGFMSDIFAGNSLVNMYAKCGSIDDADRVFSKIPERGI-----VSWSSM  646


 Score =   229 bits (583),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 140/494 (28%), Positives = 254/494 (51%), Gaps = 2/494 (0%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             ++++   P + SLS +I + T  +    G+  H  LIK G  SD ++ N L+ M      
Sbjct  262   MVSSGIKPNEFSLSSMINAYTGLEDSGQGRKTHGFLIKLGYDSDPFSKNALVDMCAKVGS  321

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
             +E A  +F+E+ + ++++W  +I+        + AL  F  M    G  PN +T   AL 
Sbjct  322   LEDAVFVFEEIARPDIVSWNAVIAGCVLHENHDWALELFGQM-RRSGTHPNMFTLSSALK  380

Query  2742  ACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVT  2563
             AC+  G  + G+++H  + +     + FV   L++ Y K  L+  A++VF+ M + + + 
Sbjct  381   ACAGTGHKKLGRQLHCNLIKINVGSDPFVDVGLIDMYSKTYLMNDARMVFNLMPDKDLIA  440

Query  2562  WASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIV  2383
             W +++S H Q GE  E + +F    + G+  N+      L + A ++       +H L V
Sbjct  441   WNAVISGHSQNGEDMEAISLFPLMYKEGIGFNQTTLSTVLKSIACLQANNVCKQVHALSV  500

Query  2382  KCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVN  2203
             K G + D YVV  L++ Y KC  L  A   F      +L A+T++I    Q G+G EA+ 
Sbjct  501   KSGFESDNYVVNSLIDAYGKCALLEDATRIFRECLIVDLVAFTSMITAYAQSGQGEEALK  560

Query  2202  LFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYS  2023
             L+ ++L  G++P     +S+L A  +   ++ G Q+H  I+K GF S  F  N+LV+ Y+
Sbjct  561   LYLEMLDRGIEPDPFVGSSLLNACANLSAYEQGKQVHVHILKFGFMSDIFAGNSLVNMYA  620

Query  2022  KSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSC  1843
             K   +D++ ++F ++ E  IV+W+++I G  + GH ++A+++  +ML  G+ PN  T   
Sbjct  621   KCGSIDDADRVFSKIPERGIVSWSSMIGGLAQHGHGKEALRVFNQMLKYGVSPNQITLVS  680

Query  1842  ILSICGDLPAIEWGKQVHCRIMKP-GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK  1666
             +L  C     I   K+    + +  GF+      + +ID+  + GRL +A ++ + +P +
Sbjct  681   VLCACNHAGLITEAKRYFGSMRELFGFEPMQEHYACMIDLLGRAGRLDEAMELANTMPFQ  740

Query  1665  NLVSWNTMLIGYAQ  1624
                S    L+G A+
Sbjct  741   ADASVWGALLGAAR  754


 Score =   182 bits (461),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/413 (29%), Positives = 203/413 (49%), Gaps = 15/413 (4%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   +LS  +++C        G+  H  LIK    SD + +  L+ MY   + +  A+ +
Sbjct  370   PNMFTLSSALKACAGTGHKKLGRQLHCNLIKINVGSDPFVDVGLIDMYSKTYLMNDARMV  429

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F+ MP +++I W  +IS +S  G   +A+  F  ++ ++G   N  T    L + +CL A
Sbjct  430   FNLMPDKDLIAWNAVISGHSQNGEDMEAISLF-PLMYKEGIGFNQTTLSTVLKSIACLQA  488

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                 K++H    ++    +N+V N L++ YGKC LL+ A  +F   L  + V + S+++ 
Sbjct  489   NNVCKQVHALSVKSGFESDNYVVNSLIDAYGKCALLEDATRIFRECLIVDLVAFTSMITA  548

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q G+ +E L+++L  L  G+  + F+    L ACA++     G  +H  I+K G   D
Sbjct  549   YAQSGQGEEALKLYLEMLDRGIEPDPFVGSSLLNACANLSAYEQGKQVHVHILKFGFMSD  608

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              +    LVN Y KCG +  A   F+      + +W+++IGG  Q G G+EA+ +F ++L 
Sbjct  609   IFAGNSLVNMYAKCGSIDDADRVFSKIPERGIVSWSSMIGGLAQHGHGKEALRVFNQMLK  668

Query  2181  SGLKPSERTYASVL------GAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSK  2020
              G+ P++ T  SVL      G  T+ K +   M+        GF         ++D   +
Sbjct  669   YGVSPNQITLVSVLCACNHAGLITEAKRYFGSMRE-----LFGFEPMQEHYACMIDLLGR  723

Query  2019  SNLLDESFKIFQEMT-EYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEP  1864
             +  LDE+ ++   M  + D   W AL+ G  R     +  +L  EMLF  LEP
Sbjct  724   AGRLDEAMELANTMPFQADASVWGALL-GAARIHKNVELGQLAAEMLFT-LEP  774


 Score = 85.1 bits (209),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 98/218 (45%), Gaps = 13/218 (6%)
 Frame = -2

Query  1926  SGHYEQAIKLLQ-----EMLFEGLEPNLHT-----YSCILSICGDLPAIEWGKQVHCRIM  1777
             S H++ + KL         L    EPN        YS +LS C        G Q+H   +
Sbjct  37    SQHFQTSAKLTHGSKSNPFLSSTQEPNFTPISVPYYSKLLSKCNATKNPSPGMQIHAITI  96

Query  1776  KPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALE  1597
             K G   +    + LI +YAKC     ARK+ D  P  +LVSW+ ++ GYAQ+GFGKEA+ 
Sbjct  97    KFGSTKDPKSRNLLISLYAKCKLFRYARKLVDESPEPDLVSWSALISGYAQNGFGKEAIL  156

Query  1596  IYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLF  1417
              +  M   GV+ ND TF  VL AC       E     +++    G          +V ++
Sbjct  157   AFYEMHLLGVRCNDFTFPSVLKACT-FTRDLELGRQIHAVVVVTGFECDEYVANSLVVMY  215

Query  1416  ARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDF  1303
             A+ G+   +       PE+   V W  LLS C +  D+
Sbjct  216   AKCGEFGDSRRLFEDMPER-SVVSWNALLS-CYVQSDY  251



>ref|XP_009804600.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Nicotiana sylvestris]
Length=870

 Score =   448 bits (1152),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 256/738 (35%), Positives = 417/738 (57%), Gaps = 22/738 (3%)
 Frame = -2

Query  3069  SLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM  2890
             SLS I++ C     +  GK  HA  I+ G   +V     L+ MY+    ++  +++FDEM
Sbjct  98    SLSCILKVCACLSDLTFGKQVHALCIRSGYFDNVSVGTSLVDMYMKMENVDEGRRVFDEM  157

Query  2889  PKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTG  2710
               +NV+TWT+L+S YS   L ++AL  F  M+L  G  PN +T+   L   +   A   G
Sbjct  158   EDKNVVTWTSLLSGYSCNKLVDRALQVFH-MMLVGGVNPNAFTFATVLGVLADKCAVEKG  216

Query  2709  KEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQC  2530
              ++H  + +    +   V N L+N Y K G+++ A +VF++M   N V+W  ++      
Sbjct  217   IQVHTMVIKCGFEVITSVGNSLINMYLKSGMVREATVVFESMGNRNEVSWNGMIGGLVTN  276

Query  2529  GEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVV  2350
             G Y E +++F     AGV +   +   A+  C +++ L F   +H  + K G  +D  + 
Sbjct  277   GLYSEAVKLFHMMRLAGVELTRSIYVTAVKLCTNLKELVFARQLHGRVTKNGFYLDNNIR  336

Query  2349  TGLVNFYVKCGQLGLAYNTFNMASA-PELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
             T L+  Y KCG++  A+N F+M      + +WTA+IGG +Q  +  +A NLFC++   G+
Sbjct  337   TALMVSYTKCGEMDDAFNLFSMMHTFRNVVSWTAMIGGYMQNNRPEQAANLFCQMKKDGI  396

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             +P++ TY+++L A      FQV    H+ IIK  +     V  AL+D Y K+  + E+ K
Sbjct  397   RPNDFTYSTILAAQPSISLFQV----HAEIIKTKYEGSPTVGTALLDAYVKTGNIGEAAK  452

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG-DLP  1816
             +F+E+ E DI+ W+A+++GY + G  + A+++ +++   G+ PN  T+S +++ C   + 
Sbjct  453   VFEEIDEKDIIAWSAMLSGYAQRGDIQGAVRVFRQLSKSGVWPNEFTFSSVINACTTSMA  512

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             ++E GKQ H   +K G+ +   V S L+ MYAK G +  A +VF     ++LVSWN+M+ 
Sbjct  513   SVEQGKQFHASSIKSGYSNAFCVSSALVTMYAKRGNIESANEVFKRQKERDLVSWNSMIS  572

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             GYAQHG+G++AL+I+  M++  ++ ++ITF+GV+SAC H GLL EG  +F+ M NN  I+
Sbjct  573   GYAQHGYGRKALKIFEEMRKKNLEMDNITFIGVISACTHAGLLNEGQKYFDMMVNNLHIS  632

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             P     +CMV+L++R G   KA   I         +VWR LL+   ++++  LGK AA+ 
Sbjct  633   PTMEIYSCMVDLYSRAGMLDKAMAIINGMSFPAGAIVWRTLLAASRVHRNVELGKLAADN  692

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSS  1096
             ++S+ P D++A+V LSN+YA    W E A+IRK+M  +++KKE G SW E++NK Y F  
Sbjct  693   LISLQPQDSAAYVLLSNLYAATGNWQERAKIRKLMDVRKVKKEIGYSWIEVKNKTYSF--  750

Query  1095  SYNMLLGEV------SMKKLLIGLTAQLLDAGYVPDTKLSF-DYGD*LGLSI--RHLSRF  943
                 + G+V      S+   L  L+ +L DAGY PDT     D  D    +I  RH  R 
Sbjct  751   ----MAGDVSHPLADSIYVKLDELSVRLKDAGYKPDTNYVLHDVEDEHKEAILSRHSERL  806

Query  942   VKFDPPISTTGGSKLAVV  889
                   I+T+ G  + +V
Sbjct  807   AIAFGLIATSPGIPIQIV  824


 Score =   199 bits (506),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/400 (29%), Positives = 203/400 (51%), Gaps = 7/400 (2%)
 Frame = -2

Query  2520  DEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGL  2341
             +E L +F+   R G+L++       L  CA +  L FG  +H L ++ G   +  V T L
Sbjct  78    EEALNLFVGVHRTGLLIDGSSLSCILKVCACLSDLTFGKQVHALCIRSGYFDNVSVGTSL  137

Query  2340  VNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSE  2161
             V+ Y+K   +      F+      +  WT+L+ G         A+ +F  +L  G+ P+ 
Sbjct  138   VDMYMKMENVDEGRRVFDEMEDKNVVTWTSLLSGYSCNKLVDRALQVFHMMLVGGVNPNA  197

Query  2160  RTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQE  1981
              T+A+VLG   D    + G+Q+H+ +IK GF   T V N+L++ Y KS ++ E+  +F+ 
Sbjct  198   FTFATVLGVLADKCAVEKGIQVHTMVIKCGFEVITSVGNSLINMYLKSGMVREATVVFES  257

Query  1980  MTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWG  1801
             M   + V+WN +I G + +G Y +A+KL   M   G+E     Y   + +C +L  + + 
Sbjct  258   MGNRNEVSWNGMIGGLVTNGLYSEAVKLFHMMRLAGVELTRSIYVTAVKLCTNLKELVFA  317

Query  1800  KQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPC-KNLVSWNTMLIGYAQ  1624
             +Q+H R+ K GF  +  + + L+  Y KCG + DA  +F ++   +N+VSW  M+ GY Q
Sbjct  318   RQLHGRVTKNGFYLDNNIRTALMVSYTKCGEMDDAFNLFSMMHTFRNVVSWTAMIGGYMQ  377

Query  1623  HGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTN  1444
             +   ++A  ++  M+++G++PND T+  +L+A      +     H   +K  Y  +P   
Sbjct  378   NNRPEQAANLFCQMKKDGIRPNDFTYSTILAA---QPSISLFQVHAEIIKTKYEGSPTVG  434

Query  1443  HLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
                 +++ + + G   +A        EK D + W  +LSG
Sbjct  435   --TALLDAYVKTGNIGEAAKVFEEIDEK-DIIAWSAMLSG  471


 Score =   103 bits (257),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 66/214 (31%), Positives = 113/214 (53%), Gaps = 2/214 (1%)
 Frame = -2

Query  1953  NALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMK  1774
             N L+  Y R+   E+A+ L   +   GL  +  + SCIL +C  L  + +GKQVH   ++
Sbjct  65    NHLLFEYSRNSINEEALNLFVGVHRTGLLIDGSSLSCILKVCACLSDLTFGKQVHALCIR  124

Query  1773  PGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEI  1594
              G+  NV VG++L+DMY K   + + R+VFD +  KN+V+W ++L GY+ +     AL++
Sbjct  125   SGYFDNVSVGTSLVDMYMKMENVDEGRRVFDEMEDKNVVTWTSLLSGYSCNKLVDRALQV  184

Query  1593  YSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFA  1414
             + MM   GV PN  TF  VL        +E+G+   ++M    G    T+    ++N++ 
Sbjct  185   FHMMLVGGVNPNAFTFATVLGVLADKCAVEKGI-QVHTMVIKCGFEVITSVGNSLINMYL  243

Query  1413  RKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNIN  1312
             + G  ++A     S   + ++V W  ++ G   N
Sbjct  244   KSGMVREATVVFESMGNR-NEVSWNGMIGGLVTN  276



>ref|XP_004137966.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Cucumis sativus]
 gb|KGN58944.1| hypothetical protein Csa_3G736910 [Cucumis sativus]
Length=792

 Score =   445 bits (1145),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 239/697 (34%), Positives = 404/697 (58%), Gaps = 4/697 (1%)
 Frame = -2

Query  3090  ARGPLK-MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIEC  2914
             +  PLK ++ + +I +C++ +S+  G+  H  ++    + D+   NH+LSMY     ++ 
Sbjct  92    SSSPLKSVTYTHLINACSSLRSLEHGRKIHRHMLTCNYQPDMILQNHILSMYGKCGSLKE  151

Query  2913  AQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACS  2734
             A+ +FD MP +NV++WT++IS YS  G  + A+  +  M L  G  P+H+T+   + +CS
Sbjct  152   ARNMFDSMPLKNVVSWTSMISGYSRYGEEDNAITLYVQM-LRSGHIPDHFTFGSIVKSCS  210

Query  2733  CLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWAS  2554
              L   +  +++H  + ++E   +    N L++ Y K   +  A  VF  ++  + ++W S
Sbjct  211   GLDDFKLARQLHAHVLKSEFGADLIAQNALISMYTKFSQMADAINVFSRIIIKDLISWGS  270

Query  2553  LLSCHCQCGEYDEGLRIFLRSLRAGVL-VNEFLCGIALGACASVECLGFGMGIHCLIVKC  2377
             +++   Q G   E L  F   L   V   NEF+ G A  AC+ +     G  IH L +K 
Sbjct  271   MIAGFSQLGYELEALCHFREMLSQSVYQPNEFVFGSAFSACSKLLEPDCGRQIHGLCIKF  330

Query  2376  GVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLF  2197
             G+  D +    L + Y KCG L  A   F     P+L AW A+I G       +E+ + F
Sbjct  331   GLGSDLFAGCSLCDMYAKCGFLESARTVFYHIEKPDLVAWNAIIAGFASVSNAKESSSFF  390

Query  2196  CKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKS  2017
              ++  +GL P++ T  S+L A ++      G+Q+HS+I+K+GFN    VCN+L+  YSK 
Sbjct  391   SQMRHTGLVPNDVTVLSLLCACSEPVMLNHGIQVHSYIVKMGFNLDIPVCNSLLSMYSKC  450

Query  2016  NLLDESFKIFQEM-TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCI  1840
             + L+++ ++F+++  + DIV+WN L+   ++     + ++L + M    ++P+  T + +
Sbjct  451   SNLNDALQVFEDIGNKADIVSWNTLLTACLQQNQAGEVLRLTKLMFASRIKPDHVTLTNV  510

Query  1839  LSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNL  1660
             L   G + + E G Q+HC IMK G + ++ V + LI+MY KCG L  ARK+FD +   ++
Sbjct  511   LVSSGQIASYEVGSQIHCFIMKSGLNLDISVSNALINMYTKCGSLECARKMFDSIGNPDI  570

Query  1659  VSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNS  1480
             +SW+++++GYAQ G GKEA E++  M+  GVKPN+ITFVG+L+AC H G++EEGL  + +
Sbjct  571   ISWSSLIVGYAQAGCGKEAFELFRTMRGLGVKPNEITFVGILTACSHIGMVEEGLKLYRT  630

Query  1479  MKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFV  1300
             M+ +Y I+P   H +CMV+L AR G    A DFI+  P  PD VVW+ LL+ C ++ +  
Sbjct  631   MQEDYRISPTKEHCSCMVDLLARAGCLDVAEDFIKQMPFVPDVVVWKTLLAACKVHGNLE  690

Query  1299  LGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQ  1120
             +GK AAE +L IDP++++A V L NI+A    W + A++R  M++ ++ K  G SW E++
Sbjct  691   VGKRAAENVLKIDPSNSAAVVMLCNIHASSGHWKDFARLRSSMRRMDVGKVPGQSWIEIK  750

Query  1119  NKIYCFSSSYNMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
             +K++ F +  N+      +  +L  L  Q+LD G  P
Sbjct  751   DKVHVFLAEDNLHPERGKIYTMLEELMLQILDDGCDP  787


 Score =   238 bits (607),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 149/530 (28%), Positives = 264/530 (50%), Gaps = 9/530 (2%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L +   P   +   I++SC+        +  HA ++K    +D+   N L+SMY  F +
Sbjct  190   MLRSGHIPDHFTFGSIVKSCSGLDDFKLARQLHAHVLKSEFGADLIAQNALISMYTKFSQ  249

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
             +  A  +F  +  +++I+W ++I+ +S +G   +AL  FR M+ +  + PN + +  A S
Sbjct  250   MADAINVFSRIIIKDLISWGSMIAGFSQLGYELEALCHFREMLSQSVYQPNEFVFGSAFS  309

Query  2742  ACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVT  2563
             ACS L     G++IHG   +     + F    L + Y KCG L+SA+ VF  + +P+ V 
Sbjct  310   ACSKLLEPDCGRQIHGLCIKFGLGSDLFAGCSLCDMYAKCGFLESARTVFYHIEKPDLVA  369

Query  2562  WASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIV  2383
             W ++++         E    F +    G++ N+      L AC+    L  G+ +H  IV
Sbjct  370   WNAIIAGFASVSNAKESSSFFSQMRHTGLVPNDVTVLSLLCACSEPVMLNHGIQVHSYIV  429

Query  2382  KCGVKMDQYVVTGLVNFYVKCGQLGLAYNTF-NMASAPELHAWTALIGGCVQQGKGREAV  2206
             K G  +D  V   L++ Y KC  L  A   F ++ +  ++ +W  L+  C+QQ +  E +
Sbjct  430   KMGFNLDIPVCNSLLSMYSKCSNLNDALQVFEDIGNKADIVSWNTLLTACLQQNQAGEVL  489

Query  2205  NLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFY  2026
              L   + +S +KP   T  +VL +      ++VG Q+H FI+K G N    V NAL++ Y
Sbjct  490   RLTKLMFASRIKPDHVTLTNVLVSSGQIASYEVGSQIHCFIMKSGLNLDISVSNALINMY  549

Query  2025  SKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYS  1846
             +K   L+ + K+F  +   DI++W++LI GY ++G  ++A +L + M   G++PN  T+ 
Sbjct  550   TKCGSLECARKMFDSIGNPDIISWSSLIVGYAQAGCGKEAFELFRTMRGLGVKPNEITFV  609

Query  1845  CILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVG--STLIDMYAKCGRLGDARKVFDILP  1672
              IL+ C  +  +E G +++ R M+  +  +      S ++D+ A+ G L  A      +P
Sbjct  610   GILTACSHIGMVEEGLKLY-RTMQEDYRISPTKEHCSCMVDLLARAGCLDVAEDFIKQMP  668

Query  1671  -CKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSAC  1525
                ++V W T+L     HG     LE+     EN +K +      V+  C
Sbjct  669   FVPDVVVWKTLLAACKVHG----NLEVGKRAAENVLKIDPSNSAAVVMLC  714



>ref|XP_009343153.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Pyrus x bretschneideri]
Length=758

 Score =   444 bits (1143),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 237/687 (34%), Positives = 388/687 (56%), Gaps = 3/687 (0%)
 Frame = -2

Query  3063  SQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPK  2884
             + ++ +C++ +S+  G+  H  ++    + D+   NH+L+MY        A+K+FD MP+
Sbjct  70    TNLVYACSSLRSLEYGRRIHGHILASNYQPDIVFQNHVLNMYGKCGSFAEARKVFDAMPE  129

Query  2883  RNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKE  2704
             RNV++WT+LIS YS     +KA+  +  M L  G  P+H+T+   L ACS L     G++
Sbjct  130   RNVVSWTSLISGYSQNSQEDKAIELYFQM-LRAGCVPDHFTFGSVLKACSGLRNELLGRQ  188

Query  2703  IHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGE  2524
             +H  + ++E   +    N L + Y K GL+  A  VF  +   + ++W S+++   Q G 
Sbjct  189   LHAHVVKSETGSHPIAQNALTSMYAKFGLIADAFDVFSRVPTKDLISWGSMIAGFSQLGY  248

Query  2523  YDEGLRIFLRSLRAGVL-VNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVT  2347
               E L  F   L  G    NEF+ G A  AC  +    +G  IH + +K G+  D +   
Sbjct  249   EKEALDHFKDMLFQGAYRPNEFIFGSAFSACGGLLQPEYGKQIHGMCIKFGLGRDIFAGC  308

Query  2346  GLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKP  2167
              L + Y KCGQL  A   F     P+L +W A+I G    G   EA++ F ++   GL P
Sbjct  309   SLCDMYAKCGQLESARTVFYQIDRPDLVSWNAIISGFSNAGDSNEALSFFSQMRHKGLIP  368

Query  2166  SERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
              E +   +L A T       G Q+HS+IIK  F+    VCN+L+  Y+K + L ++F +F
Sbjct  369   DEVSVLPILTACTSPSTLYQGEQIHSYIIKRAFDFTVIVCNSLLTMYAKCSNLYDAFLVF  428

Query  1986  QEM-TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAI  1810
             +++  + D+VTWNA+I+  ++     +  +LL  M      P+  T   ++  C ++ ++
Sbjct  429   EDIRNDADLVTWNAIISACMQHNQAGEVFRLLNLMRISETTPDHITLGNLIGACANISSL  488

Query  1809  EWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGY  1630
             E G Q+HC  +K G   +V V + LIDMY KCG +G A+K+F  +   ++VSW+++++GY
Sbjct  489   EVGNQIHCFTVKSGIVLDVTVSNGLIDMYTKCGSIGSAQKLFGWMEDPDVVSWSSLIVGY  548

Query  1629  AQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPR  1450
             AQ G+G+EAL+++  M E G+KPN++T VGVL+AC H GL+EEG   + +M++ +GI P 
Sbjct  549   AQFGYGEEALDLFKRMMELGIKPNEVTLVGVLTACSHIGLVEEGWKIYKTMESEHGIVPT  608

Query  1449  TNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEIL  1270
               H +CMV+L AR G   +A  FI+    +PD +VW  LL+ C    +  +GK AAE IL
Sbjct  609   IEHCSCMVDLLARSGCLHEAEAFIKQMAFEPDVLVWMTLLAACRTRGNVEIGKRAAENIL  668

Query  1269  SIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSY  1090
              +DP+ ++A V L NI+A    WD+ A++R +M++++++K  G SW E++++ + F    
Sbjct  669   KLDPSHSAALVLLCNIHASSGNWDDVARLRNLMRERDVRKVPGQSWIEVKDRAHVFFVED  728

Query  1089  NMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
              +      +  +L  L  Q+LD GY P
Sbjct  729   CLHPERGKIYAMLEELWLQMLDDGYDP  755


 Score =   244 bits (623),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 169/600 (28%), Positives = 285/600 (48%), Gaps = 15/600 (3%)
 Frame = -2

Query  2937  VTFHEIECAQKLFDEMPKRNVITWTT-LISSYSHMGLSEKALGSFRSMVLEDGFTPNHYT  2761
             +TFH+ + +Q     +PK N   ++   I S     L  +A+ +F  +  +  F     T
Sbjct  10    LTFHKSQPSQSP-SHLPKFNNEQFSNNYIISLCKQKLYREAIEAFEFLQGQTNFPIFPST  68

Query  2760  YVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAML  2581
             Y   + ACS L +   G+ IHG I  +    +    N ++N YGKCG    A+ VFDAM 
Sbjct  69    YTNLVYACSSLRSLEYGRRIHGHILASNYQPDIVFQNHVLNMYGKCGSFAEARKVFDAMP  128

Query  2580  EPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMG  2401
             E N V+W SL+S + Q  + D+ + ++ + LRAG + + F  G  L AC+ +     G  
Sbjct  129   ERNVVSWTSLISGYSQNSQEDKAIELYFQMLRAGCVPDHFTFGSVLKACSGLRNELLGRQ  188

Query  2400  IHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGK  2221
             +H  +VK            L + Y K G +  A++ F+     +L +W ++I G  Q G 
Sbjct  189   LHAHVVKSETGSHPIAQNALTSMYAKFGLIADAFDVFSRVPTKDLISWGSMIAGFSQLGY  248

Query  2220  GREAVNLFCKLLSSG-LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCN  2044
              +EA++ F  +L  G  +P+E  + S   A     + + G Q+H   IK G     F   
Sbjct  249   EKEALDHFKDMLFQGAYRPNEFIFGSAFSACGGLLQPEYGKQIHGMCIKFGLGRDIFAGC  308

Query  2043  ALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEP  1864
             +L D Y+K   L+ +  +F ++   D+V+WNA+I+G+  +G   +A+    +M  +GL P
Sbjct  309   SLCDMYAKCGQLESARTVFYQIDRPDLVSWNAIISGFSNAGDSNEALSFFSQMRHKGLIP  368

Query  1863  NLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVF  1684
             +  +   IL+ C     +  G+Q+H  I+K  FD  V+V ++L+ MYAKC  L DA  VF
Sbjct  369   DEVSVLPILTACTSPSTLYQGEQIHSYIIKRAFDFTVIVCNSLLTMYAKCSNLYDAFLVF  428

Query  1683  -DILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHggll  1507
              DI    +LV+WN ++    QH    E   + ++M+ +   P+ IT   ++ AC +    
Sbjct  429   EDIRNDADLVTWNAIISACMQHNQAGEVFRLLNLMRISETTPDHITLGNLIGACAN-ISS  487

Query  1506  eegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLS  1327
              E  N  +      GI         +++++ + G    A      + E PD V W  L+ 
Sbjct  488   LEVGNQIHCFTVKSGIVLDVTVSNGLIDMYTKCGSIGSAQKLF-GWMEDPDVVSWSSLIV  546

Query  1326  GCNINKDFVLGKYAAEEI-----LSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQK  1162
             G      F  G+ A +       L I PN+ +  V +    + + + +E  +I K M+ +
Sbjct  547   G---YAQFGYGEEALDLFKRMMELGIKPNEVTL-VGVLTACSHIGLVEEGWKIYKTMESE  602


 Score =   233 bits (594),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 143/502 (28%), Positives = 249/502 (50%), Gaps = 8/502 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   +   ++++C+  ++ L G+  HA ++K  + S     N L SMY  F  I  A  +
Sbjct  165   PDHFTFGSVLKACSGLRNELLGRQLHAHVVKSETGSHPIAQNALTSMYAKFGLIADAFDV  224

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F  +P +++I+W ++I+ +S +G  ++AL  F+ M+ +  + PN + +  A SAC  L  
Sbjct  225   FSRVPTKDLISWGSMIAGFSQLGYEKEALDHFKDMLFQGAYRPNEFIFGSAFSACGGLLQ  284

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IHG   +     + F    L + Y KCG L+SA+ VF  +  P+ V+W +++S 
Sbjct  285   PEYGKQIHGMCIKFGLGRDIFAGCSLCDMYAKCGQLESARTVFYQIDRPDLVSWNAIISG  344

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
                 G+ +E L  F +    G++ +E      L AC S   L  G  IH  I+K      
Sbjct  345   FSNAGDSNEALSFFSQMRHKGLIPDEVSVLPILTACTSPSTLYQGEQIHSYIIKRAFDFT  404

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTF-NMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
               V   L+  Y KC  L  A+  F ++ +  +L  W A+I  C+Q  +  E   L   + 
Sbjct  405   VIVCNSLLTMYAKCSNLYDAFLVFEDIRNDADLVTWNAIISACMQHNQAGEVFRLLNLMR  464

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
              S   P   T  +++GA  +    +VG Q+H F +K G      V N L+D Y+K   + 
Sbjct  465   ISETTPDHITLGNLIGACANISSLEVGNQIHCFTVKSGIVLDVTVSNGLIDMYTKCGSIG  524

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
              + K+F  M + D+V+W++LI GY + G+ E+A+ L + M+  G++PN  T   +L+ C 
Sbjct  525   SAQKLFGWMEDPDVVSWSSLIVGYAQFGYGEEALDLFKRMMELGIKPNEVTLVGVLTACS  584

Query  1824  DLPAIEWGKQVHCRIMKP--GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-NLVS  1654
              +  +E G +++ + M+   G    +   S ++D+ A+ G L +A      +  + +++ 
Sbjct  585   HIGLVEEGWKIY-KTMESEHGIVPTIEHCSCMVDLLARSGCLHEAEAFIKQMAFEPDVLV  643

Query  1653  WNTMLIGYAQHG---FGKEALE  1597
             W T+L      G    GK A E
Sbjct  644   WMTLLAACRTRGNVEIGKRAAE  665



>ref|XP_011088875.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Sesamum indicum]
Length=873

 Score =   447 bits (1151),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 246/700 (35%), Positives = 403/700 (58%), Gaps = 25/700 (4%)
 Frame = -2

Query  3069  SLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM  2890
             +LS I++   + K  + GK  H Q +K G   DV     L+ MYV    ++  +++F+E+
Sbjct  101   TLSCILKVSASLKHDVFGKQIHCQCVKNGFFEDVSVGTSLVDMYVKNENLDDGKRVFEEI  160

Query  2889  PKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTG  2710
              ++NV+TWT+L++ Y+H G+ +  + +F  M  E G  PN +T+   + A +  G  R G
Sbjct  161   REKNVVTWTSLLTGYAHKGMIQNVVETFCLMKFE-GVQPNPFTFATVIGAFADEGEMRGG  219

Query  2709  KEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQC  2530
              ++HG + ++       V N LV+ Y K G+++ A+ VFD +   + V+W  +++     
Sbjct  220   AQVHGVVIKSGFDSTRVVGNSLVSLYSKSGMIREARDVFDGIEFRDGVSWNGIIAGLIIN  279

Query  2529  GEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVV  2350
             G   + L++F R   AGV   E      +  C S++ LGF   IH  +VK G      + 
Sbjct  280   GLELDALQMFYRMRLAGVKYTETTFSTVVKLCTSLKELGFARQIHSQVVKSGFVCFDNIR  339

Query  2349  TGLVNFYVKCGQLGLAYNTFNMAS-APELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
             T L+  Y+K  ++  A   F++   A  + +WTA+I GC+Q G+  EA+++F ++    +
Sbjct  340   TALIACYMKGSEMDDAIKMFSVVDIAQTVVSWTAVISGCLQNGRALEAIDMFLQMRRENV  399

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             +P+  TY+++L A      FQV    H+ IIK  + + + V  AL+D Y K     ++ K
Sbjct  400   RPNHYTYSTILAALPTISLFQV----HAEIIKTNYENSSSVGTALLDAYIKIGKGTDAAK  455

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDL-P  1816
             +F+++ E D+V W+A++ GY +    E A+K   ++  EG++PN  T+S IL+ C     
Sbjct  456   VFKQIEEKDVVVWSAMLVGYAQDKDTEGAVKFFGQLAKEGVKPNEFTFSSILNACATPSA  515

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             A+E GKQ H   +K G+ + ++V S L+ +YAK G +  A +VF     ++LVSWN+M+ 
Sbjct  516   AVEQGKQFHASSIKFGYSNALMVSSALVTLYAKKGDIQSANEVFKRQQERDLVSWNSMIS  575

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             GYAQHG+G++AL+++  MQE  ++ ++ITF+GV+SAC H GL+ EG  +F+ M NN  I+
Sbjct  576   GYAQHGYGEKALQVFKEMQERNLEMDEITFIGVISACNHAGLVSEGEVYFDMMVNNLHIS  635

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             P     +CMV+L++R G   KA   I   P      VWR LL+ C ++++  LGK AAE+
Sbjct  636   PTMEIYSCMVDLYSRAGMLDKAMALIDGMPFPAGATVWRTLLAACRVHRNLELGKLAAEK  695

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF--  1102
             ++S  P D+SA+V L+N+YA    W + A++RK+M ++++KKETG SW E++NK Y F  
Sbjct  696   LISCQPQDSSAYVLLANLYAASGHWRDRAKVRKLMDERKVKKETGYSWIEVKNKTYSFMA  755

Query  1101  -------SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDT  1003
                    S    M LGE+S++         L DAGY PDT
Sbjct  756   GDVSHPLSDRIYMKLGEISIR---------LRDAGYQPDT  786


 Score =   197 bits (501),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 130/431 (30%), Positives = 215/431 (50%), Gaps = 7/431 (2%)
 Frame = -2

Query  2595  FDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECL  2416
             FD  L+ +   +  LL  + + G   E ++I+      GVLV+       L   AS++  
Sbjct  56    FDKCLQRDISYYNHLLFEYSRDGLNKEAVKIYALINSVGVLVDGCTLSCILKVSASLKHD  115

Query  2415  GFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGC  2236
              FG  IHC  VK G   D  V T LV+ YVK   L      F       +  WT+L+ G 
Sbjct  116   VFGKQIHCQCVKNGFFEDVSVGTSLVDMYVKNENLDDGKRVFEEIREKNVVTWTSLLTGY  175

Query  2235  VQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFT  2056
               +G  +  V  FC +   G++P+  T+A+V+GAF D  E + G Q+H  +IK GF+S  
Sbjct  176   AHKGMIQNVVETFCLMKFEGVQPNPFTFATVIGAFADEGEMRGGAQVHGVVIKSGFDSTR  235

Query  2055  FVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFE  1876
              V N+LV  YSKS ++ E+  +F  +   D V+WN +IAG I +G    A+++   M   
Sbjct  236   VVGNSLVSLYSKSGMIREARDVFDGIEFRDGVSWNGIIAGLIINGLELDALQMFYRMRLA  295

Query  1875  GLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDA  1696
             G++    T+S ++ +C  L  + + +Q+H +++K GF     + + LI  Y K   + DA
Sbjct  296   GVKYTETTFSTVVKLCTSLKELGFARQIHSQVVKSGFVCFDNIRTALIACYMKGSEMDDA  355

Query  1695  RKVFDILP-CKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGH  1519
              K+F ++   + +VSW  ++ G  Q+G   EA++++  M+   V+PN  T+  +L+A   
Sbjct  356   IKMFSVVDIAQTVVSWTAVISGCLQNGRALEAIDMFLQMRRENVRPNHYTYSTILAALPT  415

Query  1518  gglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWR  1339
               L +    H   +K NY  +        +++ + + G+   A    +   EK D VVW 
Sbjct  416   ISLFQV---HAEIIKTNYENSSSVG--TALLDAYIKIGKGTDAAKVFKQIEEK-DVVVWS  469

Query  1338  CLLSGCNINKD  1306
              +L G   +KD
Sbjct  470   AMLVGYAQDKD  480


 Score =   175 bits (444),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 132/532 (25%), Positives = 242/532 (45%), Gaps = 21/532 (4%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + + +I +      +  G   H  +IK G  S     N L+S+Y     I  A+ +
Sbjct  198   PNPFTFATVIGAFADEGEMRGGAQVHGVVIKSGFDSTRVVGNSLVSLYSKSGMIREARDV  257

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD +  R+ ++W  +I+     GL   AL  F  M L  G      T+   +  C+ L  
Sbjct  258   FDGIEFRDGVSWNGIIAGLIINGLELDALQMFYRMRLA-GVKYTETTFSTVVKLCTSLKE  316

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAM-LEPNTVTWASLLS  2545
                 ++IH ++ ++     + +   L+  Y K   +  A  +F  + +    V+W +++S
Sbjct  317   LGFARQIHSQVVKSGFVCFDNIRTALIACYMKGSEMDDAIKMFSVVDIAQTVVSWTAVIS  376

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
                Q G   E + +FL+  R  V  N +     L A  ++        +H  I+K   + 
Sbjct  377   GCLQNGRALEAIDMFLQMRRENVRPNHYTYSTILAALPTISLF----QVHAEIIKTNYEN  432

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
                V T L++ Y+K G+   A   F      ++  W+A++ G  Q      AV  F +L 
Sbjct  433   SSSVGTALLDAYIKIGKGTDAAKVFKQIEEKDVVVWSAMLVGYAQDKDTEGAVKFFGQLA  492

Query  2184  SSGLKPSERTYASVLGA-FTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
               G+KP+E T++S+L A  T +   + G Q H+  IK G+++   V +ALV  Y+K   +
Sbjct  493   KEGVKPNEFTFSSILNACATPSAAVEQGKQFHASSIKFGYSNALMVSSALVTLYAKKGDI  552

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
               + ++F+   E D+V+WN++I+GY + G+ E+A+++ +EM    LE +  T+  ++S C
Sbjct  553   QSANEVFKRQQERDLVSWNSMISGYAQHGYGEKALQVFKEMQERNLEMDEITFIGVISAC  612

Query  1827  GDLPAIEWGKQVHCRIMKPGF--DSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-NLV  1657
                  +  G +V+  +M         + + S ++D+Y++ G L  A  + D +P      
Sbjct  613   NHAGLVSEG-EVYFDMMVNNLHISPTMEIYSCMVDLYSRAGMLDKAMALIDGMPFPAGAT  671

Query  1656  SWNTMLIGYAQHGFGKEALEIYSMMQENGV--KPND----ITFVGVLSACGH  1519
              W T+L     H      LE+  +  E  +  +P D    +    + +A GH
Sbjct  672   VWRTLLAACRVH----RNLELGKLAAEKLISCQPQDSSAYVLLANLYAASGH  719


 Score =   146 bits (368),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/259 (31%), Positives = 140/259 (54%), Gaps = 0/259 (0%)
 Frame = -2

Query  2301  YNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDT  2122
             +N F+     ++  +  L+    + G  +EAV ++  + S G+     T + +L      
Sbjct  53    HNPFDKCLQRDISYYNHLLFEYSRDGLNKEAVKIYALINSVGVLVDGCTLSCILKVSASL  112

Query  2121  KEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALI  1942
             K    G Q+H   +K GF     V  +LVD Y K+  LD+  ++F+E+ E ++VTW +L+
Sbjct  113   KHDVFGKQIHCQCVKNGFFEDVSVGTSLVDMYVKNENLDDGKRVFEEIREKNVVTWTSLL  172

Query  1941  AGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFD  1762
              GY   G  +  ++    M FEG++PN  T++ ++    D   +  G QVH  ++K GFD
Sbjct  173   TGYAHKGMIQNVVETFCLMKFEGVQPNPFTFATVIGAFADEGEMRGGAQVHGVVIKSGFD  232

Query  1761  SNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMM  1582
             S  VVG++L+ +Y+K G + +AR VFD +  ++ VSWN ++ G   +G   +AL+++  M
Sbjct  233   STRVVGNSLVSLYSKSGMIREARDVFDGIEFRDGVSWNGIIAGLIINGLELDALQMFYRM  292

Query  1581  QENGVKPNDITFVGVLSAC  1525
             +  GVK  + TF  V+  C
Sbjct  293   RLAGVKYTETTFSTVVKLC  311



>ref|XP_010693463.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010693464.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010693465.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Beta vulgaris subsp. vulgaris]
Length=705

 Score =   442 bits (1138),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 235/687 (34%), Positives = 387/687 (56%), Gaps = 5/687 (1%)
 Frame = -2

Query  3060  QIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKR  2881
             +++R  T  +++  GKA HA++IK  S S+VY  N ++++Y    ++  A++ F+E+P +
Sbjct  11    EVVR-LTQEQNLQKGKALHAKIIKSNSFSNVYLANSIVNLYAKCGQLTKAKRAFEEIPVK  69

Query  2880  NVITWTTLISSYSHMGLSEKAL---GSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTG  2710
             + ++W+++I++++  G ++ +L     FR M  E  F P+ ++  G  +A S LG  R G
Sbjct  70    DDVSWSSIINAHAQQGGTKSSLLVMDLFRQMRAEK-FLPSAHSLAGIFTAVSNLGDGRVG  128

Query  2709  KEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQC  2530
             K++H    + +   +  V + ++N Y K G++  A+ + D M E N+V+WA+++S +   
Sbjct  129   KQVHSLAIKTDHCGDVVVGSSILNMYCKSGIIHDARQMLDKMPERNSVSWATMISGYATR  188

Query  2529  GEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVV  2350
             G   E + +F   L+     N F     L A    E +  G  +HC+ VK GV     V 
Sbjct  189   GMAGEAVGVFKLILQDEEESNPFFFTSVLSALTLPELINAGSEVHCVAVKTGVIQIAEVR  248

Query  2349  TGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLK  2170
               LV  Y+KCG    A   F +++      W+A++ G  Q G  ++A+ LF ++  SG+ 
Sbjct  249   NALVTMYLKCGSPDNALQMFALSTIKNSIMWSAMVTGFAQSGDSKKALELFSRMHHSGVS  308

Query  2169  PSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKI  1990
             PSE T+  V+ A +D    Q G Q+HS+ +K+GF +  ++  ALVD Y+KS  + ++ K 
Sbjct  309   PSEYTFVGVINACSDIGATQEGRQVHSYSVKMGFENQMYIVTALVDMYAKSGSIADARKG  368

Query  1989  FQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAI  1810
             F  + E D+V W ++I GYI+ G  E+A+ L   M  EG+ PN  T + +L  C  L A+
Sbjct  369   FDCLLEPDVVLWTSMIGGYIQHGDNEEALSLYGRMEAEGIPPNDLTIASVLKGCSSLAAL  428

Query  1809  EWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGY  1630
             E GKQ+H R +K G    + +GS+L  MYAKCG + +   VF  +  +++VSWN M+ G 
Sbjct  429   EQGKQIHARAIKYGIAGEITIGSSLSSMYAKCGCIDEGNMVFRRMTTRDIVSWNAMISGL  488

Query  1629  AQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPR  1450
             AQ+G   EALE++  M+  GVKP+++TFV VLSAC H GL+E    +F  +   + + P 
Sbjct  489   AQNGCSDEALELFEEMRSEGVKPDNVTFVNVLSACSHIGLVERAWEYFKMISTEFELVPG  548

Query  1449  TNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEIL  1270
               H  CMV+ ++R G+  +A +FI S        +WR LLS C  ++ + LG YA E+++
Sbjct  549   LEHYTCMVDAYSRAGRLIEAKEFIESATLDHGMCLWRILLSACRNHRHYELGAYAGEKLM  608

Query  1269  SIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSY  1090
              +   ++SA+V LS IY  L   D+  +I ++MK + + KE GCSW EL+N ++ F    
Sbjct  609   ELGSQESSAYVLLSRIYTALGRSDDVGRIMRLMKLRRVGKEPGCSWIELKNLVHVFVVGD  668

Query  1089  NMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
                     +   L  LT Q++D GY P
Sbjct  669   QKHPEIADISSWLRILTKQMMDEGYQP  695


 Score =   103 bits (256),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 102/219 (47%), Gaps = 1/219 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +   +I +C+   +   G+  H+  +K G ++ +Y    L+ MY     I  A+K 
Sbjct  309   PSEYTFVGVINACSDIGATQEGRQVHSYSVKMGFENQMYIVTALVDMYAKSGSIADARKG  368

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD + + +V+ WT++I  Y   G +E+AL  +  M  E G  PN  T    L  CS L A
Sbjct  369   FDCLLEPDVVLWTSMIGGYIQHGDNEEALSLYGRMEAE-GIPPNDLTIASVLKGCSSLAA  427

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IH R  +        + + L + Y KCG +    +VF  M   + V+W +++S 
Sbjct  428   LEQGKQIHARAIKYGIAGEITIGSSLSSMYAKCGCIDEGNMVFRRMTTRDIVSWNAMISG  487

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASV  2425
               Q G  DE L +F      GV  +       L AC+ +
Sbjct  488   LAQNGCSDEALELFEEMRSEGVKPDNVTFVNVLSACSHI  526


 Score = 85.9 bits (211),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/196 (29%), Positives = 97/196 (49%), Gaps = 12/196 (6%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P  ++++ +++ C++  ++  GK  HA+ IKYG   ++   + L SMY     I+    +
Sbjct  410   PNDLTIASVLKGCSSLAALEQGKQIHARAIKYGIAGEITIGSSLSSMYAKCGCIDEGNMV  469

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F  M  R++++W  +IS  +  G S++AL  F  M  E G  P++ T+V  LSACS +G 
Sbjct  470   FRRMTTRDIVSWNAMISGLAQNGCSDEALELFEEMRSE-GVKPDNVTFVNVLSACSHIGL  528

Query  2721  ARTGKEIHGRI---FRAEETLNNFVSNCLVNFYGKCG-LLKSAQLVFDAMLEPNTVTWAS  2554
                  E    I   F     L ++   C+V+ Y + G L+++ + +  A L+     W  
Sbjct  529   VERAWEYFKMISTEFELVPGLEHY--TCMVDAYSRAGRLIEAKEFIESATLDHGMCLWRI  586

Query  2553  LLSC-----HCQCGEY  2521
             LLS      H + G Y
Sbjct  587   LLSACRNHRHYELGAY  602



>ref|XP_007051907.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOX96064.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=809

 Score =   446 bits (1146),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 242/708 (34%), Positives = 396/708 (56%), Gaps = 10/708 (1%)
 Frame = -2

Query  3093  TARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIEC  2914
             T    LK+  ++++   + +  I   +    +L     + D +T N +++ Y    ++  
Sbjct  30    TNSSQLKLDSNRVLNELSKSGRINEAR----KLFDEMPERDEFTWNTMIAAYANSGKLTE  85

Query  2913  AQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACS  2734
             A +LF E+P ++ ITW +LIS Y   G+  +A   F  M  E G  PN YT    L  CS
Sbjct  86    AIELFKEIPMKSSITWNSLISGYCRGGMEIEAFDLFWGMQFE-GQRPNQYTMGSILRLCS  144

Query  2733  CLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEP-NTVTWA  2557
              LG  + GK++HG + + +   N++V   LV+ Y KC  +  A+ +F  M +  N V W 
Sbjct  145   TLGLLQRGKQVHGYVIKTQFESNDYVVTGLVDMYAKCNCILEAECLFKMMPDKRNHVMWT  204

Query  2556  SLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKC  2377
             ++++ + Q GE  + +  F   L  GV  N+F     L ACA+V+    G  +H  I + 
Sbjct  205   AIVAGYSQNGEAFKAIECFRDMLVEGVESNQFTFPSVLIACAAVKAGNVGAQVHGCIFRS  264

Query  2376  GVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLF  2197
             G + + YV + LV+ Y KC  L  A          ++ +W ++I GCV+QG   EA++LF
Sbjct  265   GFETNVYVQSALVDMYAKCRDLDNAMRVLENMEVDDVVSWNSMIVGCVRQGFEEEALSLF  324

Query  2196  CKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKS  2017
              K+ +  +K    TY SVL  F    + +  M +H  I+K GF +   V NALVD Y+K 
Sbjct  325   RKMHARDMKMDSFTYPSVLNCFASMMDSKHAMSVHCLIVKAGFEACKLVNNALVDMYAKQ  384

Query  2016  NLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCIL  1837
               LD +F++F  M   D+++W +L+ GY  +G +E+A+KL  +M   G+ P+    + IL
Sbjct  385   GNLDCAFQVFNHMPNKDVISWTSLVTGYAHNGRHEEALKLFCDMRTAGIYPDHIILASIL  444

Query  1836  SICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLV  1657
             S C +L  +E+G+QVH   +K G  S++ V ++L+ MYAKCG +  A +VFD +  ++++
Sbjct  445   SACAELTVLEFGQQVHANFVKSGLQSSLSVDNSLVTMYAKCGCIEYASRVFDSMQIQDVI  504

Query  1656  SWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSM  1477
             +W  +++GYAQ+G GK+++  Y  M  +G KP+ ITF+G+L AC H GLLE G ++F SM
Sbjct  505   TWTALIVGYAQNGKGKDSVRFYDQMIASGTKPDFITFIGLLFACSHAGLLESGRSYFASM  564

Query  1476  KNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVL  1297
             K  YGI P   H ACM++L  R G+  +A   +     +PD  VW+ LL+ C ++ +  L
Sbjct  565   KKVYGIKPGPEHYACMIDLLGRSGKLVEAETLLNQMDVEPDATVWKALLAACRVHGNLEL  624

Query  1296  GKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQN  1117
             G+ AA+ +  ++P +   ++ LSN+Y+    W+EAA+IR+ MK + + KE GCSW E+ +
Sbjct  625   GERAAKNLFELEPWNAVPYIMLSNMYSASGKWEEAARIRRTMKSRGINKEPGCSWIEVNS  684

Query  1116  KIYCFSSSY--NMLLGEVSMKKLLIGLTAQLLDAGYVPDTKLSFDYGD  979
             +++ F S    +   GE+  K  +  +  Q+ +AGYVPD   +    D
Sbjct  685   RVHRFMSEDRGHPRTGEIYSK--IDEMMLQIKEAGYVPDISFALHNTD  730



>ref|XP_008239469.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial [Prunus mume]
Length=759

 Score =   444 bits (1142),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 235/689 (34%), Positives = 393/689 (57%), Gaps = 3/689 (0%)
 Frame = -2

Query  3069  SLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM  2890
             + + ++ +C+  +S+  G+  H  ++    + D+   NH+L+MY     ++ A K+FD M
Sbjct  69    TYADLVSACSFLRSLDHGRKIHDHILASKCEPDIILYNHVLNMYGKCGSVKDAGKVFDAM  128

Query  2889  PKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTG  2710
             P+RNV++WT+LIS +S     +KA+  +  M L  G  P+H+T+   + ACS +G A  G
Sbjct  129   PERNVVSWTSLISGHSQNKQEDKAIELYFEM-LRSGCRPDHFTFGSIIKACSGMGNAWLG  187

Query  2709  KEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQC  2530
             +++H  + ++E   +    N L + Y K GL+  A  VF  +   + ++W S+++   Q 
Sbjct  188   RQVHAHVLKSETGSHPIAQNALTSMYTKFGLIADAFDVFSHVQRKDLISWGSMIAGFSQL  247

Query  2529  GEYDEGLRIFLRSLRAGVL-VNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
             G   E L  F   L  G    NEF+ G A  AC+S+    +G  +H + +K G+  D + 
Sbjct  248   GYDKESLGHFKEMLCEGAYQPNEFIFGSAFSACSSLLQPEYGKQMHGMCIKFGLGRDIFA  307

Query  2352  VTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
                L + Y K G L  A   F     P+L +W A+I G    G   EA++ F ++   GL
Sbjct  308   GCSLCDMYAKYGYLESARTVFYQIERPDLVSWNAIISGFSNGGDANEAISFFSQMRHKGL  367

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
              P E +  S+L A T       G Q+HS+IIK  F+    VCNAL+  Y+K + L ++F 
Sbjct  368   VPDEISVLSILSACTSPSTLYQGRQVHSYIIKRAFDGIVIVCNALLTMYAKCSNLYDAFI  427

Query  1992  IFQEMTEY-DIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
             +F+++  + D V+WNA+I   ++     +  +LL+ M    ++P+  T   ++  C ++ 
Sbjct  428   VFEDIRNHTDSVSWNAIITACMQHNQAGEVFRLLKLMRSSEIKPDYITLKNVIGACANIA  487

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             ++E G Q+HC  +K G   +V + + LIDMY KCG LG A+ +F  +   ++VSW+++++
Sbjct  488   SLEVGNQIHCFTVKSGLVLDVTITNGLIDMYTKCGSLGSAQNLFGFMENPDVVSWSSLIV  547

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             GYAQ G+G+EALE++  M+  G+KPN++T VGVL+AC H GL+EEG   + +M++ +GI 
Sbjct  548   GYAQFGYGEEALELFKTMKGLGIKPNEVTMVGVLTACSHIGLVEEGRQLYKTMESEHGIV  607

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             P   H +CMV+L AR G   +A  FI     +PD +VW+ LL+ C    +  +GK AAE 
Sbjct  608   PTREHCSCMVDLLARAGCLHEAEAFIEQMEFEPDILVWKTLLAACKTRGNVEIGKRAAEN  667

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSS  1096
             IL +DP++++A V L NI+A    W E A++R +M++++++K  G SW E++++ + F  
Sbjct  668   ILKVDPSNSAALVLLCNIHASSGSWVEVARLRNLMRERDVRKVPGQSWIEVKDRTHVFFV  727

Query  1095  SYNMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
               N+      +  +L  L  Q+LD GY P
Sbjct  728   EDNLHPERGKIYAMLEELWLQMLDDGYDP  756


 Score =   251 bits (642),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 171/585 (29%), Positives = 280/585 (48%), Gaps = 14/585 (2%)
 Frame = -2

Query  2892  MPK-RNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
             +PK +N       ISS     L ++AL +F  +     F     TY   +SACS L +  
Sbjct  25    LPKFKNQQCSNDYISSLCRQKLYKEALQAFEFLEGNTNFQIFPSTYADLVSACSFLRSLD  84

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G++IH  I  ++   +  + N ++N YGKCG +K A  VFDAM E N V+W SL+S H 
Sbjct  85    HGRKIHDHILASKCEPDIILYNHVLNMYGKCGSVKDAGKVFDAMPERNVVSWTSLISGHS  144

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
             Q  + D+ + ++   LR+G   + F  G  + AC+ +     G  +H  ++K        
Sbjct  145   QNKQEDKAIELYFEMLRSGCRPDHFTFGSIIKACSGMGNAWLGRQVHAHVLKSETGSHPI  204

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
                 L + Y K G +  A++ F+     +L +W ++I G  Q G  +E++  F ++L  G
Sbjct  205   AQNALTSMYTKFGLIADAFDVFSHVQRKDLISWGSMIAGFSQLGYDKESLGHFKEMLCEG  264

Query  2175  -LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDES  1999
               +P+E  + S   A +   + + G Q+H   IK G     F   +L D Y+K   L+ +
Sbjct  265   AYQPNEFIFGSAFSACSSLLQPEYGKQMHGMCIKFGLGRDIFAGCSLCDMYAKYGYLESA  324

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDL  1819
               +F ++   D+V+WNA+I+G+   G   +AI    +M  +GL P+  +   ILS C   
Sbjct  325   RTVFYQIERPDLVSWNAIISGFSNGGDANEAISFFSQMRHKGLVPDEISVLSILSACTSP  384

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVF-DILPCKNLVSWNTM  1642
               +  G+QVH  I+K  FD  V+V + L+ MYAKC  L DA  VF DI    + VSWN +
Sbjct  385   STLYQGRQVHSYIIKRAFDGIVIVCNALLTMYAKCSNLYDAFIVFEDIRNHTDSVSWNAI  444

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +    QH    E   +  +M+ + +KP+ IT   V+ AC +     E  N  +      G
Sbjct  445   ITACMQHNQAGEVFRLLKLMRSSEIKPDYITLKNVIGACAN-IASLEVGNQIHCFTVKSG  503

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             +         +++++ + G    A +    F E PD V W  L+ G      F  G+ A 
Sbjct  504   LVLDVTITNGLIDMYTKCGSLGSAQNLF-GFMENPDVVSWSSLIVG---YAQFGYGEEAL  559

Query  1281  E-----EILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQK  1162
             E     + L I PN+ +  V +    + + + +E  Q+ K M+ +
Sbjct  560   ELFKTMKGLGIKPNEVTM-VGVLTACSHIGLVEEGRQLYKTMESE  603


 Score =   228 bits (582),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 143/502 (28%), Positives = 250/502 (50%), Gaps = 8/502 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   +   II++C+   +   G+  HA ++K  + S     N L SMY  F  I  A  +
Sbjct  166   PDHFTFGSIIKACSGMGNAWLGRQVHAHVLKSETGSHPIAQNALTSMYTKFGLIADAFDV  225

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F  + ++++I+W ++I+ +S +G  +++LG F+ M+ E  + PN + +  A SACS L  
Sbjct  226   FSHVQRKDLISWGSMIAGFSQLGYDKESLGHFKEMLCEGAYQPNEFIFGSAFSACSSLLQ  285

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK++HG   +     + F    L + Y K G L+SA+ VF  +  P+ V+W +++S 
Sbjct  286   PEYGKQMHGMCIKFGLGRDIFAGCSLCDMYAKYGYLESARTVFYQIERPDLVSWNAIISG  345

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
                 G+ +E +  F +    G++ +E      L AC S   L  G  +H  I+K      
Sbjct  346   FSNGGDANEAISFFSQMRHKGLVPDEISVLSILSACTSPSTLYQGRQVHSYIIKRAFDGI  405

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTF-NMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
               V   L+  Y KC  L  A+  F ++ +  +  +W A+I  C+Q  +  E   L   + 
Sbjct  406   VIVCNALLTMYAKCSNLYDAFIVFEDIRNHTDSVSWNAIITACMQHNQAGEVFRLLKLMR  465

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
             SS +KP   T  +V+GA  +    +VG Q+H F +K G      + N L+D Y+K   L 
Sbjct  466   SSEIKPDYITLKNVIGACANIASLEVGNQIHCFTVKSGLVLDVTITNGLIDMYTKCGSLG  525

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
              +  +F  M   D+V+W++LI GY + G+ E+A++L + M   G++PN  T   +L+ C 
Sbjct  526   SAQNLFGFMENPDVVSWSSLIVGYAQFGYGEEALELFKTMKGLGIKPNEVTMVGVLTACS  585

Query  1824  DLPAIEWGKQVHCRIMKP--GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-NLVS  1654
              +  +E G+Q++ + M+   G        S ++D+ A+ G L +A    + +  + +++ 
Sbjct  586   HIGLVEEGRQLY-KTMESEHGIVPTREHCSCMVDLLARAGCLHEAEAFIEQMEFEPDILV  644

Query  1653  WNTMLIGYAQHG---FGKEALE  1597
             W T+L      G    GK A E
Sbjct  645   WKTLLAACKTRGNVEIGKRAAE  666



>ref|XP_008387621.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Malus domestica]
Length=758

 Score =   444 bits (1141),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 238/687 (35%), Positives = 387/687 (56%), Gaps = 3/687 (0%)
 Frame = -2

Query  3063  SQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPK  2884
             + ++ +C++ +S+  G+  H   +    + D+   NH+L+MY     +  A+K+FD MP+
Sbjct  70    TNLVYACSSLRSLEHGRRIHGHTLASNYQPDIVFQNHVLNMYGKCGSLADARKVFDAMPE  129

Query  2883  RNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKE  2704
             RNV++WT+LIS YS     +KA+  +  M L  G  P+H+T+   L ACS L     G++
Sbjct  130   RNVVSWTSLISGYSQNSQEDKAIELYFQM-LRAGCVPDHFTFGSVLKACSGLRNELLGRQ  188

Query  2703  IHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGE  2524
             +H  + ++E   +    N L + Y K GL+  A  VF  +   + ++W S+++   Q G 
Sbjct  189   LHAHVVKSETGSHPIAQNALTSMYTKFGLIADAFDVFSRVPTKDLISWGSMIAGFSQLGY  248

Query  2523  YDEGLRIFLRSLRAGVL-VNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVT  2347
               E L  F   L  G    NEF+ G A  AC  +    +G  IH + +K G+  D +   
Sbjct  249   EKEALDHFKEMLFQGAYQPNEFIFGSAFSACGGLLEPEYGKQIHGMCIKFGLGRDIFAGC  308

Query  2346  GLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKP  2167
              L + Y KCGQL  A   F     P+L +W A+I G    G   EA+  F ++   GL P
Sbjct  309   SLCDMYAKCGQLESARTVFYQIDRPDLVSWNAIISGFSNAGDSNEALXFFSQMRHKGLIP  368

Query  2166  SERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
              E +   +L A T       G Q+HS+IIK  F+    VCN+L+  Y+K + L ++F +F
Sbjct  369   DEVSVLPILTACTSPSTLYQGEQIHSYIIKRAFDFTVIVCNSLLTMYAKCSNLYDAFLVF  428

Query  1986  QEM-TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAI  1810
             +++  + D+VTWNA+I+  ++     +  +LL  M      P+  T   ++  C ++ ++
Sbjct  429   EDIRNDADLVTWNAIISACMQHNQAGEVFRLLNLMRXSETTPDHITLGNLIGACANISSL  488

Query  1809  EWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGY  1630
             E G Q+HC  +K G   +V V + LIDMY KCG +G A+K+F  +   ++VSW+++++GY
Sbjct  489   EVGNQIHCFTVKSGIVLDVTVSNGLIDMYTKCGSIGSAQKLFGWMEDPDVVSWSSLIVGY  548

Query  1629  AQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPR  1450
             AQ G+G+EAL+++  M E G+KPN++T VGVL+AC H GL+EEG   + +M++ +GI P 
Sbjct  549   AQFGYGEEALDLFKRMXELGIKPNEVTLVGVLTACSHIGLVEEGWKIYKTMESEHGIVPT  608

Query  1449  TNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEIL  1270
               H +CMV+L AR G   +A  FI     +PD +VW  LL+ C    +  +GK AAE IL
Sbjct  609   IEHCSCMVDLLARSGCLHEAEAFITQMAFEPDVLVWMTLLAACRTRGNVEIGKRAAENIL  668

Query  1269  SIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSY  1090
              +DP+ ++A V L NI+A    WD+ A++R +M++++++K  G SW E++++I+ F    
Sbjct  669   KLDPSHSAALVLLCNIHASSGNWDDVARLRNLMRERDVRKVPGQSWIEVKDRIHVFFVED  728

Query  1089  NMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
              +      +  +L  L  Q+LD GY P
Sbjct  729   CLHPERGKIYAMLEELWLQMLDDGYDP  755


 Score =   241 bits (615),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 161/564 (29%), Positives = 269/564 (48%), Gaps = 13/564 (2%)
 Frame = -2

Query  2832  LSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVS  2653
             L  +A+ +F  +     F     TY   + ACS L +   G+ IHG    +    +    
Sbjct  45    LYREAIEAFEFLQGHTNFPIFPRTYTNLVYACSSLRSLEHGRRIHGHTLASNYQPDIVFQ  104

Query  2652  NCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVL  2473
             N ++N YGKCG L  A+ VFDAM E N V+W SL+S + Q  + D+ + ++ + LRAG +
Sbjct  105   NHVLNMYGKCGSLADARKVFDAMPERNVVSWTSLISGYSQNSQEDKAIELYFQMLRAGCV  164

Query  2472  VNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNT  2293
              + F  G  L AC+ +     G  +H  +VK            L + Y K G +  A++ 
Sbjct  165   PDHFTFGSVLKACSGLRNELLGRQLHAHVVKSETGSHPIAQNALTSMYTKFGLIADAFDV  224

Query  2292  FNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG-LKPSERTYASVLGAFTDTKE  2116
             F+     +L +W ++I G  Q G  +EA++ F ++L  G  +P+E  + S   A     E
Sbjct  225   FSRVPTKDLISWGSMIAGFSQLGYEKEALDHFKEMLFQGAYQPNEFIFGSAFSACGGLLE  284

Query  2115  FQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAG  1936
              + G Q+H   IK G     F   +L D Y+K   L+ +  +F ++   D+V+WNA+I+G
Sbjct  285   PEYGKQIHGMCIKFGLGRDIFAGCSLCDMYAKCGQLESARTVFYQIDRPDLVSWNAIISG  344

Query  1935  YIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSN  1756
             +  +G   +A+    +M  +GL P+  +   IL+ C     +  G+Q+H  I+K  FD  
Sbjct  345   FSNAGDSNEALXFFSQMRHKGLIPDEVSVLPILTACTSPSTLYQGEQIHSYIIKRAFDFT  404

Query  1755  VVVGSTLIDMYAKCGRLGDARKVF-DILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQ  1579
             V+V ++L+ MYAKC  L DA  VF DI    +LV+WN ++    QH    E   + ++M+
Sbjct  405   VIVCNSLLTMYAKCSNLYDAFLVFEDIRNDADLVTWNAIISACMQHNQAGEVFRLLNLMR  464

Query  1578  ENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQT  1399
              +   P+ IT   ++ AC +     E  N  +      GI         +++++ + G  
Sbjct  465   XSETTPDHITLGNLIGACAN-ISSLEVGNQIHCFTVKSGIVLDVTVSNGLIDMYTKCGSI  523

Query  1398  KKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEI-----LSIDPNDTSAHVT  1234
               A      + E PD V W  L+ G      F  G+ A +       L I PN+ +  V 
Sbjct  524   GSAQKLF-GWMEDPDVVSWSSLIVG---YAQFGYGEEALDLFKRMXELGIKPNEVTL-VG  578

Query  1233  LSNIYARLNMWDEAAQIRKMMKQK  1162
             +    + + + +E  +I K M+ +
Sbjct  579   VLTACSHIGLVEEGWKIYKTMESE  602


 Score =   233 bits (593),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 143/502 (28%), Positives = 248/502 (49%), Gaps = 8/502 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   +   ++++C+  ++ L G+  HA ++K  + S     N L SMY  F  I  A  +
Sbjct  165   PDHFTFGSVLKACSGLRNELLGRQLHAHVVKSETGSHPIAQNALTSMYTKFGLIADAFDV  224

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F  +P +++I+W ++I+ +S +G  ++AL  F+ M+ +  + PN + +  A SAC  L  
Sbjct  225   FSRVPTKDLISWGSMIAGFSQLGYEKEALDHFKEMLFQGAYQPNEFIFGSAFSACGGLLE  284

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IHG   +     + F    L + Y KCG L+SA+ VF  +  P+ V+W +++S 
Sbjct  285   PEYGKQIHGMCIKFGLGRDIFAGCSLCDMYAKCGQLESARTVFYQIDRPDLVSWNAIISG  344

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
                 G+ +E L  F +    G++ +E      L AC S   L  G  IH  I+K      
Sbjct  345   FSNAGDSNEALXFFSQMRHKGLIPDEVSVLPILTACTSPSTLYQGEQIHSYIIKRAFDFT  404

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTF-NMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
               V   L+  Y KC  L  A+  F ++ +  +L  W A+I  C+Q  +  E   L   + 
Sbjct  405   VIVCNSLLTMYAKCSNLYDAFLVFEDIRNDADLVTWNAIISACMQHNQAGEVFRLLNLMR  464

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
              S   P   T  +++GA  +    +VG Q+H F +K G      V N L+D Y+K   + 
Sbjct  465   XSETTPDHITLGNLIGACANISSLEVGNQIHCFTVKSGIVLDVTVSNGLIDMYTKCGSIG  524

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
              + K+F  M + D+V+W++LI GY + G+ E+A+ L + M   G++PN  T   +L+ C 
Sbjct  525   SAQKLFGWMEDPDVVSWSSLIVGYAQFGYGEEALDLFKRMXELGIKPNEVTLVGVLTACS  584

Query  1824  DLPAIEWGKQVHCRIMKP--GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-NLVS  1654
              +  +E G +++ + M+   G    +   S ++D+ A+ G L +A      +  + +++ 
Sbjct  585   HIGLVEEGWKIY-KTMESEHGIVPTIEHCSCMVDLLARSGCLHEAEAFITQMAFEPDVLV  643

Query  1653  WNTMLIGYAQHG---FGKEALE  1597
             W T+L      G    GK A E
Sbjct  644   WMTLLAACRTRGNVEIGKRAAE  665



>ref|XP_010113220.1| hypothetical protein L484_000366 [Morus notabilis]
 gb|EXC74714.1| hypothetical protein L484_000366 [Morus notabilis]
Length=841

 Score =   446 bits (1148),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 247/747 (33%), Positives = 412/747 (55%), Gaps = 48/747 (6%)
 Frame = -2

Query  3198  SLSVRPSQGAHPPLPPATTASLRPA*QSQGSSILTTARGPLKMSLSQIIRSCTTNKSILS  3019
             +L +    GAHP LP                            S S +++SC  +++   
Sbjct  45    TLDLMVHNGAHPDLP----------------------------SYSLLLKSCIRSRNFEL  76

Query  3018  GKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM-PKRNVITWTTLISSYS  2842
             GK  HA L+      D  T N L+S+Y    + E A  +F  M  KRN+++WT+++S ++
Sbjct  77    GKLVHAHLVNSKLDLDSLTLNSLISLYSKNGDWEKADSIFRSMGNKRNLVSWTSIVSCFA  136

Query  2841  HMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNN  2662
             +  L  +A+ +F  M LE+GF P+ Y +     AC   G    G+ I G + ++     +
Sbjct  137   NNDLGFEAIVAFLDM-LENGFWPDEYCFAAVFRACLDTGDLSIGETIFGFVIKSGYFKAD  195

Query  2661  FVSNC-LVNFYGKCG-LLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSL  2488
                 C L++ + K G  L SA  VFD M E N VTW  +++   Q G   E + +FL  +
Sbjct  196   LCVGCSLIDMFAKGGGDLNSAYKVFDKMPEKNVVTWTLMITRFAQLGFAREAVDLFLDMV  255

Query  2487  RAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKC---G  2317
              + ++ ++F     + ACA +E L FG  +H  +++ G+  + YV   LV+ Y KC   G
Sbjct  256   LSDLVPDQFTFSSVMSACAELELLSFGKQLHSQVIRRGLAFNHYVGCCLVDLYAKCAADG  315

Query  2316  QLGLAYNTFNMASAPELHAWTALIGGCVQQG-KGREAVNLFCKLLSSGLKPSERTYASVL  2140
              +  +   F+  +   + +WTALI G V+ G +  EA+ LFC+++S  ++P+  T++S+L
Sbjct  316   SMDESRKVFDHMTNHNVTSWTALITGYVRNGGRYHEAIKLFCEMISGHVRPNHFTFSSIL  375

Query  2139  GAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIV  1960
              A     +   G Q+HS  +KLG  S   V N+L+  Y++S  ++ S K F  + + +++
Sbjct  376   KASASLSDLSTGKQVHSLAVKLGLASDNCVGNSLISMYAQSRQMEYSRKAFDNLFDKNLI  435

Query  1959  TWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRI  1780
             ++N ++  Y++S   ++A  L  E+       N +T+S +LS    + AI  G+Q+H R 
Sbjct  436   SYNTIVDAYVKSFESKEAFDLFHEIDDVEFGANAYTFSSLLSGAASIGAIGKGEQIHART  495

Query  1779  MKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEAL  1600
             +K GFDSN  + + L+ MY++CG +  A +VF  +  +N++SW +++ G+++HG+ + AL
Sbjct  496   LKSGFDSNQCISNALVSMYSRCGNVEAAFQVFSEMVDRNIISWTSIITGFSKHGYAERAL  555

Query  1599  EIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNL  1420
              ++  M E+G++PN++T+  VLSAC H GL+ EG  HFN+M + +GI PR  H ACMV+L
Sbjct  556   TMFYEMLESGIRPNEVTYTAVLSACSHAGLVSEGRKHFNTMYSKHGIVPRMEHYACMVDL  615

Query  1419  FARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAH  1240
               R G   KA +FI S P   D ++WR  L  C ++ +  L ++AA  IL  DP++ +A 
Sbjct  616   LGRSGLLSKALEFINSMPFMADALIWRTFLGACRVHGNTELARHAASMILEQDPHNPAAF  675

Query  1239  VTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGEVSMK  1060
             V L+N++A +N W+E A+IRK MK+++L KE G SW E++NK+Y F       +G+ S  
Sbjct  676   VLLANLHASMNQWEEVAKIRKRMKERDLTKEAGSSWIEVENKVYKFH------VGDTSHP  729

Query  1059  KL------LIGLTAQLLDAGYVPDTKL  997
             K       L  L  ++ + GYVP+T  
Sbjct  730   KASEIYNELDRLVLKIKELGYVPNTDF  756


 Score = 76.3 bits (186),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 94/208 (45%), Gaps = 17/208 (8%)
 Frame = -2

Query  1923  GHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVG  1744
             G   +AI  L  M+  G  P+L +YS +L  C      E GK VH  ++    D + +  
Sbjct  37    GRLSKAISTLDLMVHNGAHPDLPSYSLLLKSCIRSRNFELGKLVHAHLVNSKLDLDSLTL  96

Query  1743  STLIDMYAKCGRLGDARKVFDILPCK-NLVSWNTMLIGYAQHGFGKEALEIYSMMQENGV  1567
             ++LI +Y+K G    A  +F  +  K NLVSW +++  +A +  G EA+  +  M ENG 
Sbjct  97    NSLISLYSKNGDWEKADSIFRSMGNKRNLVSWTSIVSCFANNDLGFEAIVAFLDMLENGF  156

Query  1566  KPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLAC-------MVNLFAR-  1411
              P++  F  V  AC             +  +  +G   ++ +          ++++FA+ 
Sbjct  157   WPDEYCFAAVFRAC-------LDTGDLSIGETIFGFVIKSGYFKADLCVGCSLIDMFAKG  209

Query  1410  KGQTKKAYDFIRSFPEKPDKVVWRCLLS  1327
              G    AY      PEK + V W  +++
Sbjct  210   GGDLNSAYKVFDKMPEK-NVVTWTLMIT  236



>ref|XP_010041412.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Eucalyptus grandis]
Length=927

 Score =   449 bits (1154),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 239/691 (35%), Positives = 393/691 (57%), Gaps = 5/691 (1%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +   +++SC+    ++ GK  H  ++  G  SD +  N L+ MY    E    +++F 
Sbjct  151   EFTFPTVLKSCSIRGDLVMGKQVHGVVVVTGYDSDEFVANGLIVMYAKCGEFGDTRRVFC  210

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              +  +NV++W  LISSY       +A   F  M+L  G  P+ ++    L+AC+ LG   
Sbjct  211   SIHVKNVVSWNGLISSYVKSDFLREAKEMFDEMILS-GIRPSEFSLSTILNACAGLGDCI  269

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G++ HG + +     + F  N LV+ Y K G L+ A   F+ +L+P+ V+W ++++   
Sbjct  270   QGRKAHGYLIKLGYESDQFSQNALVDMYAKAGDLEDAITAFEEILQPDIVSWNAIIAGCV  329

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
                   + L+++ +  R+G+  N F    AL ACAS+E       +H +++K   K D +
Sbjct  330   LHERNHQALKLYTQMNRSGIFPNLFTLSSALKACASMELNYLARQLHSIVIKHDTKADSF  389

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V  GLV+ Y KC  +  A   F++ +  +L A  ALI G  Q G+  +AV+LF +   S 
Sbjct  390   VRAGLVDMYSKCSLMDEARMAFDLMAQKDLIALNALISGYSQNGEDVQAVSLFAETYKSE  449

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             +  ++ T + +L + T  +   V MQ+H+  +KLGF++ + V  +L+D YSK   ++E+ 
Sbjct  450   IGFNQTTLSVILKSATSMQAIDVSMQVHAVSLKLGFDNDSQVATSLIDAYSKCGNIEEAA  509

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
               F+     D+V   ++IA Y + G  E+A+KL  E+   GL+P+    S +L+ C +L 
Sbjct  510   TAFEICAAGDLVALTSMIAAYAQCGQGEEAVKLYLEVQRRGLKPDPFVCSSLLNACANLS  569

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             A E GKQ H  ++K GF S+V  G++L++MYAKCG + DA   FD +P + +VSW+ M+ 
Sbjct  570   AYEQGKQAHVHVLKFGFMSDVFAGNSLVNMYAKCGSIDDAICAFDEIPDRGIVSWSAMIG  629

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             G+AQHG GKEAL+ +  M E+G+ PN IT + VL AC H GL+++  ++F SM+  + I 
Sbjct  630   GFAQHGHGKEALQFFDQMLEDGIAPNHITLLSVLCACNHAGLVDKAEHYFKSMEELFAIR  689

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             P   H ACM+++  R G+ ++A D I + P + +  VW  +L    I+K+  LGK AAE 
Sbjct  690   PTQEHYACMIDILGRAGKLEEAVDLIETMPFQANGHVWGAILGAARIHKNVELGKRAAEM  749

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF--  1102
             +  ++P ++  HV LSNIYA   MW + A++R++MK  ++KKE G SW EL++K+Y F  
Sbjct  750   LFLLEPENSGTHVLLSNIYASAGMWGKVAEVRRLMKHSKVKKEPGTSWVELKDKVYTFIV  809

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
               + +   GE+  K  L  L+  +  AGYVP
Sbjct  810   GDTSHPRTGEIYAK--LDELSELMSRAGYVP  838


 Score =   303 bits (776),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 192/603 (32%), Positives = 312/603 (52%), Gaps = 17/603 (3%)
 Frame = -2

Query  3120  QSQGSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSM  2941
             Q++GS +      P     S+++  C  +KS++ GK AH QL K G   D     HL+++
Sbjct  41    QNEGSVL------PASSYYSKLLSQCCASKSLVQGKLAHTQLTKLGLSEDPKLRIHLITL  94

Query  2940  YVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYT  2761
             Y    +   A+KL DE P+ ++++W+ LIS Y+      +A+ ++R M    G   N +T
Sbjct  95    YSKCRDFGYARKLVDESPEPDLVSWSALISGYAQNEHGLEAISAYREM-HGMGVKGNEFT  153

Query  2760  YVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAML  2581
             +   L +CS  G    GK++HG +       + FV+N L+  Y KCG     + VF ++ 
Sbjct  154   FPTVLKSCSIRGDLVMGKQVHGVVVVTGYDSDEFVANGLIVMYAKCGEFGDTRRVFCSIH  213

Query  2580  EPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASV-ECLGFGM  2404
               N V+W  L+S + +     E   +F   + +G+  +EF     L ACA + +C+  G 
Sbjct  214   VKNVVSWNGLISSYVKSDFLREAKEMFDEMILSGIRPSEFSLSTILNACAGLGDCIQ-GR  272

Query  2403  GIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQG  2224
               H  ++K G + DQ+    LV+ Y K G L  A   F     P++ +W A+I GCV   
Sbjct  273   KAHGYLIKLGYESDQFSQNALVDMYAKAGDLEDAITAFEEILQPDIVSWNAIIAGCVLHE  332

Query  2223  KGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCN  2044
             +  +A+ L+ ++  SG+ P+  T +S L A    +   +  QLHS +IK    + +FV  
Sbjct  333   RNHQALKLYTQMNRSGIFPNLFTLSSALKACASMELNYLARQLHSIVIKHDTKADSFVRA  392

Query  2043  ALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEP  1864
              LVD YSK +L+DE+   F  M + D++  NALI+GY ++G   QA+ L  E     +  
Sbjct  393   GLVDMYSKCSLMDEARMAFDLMAQKDLIALNALISGYSQNGEDVQAVSLFAETYKSEIGF  452

Query  1863  NLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVF  1684
             N  T S IL     + AI+   QVH   +K GFD++  V ++LID Y+KCG + +A   F
Sbjct  453   NQTTLSVILKSATSMQAIDVSMQVHAVSLKLGFDNDSQVATSLIDAYSKCGNIEEAATAF  512

Query  1683  DILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglle  1504
             +I    +LV+  +M+  YAQ G G+EA+++Y  +Q  G+KP+      +L+AC +    E
Sbjct  513   EICAAGDLVALTSMIAAYAQCGQGEEAVKLYLEVQRRGLKPDPFVCSSLLNACANLSAYE  572

Query  1503  egLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDK--VVWRCL  1333
             +G   H + +K  +G          +VN++A+ G      D I +F E PD+  V W  +
Sbjct  573   QGKQAHVHVLK--FGFMSDVFAGNSLVNMYAKCGSID---DAICAFDEIPDRGIVSWSAM  627

Query  1332  LSG  1324
             + G
Sbjct  628   IGG  630



>gb|KCW57628.1| hypothetical protein EUGRSUZ_H00398, partial [Eucalyptus grandis]
Length=740

 Score =   443 bits (1139),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 245/692 (35%), Positives = 384/692 (55%), Gaps = 12/692 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +  L+ +IR C  +  +  G   H  ++K G   DVY    L+ +Y     I+ A+ +
Sbjct  53    PNEYILASLIRGCAQSGGLDEGVQVHCFVVKAGLGQDVYVGTSLVFLYANNGGIDGARSV  112

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD +  +  +TWT +IS +   G SE +L  F  M+ + G  P+ Y     LSACS L  
Sbjct  113   FDGLLDKTDVTWTAIISGHVKCGRSEVSLQLFSQMI-DAGLLPDKYVISSVLSACSALEF  171

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IH  I R E  ++  V N L++          ++ +F+ M   N ++W +++S 
Sbjct  172   VEGGKQIHAHILRREVEMDISVVNVLID----------SRRLFNHMEVRNMISWTTMISG  221

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q     E L++FL     G   + F C   L +C S+E L  G  +H   +K  ++ D
Sbjct  222   YMQNSYDKEALKLFLEMTGLGWNPDAFACTSVLTSCGSLEALMQGKQVHAYTIKANLEFD  281

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              +V  GL++ Y KC  L  A   F++     + ++ A+I G  +  K  EA++LF  +  
Sbjct  282   DFVKNGLIDMYAKCNALEDARKVFDVMDGKNVVSYNAMIEGYSRLEKLEEALDLFHSMRL  341

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
             +   P+  T+ S+LG  T     ++  Q+H    K G +   F  ++L+D YSKS+L+ +
Sbjct  342   ASFFPTPLTFVSILGLSTALFALELSKQVHGLSSKSGISMDLFAGSSLIDVYSKSSLVRD  401

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F+EM + DIV WNA+  GY +    E+  KL  E+      PN  T++ +++   +
Sbjct  402   ARLVFEEMNDRDIVVWNAMFFGYSQQMENEETFKLFLELQLSEKRPNEFTFTSLITASSN  461

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L +++ G+Q H +I+K G D +  V + L+DMYAKCG + +ARK FD+  C+++  WN+M
Sbjct  462   LASLQHGQQFHSQIIKCGLDFDPFVTNALVDMYAKCGSIQEARKAFDLAICEDVACWNSM  521

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +  YAQHG  + AL+I+  M   GVKPN IT+VG+LSACGH GL+E+GL+H+NSM+   G
Sbjct  522   ITTYAQHGEAQAALQIFQEMIITGVKPNYITYVGILSACGHAGLVEDGLHHYNSMR-GLG  580

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I P T H ACMV+LF R G+ K A DFI + P +P  +VWR LLS C    D  LGKYAA
Sbjct  581   IEPGTEHYACMVSLFGRAGRLKDAVDFIETMPIQPMALVWRSLLSACRNAGDSELGKYAA  640

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             +  +S+DP DT ++  LSNI+A   MW +  ++R+ M +  + KE G SW E+ N+ + F
Sbjct  641   KMAISLDPTDTGSYTLLSNIFASKGMWFDVKKVRQRMDETGVLKEPGKSWIEVNNEAHVF  700

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPD  1006
              +          +  +L  L  Q+ + GYVP+
Sbjct  701   VARDWTHYEADLIYSVLHYLILQIKEIGYVPN  732


 Score =   262 bits (670),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 156/515 (30%), Positives = 266/515 (52%), Gaps = 16/515 (3%)
 Frame = -2

Query  2913  AQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACS  2734
             A++ FD +P+RN+ITW+T+IS Y+  G  ++AL SF          PN Y     +  C+
Sbjct  7     ARRAFDNIPERNLITWSTVISMYARYGCCDEALLSFVEFQRGSVERPNEYILASLIRGCA  66

Query  2733  CLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWAS  2554
               G    G ++H  + +A    + +V   LV  Y   G +  A+ VFD +L+   VTW +
Sbjct  67    QSGGLDEGVQVHCFVVKAGLGQDVYVGTSLVFLYANNGGIDGARSVFDGLLDKTDVTWTA  126

Query  2553  LLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCG  2374
             ++S H +CG  +  L++F + + AG+L ++++    L AC+++E +  G  IH  I++  
Sbjct  127   IISGHVKCGRSEVSLQLFSQMIDAGLLPDKYVISSVLSACSALEFVEGGKQIHAHILRRE  186

Query  2373  VKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFC  2194
             V+MD  VV  L++          +   FN      + +WT +I G +Q    +EA+ LF 
Sbjct  187   VEMDISVVNVLID----------SRRLFNHMEVRNMISWTTMISGYMQNSYDKEALKLFL  236

Query  2193  KLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSN  2014
             ++   G  P      SVL +    +    G Q+H++ IK       FV N L+D Y+K N
Sbjct  237   EMTGLGWNPDAFACTSVLTSCGSLEALMQGKQVHAYTIKANLEFDDFVKNGLIDMYAKCN  296

Query  2013  LLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILS  1834
              L+++ K+F  M   ++V++NA+I GY R    E+A+ L   M      P   T+  IL 
Sbjct  297   ALEDARKVFDVMDGKNVVSYNAMIEGYSRLEKLEEALDLFHSMRLASFFPTPLTFVSILG  356

Query  1833  ICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVS  1654
             +   L A+E  KQVH    K G   ++  GS+LID+Y+K   + DAR VF+ +  +++V 
Sbjct  357   LSTALFALELSKQVHGLSSKSGISMDLFAGSSLIDVYSKSSLVRDARLVFEEMNDRDIVV  416

Query  1653  WNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSM  1477
             WN M  GY+Q    +E  +++  +Q +  +PN+ TF  +++A  +   L+ G   H   +
Sbjct  417   WNAMFFGYSQQMENEETFKLFLELQLSEKRPNEFTFTSLITASSNLASLQHGQQFHSQII  476

Query  1476  KNNYGITPRTNHLACMVNLFARKG---QTKKAYDF  1381
             K      P   +   +V+++A+ G   + +KA+D 
Sbjct  477   KCGLDFDPFVTN--ALVDMYAKCGSIQEARKAFDL  509


 Score =   213 bits (541),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 130/434 (30%), Positives = 224/434 (52%), Gaps = 13/434 (3%)
 Frame = -2

Query  2622  GLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGV-LVNEFLCGIA  2446
             G L+ A+  FD + E N +TW++++S + + G  DE L  F+   R  V   NE++    
Sbjct  2     GALRDARRAFDNIPERNLITWSTVISMYARYGCCDEALLSFVEFQRGSVERPNEYILASL  61

Query  2445  LGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPEL  2266
             +  CA    L  G+ +HC +VK G+  D YV T LV  Y   G +  A + F+       
Sbjct  62    IRGCAQSGGLDEGVQVHCFVVKAGLGQDVYVGTSLVFLYANNGGIDGARSVFDGLLDKTD  121

Query  2265  HAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSF  2086
               WTA+I G V+ G+   ++ LF +++ +GL P +   +SVL A +  +  + G Q+H+ 
Sbjct  122   VTWTAIISGHVKCGRSEVSLQLFSQMIDAGLLPDKYVISSVLSACSALEFVEGGKQIHAH  181

Query  2085  IIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQA  1906
             I++        V N L+D          S ++F  M   ++++W  +I+GY+++ + ++A
Sbjct  182   ILRREVEMDISVVNVLID----------SRRLFNHMEVRNMISWTTMISGYMQNSYDKEA  231

Query  1905  IKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDM  1726
             +KL  EM   G  P+    + +L+ CG L A+  GKQVH   +K   + +  V + LIDM
Sbjct  232   LKLFLEMTGLGWNPDAFACTSVLTSCGSLEALMQGKQVHAYTIKANLEFDDFVKNGLIDM  291

Query  1725  YAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITF  1546
             YAKC  L DARKVFD++  KN+VS+N M+ GY++    +EAL+++  M+     P  +TF
Sbjct  292   YAKCNALEDARKVFDVMDGKNVVSYNAMIEGYSRLEKLEEALDLFHSMRLASFFPTPLTF  351

Query  1545  VGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFP  1366
             V +L          E     + + +  GI+      + +++++++    + A        
Sbjct  352   VSIL-GLSTALFALELSKQVHGLSSKSGISMDLFAGSSLIDVYSKSSLVRDARLVFEEMN  410

Query  1365  EKPDKVVWRCLLSG  1324
             ++ D VVW  +  G
Sbjct  411   DR-DIVVWNAMFFG  423



>gb|AEB39779.1| pentatricopeptide repeat protein 98 [Funaria hygrometrica]
Length=980

 Score =   450 bits (1157),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 246/694 (35%), Positives = 378/694 (54%), Gaps = 2/694 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P K +   ++ +C   K++  G    + ++  G  +D++    L++M++    ++ A K+
Sbjct  203   PDKYTFVYMLNACADAKNVDKGGELFSLILNAGWDTDLFVGTALINMHIKCGGVDDALKV  262

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F+ +P+R++ITWT++I+  +     ++A   F+ M  E+G  P+   +V  L AC+   A
Sbjct  263   FNNLPRRDLITWTSMITGLARHRQFKQACNLFQVME-EEGVQPDKVAFVSLLKACNHPEA  321

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK +H R+         +V   L++ Y KCG ++ A  VF+ +   N V+W ++++ 
Sbjct  322   LEQGKRVHARMKEVGLDTEIYVGTALLSMYTKCGSMEDALEVFNLVKGRNVVSWTAMIAG  381

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
               Q G  +E    F + + +G+  N       LGAC+    L  G  IH  I+K G   D
Sbjct  382   FAQHGRMEEAFLFFNKMIESGIEPNRVTFMSILGACSRPSALKQGRQIHDRIIKAGYITD  441

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
               V T L++ Y KCG L  A N F   S   + AW A+I   VQ  K   AV  F  LL 
Sbjct  442   DRVRTALLSMYAKCGSLMDARNVFERISKQNVVAWNAMITAYVQHEKYDNAVATFQALLK  501

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              G+KP   T+ S+L         ++G  + S II+ GF S   + NALV  +     L  
Sbjct  502   EGIKPDSSTFTSILNVCKSPDALELGKWVQSLIIRAGFESDLHIRNALVSMFVNCGDLMS  561

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F +M E D+V+WN +IAG+++ G  + A    + M   G++P+  T++ +L+ C  
Sbjct  562   AMNLFNDMPERDLVSWNTIIAGFVQHGENQFAFDYFKMMQESGVKPDQITFTGLLNACAS  621

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
               A+  G+++H  I +   D +VVVG+ LI MY KCG + DA  VF  LP KN+ SW +M
Sbjct  622   PEALTEGRRLHALITEAALDCDVVVGTGLISMYTKCGSIDDAHLVFHNLPKKNVYSWTSM  681

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             + GYAQHG GKEALE++  MQ+ GVKP+ ITFVG LSAC H GL++EGL+HF SMK ++ 
Sbjct  682   ITGYAQHGRGKEALELFCQMQQEGVKPDWITFVGALSACAHAGLIKEGLHHFESMK-DFN  740

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I PR  H  CMV+LF R G   +A +FI     KPD  +W  LL  C ++ D  L +  A
Sbjct  741   IEPRMEHYGCMVDLFGRAGLLHEAVEFINKMQVKPDSRLWGALLGACQVHLDVELAEKVA  800

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             ++ L +DPND   +V LSNIYA   MW E  ++RK+M  + + K+ G SW E+  +++ F
Sbjct  801   QKKLELDPNDDGVYVILSNIYAAAGMWKEVTKMRKVMLDRGVVKKPGQSWIEVDGRVHIF  860

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDTK  1000
              S          +   L  L  ++   GYVPDT+
Sbjct  861   CSDDKTHPQIEEIHAELGRLHMEMKKLGYVPDTR  894


 Score =   321 bits (823),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 166/518 (32%), Positives = 286/518 (55%), Gaps = 1/518 (0%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + + S +++ C  +K++  G+  H  +     + D++  N L+SMY        A+++FD
Sbjct  104   RQTYSSLLQLCIKHKNLGDGERIHNHIKFSKIQPDIFMWNMLISMYAKCGNTNSAKQIFD  163

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
             EMP ++V +W  L+  Y      E+A      MV +DG  P+ YT+V  L+AC+      
Sbjct  164   EMPDKDVYSWNLLLGGYVQHRRYEEAFRLHEQMV-QDGVKPDKYTFVYMLNACADAKNVD  222

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G E+   I  A    + FV   L+N + KCG +  A  VF+ +   + +TW S+++   
Sbjct  223   KGGELFSLILNAGWDTDLFVGTALINMHIKCGGVDDALKVFNNLPRRDLITWTSMITGLA  282

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
             +  ++ +   +F      GV  ++      L AC   E L  G  +H  + + G+  + Y
Sbjct  283   RHRQFKQACNLFQVMEEEGVQPDKVAFVSLLKACNHPEALEQGKRVHARMKEVGLDTEIY  342

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V T L++ Y KCG +  A   FN+     + +WTA+I G  Q G+  EA   F K++ SG
Sbjct  343   VGTALLSMYTKCGSMEDALEVFNLVKGRNVVSWTAMIAGFAQHGRMEEAFLFFNKMIESG  402

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             ++P+  T+ S+LGA +     + G Q+H  IIK G+ +   V  AL+  Y+K   L ++ 
Sbjct  403   IEPNRVTFMSILGACSRPSALKQGRQIHDRIIKAGYITDDRVRTALLSMYAKCGSLMDAR  462

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
              +F+ +++ ++V WNA+I  Y++   Y+ A+   Q +L EG++P+  T++ IL++C    
Sbjct  463   NVFERISKQNVVAWNAMITAYVQHEKYDNAVATFQALLKEGIKPDSSTFTSILNVCKSPD  522

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             A+E GK V   I++ GF+S++ + + L+ M+  CG L  A  +F+ +P ++LVSWNT++ 
Sbjct  523   ALELGKWVQSLIIRAGFESDLHIRNALVSMFVNCGDLMSAMNLFNDMPERDLVSWNTIIA  582

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACG  1522
             G+ QHG  + A + + MMQE+GVKP+ ITF G+L+AC 
Sbjct  583   GFVQHGENQFAFDYFKMMQESGVKPDQITFTGLLNACA  620


 Score =   219 bits (557),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 123/418 (29%), Positives = 217/418 (52%), Gaps = 4/418 (1%)
 Frame = -2

Query  2574  NTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIH  2395
             NT    + L+   + G+  E + + L      + ++       L  C   + LG G  IH
Sbjct  68    NTQRANAFLNRLSKAGQLSEAMLVLLSVDSPHIQIHRQTYSSLLQLCIKHKNLGDGERIH  127

Query  2394  CLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGR  2215
               I    ++ D ++   L++ Y KCG    A   F+     ++++W  L+GG VQ  +  
Sbjct  128   NHIKFSKIQPDIFMWNMLISMYAKCGNTNSAKQIFDEMPDKDVYSWNLLLGGYVQHRRYE  187

Query  2214  EAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALV  2035
             EA  L  +++  G+KP + T+  +L A  D K    G +L S I+  G+++  FV  AL+
Sbjct  188   EAFRLHEQMVQDGVKPDKYTFVYMLNACADAKNVDKGGELFSLILNAGWDTDLFVGTALI  247

Query  2034  DFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLH  1855
             + + K   +D++ K+F  +   D++TW ++I G  R   ++QA  L Q M  EG++P+  
Sbjct  248   NMHIKCGGVDDALKVFNNLPRRDLITWTSMITGLARHRQFKQACNLFQVMEEEGVQPDKV  307

Query  1854  TYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDIL  1675
              +  +L  C    A+E GK+VH R+ + G D+ + VG+ L+ MY KCG + DA +VF+++
Sbjct  308   AFVSLLKACNHPEALEQGKRVHARMKEVGLDTEIYVGTALLSMYTKCGSMEDALEVFNLV  367

Query  1674  PCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegL  1495
               +N+VSW  M+ G+AQHG  +EA   ++ M E+G++PN +TF+ +L AC     L++G 
Sbjct  368   KGRNVVSWTAMIAGFAQHGRMEEAFLFFNKMIESGIEPNRVTFMSILGACSRPSALKQGR  427

Query  1494  N-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
               H   +K  Y    R      +++++A+ G    A +       K + V W  +++ 
Sbjct  428   QIHDRIIKAGYITDDRVR--TALLSMYAKCGSLMDARNVFERI-SKQNVVAWNAMITA  482



>ref|XP_004166371.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Cucumis sativus]
Length=792

 Score =   444 bits (1142),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 239/697 (34%), Positives = 403/697 (58%), Gaps = 4/697 (1%)
 Frame = -2

Query  3090  ARGPLK-MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIEC  2914
             +  PLK ++ + +I +C++ +S+  G+  H  ++    + D+   NH+LSMY     ++ 
Sbjct  92    SSSPLKSVTYTHLINACSSLRSLEHGRKIHRHMLTCNYQPDMILQNHILSMYGKCGSLKE  151

Query  2913  AQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACS  2734
             A+ +FD MP +NV++WT++IS YS  G  + A+  +  M L  G  P+H+T+   + +CS
Sbjct  152   ARNMFDSMPLKNVVSWTSMISGYSRYGEEDNAITLYVQM-LRSGHIPDHFTFGSIVKSCS  210

Query  2733  CLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWAS  2554
              L   +  +++H  + ++E   +    N L++ Y K   +  A  VF  ++  + ++W S
Sbjct  211   GLDDFKLARQLHAHVLKSEFGADLIAQNALISMYTKFSQMADAINVFSRIIIKDLISWGS  270

Query  2553  LLSCHCQCGEYDEGLRIFLRSLRAGVL-VNEFLCGIALGACASVECLGFGMGIHCLIVKC  2377
             +++   Q G   E L  F   L   V   NEF+ G A  AC+ +     G  IH L +K 
Sbjct  271   MIAGFSQLGYELEALCHFREMLSQSVYQPNEFVFGSAFSACSKLLEPDCGRQIHGLCIKF  330

Query  2376  GVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLF  2197
             G+  D +    L + Y KCG L  A   F     P+L AW A+I G       +E+ + F
Sbjct  331   GLGSDLFAGCSLCDMYAKCGFLESARTVFYHIEKPDLVAWNAIIAGFASVSNAKESSSFF  390

Query  2196  CKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKS  2017
              ++  +GL P++ T  S+L A ++      G+Q+HS+I+K+GFN    VCN+L+  YSK 
Sbjct  391   SQMRHTGLVPNDVTVLSLLCACSEPVMLNHGIQVHSYIVKMGFNLDIPVCNSLLSMYSKC  450

Query  2016  NLLDESFKIFQEM-TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCI  1840
             + L+++ ++F+++  + DIV+WN L+   ++     + ++L + M    ++P+  T + +
Sbjct  451   SNLNDALQVFEDIGNKADIVSWNTLLTACLQQNQAGEVLRLTKLMFASRIKPDHVTLTNV  510

Query  1839  LSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNL  1660
             L   G + + E G Q+HC IMK G + ++ V + LI+MY KCG L  ARK+FD +   ++
Sbjct  511   LVSSGQIASYEVGSQIHCFIMKSGLNLDISVSNALINMYTKCGSLECARKMFDSIGNPDI  570

Query  1659  VSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNS  1480
             +SW+++++GYAQ G GKEA E++  M+  GVKPN+ITFVG+L+AC H G++EEGL  + +
Sbjct  571   ISWSSLIVGYAQAGCGKEAFELFRTMRGLGVKPNEITFVGILTACSHIGMVEEGLKLYRT  630

Query  1479  MKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFV  1300
             M+ +Y I+P   H +CMV+L AR G    A DFIR  P  PD VVW+ LL+ C ++ +  
Sbjct  631   MQEDYRISPTKEHCSCMVDLLARAGCLDVAEDFIRQMPFVPDVVVWKTLLAACKVHGNLE  690

Query  1299  LGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQ  1120
             +GK AAE +L IDP++++A V L NI+A    W + A++R  M++ ++ K  G SW E++
Sbjct  691   VGKRAAENVLKIDPSNSAAVVMLCNIHASSGHWKDFARLRSSMRRMDVGKVPGQSWIEIK  750

Query  1119  NKIYCFSSSYNMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
             +K++ F +  N+      +  +L  L  Q+LD    P
Sbjct  751   DKVHVFLAEDNLHPERGKIYTMLEELMLQILDDSCDP  787


 Score =   238 bits (606),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 149/530 (28%), Positives = 264/530 (50%), Gaps = 9/530 (2%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L +   P   +   I++SC+        +  HA ++K    +D+   N L+SMY  F +
Sbjct  190   MLRSGHIPDHFTFGSIVKSCSGLDDFKLARQLHAHVLKSEFGADLIAQNALISMYTKFSQ  249

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
             +  A  +F  +  +++I+W ++I+ +S +G   +AL  FR M+ +  + PN + +  A S
Sbjct  250   MADAINVFSRIIIKDLISWGSMIAGFSQLGYELEALCHFREMLSQSVYQPNEFVFGSAFS  309

Query  2742  ACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVT  2563
             ACS L     G++IHG   +     + F    L + Y KCG L+SA+ VF  + +P+ V 
Sbjct  310   ACSKLLEPDCGRQIHGLCIKFGLGSDLFAGCSLCDMYAKCGFLESARTVFYHIEKPDLVA  369

Query  2562  WASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIV  2383
             W ++++         E    F +    G++ N+      L AC+    L  G+ +H  IV
Sbjct  370   WNAIIAGFASVSNAKESSSFFSQMRHTGLVPNDVTVLSLLCACSEPVMLNHGIQVHSYIV  429

Query  2382  KCGVKMDQYVVTGLVNFYVKCGQLGLAYNTF-NMASAPELHAWTALIGGCVQQGKGREAV  2206
             K G  +D  V   L++ Y KC  L  A   F ++ +  ++ +W  L+  C+QQ +  E +
Sbjct  430   KMGFNLDIPVCNSLLSMYSKCSNLNDALQVFEDIGNKADIVSWNTLLTACLQQNQAGEVL  489

Query  2205  NLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFY  2026
              L   + +S +KP   T  +VL +      ++VG Q+H FI+K G N    V NAL++ Y
Sbjct  490   RLTKLMFASRIKPDHVTLTNVLVSSGQIASYEVGSQIHCFIMKSGLNLDISVSNALINMY  549

Query  2025  SKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYS  1846
             +K   L+ + K+F  +   DI++W++LI GY ++G  ++A +L + M   G++PN  T+ 
Sbjct  550   TKCGSLECARKMFDSIGNPDIISWSSLIVGYAQAGCGKEAFELFRTMRGLGVKPNEITFV  609

Query  1845  CILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVG--STLIDMYAKCGRLGDARKVFDILP  1672
              IL+ C  +  +E G +++ R M+  +  +      S ++D+ A+ G L  A      +P
Sbjct  610   GILTACSHIGMVEEGLKLY-RTMQEDYRISPTKEHCSCMVDLLARAGCLDVAEDFIRQMP  668

Query  1671  -CKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSAC  1525
                ++V W T+L     HG     LE+     EN +K +      V+  C
Sbjct  669   FVPDVVVWKTLLAACKVHG----NLEVGKRAAENVLKIDPSNSAAVVMLC  714



>ref|XP_006840276.1| hypothetical protein AMTR_s00045p00048330 [Amborella trichopoda]
 gb|ERN01951.1| hypothetical protein AMTR_s00045p00048330 [Amborella trichopoda]
Length=605

 Score =   438 bits (1126),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 221/603 (37%), Positives = 356/603 (59%), Gaps = 0/603 (0%)
 Frame = -2

Query  2796  VLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGL  2617
             +L  GF P+ +T+  A+ ACS L A   G+++H  + ++E   + F  N L+  Y K  +
Sbjct  1     MLRAGFRPDQFTFASAVRACSGLNAVELGRQMHCHLLKSEFGYDPFSQNSLIAMYAKFSM  60

Query  2616  LKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGA  2437
             +  A  VFD  +  + V+W+++++   Q     + + +F      GV  NEF+ G    A
Sbjct  61    IVEAYTVFDRTVNKDLVSWSTMIAGLAQQRFEFKAILLFRDMHLVGVSANEFVFGSIFMA  120

Query  2436  CASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAW  2257
             C+ +  L  G  IH L +K G  ++ +V   L + Y KCG LG A   F     P+L +W
Sbjct  121   CSCISFLDQGRQIHGLCLKYGFGVNAFVGCSLSSLYAKCGSLGCAEKVFYQIRNPDLASW  180

Query  2256  TALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIK  2077
              A++ G  Q G   EA+  F ++   G++P E +   +LG   D      G Q+H+FIIK
Sbjct  181   NAMLVGYAQGGGINEAIMFFSQMRHHGMRPDEISVRCLLGGCMDAMALFQGQQIHTFIIK  240

Query  2076  LGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKL  1897
             + F+    VCN L+  Y+  + L  +  +F+ M   D+V+WNA+IA Y++  H  + ++L
Sbjct  241   MNFSKDISVCNTLLTMYTNCSSLSGASLVFESMILRDLVSWNAMIAAYLKHDHGPEVLRL  300

Query  1896  LQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAK  1717
             L+ +   G++P+  T    +  C DL A+E G Q+H  + K G  S++ + + LID+Y+K
Sbjct  301   LRLLHSAGMKPDQFTMGSGIGACADLAALEPGNQIHGYVNKIGLGSDLSISNALIDLYSK  360

Query  1716  CGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGV  1537
             CG L DA KVF  +   ++VSW+++++GYAQ+G+G+EAL ++S MQ+ G+KPN IT VGV
Sbjct  361   CGSLEDAHKVFTWMSDPDVVSWSSLVVGYAQYGYGEEALHLFSKMQDLGIKPNHITLVGV  420

Query  1536  LSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKP  1357
             LSAC   GL++ G + F +M+ ++GI P   H ACMV+LF R G  K+A DFI   P +P
Sbjct  421   LSACSRIGLIDVGAHVFRNMERDHGIVPTREHYACMVDLFGRAGHLKEAEDFISRMPFEP  480

Query  1356  DKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRK  1177
             D +VW+ LL+ C  + +  LGK AAE IL++DP+++SA V LSN+YAR N W+E A++RK
Sbjct  481   DPIVWKTLLAACRTHGNLELGKRAAENILNLDPSNSSAFVLLSNMYARSNSWEEVARLRK  540

Query  1176  MMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDTKL  997
             +MK + ++K+ G SW ++++K++ F S          +  + + L+  + +AGY PD   
Sbjct  541   LMKSRGVRKDPGLSWIKVKDKVHVFVSEDGNHPQMEDVYVVSLELSLHMREAGYAPDLGF  600

Query  996   SFD  988
             + D
Sbjct  601   ALD  603


 Score =   240 bits (612),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 145/503 (29%), Positives = 246/503 (49%), Gaps = 12/503 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + + +  +R+C+   ++  G+  H  L+K     D ++ N L++MY  F  I  A  +
Sbjct  8     PDQFTFASAVRACSGLNAVELGRQMHCHLLKSEFGYDPFSQNSLIAMYAKFSMIVEAYTV  67

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD    +++++W+T+I+  +      KA+  FR M L  G + N + +     ACSC+  
Sbjct  68    FDRTVNKDLVSWSTMIAGLAQQRFEFKAILLFRDMHLV-GVSANEFVFGSIFMACSCISF  126

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G++IHG   +    +N FV   L + Y KCG L  A+ VF  +  P+  +W ++L  
Sbjct  127   LDQGRQIHGLCLKYGFGVNAFVGCSLSSLYAKCGSLGCAEKVFYQIRNPDLASWNAMLVG  186

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q G  +E +  F +    G+  +E      LG C     L  G  IH  I+K     D
Sbjct  187   YAQGGGINEAIMFFSQMRHHGMRPDEISVRCLLGGCMDAMALFQGQQIHTFIIKMNFSKD  246

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
               V   L+  Y  C  L  A   F      +L +W A+I   ++   G E + L   L S
Sbjct  247   ISVCNTLLTMYTNCSSLSGASLVFESMILRDLVSWNAMIAAYLKHDHGPEVLRLLRLLHS  306

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
             +G+KP + T  S +GA  D    + G Q+H ++ K+G  S   + NAL+D YSK   L++
Sbjct  307   AGMKPDQFTMGSGIGACADLAALEPGNQIHGYVNKIGLGSDLSISNALIDLYSKCGSLED  366

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             + K+F  M++ D+V+W++L+ GY + G+ E+A+ L  +M   G++PN  T   +LS C  
Sbjct  367   AHKVFTWMSDPDVVSWSSLVVGYAQYGYGEEALHLFSKMQDLGIKPNHITLVGVLSACSR  426

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVG----STLIDMYAKCGRLGDARKVFDILPCK-NLV  1657
             +  I+ G  V   + +   D  +V      + ++D++ + G L +A      +P + + +
Sbjct  427   IGLIDVGAHVFRNMER---DHGIVPTREHYACMVDLFGRAGHLKEAEDFISRMPFEPDPI  483

Query  1656  SWNTMLIGYAQHG---FGKEALE  1597
              W T+L     HG    GK A E
Sbjct  484   VWKTLLAACRTHGNLELGKRAAE  506


 Score =   154 bits (389),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 108/412 (26%), Positives = 193/412 (47%), Gaps = 9/412 (2%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             I  +C+    +  G+  H   +KYG   + +    L S+Y     + CA+K+F ++   +
Sbjct  117   IFMACSCISFLDQGRQIHGLCLKYGFGVNAFVGCSLSSLYAKCGSLGCAEKVFYQIRNPD  176

Query  2877  VITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
             + +W  ++  Y+  G   +A+  F S +   G  P+  +    L  C    A   G++IH
Sbjct  177   LASWNAMLVGYAQGGGINEAI-MFFSQMRHHGMRPDEISVRCLLGGCMDAMALFQGQQIH  235

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
               I +   + +  V N L+  Y  C  L  A LVF++M+  + V+W ++++ + +     
Sbjct  236   TFIIKMNFSKDISVCNTLLTMYTNCSSLSGASLVFESMILRDLVSWNAMIAAYLKHDHGP  295

Query  2517  EGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLV  2338
             E LR+      AG+  ++F  G  +GACA +  L  G  IH  + K G+  D  +   L+
Sbjct  296   EVLRLLRLLHSAGMKPDQFTMGSGIGACADLAALEPGNQIHGYVNKIGLGSDLSISNALI  355

Query  2337  NFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSER  2158
             + Y KCG L  A+  F   S P++ +W++L+ G  Q G G EA++LF K+   G+KP+  
Sbjct  356   DLYSKCGSLEDAHKVFTWMSDPDVVSWSSLVVGYAQYGYGEEALHLFSKMQDLGIKPNHI  415

Query  2157  TYASVLGAFTDTKEFQVGMQLHSFIIK---LGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
             T   VL A +      VG  +   + +   +      + C  +VD + ++  L E+    
Sbjct  416   TLVGVLSACSRIGLIDVGAHVFRNMERDHGIVPTREHYAC--MVDLFGRAGHLKEAEDFI  473

Query  1986  QEMT-EYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILS  1834
               M  E D + W  L+A     G+ E   +  + +L   L+P+  +   +LS
Sbjct  474   SRMPFEPDPIVWKTLLAACRTHGNLELGKRAAENIL--NLDPSNSSAFVLLS  523



>ref|XP_003567531.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530 
[Brachypodium distachyon]
Length=822

 Score =   445 bits (1144),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 240/695 (35%), Positives = 386/695 (56%), Gaps = 1/695 (0%)
 Frame = -2

Query  3087  RGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQ  2908
               P +  L+  +R+C  ++++  G+  H   ++ G   +VY    L+++Y     I+ A 
Sbjct  110   EAPNEFLLASALRACAQSRAVSFGQQVHGVAVRIGLDGNVYVGTALINLYAKVGCIDAAM  169

Query  2907  KLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCL  2728
              +FD +P +N +TWT +I+ YS +G    AL  F  M L DG  P+ +    A+SACS L
Sbjct  170   LVFDALPVKNPVTWTAVITGYSQIGQGGVALELFGKMGL-DGVRPDRFVLASAVSACSAL  228

Query  2727  GAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLL  2548
             G    G++ HG  +R     +  V N L++ Y KC  L  A+ +FD M   N V+W +++
Sbjct  229   GFLEGGRQTHGYAYRIAVETDASVINALIDLYCKCSRLSLARKLFDCMENRNLVSWTTMI  288

Query  2547  SCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVK  2368
             + + Q     E + +F +  + G   + F C   L +C S+  +  G  +H   +K  ++
Sbjct  289   AGYMQNSCDAEAMAMFWQLSQEGWQPDVFACASILNSCGSLAAIWQGRQVHAHAIKANLE  348

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
              D+YV   L++ Y KC  L  A   F   +  +  ++ A+I G  + G    A+++F K+
Sbjct  349   SDEYVKNSLIDMYAKCEHLTEARAVFEALAEDDAISYNAMIEGYSRLGDLAGAIDVFSKM  408

Query  2187  LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
                 LKPS  T+ S+LG  +     ++  Q+H  I+K G +   +  ++L+D YSK +L+
Sbjct  409   RYCSLKPSPLTFVSLLGVSSSQSAIELSKQIHGLIVKSGTSLDLYAGSSLIDVYSKFSLV  468

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
             +++  +F  M   D+V WNA+I G  ++   E+A+KL  ++   GL PN  T+  ++++ 
Sbjct  469   EDAKAVFNLMHNRDMVIWNAMIFGLAQNEQGEEAVKLFNQLQVSGLAPNEFTFVALVTVA  528

Query  1827  GDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWN  1648
               L ++  G+Q H +I+K G DS+  V + LIDMYAKCG + + R +F+    K+++ WN
Sbjct  529   STLVSMFHGQQFHAQIIKAGADSDHHVSNALIDMYAKCGFIKEGRLLFESTLGKDVICWN  588

Query  1647  TMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNN  1468
             +M+  YAQHG  +EAL ++ MM   GV+PN +TFVGVLSAC H GL++EGL HF+ MK  
Sbjct  589   SMISTYAQHGQAEEALYVFRMMGGTGVEPNYVTFVGVLSACAHAGLVDEGLRHFDFMKTK  648

Query  1467  YGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKY  1288
             Y I P T H A +VNLF R G+   A +FI   P +P   VWR LLS C++  +  +G+Y
Sbjct  649   YAIEPGTEHYASVVNLFGRSGKLHAAKEFIERMPIEPAAAVWRSLLSACHLFGNVEIGRY  708

Query  1287  AAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIY  1108
             A E  L  DP D+   V +SNIYA   +W +A ++R+ M    + KE G SW E+  +++
Sbjct  709   ATEMALLADPADSGPSVLMSNIYASRGLWSDAQKLRQGMDCAGVVKEPGYSWIEVMKEVH  768

Query  1107  CFSSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDT  1003
              F +          +  LL  LT+ L + GY+PDT
Sbjct  769   TFIARGREHPEADVIYSLLDELTSILKNGGYLPDT  803


 Score =   294 bits (753),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 173/582 (30%), Positives = 300/582 (52%), Gaps = 4/582 (1%)
 Frame = -2

Query  3066  LSQIIRSCTTNKSILSG-KAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM  2890
             L+Q++ SC     +      AHA+ +  G+  D++  N LL  Y     +  A++LFD M
Sbjct  13    LAQLLLSCLAGDRLHRLLPLAHARAVVTGALPDLFLANLLLRAYSKLGRVRDARRLFDRM  72

Query  2889  PKRNVITWTTLISSYSHMGLSEKALGSFRSMV-LEDGFTPNHYTYVGALSACSCLGAART  2713
             P +N+++W + IS ++  G  E A+  F +      G  PN +    AL AC+   A   
Sbjct  73    PHKNLVSWGSAISMHAQHGCEEDAVALFAAFQRASGGEAPNEFLLASALRACAQSRAVSF  132

Query  2712  GKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQ  2533
             G+++HG   R     N +V   L+N Y K G + +A LVFDA+   N VTW ++++ + Q
Sbjct  133   GQQVHGVAVRIGLDGNVYVGTALINLYAKVGCIDAAMLVFDALPVKNPVTWTAVITGYSQ  192

Query  2532  CGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
              G+    L +F +    GV  + F+   A+ AC+++  L  G   H    +  V+ D  V
Sbjct  193   IGQGGVALELFGKMGLDGVRPDRFVLASAVSACSALGFLEGGRQTHGYAYRIAVETDASV  252

Query  2352  VTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
             +  L++ Y KC +L LA   F+      L +WT +I G +Q     EA+ +F +L   G 
Sbjct  253   INALIDLYCKCSRLSLARKLFDCMENRNLVSWTTMIAGYMQNSCDAEAMAMFWQLSQEGW  312

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             +P     AS+L +         G Q+H+  IK    S  +V N+L+D Y+K   L E+  
Sbjct  313   QPDVFACASILNSCGSLAAIWQGRQVHAHAIKANLESDEYVKNSLIDMYAKCEHLTEARA  372

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPA  1813
             +F+ + E D +++NA+I GY R G    AI +  +M +  L+P+  T+  +L +     A
Sbjct  373   VFEALAEDDAISYNAMIEGYSRLGDLAGAIDVFSKMRYCSLKPSPLTFVSLLGVSSSQSA  432

Query  1812  IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIG  1633
             IE  KQ+H  I+K G   ++  GS+LID+Y+K   + DA+ VF+++  +++V WN M+ G
Sbjct  433   IELSKQIHGLIVKSGTSLDLYAGSSLIDVYSKFSLVEDAKAVFNLMHNRDMVIWNAMIFG  492

Query  1632  YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITP  1453
              AQ+  G+EA+++++ +Q +G+ PN+ TFV +++      +       F++     G   
Sbjct  493   LAQNEQGEEAVKLFNQLQVSGLAPNEFTFVALVTVAS-TLVSMFHGQQFHAQIIKAGADS  551

Query  1452  RTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLS  1327
               +    +++++A+ G  K+      S   K D + W  ++S
Sbjct  552   DHHVSNALIDMYAKCGFIKEGRLLFESTLGK-DVICWNSMIS  592



>ref|XP_008358674.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Malus domestica]
Length=928

 Score =   448 bits (1152),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 236/690 (34%), Positives = 387/690 (56%), Gaps = 3/690 (0%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +   ++++C+  K +  G   H   +  G +SD +  N L+ MY    E   +++LFD
Sbjct  152   EFTFPSVLKACSITKDLGLGTQVHGVALLTGFESDEFVANTLVVMYAKCGEFGDSRRLFD  211

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              +P+RNV++W  L S Y       +A+  F+ MVL  G  PN Y+    ++AC+  G   
Sbjct  212   AIPERNVVSWNALFSCYVQSDFHGEAMDLFQEMVL-SGVRPNEYSLSSIINACTGFGDGS  270

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G++IHG + +     ++F +N LV+ Y K   L+ A  VF+ + +P+ V+W ++++  C
Sbjct  271   RGRKIHGYMIKLGYESDSFSANALVDMYAKVKSLEDAVTVFEKIEQPDIVSWNAVIAG-C  329

Query  2535  QCGEYDEGLRIFLRSLR-AGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQ  2359
                EY      F R ++ +G+  N F    AL ACA +     G  +H  ++K   + D 
Sbjct  330   VLHEYHGRALKFFRQMKGSGIRPNMFTLSSALKACAGLGFKKLGRQLHSFLIKMDTESDS  389

Query  2358  YVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSS  2179
             +V  GL++ Y KC  +  A   F+M    ++ AW A+I G  Q G+  EAV+LF ++   
Sbjct  390   FVNVGLIDMYCKCEMMSNARVLFDMMPKKDMIAWNAVISGHSQNGEDIEAVSLFSEMYKE  449

Query  2178  GLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDES  1999
             G++ ++ T ++VL A    +   V  Q+H+  +K GF S  +V N+L+D Y K   ++++
Sbjct  450   GVEFNQTTLSTVLKATASLQAIDVCEQVHALSVKTGFESDMYVINSLLDTYGKCGKVEDA  509

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDL  1819
              +IF+E    D+V + ++I  Y +    E+A+KL  +ML    +P+    S +L+ C +L
Sbjct  510   ARIFKECPIEDVVAFTSMITAYSQYEQGEEALKLYLQMLERENKPDSFVCSSLLNACANL  569

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
              A E GKQ+H  I+K GF S+   G++L++MYAKCG + DA + F  +P + +VSW+ M+
Sbjct  570   SAYEQGKQIHVHILKFGFMSDAFAGNSLVNMYAKCGSIEDADRAFAEVPERGIVSWSAMI  629

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGI  1459
              G AQHG G+EAL  ++ M ++GV PN IT V VL AC H GL+ E   +F SM+  +G+
Sbjct  630   GGLAQHGHGREALNFFTQMLKDGVPPNHITLVSVLCACNHAGLVTEAKKYFESMRELFGV  689

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAE  1279
              PR  H ACM++L  R G+  +A + + + P + +  VW  LL    I+K+  LG+ AAE
Sbjct  690   VPRQEHYACMIDLLGRAGKINEAMELVNTMPFQANASVWGALLGAARIHKNVELGERAAE  749

Query  1278  EILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFS  1099
              +L ++P  +  HV L+NIYA   MWD  A++RK+MK  ++KKE G SW E++++++ F 
Sbjct  750   MLLVLEPEKSGTHVLLANIYASAGMWDNVAKMRKLMKDDQVKKEPGMSWIEVKDQVHTFI  809

Query  1098  SSYNMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
                        +   L  L   +  AGYVP
Sbjct  810   VGDRNHSRSDEIYAKLDELFDLMYKAGYVP  839


 Score =   331 bits (849),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 196/620 (32%), Positives = 323/620 (52%), Gaps = 13/620 (2%)
 Frame = -2

Query  3162  PLPPATTASLRPA*QS----QGSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQL  2995
             PLP       +P   S      +  L     P  +  S+++  CT +KS+  G+  HA +
Sbjct  18    PLPQRLYLPFKPIQTSVQFSTEAKTLNPNFTPTSVLYSKLLSQCTASKSVGVGREIHAHM  77

Query  2994  IKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKAL  2815
             I++G   D    NHL+++Y        A+KL DE P+ ++++W+ LIS Y+  GL ++AL
Sbjct  78    IRFGCSEDPNLRNHLINLYAKCRFFRHARKLVDESPEPDLVSWSALISGYAQNGLGKEAL  137

Query  2814  GSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNF  2635
              +FR M    G   N +T+   L ACS       G ++HG         + FV+N LV  
Sbjct  138   SAFREM-HSLGVKCNEFTFPSVLKACSITKDLGLGTQVHGVALLTGFESDEFVANTLVVM  196

Query  2634  YGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLC  2455
             Y KCG    ++ +FDA+ E N V+W +L SC+ Q   + E + +F   + +GV  NE+  
Sbjct  197   YAKCGEFGDSRRLFDAIPERNVVSWNALFSCYVQSDFHGEAMDLFQEMVLSGVRPNEYSL  256

Query  2454  GIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASA  2275
                + AC        G  IH  ++K G + D +    LV+ Y K   L  A   F     
Sbjct  257   SSIINACTGFGDGSRGRKIHGYMIKLGYESDSFSANALVDMYAKVKSLEDAVTVFEKIEQ  316

Query  2274  PELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQL  2095
             P++ +W A+I GCV       A+  F ++  SG++P+  T +S L A       ++G QL
Sbjct  317   PDIVSWNAVIAGCVLHEYHGRALKFFRQMKGSGIRPNMFTLSSALKACAGLGFKKLGRQL  376

Query  2094  HSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHY  1915
             HSF+IK+   S +FV   L+D Y K  ++  +  +F  M + D++ WNA+I+G+ ++G  
Sbjct  377   HSFLIKMDTESDSFVNVGLIDMYCKCEMMSNARVLFDMMPKKDMIAWNAVISGHSQNGED  436

Query  1914  EQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTL  1735
              +A+ L  EM  EG+E N  T S +L     L AI+  +QVH   +K GF+S++ V ++L
Sbjct  437   IEAVSLFSEMYKEGVEFNQTTLSTVLKATASLQAIDVCEQVHALSVKTGFESDMYVINSL  496

Query  1734  IDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPND  1555
             +D Y KCG++ DA ++F   P +++V++ +M+  Y+Q+  G+EAL++Y  M E   KP+ 
Sbjct  497   LDTYGKCGKVEDAARIFKECPIEDVVAFTSMITAYSQYEQGEEALKLYLQMLERENKPDS  556

Query  1554  ITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFI  1378
                  +L+AC +    E+G   H + +K  +G          +VN++A+ G  +   D  
Sbjct  557   FVCSSLLNACANLSAYEQGKQIHVHILK--FGFMSDAFAGNSLVNMYAKCGSIE---DAD  611

Query  1377  RSFPEKPDK--VVWRCLLSG  1324
             R+F E P++  V W  ++ G
Sbjct  612   RAFAEVPERGIVSWSAMIGG  631


 Score =   271 bits (694),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 173/574 (30%), Positives = 288/574 (50%), Gaps = 34/574 (6%)
 Frame = -2

Query  2811  SFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFY  2632
             S  +  L   FTP    Y   LS C+   +   G+EIH  + R   + +  + N L+N Y
Sbjct  37    STEAKTLNPNFTPTSVLYSKLLSQCTASKSVGVGREIHAHMIRFGCSEDPNLRNHLINLY  96

Query  2631  GKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCG  2452
              KC   + A+ + D   EP+ V+W++L+S + Q G   E L  F      GV  NEF   
Sbjct  97    AKCRFFRHARKLVDESPEPDLVSWSALISGYAQNGLGKEALSAFREMHSLGVKCNEFTFP  156

Query  2451  IALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAP  2272
               L AC+  + LG G  +H + +  G + D++V   LV  Y KCG+ G +   F+     
Sbjct  157   SVLKACSITKDLGLGTQVHGVALLTGFESDEFVANTLVVMYAKCGEFGDSRRLFDAIPER  216

Query  2271  ELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLH  2092
              + +W AL    VQ     EA++LF +++ SG++P+E + +S++ A T   +   G ++H
Sbjct  217   NVVSWNALFSCYVQSDFHGEAMDLFQEMVLSGVRPNEYSLSSIINACTGFGDGSRGRKIH  276

Query  2091  SFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYE  1912
              ++IKLG+ S +F  NALVD Y+K   L+++  +F+++ + DIV+WNA+IAG +   ++ 
Sbjct  277   GYMIKLGYESDSFSANALVDMYAKVKSLEDAVTVFEKIEQPDIVSWNAVIAGCVLHEYHG  336

Query  1911  QAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLI  1732
             +A+K  ++M   G+ PN+ T S  L  C  L   + G+Q+H  ++K   +S+  V   LI
Sbjct  337   RALKFFRQMKGSGIRPNMFTLSSALKACAGLGFKKLGRQLHSFLIKMDTESDSFVNVGLI  396

Query  1731  DMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDI  1552
             DMY KC  + +AR +FD++P K++++WN ++ G++Q+G   EA+ ++S M + GV+ N  
Sbjct  397   DMYCKCEMMSNARVLFDMMPKKDMIAWNAVISGHSQNGEDIEAVSLFSEMYKEGVEFNQT  456

Query  1551  TFVGVLSACG-----------HgglleegLNH----FNSMKNNYGITPRTNHLA------  1435
             T   VL A             H   ++ G        NS+ + YG   +    A      
Sbjct  457   TLSTVLKATASLQAIDVCEQVHALSVKTGFESDMYVINSLLDTYGKCGKVEDAARIFKEC  516

Query  1434  ---------CMVNLFARKGQTKKAYDFIRSFPE---KPDKVVWRCLLSGCNINKDFVLGK  1291
                       M+  +++  Q ++A        E   KPD  V   LL+ C     +  GK
Sbjct  517   PIEDVVAFTSMITAYSQYEQGEEALKLYLQMLERENKPDSFVCSSLLNACANLSAYEQGK  576

Query  1290  YAAEEILSID-PNDTSAHVTLSNIYARLNMWDEA  1192
                  IL     +D  A  +L N+YA+    ++A
Sbjct  577   QIHVHILKFGFMSDAFAGNSLVNMYAKCGSIEDA  610



>ref|XP_001774871.1| predicted protein [Physcomitrella patens]
 gb|EDQ60283.1| predicted protein [Physcomitrella patens]
Length=902

 Score =   447 bits (1149),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 242/734 (33%), Positives = 402/734 (55%), Gaps = 4/734 (1%)
 Frame = -2

Query  3084  GPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQK  2905
              P + ++   + SC +  ++  G+  H Q ++ G   DV   N +L+MY     IE A++
Sbjct  123   APDRTTIMSFLSSCKSPGALEWGREIHFQAMQAGLLFDVKVANCILNMYAKCGSIEEARE  182

Query  2904  LFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             +FD+M K++V++WT  I  Y+  G SE A   F+ M  ++G  PN  TY+  L+A S   
Sbjct  183   VFDKMEKKSVVSWTITIGGYADCGRSETAFEIFQKME-QEGVVPNRITYISVLNAFSSPA  241

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
             A + GK +H RI  A    +  V   LV  Y KCG  K  + VF+ ++  + + W +++ 
Sbjct  242   ALKWGKAVHSRILNAGHESDTAVGTALVKMYAKCGSYKDCRQVFEKLVNRDLIAWNTMIG  301

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
                + G ++E   ++ +  R GV+ N+    I L AC +   L +G  IH  + K G   
Sbjct  302   GLAEGGYWEEASEVYNQMQREGVMPNKITYVILLNACVNSAALHWGKEIHSRVAKAGFTS  361

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
             D  V   L++ Y +CG +  A   F+     ++ +WTA+IGG  + G G EA+ ++ ++ 
Sbjct  362   DIGVQNALISMYSRCGSIKDARLVFDKMVRKDVISWTAMIGGLAKSGFGAEALTVYQEMQ  421

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
              +G++P+  TY S+L A +     + G ++H  +++ G  +   V N LV+ YS    + 
Sbjct  422   QAGVEPNRVTYTSILNACSSPAALEWGRRIHQQVVEAGLATDAHVGNTLVNMYSMCGSVK  481

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
             ++ ++F  M + DIV +NA+I GY      ++A+KL   +  EGL+P+  TY  +L+ C 
Sbjct  482   DARQVFDRMIQRDIVAYNAMIGGYAAHNLGKEALKLFDRLQEEGLKPDKVTYINMLNACA  541

Query  1824  DLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNT  1645
             +  ++EW +++H  + K GF S+  VG+ L+  YAKCG   DA  VF+ +  +N++SWN 
Sbjct  542   NSGSLEWAREIHTLVRKGGFFSDTSVGNALVSTYAKCGSFSDASIVFEKMTKRNVISWNA  601

Query  1644  MLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNY  1465
             ++ G AQHG G++AL+++  M+  GVKP+ +TFV +LSAC H GLLEEG  +F SM  ++
Sbjct  602   IIGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYFCSMSQDF  661

Query  1464  GITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYA  1285
              I P   H  CMV+L  R GQ  +A   I++ P + +  +W  LL  C I+ +  + + A
Sbjct  662   AIIPTIEHYGCMVDLLGRAGQLDEAEALIKTMPFQANTRIWGALLGACRIHGNVPVAERA  721

Query  1284  AEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYC  1105
             AE  L +D ++   +V LS++YA   MWD AA++RK+M+Q+ + KE G SW ++ +K++ 
Sbjct  722   AESSLKLDLDNAVVYVALSHMYAAAGMWDSAAKLRKLMEQRGVTKEPGRSWIQVGDKLHY  781

Query  1104  FSSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDTKL---SFDYGD*LGLSIRHLSRFVKF  934
             F +          +   L  LT  +   GYVPDT+      D G+       H  R    
Sbjct  782   FVAEDRSHPQSEKIYAELDRLTHAMKMKGYVPDTRSVMHDVDEGEKENAVCHHSERLAIA  841

Query  933   DPPISTTGGSKLAV  892
                IST  G+++ +
Sbjct  842   YGLISTPPGTRIHI  855


 Score =   340 bits (872),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 170/516 (33%), Positives = 292/516 (57%), Gaps = 3/516 (1%)
 Frame = -2

Query  3060  QIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMP--  2887
             ++++ C   K +++G+  H  +I++ +  D YT N L++MY+    IE A++++ ++   
Sbjct  28    KMLKRCIEVKDLVAGRQVHQHIIQHRTVPDQYTVNALINMYIQCGSIEEARQVWKKLSYM  87

Query  2886  KRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGK  2707
             +R V +W  ++  Y   G  EKAL   R M  + G  P+  T +  LS+C   GA   G+
Sbjct  88    ERTVHSWNAMVVGYIQYGYIEKALKLLRQM-QQHGLAPDRTTIMSFLSSCKSPGALEWGR  146

Query  2706  EIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCG  2527
             EIH +  +A    +  V+NC++N Y KCG ++ A+ VFD M + + V+W   +  +  CG
Sbjct  147   EIHFQAMQAGLLFDVKVANCILNMYAKCGSIEEAREVFDKMEKKSVVSWTITIGGYADCG  206

Query  2526  EYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVT  2347
               +    IF +  + GV+ N       L A +S   L +G  +H  I+  G + D  V T
Sbjct  207   RSETAFEIFQKMEQEGVVPNRITYISVLNAFSSPAALKWGKAVHSRILNAGHESDTAVGT  266

Query  2346  GLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKP  2167
              LV  Y KCG        F      +L AW  +IGG  + G   EA  ++ ++   G+ P
Sbjct  267   ALVKMYAKCGSYKDCRQVFEKLVNRDLIAWNTMIGGLAEGGYWEEASEVYNQMQREGVMP  326

Query  2166  SERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
             ++ TY  +L A  ++     G ++HS + K GF S   V NAL+  YS+   + ++  +F
Sbjct  327   NKITYVILLNACVNSAALHWGKEIHSRVAKAGFTSDIGVQNALISMYSRCGSIKDARLVF  386

Query  1986  QEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIE  1807
              +M   D+++W A+I G  +SG   +A+ + QEM   G+EPN  TY+ IL+ C    A+E
Sbjct  387   DKMVRKDVISWTAMIGGLAKSGFGAEALTVYQEMQQAGVEPNRVTYTSILNACSSPAALE  446

Query  1806  WGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYA  1627
             WG+++H ++++ G  ++  VG+TL++MY+ CG + DAR+VFD +  +++V++N M+ GYA
Sbjct  447   WGRRIHQQVVEAGLATDAHVGNTLVNMYSMCGSVKDARQVFDRMIQRDIVAYNAMIGGYA  506

Query  1626  QHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGH  1519
              H  GKEAL+++  +QE G+KP+ +T++ +L+AC +
Sbjct  507   AHNLGKEALKLFDRLQEEGLKPDKVTYINMLNACAN  542


 Score =   261 bits (668),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 134/424 (32%), Positives = 227/424 (54%), Gaps = 2/424 (0%)
 Frame = -2

Query  2790  EDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLK  2611
             + G   N   Y+  L  C  +     G+++H  I +     + +  N L+N Y +CG ++
Sbjct  16    QQGAQVNSSDYMKMLKRCIEVKDLVAGRQVHQHIIQHRTVPDQYTVNALINMYIQCGSIE  75

Query  2610  SAQLVFDAM--LEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGA  2437
              A+ V+  +  +E    +W +++  + Q G  ++ L++  +  + G+  +       L +
Sbjct  76    EARQVWKKLSYMERTVHSWNAMVVGYIQYGYIEKALKLLRQMQQHGLAPDRTTIMSFLSS  135

Query  2436  CASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAW  2257
             C S   L +G  IH   ++ G+  D  V   ++N Y KCG +  A   F+      + +W
Sbjct  136   CKSPGALEWGREIHFQAMQAGLLFDVKVANCILNMYAKCGSIEEAREVFDKMEKKSVVSW  195

Query  2256  TALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIK  2077
             T  IGG    G+   A  +F K+   G+ P+  TY SVL AF+     + G  +HS I+ 
Sbjct  196   TITIGGYADCGRSETAFEIFQKMEQEGVVPNRITYISVLNAFSSPAALKWGKAVHSRILN  255

Query  2076  LGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKL  1897
              G  S T V  ALV  Y+K     +  ++F+++   D++ WN +I G    G++E+A ++
Sbjct  256   AGHESDTAVGTALVKMYAKCGSYKDCRQVFEKLVNRDLIAWNTMIGGLAEGGYWEEASEV  315

Query  1896  LQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAK  1717
               +M  EG+ PN  TY  +L+ C +  A+ WGK++H R+ K GF S++ V + LI MY++
Sbjct  316   YNQMQREGVMPNKITYVILLNACVNSAALHWGKEIHSRVAKAGFTSDIGVQNALISMYSR  375

Query  1716  CGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGV  1537
             CG + DAR VFD +  K+++SW  M+ G A+ GFG EAL +Y  MQ+ GV+PN +T+  +
Sbjct  376   CGSIKDARLVFDKMVRKDVISWTAMIGGLAKSGFGAEALTVYQEMQQAGVEPNRVTYTSI  435

Query  1536  LSAC  1525
             L+AC
Sbjct  436   LNAC  439


 Score =   159 bits (402),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/298 (30%), Positives = 159/298 (53%), Gaps = 4/298 (1%)
 Frame = -2

Query  2211  AVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVD  2032
             AV++   L   G + +   Y  +L    + K+   G Q+H  II+       +  NAL++
Sbjct  7     AVDVVQYLQQQGAQVNSSDYMKMLKRCIEVKDLVAGRQVHQHIIQHRTVPDQYTVNALIN  66

Query  2031  FYSKSNLLDESFKIFQEMT--EYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNL  1858
              Y +   ++E+ +++++++  E  + +WNA++ GYI+ G+ E+A+KLL++M   GL P+ 
Sbjct  67    MYIQCGSIEEARQVWKKLSYMERTVHSWNAMVVGYIQYGYIEKALKLLRQMQQHGLAPDR  126

Query  1857  HTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDI  1678
              T    LS C    A+EWG+++H + M+ G   +V V + +++MYAKCG + +AR+VFD 
Sbjct  127   TTIMSFLSSCKSPGALEWGREIHFQAMQAGLLFDVKVANCILNMYAKCGSIEEAREVFDK  186

Query  1677  LPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleeg  1498
             +  K++VSW   + GYA  G  + A EI+  M++ GV PN IT++ VL+A        + 
Sbjct  187   MEKKSVVSWTITIGGYADCGRSETAFEIFQKMEQEGVVPNRITYISVLNAFS-SPAALKW  245

Query  1497  LNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
                 +S   N G    T     +V ++A+ G  K           + D + W  ++ G
Sbjct  246   GKAVHSRILNAGHESDTAVGTALVKMYAKCGSYKDCRQVFEKLVNR-DLIAWNTMIGG  302



>ref|XP_009352868.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Pyrus x bretschneideri]
Length=928

 Score =   447 bits (1151),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 237/690 (34%), Positives = 387/690 (56%), Gaps = 3/690 (0%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +   ++++C+  K +  GK  H   +  G +SD +  N  + MY    E   +++LFD
Sbjct  152   EFTFPSVLKACSITKDLGLGKQVHGVALLTGFESDEFVANTSVVMYAKCGEFGDSRRLFD  211

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              +P+RNV++W  L S Y       +A+  F+ MVL  G  PN Y+    ++AC+  G   
Sbjct  212   AIPERNVVSWNALFSCYVQSDFHGEAMDLFQEMVLS-GVRPNEYSLSSIINACTGFGDGS  270

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G++IHG + +     ++F +N LV+ Y K   L  A  VF+ + +P+ V+W ++++  C
Sbjct  271   QGRKIHGYMIKLGYESDSFSANALVDMYAKVKSLDDAVTVFEKIEQPDIVSWNAVIA-GC  329

Query  2535  QCGEYD-EGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQ  2359
                EY    L+ F++   +G+  N F    AL ACA +     G  +H  ++K  ++ D 
Sbjct  330   VLHEYHGRALKFFIQMKGSGIRPNMFTLSSALKACAGLGFKKLGRQLHSFLIKMDMESDS  389

Query  2358  YVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSS  2179
             +V  GL++ Y KC  +  A   F+M    ++ AW A+I G  Q G+  EAV+LF ++   
Sbjct  390   FVNVGLIDMYCKCEMMSNARVLFDMMPKKDMIAWNAVISGHSQNGEDIEAVSLFSEMYKD  449

Query  2178  GLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDES  1999
             G++ ++ T ++VL A    +   V  Q+H+  +K GF S  +V N+L+D Y K   + ++
Sbjct  450   GVEFNQTTLSTVLKATASVQAIDVCEQVHALSVKTGFESDMYVINSLLDTYGKCGKVQDA  509

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDL  1819
              KIF+E    D+V + ++I  Y +    E+A+KL  +ML    +P+    S +L+ C +L
Sbjct  510   AKIFKECPIEDVVAFTSMITAYSQYEQGEEALKLYLQMLERENKPDSFVCSSLLNACANL  569

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
              A E GKQ+H  I+K GF S+   G++L++MYAKCG + DA   F  +P + +VSW+ M+
Sbjct  570   SAYEQGKQIHVHILKFGFMSDAFAGNSLVNMYAKCGSIEDADCAFAEVPERGIVSWSAMI  629

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGI  1459
              G AQHG G+EAL +++ M ++GV PN IT V VL AC H GL+ E   +F SM   +G+
Sbjct  630   GGLAQHGHGREALNLFTQMLKDGVPPNHITLVSVLCACNHAGLVTEAKKYFESMTELFGV  689

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAE  1279
              PR  H ACM++L  R G+  +A + +++ P + +  VW  LL    I+K+  LG+ AAE
Sbjct  690   VPRQEHYACMIDLLGRAGKINEAMELVKTMPFQANASVWGALLGAARIHKNVELGERAAE  749

Query  1278  EILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFS  1099
              +L ++P  +  HV L+NIYA   MWD  A++RK+MK  ++KKE G SW E++++++ F 
Sbjct  750   MLLVLEPEKSGTHVLLANIYASAGMWDNVAKMRKLMKDDQVKKEPGMSWIEVKDQVHTFI  809

Query  1098  SSYNMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
                        +   L  L   +  AGYVP
Sbjct  810   VGDRNHSRSAEIYAKLDELFDLMYKAGYVP  839


 Score =   331 bits (849),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 199/625 (32%), Positives = 327/625 (52%), Gaps = 23/625 (4%)
 Frame = -2

Query  3162  PLPPATTASLRPA*QS----QGSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQL  2995
             PLP      L+P   S      +  L     P  +S S+++  CT +KS+  G+  HA +
Sbjct  18    PLPQRLYLPLKPIQTSLQFSTEAKTLNPNFTPTSVSYSKLLSQCTASKSVGVGREIHAHV  77

Query  2994  IKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKAL  2815
             I++G   D    NHL+++Y        A+KL DE P+ ++++W+ LIS Y+  GL ++AL
Sbjct  78    IRFGCSEDPNLRNHLINLYAKCRFFRHARKLVDESPEPDLVSWSALISGYAQNGLGKEAL  137

Query  2814  GSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNF  2635
              +FR M    G   N +T+   L ACS       GK++HG         + FV+N  V  
Sbjct  138   SAFREM-HSLGVKCNEFTFPSVLKACSITKDLGLGKQVHGVALLTGFESDEFVANTSVVM  196

Query  2634  YGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLC  2455
             Y KCG    ++ +FDA+ E N V+W +L SC+ Q   + E + +F   + +GV  NE+  
Sbjct  197   YAKCGEFGDSRRLFDAIPERNVVSWNALFSCYVQSDFHGEAMDLFQEMVLSGVRPNEYSL  256

Query  2454  GIALGACASVECLGFGMG-----IHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTF  2290
                + AC      GFG G     IH  ++K G + D +    LV+ Y K   L  A   F
Sbjct  257   SSIINACT-----GFGDGSQGRKIHGYMIKLGYESDSFSANALVDMYAKVKSLDDAVTVF  311

Query  2289  NMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQ  2110
                  P++ +W A+I GCV       A+  F ++  SG++P+  T +S L A       +
Sbjct  312   EKIEQPDIVSWNAVIAGCVLHEYHGRALKFFIQMKGSGIRPNMFTLSSALKACAGLGFKK  371

Query  2109  VGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYI  1930
             +G QLHSF+IK+   S +FV   L+D Y K  ++  +  +F  M + D++ WNA+I+G+ 
Sbjct  372   LGRQLHSFLIKMDMESDSFVNVGLIDMYCKCEMMSNARVLFDMMPKKDMIAWNAVISGHS  431

Query  1929  RSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVV  1750
             ++G   +A+ L  EM  +G+E N  T S +L     + AI+  +QVH   +K GF+S++ 
Sbjct  432   QNGEDIEAVSLFSEMYKDGVEFNQTTLSTVLKATASVQAIDVCEQVHALSVKTGFESDMY  491

Query  1749  VGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENG  1570
             V ++L+D Y KCG++ DA K+F   P +++V++ +M+  Y+Q+  G+EAL++Y  M E  
Sbjct  492   VINSLLDTYGKCGKVQDAAKIFKECPIEDVVAFTSMITAYSQYEQGEEALKLYLQMLERE  551

Query  1569  VKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKK  1393
              KP+      +L+AC +    E+G   H + +K  +G          +VN++A+ G  + 
Sbjct  552   NKPDSFVCSSLLNACANLSAYEQGKQIHVHILK--FGFMSDAFAGNSLVNMYAKCGSIE-  608

Query  1392  AYDFIRSFPEKPDK--VVWRCLLSG  1324
               D   +F E P++  V W  ++ G
Sbjct  609   --DADCAFAEVPERGIVSWSAMIGG  631


 Score =   272 bits (696),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 173/574 (30%), Positives = 288/574 (50%), Gaps = 34/574 (6%)
 Frame = -2

Query  2811  SFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFY  2632
             S  +  L   FTP   +Y   LS C+   +   G+EIH  + R   + +  + N L+N Y
Sbjct  37    STEAKTLNPNFTPTSVSYSKLLSQCTASKSVGVGREIHAHVIRFGCSEDPNLRNHLINLY  96

Query  2631  GKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCG  2452
              KC   + A+ + D   EP+ V+W++L+S + Q G   E L  F      GV  NEF   
Sbjct  97    AKCRFFRHARKLVDESPEPDLVSWSALISGYAQNGLGKEALSAFREMHSLGVKCNEFTFP  156

Query  2451  IALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAP  2272
               L AC+  + LG G  +H + +  G + D++V    V  Y KCG+ G +   F+     
Sbjct  157   SVLKACSITKDLGLGKQVHGVALLTGFESDEFVANTSVVMYAKCGEFGDSRRLFDAIPER  216

Query  2271  ELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLH  2092
              + +W AL    VQ     EA++LF +++ SG++P+E + +S++ A T   +   G ++H
Sbjct  217   NVVSWNALFSCYVQSDFHGEAMDLFQEMVLSGVRPNEYSLSSIINACTGFGDGSQGRKIH  276

Query  2091  SFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYE  1912
              ++IKLG+ S +F  NALVD Y+K   LD++  +F+++ + DIV+WNA+IAG +   ++ 
Sbjct  277   GYMIKLGYESDSFSANALVDMYAKVKSLDDAVTVFEKIEQPDIVSWNAVIAGCVLHEYHG  336

Query  1911  QAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLI  1732
             +A+K   +M   G+ PN+ T S  L  C  L   + G+Q+H  ++K   +S+  V   LI
Sbjct  337   RALKFFIQMKGSGIRPNMFTLSSALKACAGLGFKKLGRQLHSFLIKMDMESDSFVNVGLI  396

Query  1731  DMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDI  1552
             DMY KC  + +AR +FD++P K++++WN ++ G++Q+G   EA+ ++S M ++GV+ N  
Sbjct  397   DMYCKCEMMSNARVLFDMMPKKDMIAWNAVISGHSQNGEDIEAVSLFSEMYKDGVEFNQT  456

Query  1551  TFVGVLSACG-----------HgglleegLNH----FNSMKNNYGITPRTNHLA------  1435
             T   VL A             H   ++ G        NS+ + YG   +    A      
Sbjct  457   TLSTVLKATASVQAIDVCEQVHALSVKTGFESDMYVINSLLDTYGKCGKVQDAAKIFKEC  516

Query  1434  ---------CMVNLFARKGQTKKAYDFIRSFPE---KPDKVVWRCLLSGCNINKDFVLGK  1291
                       M+  +++  Q ++A        E   KPD  V   LL+ C     +  GK
Sbjct  517   PIEDVVAFTSMITAYSQYEQGEEALKLYLQMLERENKPDSFVCSSLLNACANLSAYEQGK  576

Query  1290  YAAEEILSID-PNDTSAHVTLSNIYARLNMWDEA  1192
                  IL     +D  A  +L N+YA+    ++A
Sbjct  577   QIHVHILKFGFMSDAFAGNSLVNMYAKCGSIEDA  610



>dbj|BAJ94557.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=783

 Score =   443 bits (1140),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 233/650 (36%), Positives = 368/650 (57%), Gaps = 1/650 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +  L+  +R+C  +++   G+  H    K G  ++V+    L+++Y     I+ A  +
Sbjct  135   PNEFLLASALRACAQSRAARFGEQVHGVAAKLGLDANVFVGTALVNLYAKAGRIDAAMSV  194

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD +P RN +TWT +I+ YS  G +  AL  F  M L DG  P+ +    A SACS LG 
Sbjct  195   FDALPARNPVTWTAVITGYSQAGQAGVALELFGRMGL-DGVRPDRFVLASAASACSGLGF  253

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G++IHG  +R     +  V N L++ Y KC  L  A+ +FD+M   N V+W ++++ 
Sbjct  254   VEGGRQIHGYAYRTAAESDASVVNALIDLYCKCSRLLLARRLFDSMENRNLVSWTTMIAG  313

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q     E + +F +  +AG   + F C   L +C S+  +  G  +H  ++K  ++ D
Sbjct  314   YMQNSLDTEAMSMFWQLSQAGWQPDVFACTSILNSCGSLAAIWQGRQVHAHVIKADLESD  373

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
             +YV   L++ Y KC  L  A   F   +  +  ++ A+I G  + G    AV +F K+  
Sbjct  374   EYVKNALIDMYAKCEHLTEARAVFEALAEDDAISYNAMIEGYARLGDLTGAVEIFGKMRY  433

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
               LKPS  T+ S+LG  +   + ++  Q+H  I+K G +   +  +AL+D YSK +L+D+
Sbjct  434   CSLKPSLLTFVSLLGVSSSRSDLELSKQIHGLIVKSGTSLDLYAGSALIDVYSKFSLVDD  493

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F  M   D+V WNA+I G  ++   E+A+KL   +   GL PN  T+  ++++   
Sbjct  494   AKLVFSLMQNRDMVIWNAMIFGLAQNERGEEAVKLFARLRVSGLTPNEFTFVALVTVAST  553

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L +I  G+Q H +I+K G DS+  + + LIDMYAKCG + + R +F+    K+++ WN+M
Sbjct  554   LASIFHGQQFHAQIIKAGADSDPHISNALIDMYAKCGFIEEGRLLFESTLGKDVICWNSM  613

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +  YAQHG  +EAL ++ MM+  GV+PN +TFV VLSAC H GL++EGL+HFNSMK  Y 
Sbjct  614   ISTYAQHGHAEEALHVFGMMEGAGVEPNYVTFVSVLSACAHAGLVDEGLHHFNSMKTKYA  673

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             + P T H A +VNLF R G+   A +FI   P +P   +WR LLS C++  +  +G+YA 
Sbjct  674   VEPGTEHYASVVNLFGRSGKLHAAKEFIERMPIEPVATIWRSLLSACHLFGNVEIGRYAT  733

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSW  1132
             E  L  DP D+   V +SNIYA   +W +A ++R+ M    + KE G SW
Sbjct  734   EMALLADPADSGPSVLMSNIYASKGLWADAQKLRQGMDCAGVVKEPGYSW  783


 Score =   299 bits (766),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 178/588 (30%), Positives = 303/588 (52%), Gaps = 10/588 (2%)
 Frame = -2

Query  3069  SLSQIIRSCTTNKSILSG-KAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDE  2893
             SL+Q++ SC     +      AHA+ +  G   D++  N LL  Y     +  A++LFD 
Sbjct  31    SLAQLLLSCLAGDRLRRVLPPAHARAVVSGLLPDLFLANLLLRGYSKLGRLGDARRLFDS  90

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSM-----VLEDGFTPNHYTYVGALSACSCL  2728
             MP RN+++W + IS Y+  G  + AL  F +         DG  PN +    AL AC+  
Sbjct  91    MPSRNLVSWGSAISMYAQHGREDDALLLFAAFPSAGAASPDGEPPNEFLLASALRACAQS  150

Query  2727  GAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLL  2548
              AAR G+++HG   +     N FV   LVN Y K G + +A  VFDA+   N VTW +++
Sbjct  151   RAARFGEQVHGVAAKLGLDANVFVGTALVNLYAKAGRIDAAMSVFDALPARNPVTWTAVI  210

Query  2547  SCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVK  2368
             + + Q G+    L +F R    GV  + F+   A  AC+ +  +  G  IH    +   +
Sbjct  211   TGYSQAGQAGVALELFGRMGLDGVRPDRFVLASAASACSGLGFVEGGRQIHGYAYRTAAE  270

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
              D  VV  L++ Y KC +L LA   F+      L +WT +I G +Q     EA+++F +L
Sbjct  271   SDASVVNALIDLYCKCSRLLLARRLFDSMENRNLVSWTTMIAGYMQNSLDTEAMSMFWQL  330

Query  2187  LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
               +G +P      S+L +         G Q+H+ +IK    S  +V NAL+D Y+K   L
Sbjct  331   SQAGWQPDVFACTSILNSCGSLAAIWQGRQVHAHVIKADLESDEYVKNALIDMYAKCEHL  390

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
              E+  +F+ + E D +++NA+I GY R G    A+++  +M +  L+P+L T+  +L + 
Sbjct  391   TEARAVFEALAEDDAISYNAMIEGYARLGDLTGAVEIFGKMRYCSLKPSLLTFVSLLGVS  450

Query  1827  GDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWN  1648
                  +E  KQ+H  I+K G   ++  GS LID+Y+K   + DA+ VF ++  +++V WN
Sbjct  451   SSRSDLELSKQIHGLIVKSGTSLDLYAGSALIDVYSKFSLVDDAKLVFSLMQNRDMVIWN  510

Query  1647  TMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKN  1471
              M+ G AQ+  G+EA+++++ ++ +G+ PN+ TFV +++       +  G   H   +K 
Sbjct  511   AMIFGLAQNERGEEAVKLFARLRVSGLTPNEFTFVALVTVASTLASIFHGQQFHAQIIKA  570

Query  1470  NYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLS  1327
                  P  ++   +++++A+ G  ++      S   K D + W  ++S
Sbjct  571   GADSDPHISN--ALIDMYAKCGFIEEGRLLFESTLGK-DVICWNSMIS  615



>gb|EYU25211.1| hypothetical protein MIMGU_mgv1a001568mg [Erythranthe guttata]
Length=794

 Score =   443 bits (1140),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 250/704 (36%), Positives = 406/704 (58%), Gaps = 9/704 (1%)
 Frame = -2

Query  3084  GPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQK  2905
              P   + S +++SC   ++   G+  H++LI+   + D    N L+S+Y        A++
Sbjct  7     APDLATYSVLLKSCIRTRNFELGQLVHSRLIESRLQPDAVVLNSLISLYSKCGHWRKAEE  66

Query  2904  LFDEMP-KRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCL  2728
             +F  M   R++++W+ +IS Y+H GL+  A+  F  M LE G  PN + +  A+ ACS  
Sbjct  67    IFSSMGGARDMVSWSAMISCYAHNGLNLDAVLVFVEM-LEYGEHPNEFCFSAAIRACSNR  125

Query  2727  GAARTGKEIHGRIFRAEETLNNFVSNC-LVNFYGK-CGLLKSAQLVFDAMLEPNTVTWAS  2554
               AR G EI G + +     ++    C +V+ + K  G L+ A+ VFD M E N+VTW  
Sbjct  126   ENARIGLEIFGFLLKTGYFGSDVCVGCAMVDLFVKGFGDLELAKKVFDEMPEKNSVTWTL  185

Query  2553  LLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCG  2374
             +++   Q G   + + +F   + AG + + F     L AC+ +  L  G  +H  +VK G
Sbjct  186   MITRFTQMGSPRDAIGLFSDMVIAGFVPDRFTFSSCLSACSELGSLSIGRQLHSWVVKNG  245

Query  2373  VKMDQYVVTGLVNFYVKC---GQLGLAYNTFNMASAPELHAWTALIGGCVQQG-KGREAV  2206
             +  D  V   LV+ Y K    G +  +  TF+  S   + +WTA+I G VQ G    EA+
Sbjct  246   LCFDVCVGCSLVDMYAKSAMDGSMDDSRKTFDRMSNQNVMSWTAIITGYVQNGGNDYEAI  305

Query  2205  NLFCKLLSSG-LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDF  2029
              L+C++++ G +KP+  T+A +L A  +    ++G Q++S   KLG  + + V N+L+  
Sbjct  306   ELYCRMITQGRVKPNHFTFACLLKACGNLFNPKLGEQIYSHATKLGLATVSVVGNSLISM  365

Query  2028  YSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTY  1849
             YSK + ++++ K F+ + E ++V++NAL+ GY R+   ++A +L  E+       +  T+
Sbjct  366   YSKCDRIEDARKAFEFLFEKNLVSYNALVDGYTRNLDSDEAFELFNEIENSSAGADAFTF  425

Query  1848  SCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPC  1669
             + +LS    + A+  G+Q+H R++K GF+SN+ + + LI MY +CG +    +VF+ +  
Sbjct  426   ASLLSGAASVGAVGKGEQIHARLLKAGFESNLCICNALISMYTRCGSIEAGFQVFNEMED  485

Query  1668  KNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNH  1489
             +N++SW +++ G+A+HGF K ALE+Y  M ++GV+PN++TFV VLSAC H GL+EEG   
Sbjct  486   RNIISWTSIITGFAKHGFAKRALELYKQMLDSGVEPNEVTFVAVLSACSHAGLIEEGWRQ  545

Query  1488  FNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINK  1309
             F+SM  ++GI PR  H ACM+++  R G   KA  FI S P   D +VWR LL  C ++ 
Sbjct  546   FDSMYKDHGIRPRMEHYACMIDILGRSGHLDKAIQFINSMPFAADALVWRTLLGACRVHG  605

Query  1308  DFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWT  1129
             +  LGK+AAE IL  DPND SAHV LSN+YA    W+  ++IRK MK++ + KE GCSW 
Sbjct  606   NMELGKHAAEMILEKDPNDPSAHVLLSNLYASAGQWESVSRIRKGMKERNMVKEAGCSWI  665

Query  1128  ELQNKIYCFSSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDTKL  997
             E+ NK++ F            + + L  + A++ + GYVPDT  
Sbjct  666   EIANKVHKFYVGDTKHPEAKEIYEELDEVAAKIKEMGYVPDTNF  709


 Score =   116 bits (290),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 118/222 (53%), Gaps = 3/222 (1%)
 Frame = -2

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
             + L P   TY+ +L +   T+ F++G  +HS +I+        V N+L+  YSK     +
Sbjct  4     ANLAPDLATYSVLLKSCIRTRNFELGQLVHSRLIESRLQPDAVVLNSLISLYSKCGHWRK  63

Query  2001  SFKIFQEM-TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
             + +IF  M    D+V+W+A+I+ Y  +G    A+ +  EML  G  PN   +S  +  C 
Sbjct  64    AEEIFSSMGGARDMVSWSAMISCYAHNGLNLDAVLVFVEMLEYGEHPNEFCFSAAIRACS  123

Query  1824  DLPAIEWGKQVHCRIMKPG-FDSNVVVGSTLIDMYAK-CGRLGDARKVFDILPCKNLVSW  1651
             +      G ++   ++K G F S+V VG  ++D++ K  G L  A+KVFD +P KN V+W
Sbjct  124   NRENARIGLEIFGFLLKTGYFGSDVCVGCAMVDLFVKGFGDLELAKKVFDEMPEKNSVTW  183

Query  1650  NTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSAC  1525
               M+  + Q G  ++A+ ++S M   G  P+  TF   LSAC
Sbjct  184   TLMITRFTQMGSPRDAIGLFSDMVIAGFVPDRFTFSSCLSAC  225


 Score = 89.0 bits (219),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/191 (27%), Positives = 100/191 (52%), Gaps = 7/191 (4%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF  2929
             + I  ++ G    + + ++    +  ++  G+  HA+L+K G +S++   N L+SMY   
Sbjct  411   NEIENSSAGADAFTFASLLSGAASVGAVGKGEQIHARLLKAGFESNLCICNALISMYTRC  470

Query  2928  HEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGA  2749
               IE   ++F+EM  RN+I+WT++I+ ++  G +++AL  ++ M L+ G  PN  T+V  
Sbjct  471   GSIEAGFQVFNEMEDRNIISWTSIITGFAKHGFAKRALELYKQM-LDSGVEPNEVTFVAV  529

Query  2748  LSACSCLGAARTGKEIHGRIFR---AEETLNNFVSNCLVNFYGKCGLL-KSAQLVFDAML  2581
             LSACS  G    G      +++       + ++   C+++  G+ G L K+ Q +     
Sbjct  530   LSACSHAGLIEEGWRQFDSMYKDHGIRPRMEHYA--CMIDILGRSGHLDKAIQFINSMPF  587

Query  2580  EPNTVTWASLL  2548
               + + W +LL
Sbjct  588   AADALVWRTLL  598


 Score = 80.1 bits (196),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 91/191 (48%), Gaps = 17/191 (9%)
 Frame = -2

Query  1872  LEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDAR  1693
             L P+L TYS +L  C      E G+ VH R+++     + VV ++LI +Y+KCG    A 
Sbjct  6     LAPDLATYSVLLKSCIRTRNFELGQLVHSRLIESRLQPDAVVLNSLISLYSKCGHWRKAE  65

Query  1692  KVFDIL-PCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHg  1516
             ++F  +   +++VSW+ M+  YA +G   +A+ ++  M E G  PN+  F   + AC + 
Sbjct  66    EIFSSMGGARDMVSWSAMISCYAHNGLNLDAVLVFVEMLEYGEHPNEFCFSAAIRACSNR  125

Query  1515  glleegLNHFNSMKNNYGITPRTNHLA-------CMVNLFARK-GQTKKAYDFIRSFPEK  1360
                  GL  F       G   +T +          MV+LF +  G  + A       PEK
Sbjct  126   ENARIGLEIF-------GFLLKTGYFGSDVCVGCAMVDLFVKGFGDLELAKKVFDEMPEK  178

Query  1359  PDKVVWRCLLS  1327
              + V W  +++
Sbjct  179   -NSVTWTLMIT  188



>ref|XP_007207533.1| hypothetical protein PRUPE_ppa015196mg [Prunus persica]
 gb|EMJ08732.1| hypothetical protein PRUPE_ppa015196mg [Prunus persica]
Length=737

 Score =   441 bits (1135),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 238/693 (34%), Positives = 388/693 (56%), Gaps = 2/693 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +L+ +IR+CT    +  G   H+ + K G   +VY    L+  Y    +IE A+ +
Sbjct  40    PNEYTLASVIRACTRLGGVDQGAQVHSFVAKTGFDQEVYVGTSLVDFYSKNGDIEEAKLI  99

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F+ +  ++ +TWT +IS Y+  G SE +L  F  M   D   P+ Y     L+ACS L  
Sbjct  100   FEGLKVKSAVTWTIMISGYAKCGRSEVSLKLFNQMRDTD-VLPDKYVLSSLLTACSALKF  158

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IH  + R    ++  V N LV+FY KCG +++ + +F+ ++  + ++W ++++ 
Sbjct  159   IGGGKQIHAYVLRRGTVMDVSVVNVLVDFYAKCGEVQAGRKLFNTIVVKDLISWTTMIAG  218

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q     E +++F    R G  ++ F C   L +CAS+E L  G  +H   ++  +  +
Sbjct  219   YMQNSFNREAVKLFSEMARLGWKLDGFGCSSILTSCASLEALDHGREVHAYAIRVNLVYE  278

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              YV   L++ Y KC  L  A   F+  +   + ++ A+I G  +Q K  EA++LF ++  
Sbjct  279   DYVKNSLIDMYAKCDSLTNARRVFDSMADHNVVSYNAMIEGYSRQDKMSEALDLFNEMRL  338

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
               L PS  T+ S+LG        ++  Q+H  + K G+    F  +AL+D YSK + + +
Sbjct  339   RLLHPSLLTFVSLLGVSAALFALELSKQIHGLVTKYGYCLDVFAGSALIDVYSKCSFISD  398

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F+EM E DIV WNA+  GY +    E+A+KL  E+      PN  T++ ++S   +
Sbjct  399   ARLVFEEMYEKDIVVWNAMFCGYTQQLESEEALKLYLELQLSRQNPNEFTFAALVSAASN  458

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L +I+ G+Q H +++K G DS+  V + L+DMY+ CG + +A K+FD     ++  WN++
Sbjct  459   LASIQHGQQFHNQLIKMGLDSDPFVTNALVDMYSNCGSIEEACKIFDSKIWSDVACWNSI  518

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +  YAQHG  ++AL ++  M +  +KPN ITFVGVLSAC H GL+++GL HF SM   +G
Sbjct  519   ISTYAQHGEAEQALIMFDRMMKEQIKPNFITFVGVLSACSHAGLVDDGLRHFESMP-QFG  577

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             I P T H AC+V+L  R G+  +A +F+   P KP  +VWR LLS C    +  LG+YAA
Sbjct  578   IEPGTEHYACIVSLLGRAGKLFEAKEFVMKMPIKPPAIVWRSLLSACTAAGNIELGRYAA  637

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             E  +  DP D+ +++ LSNIYA   MW +  ++R+ M+   + KETG SW E  N+++ F
Sbjct  638   EMAILSDPVDSGSYILLSNIYASKGMWADVKRVREKMEYNGVVKETGRSWVEANNEVHTF  697

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDT  1003
             ++          +  +L  L  Q+   GYVPDT
Sbjct  698   AAKDRTHRKTGLILSILDSLILQMKGLGYVPDT  730


 Score =   288 bits (736),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 148/458 (32%), Positives = 253/458 (55%), Gaps = 0/458 (0%)
 Frame = -2

Query  2892  MPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAART  2713
             MP++N +TW++++S Y+  G  E+AL  F          PN YT    + AC+ LG    
Sbjct  1     MPEKNSVTWSSMVSMYTKHGNDEEALVMFSEFCRNSDGKPNEYTLASVIRACTRLGGVDQ  60

Query  2712  GKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQ  2533
             G ++H  + +       +V   LV+FY K G ++ A+L+F+ +   + VTW  ++S + +
Sbjct  61    GAQVHSFVAKTGFDQEVYVGTSLVDFYSKNGDIEEAKLIFEGLKVKSAVTWTIMISGYAK  120

Query  2532  CGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
             CG  +  L++F +     VL ++++    L AC++++ +G G  IH  +++ G  MD  V
Sbjct  121   CGRSEVSLKLFNQMRDTDVLPDKYVLSSLLTACSALKFIGGGKQIHAYVLRRGTVMDVSV  180

Query  2352  VTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGL  2173
             V  LV+FY KCG++      FN     +L +WT +I G +Q    REAV LF ++   G 
Sbjct  181   VNVLVDFYAKCGEVQAGRKLFNTIVVKDLISWTTMIAGYMQNSFNREAVKLFSEMARLGW  240

Query  2172  KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFK  1993
             K      +S+L +    +    G ++H++ I++      +V N+L+D Y+K + L  + +
Sbjct  241   KLDGFGCSSILTSCASLEALDHGREVHAYAIRVNLVYEDYVKNSLIDMYAKCDSLTNARR  300

Query  1992  IFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPA  1813
             +F  M ++++V++NA+I GY R     +A+ L  EM    L P+L T+  +L +   L A
Sbjct  301   VFDSMADHNVVSYNAMIEGYSRQDKMSEALDLFNEMRLRLLHPSLLTFVSLLGVSAALFA  360

Query  1812  IEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIG  1633
             +E  KQ+H  + K G+  +V  GS LID+Y+KC  + DAR VF+ +  K++V WN M  G
Sbjct  361   LELSKQIHGLVTKYGYCLDVFAGSALIDVYSKCSFISDARLVFEEMYEKDIVVWNAMFCG  420

Query  1632  YAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGH  1519
             Y Q    +EAL++Y  +Q +   PN+ TF  ++SA  +
Sbjct  421   YTQQLESEEALKLYLELQLSRQNPNEFTFAALVSAASN  458


 Score = 93.6 bits (231),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 97/202 (48%), Gaps = 16/202 (8%)
 Frame = -2

Query  3093  TARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIEC  2914
             + + P + + + ++ + +   SI  G+  H QLIK G  SD +  N L+ MY     IE 
Sbjct  440   SRQNPNEFTFAALVSAASNLASIQHGQQFHNQLIKMGLDSDPFVTNALVDMYSNCGSIEE  499

Query  2913  AQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACS  2734
             A K+FD     +V  W ++IS+Y+  G +E+AL  F  M+ E    PN  T+VG LSACS
Sbjct  500   ACKIFDSKIWSDVACWNSIISTYAQHGEAEQALIMFDRMMKEQ-IKPNFITFVGVLSACS  558

Query  2733  CLGAARTGKEIHGRIFRAEETLNNFVSN-------CLVNFYGKCG-LLKSAQLVFDAMLE  2578
               G    G        R  E++  F          C+V+  G+ G L ++ + V    ++
Sbjct  559   HAGLVDDG-------LRHFESMPQFGIEPGTEHYACIVSLLGRAGKLFEAKEFVMKMPIK  611

Query  2577  PNTVTWASLLSCHCQCGEYDEG  2512
             P  + W SLLS     G  + G
Sbjct  612   PPAIVWRSLLSACTAAGNIELG  633



>ref|XP_010057372.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Eucalyptus grandis]
Length=927

 Score =   447 bits (1150),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 240/691 (35%), Positives = 391/691 (57%), Gaps = 5/691 (1%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +   +++SC+    ++ GK  H  ++  G  SD +  N L+ MY    E   ++++F 
Sbjct  151   EFTFPTVLKSCSIRGDLVMGKQVHGVVVVTGYDSDEFVANGLIVMYAKCGEFGDSRRVFC  210

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              +  +NV++W  LISSY       +A   F  M+L  G  P+ ++    L+AC+ LG   
Sbjct  211   SIHVKNVVSWNGLISSYVKSDFLREAKEMFDEMILS-GIRPSEFSLSTILNACAGLGDCI  269

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G++ HG + +     + F  N LV+ Y K G L+ A   F+ +L+P+ V+W ++++   
Sbjct  270   QGRKAHGYLIKLGYESDQFSQNALVDMYAKAGDLEDAITAFEEILQPDIVSWNAIIAGCV  329

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
                   + L+++ +  R+G+  N F    AL ACAS+E       +H +++K   K D +
Sbjct  330   LHERNHQALKLYTQMNRSGIFPNLFTLSSALKACASMELNYLARQMHSIVIKHDTKADSF  389

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V  GLV+ Y KC  +  A   FN+ +  +L A  ALI G  Q G+  +AV+LF +   S 
Sbjct  390   VRAGLVDMYSKCSLMEEARMAFNLMAQKDLIALNALISGYSQNGEDVQAVSLFAETYKSE  449

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             +  ++ T + +L + T  +   V MQ+H+  +KLGF++ + V  +L+D YSK   + E+ 
Sbjct  450   IGFNQTTLSVILKSATGMQAIDVSMQVHAVSLKLGFDNDSQVATSLIDAYSKCGNIGEAA  509

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
               F+     D+V   ++IA Y + G  E+A+KL  E+   GL+P+    S +L+ C +L 
Sbjct  510   TAFEICAAGDLVALTSMIAAYAQCGQGEEAVKLYLEVQRRGLKPDPFVCSSLLNACANLS  569

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             A E GKQ H  ++K GF S+V  G++L++MYAKCG + DA   FD +P + +VSW+ M+ 
Sbjct  570   AYEQGKQAHVHVLKFGFMSDVFAGNSLVNMYAKCGSIDDAICAFDEIPDRGIVSWSAMIG  629

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             G+AQHG GKEAL  +  M E+G+ PN IT + VL AC H GL+++   +F SM+  + I 
Sbjct  630   GFAQHGHGKEALRFFDQMLEDGIAPNHITLLSVLCACNHAGLVDKAERYFKSMEELFAIR  689

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             P   H ACM+++  R G+ ++A D I + P + +  VW  +L    I+K+  LGK AAE 
Sbjct  690   PTQEHYACMIDILGRAGKLEEAVDLIETMPFQANGHVWGAILGAARIHKNVELGKRAAEM  749

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF--  1102
             +  ++P ++  HV LSNIYA   MW + A++R++MK  ++KKE G SW EL++K+Y F  
Sbjct  750   LFLLEPENSGTHVLLSNIYASAGMWGKVAEVRRLMKHSKVKKEPGTSWVELKDKVYTFIV  809

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
               + +   GE+  K  L  L+  +  AGYVP
Sbjct  810   GDTSHPRTGEIYAK--LDELSELMSRAGYVP  838


 Score =   303 bits (776),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 191/603 (32%), Positives = 314/603 (52%), Gaps = 17/603 (3%)
 Frame = -2

Query  3120  QSQGSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSM  2941
             Q++GS +      P     S+++  C  +KS++ GK AH QL K G   D     HL+++
Sbjct  41    QNEGSVL------PASSYYSKLLSQCCASKSLVQGKLAHTQLTKLGLSEDPKLRIHLITL  94

Query  2940  YVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYT  2761
             Y    +   A+KL DE P+ ++++W+ LIS Y+      +A+ ++R M    G   N +T
Sbjct  95    YSKCRDFGYARKLVDESPEPDLVSWSALISGYAQNEHGLEAISAYREM-HGMGVKGNEFT  153

Query  2760  YVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAML  2581
             +   L +CS  G    GK++HG +       + FV+N L+  Y KCG    ++ VF ++ 
Sbjct  154   FPTVLKSCSIRGDLVMGKQVHGVVVVTGYDSDEFVANGLIVMYAKCGEFGDSRRVFCSIH  213

Query  2580  EPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASV-ECLGFGM  2404
               N V+W  L+S + +     E   +F   + +G+  +EF     L ACA + +C+  G 
Sbjct  214   VKNVVSWNGLISSYVKSDFLREAKEMFDEMILSGIRPSEFSLSTILNACAGLGDCIQ-GR  272

Query  2403  GIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQG  2224
               H  ++K G + DQ+    LV+ Y K G L  A   F     P++ +W A+I GCV   
Sbjct  273   KAHGYLIKLGYESDQFSQNALVDMYAKAGDLEDAITAFEEILQPDIVSWNAIIAGCVLHE  332

Query  2223  KGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCN  2044
             +  +A+ L+ ++  SG+ P+  T +S L A    +   +  Q+HS +IK    + +FV  
Sbjct  333   RNHQALKLYTQMNRSGIFPNLFTLSSALKACASMELNYLARQMHSIVIKHDTKADSFVRA  392

Query  2043  ALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEP  1864
              LVD YSK +L++E+   F  M + D++  NALI+GY ++G   QA+ L  E     +  
Sbjct  393   GLVDMYSKCSLMEEARMAFNLMAQKDLIALNALISGYSQNGEDVQAVSLFAETYKSEIGF  452

Query  1863  NLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVF  1684
             N  T S IL     + AI+   QVH   +K GFD++  V ++LID Y+KCG +G+A   F
Sbjct  453   NQTTLSVILKSATGMQAIDVSMQVHAVSLKLGFDNDSQVATSLIDAYSKCGNIGEAATAF  512

Query  1683  DILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglle  1504
             +I    +LV+  +M+  YAQ G G+EA+++Y  +Q  G+KP+      +L+AC +    E
Sbjct  513   EICAAGDLVALTSMIAAYAQCGQGEEAVKLYLEVQRRGLKPDPFVCSSLLNACANLSAYE  572

Query  1503  egLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDK--VVWRCL  1333
             +G   H + +K  +G          +VN++A+ G      D I +F E PD+  V W  +
Sbjct  573   QGKQAHVHVLK--FGFMSDVFAGNSLVNMYAKCGSID---DAICAFDEIPDRGIVSWSAM  627

Query  1332  LSG  1324
             + G
Sbjct  628   IGG  630



>ref|XP_010932118.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Elaeis guineensis]
Length=928

 Score =   447 bits (1150),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 244/695 (35%), Positives = 383/695 (55%), Gaps = 13/695 (2%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +L  ++++C+ +   ++G   HA  I  G +SDV+  N L+ MY  F  +  ++KLFD
Sbjct  152   EFTLPTLLKACSASSDFIAGTQIHAVAIVTGFESDVFVANTLIVMYAGFGLLLDSRKLFD  211

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              +  RNV++W  L++ +      E+A+G F  MV+  G  PN + +   L+AC+      
Sbjct  212   GIAGRNVVSWNALLAGHVKNDQCEEAVGLFSGMVMS-GIRPNEFGFSCVLNACTGSQDLH  270

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G+E+HG + R     + F +N LV+ Y K G +K+A  VF  +  P+ V+W + ++   
Sbjct  271   HGREVHGYLTRLGYDSDPFTANALVDMYAKLGNIKAAAAVFKGIARPDIVSWNAFIAGCV  330

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
               G  +  LR+ L    +G+L N F     L ACA    L  G  IH  ++K G   D +
Sbjct  331   LHGHDNWALRLLLDMRCSGMLPNVFTLSSILKACAGTGMLFLGQQIHGNLIKAGSDSDMF  390

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V  G+V+ Y KC  LG A   F++    +   W ALI GC   G  +EA+ LF K+   G
Sbjct  391   VGVGIVDMYAKCDHLGDARKAFDLIPKQDTILWNALISGCSHSGSDQEALFLFSKMRLEG  450

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
                +  T ++VL +    +       +H+  +K GF S   V N L+D Y K N ++E+ 
Sbjct  451   SIFNRTTLSAVLKSIASLQATNASKDVHALALKAGFLSDPHVVNGLIDAYGKCNCIEEAA  510

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
              +F+E +  D+V + ++I GY  SG  E+A+KL  EM+ +GL+P+    S +L+ C  L 
Sbjct  511   GVFRECSFGDVVAFTSIITGYSLSGQGEEAMKLFYEMVNQGLKPDSFALSSLLNACASLS  570

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             A E GKQ+H  ++K G+ S+   G+ L++MYAKCG + DA   F  +  + +VSW+ M+ 
Sbjct  571   AYEQGKQIHVHVLKMGYMSDGFSGNALVNMYAKCGSIEDASLAFSEISERGVVSWSAMIG  630

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             G AQHG GKEAL ++  M + GV PN IT   VLSAC H GL++E   +F  M   +GI 
Sbjct  631   GLAQHGHGKEALNLFHKMLDEGVSPNHITLTSVLSACNHAGLVDEAKRYFELMVELFGIE  690

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
                 H ACMV+L  R G+  +A + + S P + +  VW  LL    ++++  LG+ AAE 
Sbjct  691   QTHEHYACMVDLLGRAGRLNEAMELVDSMPFEANASVWGALLGASRVHRNIELGRKAAEM  750

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSS  1096
             + S++P  +  HV L+NIYA   MWD+ A++R++MK   +KKE G SW EL++++Y F  
Sbjct  751   LFSLEPEKSGTHVLLANIYASSGMWDDVAKVRRLMKDSGVKKEPGMSWMELKDRVYTF--  808

Query  1095  SYNMLLGEVSMKKL------LIGLTAQLLDAGYVP  1009
                 ++G+ S ++       L  L   +  AGYVP
Sbjct  809   ----IVGDRSHERTTEIYAKLEELGELMNRAGYVP  839


 Score =   253 bits (647),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 180/615 (29%), Positives = 296/615 (48%), Gaps = 12/615 (2%)
 Frame = -2

Query  3000  QLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEK  2821
             QL   G  S      HLL         + A+++FD +P   +++W+ LIS+Y   GL+ +
Sbjct  76    QLTTSGFSSAPPFRRHLLWFRFGSRSPDLARQVFDVIPHPALVSWSALISNYVRSGLTRE  135

Query  2820  ALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLV  2641
             AL +F+ M    G   N +T    L ACS       G +IH          + FV+N L+
Sbjct  136   ALLAFKKMQTL-GIRSNEFTLPTLLKACSASSDFIAGTQIHAVAIVTGFESDVFVANTLI  194

Query  2640  NFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEF  2461
               Y   GLL  ++ +FD +   N V+W +LL+ H +  + +E + +F   + +G+  NEF
Sbjct  195   VMYAGFGLLLDSRKLFDGIAGRNVVSWNALLAGHVKNDQCEEAVGLFSGMVMSGIRPNEF  254

Query  2460  LCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMA  2281
                  L AC   + L  G  +H  + + G   D +    LV+ Y K G +  A   F   
Sbjct  255   GFSCVLNACTGSQDLHHGREVHGYLTRLGYDSDPFTANALVDMYAKLGNIKAAAAVFKGI  314

Query  2280  SAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGM  2101
             + P++ +W A I GCV  G    A+ L   +  SG+ P+  T +S+L A   T    +G 
Sbjct  315   ARPDIVSWNAFIAGCVLHGHDNWALRLLLDMRCSGMLPNVFTLSSILKACAGTGMLFLGQ  374

Query  2100  QLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSG  1921
             Q+H  +IK G +S  FV   +VD Y+K + L ++ K F  + + D + WNALI+G   SG
Sbjct  375   QIHGNLIKAGSDSDMFVGVGIVDMYAKCDHLGDARKAFDLIPKQDTILWNALISGCSHSG  434

Query  1920  HYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGS  1741
               ++A+ L  +M  EG   N  T S +L     L A    K VH   +K GF S+  V +
Sbjct  435   SDQEALFLFSKMRLEGSIFNRTTLSAVLKSIASLQATNASKDVHALALKAGFLSDPHVVN  494

Query  1740  TLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKP  1561
              LID Y KC  + +A  VF      ++V++ +++ GY+  G G+EA++++  M   G+KP
Sbjct  495   GLIDAYGKCNCIEEAAGVFRECSFGDVVAFTSIITGYSLSGQGEEAMKLFYEMVNQGLKP  554

Query  1560  NDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYD  1384
             +      +L+AC      E+G   H + +K  Y     + +   +VN++A+ G  + A  
Sbjct  555   DSFALSSLLNACASLSAYEQGKQIHVHVLKMGYMSDGFSGN--ALVNMYAKCGSIEDASL  612

Query  1383  FIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILS-IDPNDTSAHVTLSNIYARLN  1207
                   E+   V W  ++ G   +     GK A       +D   +  H+TL+++ +  N
Sbjct  613   AFSEISER-GVVSWSAMIGGLAQHGH---GKEALNLFHKMLDEGVSPNHITLTSVLSACN  668

Query  1206  ---MWDEAAQIRKMM  1171
                + DEA +  ++M
Sbjct  669   HAGLVDEAKRYFELM  683


 Score =   234 bits (598),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 146/517 (28%), Positives = 260/517 (50%), Gaps = 7/517 (1%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF  2929
             S ++ +   P +   S ++ +CT ++ +  G+  H  L + G  SD +T N L+ MY   
Sbjct  242   SGMVMSGIRPNEFGFSCVLNACTGSQDLHHGREVHGYLTRLGYDSDPFTANALVDMYAKL  301

Query  2928  HEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGA  2749
               I+ A  +F  + + ++++W   I+     G    AL     M    G  PN +T    
Sbjct  302   GNIKAAAAVFKGIARPDIVSWNAFIAGCVLHGHDNWALRLLLDMRCS-GMLPNVFTLSSI  360

Query  2748  LSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNT  2569
             L AC+  G    G++IHG + +A    + FV   +V+ Y KC  L  A+  FD + + +T
Sbjct  361   LKACAGTGMLFLGQQIHGNLIKAGSDSDMFVGVGIVDMYAKCDHLGDARKAFDLIPKQDT  420

Query  2568  VTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCL  2389
             + W +L+S     G   E L +F +    G + N       L + AS++       +H L
Sbjct  421   ILWNALISGCSHSGSDQEALFLFSKMRLEGSIFNRTTLSAVLKSIASLQATNASKDVHAL  480

Query  2388  IVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREA  2209
              +K G   D +VV GL++ Y KC  +  A   F   S  ++ A+T++I G    G+G EA
Sbjct  481   ALKAGFLSDPHVVNGLIDAYGKCNCIEEAAGVFRECSFGDVVAFTSIITGYSLSGQGEEA  540

Query  2208  VNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDF  2029
             + LF ++++ GLKP     +S+L A      ++ G Q+H  ++K+G+ S  F  NALV+ 
Sbjct  541   MKLFYEMVNQGLKPDSFALSSLLNACASLSAYEQGKQIHVHVLKMGYMSDGFSGNALVNM  600

Query  2028  YSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTY  1849
             Y+K   ++++   F E++E  +V+W+A+I G  + GH ++A+ L  +ML EG+ PN  T 
Sbjct  601   YAKCGSIEDASLAFSEISERGVVSWSAMIGGLAQHGHGKEALNLFHKMLDEGVSPNHITL  660

Query  1848  SCILSICGDLPAIEWGKQVHCRIMKP-GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILP  1672
             + +LS C     ++  K+    +++  G +      + ++D+  + GRL +A ++ D +P
Sbjct  661   TSVLSACNHAGLVDEAKRYFELMVELFGIEQTHEHYACMVDLLGRAGRLNEAMELVDSMP  720

Query  1671  CK-NLVSWNTMLIGYAQHG---FGKEALE-IYSMMQE  1576
              + N   W  +L     H     G++A E ++S+  E
Sbjct  721   FEANASVWGALLGASRVHRNIELGRKAAEMLFSLEPE  757



>ref|XP_010257871.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g02330 [Nelumbo nucifera]
Length=875

 Score =   446 bits (1146),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 237/699 (34%), Positives = 390/699 (56%), Gaps = 3/699 (0%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + + + I+  C++ +    G   H   +K G  SDV   + L+ MY    ++  + ++F 
Sbjct  170   RTTFAIILSLCSSLEDYDLGIQIHCLAVKMGFDSDVVAGSALVDMYAKCKKLTYSHQVFQ  229

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
             E+P+RN ++W+T+I+ Y         L  F+ M    G   +   Y  A   C+ + + R
Sbjct  230   ELPERNEVSWSTMIAGYVQNDQLIDGLELFKEMQ-RAGIEVSQSIYASAFRLCAGISSLR  288

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G ++HG   +     +  V   +++ Y KC  L  A+ +F+++   N  +W +++  + 
Sbjct  289   LGSQMHGHALKNNFGSDVIVGTAILDMYSKCSCLTDARRMFNSLSHHNLQSWNAIIVGYA  348

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
             +     E L++F    R+G+ ++E     A  +CA ++ L  G+ +H L +K   + +  
Sbjct  349   RGDLGFEALQLFRLMQRSGIGIDEISLSGAFSSCAVIQGLLEGVQLHGLAIKSNFESNIC  408

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V   +++ Y KCG L  A + ++     +  +W A+I    Q     + + LF ++L SG
Sbjct  409   VANAILDMYGKCGALVEARSVYDEMERLDAVSWNAIIAAYEQNEHEEDTLLLFSRMLHSG  468

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             ++P E TY SVL A    +    G+++H+ IIK G     FV +ALVD Y K  +++E+ 
Sbjct  469   MEPDEFTYGSVLKACASLEALNYGLEIHNRIIKSGLGVDLFVGSALVDMYCKCGMMEEAG  528

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
             K+   +    IV+WNA+I+G+      E+A K   +ML  GL P+  TY+ +L  C +L 
Sbjct  529   KLHDRIDNQKIVSWNAIISGFSLQKQSEEAQKFFCQMLDTGLRPDNFTYATVLDTCANLA  588

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
              I  G+QVH +++K    S+V + STL+DMY+KCG + D+R +F+ +P K+ VSWN M+ 
Sbjct  589   TIGLGRQVHAQVIKQEMQSDVFISSTLVDMYSKCGNMQDSRLMFEKMPKKDFVSWNAMIT  648

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             GYAQHG G+EAL+I+  MQ   VKPN  TFV VL ACGH GL+EEGL +F SM + YG+ 
Sbjct  649   GYAQHGLGEEALKIFERMQVENVKPNHATFVAVLRACGHVGLVEEGLRYFQSMLHEYGLD  708

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             P+  H +CMV++  + G+  +A   I   P + D ++WR LLS C I+ +  + + AA  
Sbjct  709   PQLEHYSCMVDIVGKSGKVDEALKLINEMPFEADAIIWRNLLSICQIHGNVEVAEQAAHS  768

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSS  1096
             IL +DP D++A++ LSNIYA+  MWDE +++R++MK   LKKE GCSW E++N+++ F  
Sbjct  769   ILCLDPQDSAAYILLSNIYAKAGMWDEVSKMRRIMKHSGLKKEPGCSWIEVKNEVHTFLV  828

Query  1095  SYNMLLGEVSMKKLLIGLTAQLLDAGYVPDTKLSFDYGD  979
                       + + L  L  ++   GY PD  + F  GD
Sbjct  829   GDKSHPSYTEIYERLDELIGEMRWVGYKPD--IDFLPGD  865


 Score =   290 bits (743),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 185/619 (30%), Positives = 301/619 (49%), Gaps = 41/619 (7%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIE-------  2917
             K + S I + C+  + + +GK AHAQ+I  G    V+  N L++MY+    I+       
Sbjct  37    KKTFSHIYQECSNLRLLDAGKQAHAQMITSGFSPTVFVTNCLINMYIRCSNIDYASKVFE  96

Query  2916  ------------------------CAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGS  2809
                                      AQ +FD MP+R+VI+W +LIS Y   G   + +  
Sbjct  97    RMPQRDTVSWNAMISGYAGCGSMDLAQSIFDSMPERDVISWNSLISGYLRNGNYREPIIF  156

Query  2808  FRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYG  2629
             F  M+ + G   +  T+   LS CS L     G +IH    +     +    + LV+ Y 
Sbjct  157   FLQMMGQMGMELDRTTFAIILSLCSSLEDYDLGIQIHCLAVKMGFDSDVVAGSALVDMYA  216

Query  2628  KCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGI  2449
             KC  L  +  VF  + E N V+W+++++ + Q  +  +GL +F    RAG+ V++ +   
Sbjct  217   KCKKLTYSHQVFQELPERNEVSWSTMIAGYVQNDQLIDGLELFKEMQRAGIEVSQSIYAS  276

Query  2448  ALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPE  2269
             A   CA +  L  G  +H   +K     D  V T +++ Y KC  L  A   FN  S   
Sbjct  277   AFRLCAGISSLRLGSQMHGHALKNNFGSDVIVGTAILDMYSKCSCLTDARRMFNSLSHHN  336

Query  2268  LHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQ---VGMQ  2098
             L +W A+I G  +   G EA+ LF  +  SG+   E    S+ GAF+     Q    G+Q
Sbjct  337   LQSWNAIIVGYARGDLGFEALQLFRLMQRSGIGIDE---ISLSGAFSSCAVIQGLLEGVQ  393

Query  2097  LHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGH  1918
             LH   IK  F S   V NA++D Y K   L E+  ++ EM   D V+WNA+IA Y ++ H
Sbjct  394   LHGLAIKSNFESNICVANAILDMYGKCGALVEARSVYDEMERLDAVSWNAIIAAYEQNEH  453

Query  1917  YEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGST  1738
              E  + L   ML  G+EP+  TY  +L  C  L A+ +G ++H RI+K G   ++ VGS 
Sbjct  454   EEDTLLLFSRMLHSGMEPDEFTYGSVLKACASLEALNYGLEIHNRIIKSGLGVDLFVGSA  513

Query  1737  LIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPN  1558
             L+DMY KCG + +A K+ D +  + +VSWN ++ G++     +EA + +  M + G++P+
Sbjct  514   LVDMYCKCGMMEEAGKLHDRIDNQKIVSWNAIISGFSLQKQSEEAQKFFCQMLDTGLRPD  573

Query  1557  DITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDF  1381
             + T+  VL  C +   +  G   H   +K    +       + +V+++++ G  + +   
Sbjct  574   NFTYATVLDTCANLATIGLGRQVHAQVIKQE--MQSDVFISSTLVDMYSKCGNMQDSRLM  631

Query  1380  IRSFPEKPDKVVWRCLLSG  1324
                 P+K D V W  +++G
Sbjct  632   FEKMPKK-DFVSWNAMITG  649


 Score =   222 bits (566),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 144/521 (28%), Positives = 257/521 (49%), Gaps = 42/521 (8%)
 Frame = -2

Query  2763  TYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKC-------------  2623
             T+      CS L     GK+ H ++  +  +   FV+NCL+N Y +C             
Sbjct  39    TFSHIYQECSNLRLLDAGKQAHAQMITSGFSPTVFVTNCLINMYIRCSNIDYASKVFERM  98

Query  2622  ------------------GLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFL  2497
                               G +  AQ +FD+M E + ++W SL+S + + G Y E +  FL
Sbjct  99    PQRDTVSWNAMISGYAGCGSMDLAQSIFDSMPERDVISWNSLISGYLRNGNYREPIIFFL  158

Query  2496  RSL-RAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKC  2320
             + + + G+ ++     I L  C+S+E    G+ IHCL VK G   D    + LV+ Y KC
Sbjct  159   QMMGQMGMELDRTTFAIILSLCSSLEDYDLGIQIHCLAVKMGFDSDVVAGSALVDMYAKC  218

Query  2319  GQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVL  2140
              +L  ++  F         +W+ +I G VQ  +  + + LF ++  +G++ S+  YAS  
Sbjct  219   KKLTYSHQVFQELPERNEVSWSTMIAGYVQNDQLIDGLELFKEMQRAGIEVSQSIYASAF  278

Query  2139  GAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIV  1960
                      ++G Q+H   +K  F S   V  A++D YSK + L ++ ++F  ++ +++ 
Sbjct  279   RLCAGISSLRLGSQMHGHALKNNFGSDVIVGTAILDMYSKCSCLTDARRMFNSLSHHNLQ  338

Query  1959  TWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRI  1780
             +WNA+I GY R     +A++L + M   G+  +  + S   S C  +  +  G Q+H   
Sbjct  339   SWNAIIVGYARGDLGFEALQLFRLMQRSGIGIDEISLSGAFSSCAVIQGLLEGVQLHGLA  398

Query  1779  MKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEAL  1600
             +K  F+SN+ V + ++DMY KCG L +AR V+D +   + VSWN ++  Y Q+   ++ L
Sbjct  399   IKSNFESNICVANAILDMYGKCGALVEARSVYDEMERLDAVSWNAIIAAYEQNEHEEDTL  458

Query  1599  EIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVN  1423
              ++S M  +G++P++ T+  VL AC     L  GL  H   +K+  G+       + +V+
Sbjct  459   LLFSRMLHSGMEPDEFTYGSVLKACASLEALNYGLEIHNRIIKSGLGVDLFVG--SALVD  516

Query  1422  LFARKGQTKKA---YDFIRSFPEKPDKVVWRCLLSGCNINK  1309
             ++ + G  ++A   +D I    +    V W  ++SG ++ K
Sbjct  517   MYCKCGMMEEAGKLHDRI----DNQKIVSWNAIISGFSLQK  553


 Score =   119 bits (299),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 76/297 (26%), Positives = 147/297 (49%), Gaps = 3/297 (1%)
 Frame = -2

Query  3108  SSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF  2929
             S +L +   P + +   ++++C + +++  G   H ++IK G   D++  + L+ MY   
Sbjct  462   SRMLHSGMEPDEFTYGSVLKACASLEALNYGLEIHNRIIKSGLGVDLFVGSALVDMYCKC  521

Query  2928  HEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGA  2749
               +E A KL D +  + +++W  +IS +S    SE+A   F  M L+ G  P+++TY   
Sbjct  522   GMMEEAGKLHDRIDNQKIVSWNAIISGFSLQKQSEEAQKFFCQM-LDTGLRPDNFTYATV  580

Query  2748  LSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNT  2569
             L  C+ L     G+++H ++ + E   + F+S+ LV+ Y KCG ++ ++L+F+ M + + 
Sbjct  581   LDTCANLATIGLGRQVHAQVIKQEMQSDVFISSTLVDMYSKCGNMQDSRLMFEKMPKKDF  640

Query  2568  VTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMG-IHC  2392
             V+W ++++ + Q G  +E L+IF R     V  N       L AC  V  +  G+     
Sbjct  641   VSWNAMITGYAQHGLGEEALKIFERMQVENVKPNHATFVAVLRACGHVGLVEEGLRYFQS  700

Query  2391  LIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFN-MASAPELHAWTALIGGCVQQG  2224
             ++ + G+       + +V+   K G++  A    N M    +   W  L+  C   G
Sbjct  701   MLHEYGLDPQLEHYSCMVDIVGKSGKVDEALKLINEMPFEADAIIWRNLLSICQIHG  757



>ref|XP_006344830.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like 
[Solanum tuberosum]
Length=721

 Score =   441 bits (1133),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 250/687 (36%), Positives = 387/687 (56%), Gaps = 9/687 (1%)
 Frame = -2

Query  3042  TTNKSILSGKAAHAQLIKYGSKSD-VYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITW  2866
             T +K+I  G++ HA L+K GS S  +Y +N ++++Y   H +  A   F E+  ++V++W
Sbjct  24    TRSKNIPKGQSLHAHLLKTGSSSSCIYLSNSIVNLYAKCHRLSDAHLAFQEIQSKDVVSW  83

Query  2865  TTLISSYSHMGLSEKALGS---FRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHG  2695
               LI+ YS +G  + +L     F+ M  E+   PN +T+ G  ++ S LG + TGK+ H 
Sbjct  84    NCLINGYSQLGRRDSSLSVLNLFKLMRQENAL-PNPHTFAGIFTSVSTLGDSFTGKQAHC  142

Query  2694  RIFRAEETLNNFVSNCLVNFYGKCG-LLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
               F+     + FV + L+N Y K G  L  A+ +FD M E N+V+W +++S +       
Sbjct  143   LAFKLGYLSDVFVGSSLLNVYCKAGHYLGDARKMFDEMPERNSVSWTTMISGYALQRMVK  202

Query  2517  EGLRIFLRSL-RAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGL  2341
             E + +F   L   G  VNEF+    L A A  E +  G  IHCL +K G      V    
Sbjct  203   EAVGVFSVMLWERGEDVNEFVFTSVLSAIALPEFVYVGKQIHCLSLKNGFLWAVSVANAT  262

Query  2340  VNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSE  2161
             V  Y KCG L  A   F ++S      W+ALI G  Q G   +A+ LF ++   G+ PSE
Sbjct  263   VTMYAKCGSLDDACWAFELSSEKNSITWSALITGYAQNGDCEKALKLFSEMHYCGMNPSE  322

Query  2160  RTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQE  1981
              T   VL A +D    + G Q+H +++KLGF    ++  ALVD Y+K   + ++ + F  
Sbjct  323   YTLVGVLNACSDFDALREGKQVHGYLLKLGFEPQMYILTALVDMYAKCGNISDARRGFDY  382

Query  1980  MTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWG  1801
             + E DIV W ++IAGY+++G  E A+ +   ML EG+ PN  T + +L  C  L A+E G
Sbjct  383   LKEPDIVLWTSMIAGYVKNGDNESAMGMYCRMLMEGVIPNELTMASVLKACSSLAALEQG  442

Query  1800  KQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQH  1621
             KQ+H  I+K GF+  V +GS L  MYAK G L D   VF  +P ++LVSWN+M+ G +Q+
Sbjct  443   KQIHAHIVKHGFNLEVPIGSALSTMYAKSGSLHDGNLVFRRMPARDLVSWNSMMSGLSQN  502

Query  1620  GFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNH  1441
             G G EALE++  M   G +P+ +TFV +LSAC H GL++ G + F  M + +GI PR  H
Sbjct  503   GCGTEALELFEEMLHEGTRPDYVTFVNILSACSHMGLVKRGWSIFKMMSDEFGIEPRLEH  562

Query  1440  LACMVNLFARKGQTKKAYDFIRSFPEKPDK--VVWRCLLSGCNINKDFVLGKYAAEEILS  1267
              ACMV++F R G+  +A +FI S     D    +WR LLS C   +++ LG YA E+++ 
Sbjct  563   FACMVDMFGRAGELYEAKEFIESAASHVDHGLCLWRILLSACRNYRNYELGAYAGEKLME  622

Query  1266  IDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYN  1087
             +   ++SA+V LS+IY+ L   ++  ++R++M  + + KE GCSW EL+++ + F     
Sbjct  623   LGSQESSAYVLLSSIYSALGRLEDVERVRRLMNLRGVSKEPGCSWIELKSQFHVFVVGDQ  682

Query  1086  MLLGEVSMKKLLIGLTAQLLDAGYVPD  1006
             +    + ++  L  L+  + D GY PD
Sbjct  683   LHPQIIHIRDELWKLSKLMKDEGYKPD  709


 Score =   259 bits (663),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 147/470 (31%), Positives = 255/470 (54%), Gaps = 4/470 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF-HEIECAQK  2905
             P   + + I  S +T     +GK AH    K G  SDV+  + LL++Y    H +  A+K
Sbjct  116   PNPHTFAGIFTSVSTLGDSFTGKQAHCLAFKLGYLSDVFVGSSLLNVYCKAGHYLGDARK  175

Query  2904  LFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             +FDEMP+RN ++WTT+IS Y+   + ++A+G F  M+ E G   N + +   LSA +   
Sbjct  176   MFDEMPERNSVSWTTMISGYALQRMVKEAVGVFSVMLWERGEDVNEFVFTSVLSAIALPE  235

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
                 GK+IH    +        V+N  V  Y KCG L  A   F+   E N++TW++L++
Sbjct  236   FVYVGKQIHCLSLKNGFLWAVSVANATVTMYAKCGSLDDACWAFELSSEKNSITWSALIT  295

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
              + Q G+ ++ L++F      G+  +E+     L AC+  + L  G  +H  ++K G + 
Sbjct  296   GYAQNGDCEKALKLFSEMHYCGMNPSEYTLVGVLNACSDFDALREGKQVHGYLLKLGFEP  355

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
               Y++T LV+ Y KCG +  A   F+    P++  WT++I G V+ G    A+ ++C++L
Sbjct  356   QMYILTALVDMYAKCGNISDARRGFDYLKEPDIVLWTSMIAGYVKNGDNESAMGMYCRML  415

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
               G+ P+E T ASVL A +     + G Q+H+ I+K GFN    + +AL   Y+KS  L 
Sbjct  416   MEGVIPNELTMASVLKACSSLAALEQGKQIHAHIVKHGFNLEVPIGSALSTMYAKSGSLH  475

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
             +   +F+ M   D+V+WN++++G  ++G   +A++L +EML EG  P+  T+  ILS C 
Sbjct  476   DGNLVFRRMPARDLVSWNSMMSGLSQNGCGTEALELFEEMLHEGTRPDYVTFVNILSACS  535

Query  1824  DLPAIEWGKQVHCRIMKP--GFDSNVVVGSTLIDMYAKCGRLGDARKVFD  1681
              +  ++ G  +  ++M    G +  +   + ++DM+ + G L +A++  +
Sbjct  536   HMGLVKRGWSIF-KMMSDEFGIEPRLEHFACMVDMFGRAGELYEAKEFIE  584


 Score =   111 bits (278),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 131/286 (46%), Gaps = 5/286 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +L  ++ +C+   ++  GK  H  L+K G +  +Y    L+ MY     I  A++ 
Sbjct  320   PSEYTLVGVLNACSDFDALREGKQVHGYLLKLGFEPQMYILTALVDMYAKCGNISDARRG  379

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             FD + + +++ WT++I+ Y   G +E A+G +  M++E G  PN  T    L ACS L A
Sbjct  380   FDYLKEPDIVLWTSMIAGYVKNGDNESAMGMYCRMLME-GVIPNELTMASVLKACSSLAA  438

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IH  I +    L   + + L   Y K G L    LVF  M   + V+W S++S 
Sbjct  439   LEQGKQIHAHIVKHGFNLEVPIGSALSTMYAKSGSLHDGNLVFRRMPARDLVSWNSMMSG  498

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIV-KCGVKM  2365
               Q G   E L +F   L  G   +       L AC+ +  +  G  I  ++  + G++ 
Sbjct  499   LSQNGCGTEALELFEEMLHEGTRPDYVTFVNILSACSHMGLVKRGWSIFKMMSDEFGIEP  558

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHA---WTALIGGC  2236
                    +V+ + + G+L  A      A++   H    W  L+  C
Sbjct  559   RLEHFACMVDMFGRAGELYEAKEFIESAASHVDHGLCLWRILLSAC  604



>ref|XP_011100907.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Sesamum indicum]
Length=713

 Score =   440 bits (1132),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 242/672 (36%), Positives = 384/672 (57%), Gaps = 9/672 (1%)
 Frame = -2

Query  3096  TTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYG-SKSDVYTNNHLLSMYVTFHEI  2920
               A  P    L   +R  T ++ +  GK+ HA L+K G   S    ++ LL+ Y   H  
Sbjct  4     VAALSPQSRHLFSKLRHFTDHQGLPDGKSLHAHLLKTGLFPSCALLSSTLLNFYAKCHLF  63

Query  2919  ECAQKLFDEMP-KRNVITWTTLISSYSHMGLSE---KALGSFRSMVLEDGFTPNHYTYVG  2752
               A+ LF EMP K + ++W  LI+SYS +GL+     AL  F+ M L+    PN +T+ G
Sbjct  64    SEARLLFAEMPHKEDSVSWNILINSYSQLGLAHYSFSALQLFKEM-LQHRSLPNSHTFAG  122

Query  2751  ALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPN  2572
               SA + L      ++ H  + +  ++ + FV + ++N Y K G L   + VFD M + N
Sbjct  123   IFSAAAILEDEVMARQAHCVVVKFVDSCDVFVYSSMLNVYCKLGFLGDGRKVFDEMPDRN  182

Query  2571  TVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVL--VNEFLCGIALGACASVECLGFGMGI  2398
             ++TW++++S +      +E   +F R + +G    VNEF     L A  S E +  G  +
Sbjct  183   SITWSTMISGYASQRLGNEAFWVF-RGMMSGEEEEVNEFCVTSVLSAFTSPEFVDKGKQV  241

Query  2397  HCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKG  2218
             H L +K G+     V   +V  Y KCG L  A   F +++      W+A+I G  Q G G
Sbjct  242   HSLAIKNGLSEIVSVGNAVVTMYAKCGSLNDAVRVFELSTDKNSITWSAMITGHAQSGDG  301

Query  2217  REAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNAL  2038
              +A+ LF ++   G++PS+ T   VL A +DT+E  +G Q+H++++KLGF    ++  AL
Sbjct  302   EKALVLFKEMHFRGMRPSKYTIVGVLNACSDTEEIIMGKQVHAYLVKLGFEFQMYIMTAL  361

Query  2037  VDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNL  1858
             +D Y+K   + E+ K F  + + D+V W ++I GY+++G  E AI L   M  EG+ PN 
Sbjct  362   IDMYAKCGFIVEAQKGFDHLHDSDLVLWTSMIGGYVQNGDNESAISLYCRMQMEGIAPNE  421

Query  1857  HTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDI  1678
              T + +L  C  L A+E GKQ+H  ++K GF   V +GS L  MYAKCG L D   VF  
Sbjct  422   LTMASVLKACSSLSALEQGKQIHAHVVKNGFTLEVPIGSALSTMYAKCGSLDDGNGVFKR  481

Query  1677  LPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleeg  1498
             +P +++VSWN M+ G +Q+G G EAL+++  MQ  GVKP+ +TFV +LSAC H GL+++G
Sbjct  482   MPARDVVSWNAMISGLSQNGRGIEALDLFEEMQLEGVKPDSVTFVNILSACSHMGLVDKG  541

Query  1497  LNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCN  1318
               +F+SM   +GI P+  H ACMV++  R G+  +A +FI S        +WR LLS C 
Sbjct  542   WEYFHSMPTKFGIVPKIEHYACMVDILGRAGKLHQAKEFIESATIDHGLCLWRILLSACR  601

Query  1317  INKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGC  1138
              ++++ LG YA E+++ +   ++SA+V LS+IY+ L   ++  ++R++M  + + KE GC
Sbjct  602   NHRNYELGAYAGEKLMELGSQESSAYVLLSSIYSALGRLNDVERVRRIMSIRGISKEPGC  661

Query  1137  SWTELQNKIYCF  1102
             SW EL+N+++ F
Sbjct  662   SWIELKNQVHVF  673



>gb|AEB39776.1| pentatricopeptide repeat protein 78 [Funaria hygrometrica]
Length=1020

 Score =   449 bits (1156),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 245/726 (34%), Positives = 399/726 (55%), Gaps = 4/726 (1%)
 Frame = -2

Query  3060  QIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKR  2881
             +++ SC +  ++  G+  H + +K     DV   N +L+MY     I  A+++FD+M  +
Sbjct  249   RLLSSCKSPSALECGREIHVEAMKARLLFDVNVANCILNMYAKCGSIHEAREVFDKMETK  308

Query  2880  NVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEI  2701
             +V++WT +I  Y+  G SE A   F+ M  ++G  PN  TY+  L+A S   A + GK +
Sbjct  309   SVVSWTIIIGGYADCGHSEIAFEIFQKM-QQEGVVPNRITYINVLNAFSGPAALKWGKTV  367

Query  2700  HGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEY  2521
             H  I  A    +  V   LV  Y KCG  K  + VF+ ++  + + W +++    + G +
Sbjct  368   HSHILNAGHESDLAVGTALVKMYAKCGSYKDCRQVFEKLVNRDLIAWNTMIGGLAEGGNW  427

Query  2520  DEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGL  2341
             +E   I+ +  R G++ N+    I L AC +   L +G  IH  +VK G   D  V   L
Sbjct  428   EEASEIYHQMQREGMMPNKITYVILLNACVNPTALHWGREIHSRVVKDGFMFDISVQNAL  487

Query  2340  VNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSE  2161
             ++ Y +CG +  A   FN     ++ +WTA+IGG  + G G EA+ +F  +  +GLKP+ 
Sbjct  488   ISMYARCGSIKDARLLFNKMVRKDIISWTAMIGGLAKSGLGAEALAVFQDMQQAGLKPNR  547

Query  2160  RTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQE  1981
              TY S+L A +       G ++H  +I+ G  +   V N LV+ YS    + ++ ++F  
Sbjct  548   VTYTSILNACSSPAALDWGRRIHQQVIEAGLATDAHVANTLVNMYSMCGSVKDARQVFDR  607

Query  1980  MTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWG  1801
             MT+ DIV +NA+I GY      ++A+KL   +  EGL+P+  TY  +L+ C +  ++EW 
Sbjct  608   MTQRDIVAYNAMIGGYAAHNLGKEALKLFDRLQEEGLKPDKVTYINMLNACANSGSLEWA  667

Query  1800  KQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQH  1621
             K++H  ++K G+ S+  +G+ L+  YAKCG   DA  VFD +  +N++SWN ++ G AQH
Sbjct  668   KEIHSLVLKDGYLSDTSLGNALVSTYAKCGSFSDALLVFDKMMKRNVISWNAIIGGCAQH  727

Query  1620  GFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNH  1441
             G G++ L+++  M+  G+KP+ +TFV +LSAC H GLLEEG  +F SM  ++GITP   H
Sbjct  728   GRGQDVLQLFERMKMEGIKPDIVTFVSLLSACSHAGLLEEGRRYFCSMSRDFGITPTIEH  787

Query  1440  LACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSID  1261
               CMV+L  R GQ  +    I++ P + +  +W  LL  C I+ +  + + AAE  L +D
Sbjct  788   YGCMVDLLGRAGQLDEVEALIKTMPFQANTRIWGALLGACRIHGNVPVAERAAESSLKLD  847

Query  1260  PNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNML  1081
             P++ + +V LS++YA   MWD AA++RK+M+Q+ + KE G SW E+ +K++ F +     
Sbjct  848   PDNAAVYVALSHMYAAAGMWDSAAKLRKLMEQRGVTKEPGRSWIEVGDKLHYFVAEDRSH  907

Query  1080  LGEVSMKKLLIGLTAQLLDAGYVPDTKL---SFDYGD*LGLSIRHLSRFVKFDPPISTTG  910
                  +   L  LT  +   GYVPDT+      D G+       H  R       IST  
Sbjct  908   PESEKIYAELDKLTHAMKMEGYVPDTRSVMHDVDEGEKENAVCHHSERLAIAYGLISTLP  967

Query  909   GSKLAV  892
             G+ + +
Sbjct  968   GTPIRI  973


 Score =   320 bits (819),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 174/582 (30%), Positives = 309/582 (53%), Gaps = 5/582 (1%)
 Frame = -2

Query  3060  QIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM--P  2887
             ++++ C   K +++G+  H  +I++ +  D YT N L++MY+    IE A+++++++   
Sbjct  146   KMLKRCIEVKDLVAGREVHEHIIQHCTVLDQYTVNALINMYIQCGSIEEARQVWNKLNHT  205

Query  2886  KRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGK  2707
             +R V +W  ++  Y   G  E+AL   R M  + G      T +  LS+C    A   G+
Sbjct  206   ERTVHSWNAMVVGYVQYGYIEEALKLLREM-QQHGLALGRATTMRLLSSCKSPSALECGR  264

Query  2706  EIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCG  2527
             EIH    +A    +  V+NC++N Y KCG +  A+ VFD M   + V+W  ++  +  CG
Sbjct  265   EIHVEAMKARLLFDVNVANCILNMYAKCGSIHEAREVFDKMETKSVVSWTIIIGGYADCG  324

Query  2526  EYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVT  2347
               +    IF +  + GV+ N       L A +    L +G  +H  I+  G + D  V T
Sbjct  325   HSEIAFEIFQKMQQEGVVPNRITYINVLNAFSGPAALKWGKTVHSHILNAGHESDLAVGT  384

Query  2346  GLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKP  2167
              LV  Y KCG        F      +L AW  +IGG  + G   EA  ++ ++   G+ P
Sbjct  385   ALVKMYAKCGSYKDCRQVFEKLVNRDLIAWNTMIGGLAEGGNWEEASEIYHQMQREGMMP  444

Query  2166  SERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
             ++ TY  +L A  +      G ++HS ++K GF     V NAL+  Y++   + ++  +F
Sbjct  445   NKITYVILLNACVNPTALHWGREIHSRVVKDGFMFDISVQNALISMYARCGSIKDARLLF  504

Query  1986  QEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIE  1807
              +M   DI++W A+I G  +SG   +A+ + Q+M   GL+PN  TY+ IL+ C    A++
Sbjct  505   NKMVRKDIISWTAMIGGLAKSGLGAEALAVFQDMQQAGLKPNRVTYTSILNACSSPAALD  564

Query  1806  WGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYA  1627
             WG+++H ++++ G  ++  V +TL++MY+ CG + DAR+VFD +  +++V++N M+ GYA
Sbjct  565   WGRRIHQQVIEAGLATDAHVANTLVNMYSMCGSVKDARQVFDRMTQRDIVAYNAMIGGYA  624

Query  1626  QHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRT  1447
              H  GKEAL+++  +QE G+KP+ +T++ +L+AC +     E     +S+    G    T
Sbjct  625   AHNLGKEALKLFDRLQEEGLKPDKVTYINMLNACAN-SGSLEWAKEIHSLVLKDGYLSDT  683

Query  1446  NHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGC  1321
             +    +V+ +A+ G    A   +     K + + W  ++ GC
Sbjct  684   SLGNALVSTYAKCGSFSDAL-LVFDKMMKRNVISWNAIIGGC  724


 Score =   251 bits (641),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 145/516 (28%), Positives = 256/516 (50%), Gaps = 10/516 (2%)
 Frame = -2

Query  2847  YSHMGLSEKAL-GSFRSM-----VLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIF  2686
             +SH    E+ + G  R+M     + + G   N   Y+  L  C  +     G+E+H  I 
Sbjct  109   HSHTYKDERTITGKDRAMDVVQYLQQQGARVNSCDYMKMLKRCIEVKDLVAGREVHEHII  168

Query  2685  RAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAM--LEPNTVTWASLLSCHCQCGEYDEG  2512
             +    L+ +  N L+N Y +CG ++ A+ V++ +   E    +W +++  + Q G  +E 
Sbjct  169   QHCTVLDQYTVNALINMYIQCGSIEEARQVWNKLNHTERTVHSWNAMVVGYVQYGYIEEA  228

Query  2511  LRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNF  2332
             L++     + G+ +        L +C S   L  G  IH   +K  +  D  V   ++N 
Sbjct  229   LKLLREMQQHGLALGRATTMRLLSSCKSPSALECGREIHVEAMKARLLFDVNVANCILNM  288

Query  2331  YVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTY  2152
             Y KCG +  A   F+      + +WT +IGG    G    A  +F K+   G+ P+  TY
Sbjct  289   YAKCGSIHEAREVFDKMETKSVVSWTIIIGGYADCGHSEIAFEIFQKMQQEGVVPNRITY  348

Query  2151  ASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTE  1972
              +VL AF+     + G  +HS I+  G  S   V  ALV  Y+K     +  ++F+++  
Sbjct  349   INVLNAFSGPAALKWGKTVHSHILNAGHESDLAVGTALVKMYAKCGSYKDCRQVFEKLVN  408

Query  1971  YDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQV  1792
              D++ WN +I G    G++E+A ++  +M  EG+ PN  TY  +L+ C +  A+ WG+++
Sbjct  409   RDLIAWNTMIGGLAEGGNWEEASEIYHQMQREGMMPNKITYVILLNACVNPTALHWGREI  468

Query  1791  HCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFG  1612
             H R++K GF  ++ V + LI MYA+CG + DAR +F+ +  K+++SW  M+ G A+ G G
Sbjct  469   HSRVVKDGFMFDISVQNALISMYARCGSIKDARLLFNKMVRKDIISWTAMIGGLAKSGLG  528

Query  1611  KEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLAC  1432
              EAL ++  MQ+ G+KPN +T+  +L+AC       +     +      G+    +    
Sbjct  529   AEALAVFQDMQQAGLKPNRVTYTSILNACS-SPAALDWGRRIHQQVIEAGLATDAHVANT  587

Query  1431  MVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
             +VN+++  G  K A        ++ D V +  ++ G
Sbjct  588   LVNMYSMCGSVKDARQVFDRMTQR-DIVAYNAMIGG  622


 Score =   246 bits (628),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 135/490 (28%), Positives = 253/490 (52%), Gaps = 3/490 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +++   ++ + +   ++  GK  H+ ++  G +SD+     L+ MY      +  +++
Sbjct  343   PNRITYINVLNAFSGPAALKWGKTVHSHILNAGHESDLAVGTALVKMYAKCGSYKDCRQV  402

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F+++  R++I W T+I   +  G  E+A   +  M  E G  PN  TYV  L+AC    A
Sbjct  403   FEKLVNRDLIAWNTMIGGLAEGGNWEEASEIYHQMQRE-GMMPNKITYVILLNACVNPTA  461

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G+EIH R+ +     +  V N L++ Y +CG +K A+L+F+ M+  + ++W +++  
Sbjct  462   LHWGREIHSRVVKDGFMFDISVQNALISMYARCGSIKDARLLFNKMVRKDIISWTAMIGG  521

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
               + G   E L +F    +AG+  N       L AC+S   L +G  IH  +++ G+  D
Sbjct  522   LAKSGLGAEALAVFQDMQQAGLKPNRVTYTSILNACSSPAALDWGRRIHQQVIEAGLATD  581

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
              +V   LVN Y  CG +  A   F+  +  ++ A+ A+IGG      G+EA+ LF +L  
Sbjct  582   AHVANTLVNMYSMCGSVKDARQVFDRMTQRDIVAYNAMIGGYAAHNLGKEALKLFDRLQE  641

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              GLKP + TY ++L A  ++   +   ++HS ++K G+ S T + NALV  Y+K     +
Sbjct  642   EGLKPDKVTYINMLNACANSGSLEWAKEIHSLVLKDGYLSDTSLGNALVSTYAKCGSFSD  701

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F +M + ++++WNA+I G  + G  +  ++L + M  EG++P++ T+  +LS C  
Sbjct  702   ALLVFDKMMKRNVISWNAIIGGCAQHGRGQDVLQLFERMKMEGIKPDIVTFVSLLSACSH  761

Query  1821  LPAIEWGKQVHCRIMKP-GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-NLVSWN  1648
                +E G++  C + +  G    +     ++D+  + G+L +   +   +P + N   W 
Sbjct  762   AGLLEEGRRYFCSMSRDFGITPTIEHYGCMVDLLGRAGQLDEVEALIKTMPFQANTRIWG  821

Query  1647  TMLIGYAQHG  1618
              +L     HG
Sbjct  822   ALLGACRIHG  831



>ref|XP_002304652.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE79631.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=820

 Score =   443 bits (1140),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 242/684 (35%), Positives = 371/684 (54%), Gaps = 1/684 (0%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             +++SC  N    +GK  H ++IK G+  D++ NN LL+ YV +  +  A KLFDEMP RN
Sbjct  50    LLQSCIRNGDCATGKYLHCEIIKKGNCLDLFANNILLNFYVKYDSLPDAAKLFDEMPDRN  109

Query  2877  VITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
              +++ TLI  YS      +A+G F S +  +G   N + +   L        A+ G  +H
Sbjct  110   TVSFVTLIQGYSQCLRFSEAIGLF-SRLQGEGHELNPFVFSTVLKLLVSAEWAKLGFSVH  168

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
               +++     + FV   L++ Y  CG  + A+ VFDA+   + V+W  +++C+ +   ++
Sbjct  169   ACVYKLGFDSDAFVGTALIDCYSVCGYAECARQVFDAIEYKDMVSWTGMVACYVENECFE  228

Query  2517  EGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLV  2338
             E L++F R    G   N F     L AC  +E    G  +H    K     + +V   L+
Sbjct  229   ESLKLFSRMRIVGFKPNNFTFASVLKACVGLEVFNVGKAVHGCAFKTSYLEELFVGVELI  288

Query  2337  NFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSER  2158
             + Y+K G +  A   F      ++  W+ +I    Q  +  EA+ +FC++    + P++ 
Sbjct  289   DLYIKSGDVDDALQVFEEMPKDDVIPWSFMIARYAQSEQSEEAIEMFCRMRRGLVLPNQF  348

Query  2157  TYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEM  1978
             T AS+L A     + Q+G Q+H  ++K+G +   FV NAL+D Y+K   ++ S ++F E 
Sbjct  349   TLASLLQACASLVDLQLGNQIHCHVVKVGLDMNVFVSNALMDMYAKCGRMENSLQLFSES  408

Query  1977  TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGK  1798
                  V+WN +I GY+++G+ E+A+ L ++ML   ++    TYS +L  C  + A+E G 
Sbjct  409   PNCTDVSWNTVIVGYVQAGNGEKALILFKDMLECQVQGTEVTYSSVLRACAGIAALEPGS  468

Query  1797  QVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHG  1618
             Q+H   +K  +D N VVG+ LIDMYAKCG + DAR VFD+L   + VSWN M+ GY+ HG
Sbjct  469   QIHSLSVKTIYDKNTVVGNALIDMYAKCGNIKDARLVFDMLREHDQVSWNAMISGYSVHG  528

Query  1617  FGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHL  1438
                EAL+ +  M E   KP+ +TFVG+LSAC + GLL+ G  +F SM   Y I P   H 
Sbjct  529   LYGEALKTFESMLETECKPDKVTFVGILSACSNAGLLDRGQAYFKSMVEEYDIEPCAEHY  588

Query  1437  ACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDP  1258
              CMV L  R G   KA   +   P +P  +VWR LLS C I+ D  LG+ +A+ +L I+P
Sbjct  589   TCMVWLLGRSGHLDKAAKLVHEIPFEPSVMVWRALLSACVIHNDVELGRISAQRVLEIEP  648

Query  1257  NDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLL  1078
              D + HV LSNIYA    W   A IR  MK+K ++KE G SW E Q +++ FS       
Sbjct  649   EDEATHVLLSNIYANARRWGNVASIRTSMKRKGIRKEPGLSWIENQGRVHYFSVGDTSHP  708

Query  1077  GEVSMKKLLIGLTAQLLDAGYVPD  1006
                 +  +L  L  +  + GYVPD
Sbjct  709   DTKLINGMLEWLNMKARNEGYVPD  732


 Score =   260 bits (664),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 157/491 (32%), Positives = 255/491 (52%), Gaps = 10/491 (2%)
 Frame = -2

Query  2772  NHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVF  2593
             N Y Y   L +C   G   TGK +H  I +    L+ F +N L+NFY K   L  A  +F
Sbjct  43    NTYIYGSLLQSCIRNGDCATGKYLHCEIIKKGNCLDLFANNILLNFYVKYDSLPDAAKLF  102

Query  2592  DAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLG  2413
             D M + NTV++ +L+  + QC  + E + +F R    G  +N F+    L    S E   
Sbjct  103   DEMPDRNTVSFVTLIQGYSQCLRFSEAIGLFSRLQGEGHELNPFVFSTVLKLLVSAEWAK  162

Query  2412  FGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCV  2233
              G  +H  + K G   D +V T L++ Y  CG    A   F+     ++ +WT ++   V
Sbjct  163   LGFSVHACVYKLGFDSDAFVGTALIDCYSVCGYAECARQVFDAIEYKDMVSWTGMVACYV  222

Query  2232  QQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTF  2053
             +     E++ LF ++   G KP+  T+ASVL A    + F VG  +H    K  +    F
Sbjct  223   ENECFEESLKLFSRMRIVGFKPNNFTFASVLKACVGLEVFNVGKAVHGCAFKTSYLEELF  282

Query  2052  VCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEG  1873
             V   L+D Y KS  +D++ ++F+EM + D++ W+ +IA Y +S   E+AI++   M    
Sbjct  283   VGVELIDLYIKSGDVDDALQVFEEMPKDDVIPWSFMIARYAQSEQSEEAIEMFCRMRRGL  342

Query  1872  LEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDAR  1693
             + PN  T + +L  C  L  ++ G Q+HC ++K G D NV V + L+DMYAKCGR+ ++ 
Sbjct  343   VLPNQFTLASLLQACASLVDLQLGNQIHCHVVKVGLDMNVFVSNALMDMYAKCGRMENSL  402

Query  1692  KVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSAC-GHg  1516
             ++F   P    VSWNT+++GY Q G G++AL ++  M E  V+  ++T+  VL AC G  
Sbjct  403   QLFSESPNCTDVSWNTVIVGYVQAGNGEKALILFKDMLECQVQGTEVTYSSVLRACAGIA  462

Query  1515  glleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKA---YDFIRSFPEKPDKVV  1345
              L      H  S+K  Y       +   +++++A+ G  K A   +D +R    + D+V 
Sbjct  463   ALEPGSQIHSLSVKTIYDKNTVVGN--ALIDMYAKCGNIKDARLVFDMLR----EHDQVS  516

Query  1344  WRCLLSGCNIN  1312
             W  ++SG +++
Sbjct  517   WNAMISGYSVH  527


 Score =   164 bits (416),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 126/476 (26%), Positives = 215/476 (45%), Gaps = 57/476 (12%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + + ++++C   +    GKA H    K     +++    L+ +Y+   +++ A ++
Sbjct  244   PNNFTFASVLKACVGLEVFNVGKAVHGCAFKTSYLEELFVGVELIDLYIKSGDVDDALQV  303

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSF----RSMVLEDGFTPNHYTYVGALSACS  2734
             F+EMPK +VI W+ +I+ Y+    SE+A+  F    R +VL     PN +T    L AC+
Sbjct  304   FEEMPKDDVIPWSFMIARYAQSEQSEEAIEMFCRMRRGLVL-----PNQFTLASLLQACA  358

Query  2733  CLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWAS  2554
              L   + G +IH  + +    +N FVSN L++ Y KCG ++++  +F        V+W +
Sbjct  359   SLVDLQLGNQIHCHVVKVGLDMNVFVSNALMDMYAKCGRMENSLQLFSESPNCTDVSWNT  418

Query  2553  LLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCG  2374
             ++  + Q G  ++ L +F   L   V   E      L ACA +  L  G  IH L VK  
Sbjct  419   VIVGYVQAGNGEKALILFKDMLECQVQGTEVTYSSVLRACAGIAALEPGSQIHSLSVKTI  478

Query  2373  VKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFC  2194
                +  V   L++ Y KCG +  A   F+M    +  +W A+I G    G   EA+  F 
Sbjct  479   YDKNTVVGNALIDMYAKCGNIKDARLVFDMLREHDQVSWNAMISGYSVHGLYGEALKTFE  538

Query  2193  KLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSN  2014
              +L +  KP + T+  +L A                            C       S + 
Sbjct  539   SMLETECKPDKVTFVGILSA----------------------------C-------SNAG  563

Query  2013  LLDESFKIFQEMT-EYDIVT----WNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTY  1849
             LLD     F+ M  EYDI      +  ++    RSGH ++A KL+ E+ F   EP++  +
Sbjct  564   LLDRGQAYFKSMVEEYDIEPCAEHYTCMVWLLGRSGHLDKAAKLVHEIPF---EPSVMVW  620

Query  1848  SCILSICGDLPAIEWGKQVHCRIM--KPGFDSNVVVGSTLIDMYAKCGRLGDARKV  1687
               +LS C     +E G+    R++  +P  ++  V+   L ++YA   R G+   +
Sbjct  621   RALLSACVIHNDVELGRISAQRVLEIEPEDEATHVL---LSNIYANARRWGNVASI  673



>ref|XP_010272360.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
isoform X2 [Nelumbo nucifera]
Length=858

 Score =   444 bits (1143),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 231/689 (34%), Positives = 384/689 (56%), Gaps = 1/689 (0%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +   ++++C+  K +  GK  H  ++  G +SDV+  N L+ MY    E+E  ++LFD
Sbjct  82    EFTFPSVLKACSITKDLKGGKQIHGIVVVTGYESDVFVANTLVVMYAKCGELEDCKRLFD  141

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
             E+P+RNVI+W  L S Y       +A+  F+ MV E G  PN ++    L+AC+      
Sbjct  142   EIPERNVISWNALFSGYVQNDCYGEAVDQFKEMVAE-GTKPNEFSLSSILNACTGSEDYS  200

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              GK +HG + +     + + +N LV+ Y K G  +++  +F  +  P+ V+W + ++   
Sbjct  201   QGKRVHGYLVKLGYDSDLYSNNALVDMYSKLGDFEASMAIFQNIALPDIVSWNAAIAGCV  260

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
               G +D  L +  +   AG   N+F     L ACA +     G  +H  ++K   + D +
Sbjct  261   LHGCHDWALELLGQMKDAGTFPNKFTLSSILKACAGIGMKELGKQVHSNLIKMDTESDTF  320

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V  GL++ Y KC  +  A   F++    ++ +W A+I G  Q G+ +EA++LF  +L  G
Sbjct  321   VSVGLIDMYSKCTLVHDARMVFDLMPEHDVISWNAIISGYSQNGEDKEAISLFIDMLKEG  380

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
                +  T + +L +    +  +V  Q+H+  +K GF   ++V N+L+D Y K + ++++ 
Sbjct  381   FGFNRTTLSVILKSTAVLQASEVVKQVHALAMKAGFEYDSYVVNSLIDSYGKCSHIEDAT  440

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
             +IF+E    D+ ++ ++I  Y + G  E+A+KL  +ML  GL P+    S +L+ C +L 
Sbjct  441   RIFEECPFGDVASFTSMITAYSQYGQGEEALKLFLKMLDMGLRPDGFVCSSLLNACANLS  500

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             A E GKQ+H  I+K GF S+V  G+ L++MYAKCG + DA + F  +P + +VSW+ M+ 
Sbjct  501   AYEQGKQIHVHILKSGFISDVFAGNALVNMYAKCGSVDDADRAFLEIPERGIVSWSAMIG  560

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             G AQHG G+EAL ++  M E GV PN IT V VL AC H GL+ E   +F SM   +GI 
Sbjct  561   GLAQHGQGREALSLFHQMLEEGVFPNHITLVSVLCACNHAGLIAEAKQYFESMDKQFGIE  620

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEE  1276
             P   H ACMV+L  R G+  +A + +   P + +  VW  LL    I+ +  LG++AAE 
Sbjct  621   PMQEHYACMVDLLGRAGRLDEAVELVNKMPFEANASVWGALLGASRIHGNLELGRHAAEM  680

Query  1275  ILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSS  1096
             + +++P  +  HV L+N+YA + MW+  A++R++MK  ++KKE G SW E+++K++ F  
Sbjct  681   LFTLEPEKSGTHVLLANMYASVGMWENVAKVRRLMKDSKVKKEPGMSWIEVKDKVHAFIV  740

Query  1095  SYNMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
                       +   L  L+  +  AGYVP
Sbjct  741   GDRSHSRTAEIYAKLDELSELMCKAGYVP  769


 Score =   310 bits (793),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 190/565 (34%), Positives = 301/565 (53%), Gaps = 11/565 (2%)
 Frame = -2

Query  3006  HAQLIKYGSKSDVYTNNHLLSMYVTFHEIEC-AQKLFDEMPKRNVITWTTLISSYSHMGL  2830
             HA +IK G   D    NHL+++Y +  +I C A+ L DE+P+ ++++W+ LIS Y+  G 
Sbjct  4     HAHIIKSGFSEDTALRNHLINLY-SKRQIFCFARNLIDEIPEPDLVSWSALISGYAQNGF  62

Query  2829  SEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSN  2650
              ++AL +F  M    G   N +T+   L ACS     + GK+IHG +       + FV+N
Sbjct  63    GKEALSAFIEM-HSSGVKCNEFTFPSVLKACSITKDLKGGKQIHGIVVVTGYESDVFVAN  121

Query  2649  CLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLV  2470
              LV  Y KCG L+  + +FD + E N ++W +L S + Q   Y E +  F   +  G   
Sbjct  122   TLVVMYAKCGELEDCKRLFDEIPERNVISWNALFSGYVQNDCYGEAVDQFKEMVAEGTKP  181

Query  2469  NEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTF  2290
             NEF     L AC   E    G  +H  +VK G   D Y    LV+ Y K G    +   F
Sbjct  182   NEFSLSSILNACTGSEDYSQGKRVHGYLVKLGYDSDLYSNNALVDMYSKLGDFEASMAIF  241

Query  2289  NMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQ  2110
                + P++ +W A I GCV  G    A+ L  ++  +G  P++ T +S+L A       +
Sbjct  242   QNIALPDIVSWNAAIAGCVLHGCHDWALELLGQMKDAGTFPNKFTLSSILKACAGIGMKE  301

Query  2109  VGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYI  1930
             +G Q+HS +IK+   S TFV   L+D YSK  L+ ++  +F  M E+D+++WNA+I+GY 
Sbjct  302   LGKQVHSNLIKMDTESDTFVSVGLIDMYSKCTLVHDARMVFDLMPEHDVISWNAIISGYS  361

Query  1929  RSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVV  1750
             ++G  ++AI L  +ML EG   N  T S IL     L A E  KQVH   MK GF+ +  
Sbjct  362   QNGEDKEAISLFIDMLKEGFGFNRTTLSVILKSTAVLQASEVVKQVHALAMKAGFEYDSY  421

Query  1749  VGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENG  1570
             V ++LID Y KC  + DA ++F+  P  ++ S+ +M+  Y+Q+G G+EAL+++  M + G
Sbjct  422   VVNSLIDSYGKCSHIEDATRIFEECPFGDVASFTSMITAYSQYGQGEEALKLFLKMLDMG  481

Query  1569  VKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKK  1393
             ++P+      +L+AC +    E+G   H + +K+  G          +VN++A+ G    
Sbjct  482   LRPDGFVCSSLLNACANLSAYEQGKQIHVHILKS--GFISDVFAGNALVNMYAKCGSVD-  538

Query  1392  AYDFIRSFPEKPDK--VVWRCLLSG  1324
               D  R+F E P++  V W  ++ G
Sbjct  539   --DADRAFLEIPERGIVSWSAMIGG  561


 Score =   258 bits (660),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 154/513 (30%), Positives = 260/513 (51%), Gaps = 6/513 (1%)
 Frame = -2

Query  3117  SQGSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMY  2938
              Q   ++     P + SLS I+ +CT ++    GK  H  L+K G  SD+Y+NN L+ MY
Sbjct  169   DQFKEMVAEGTKPNEFSLSSILNACTGSEDYSQGKRVHGYLVKLGYDSDLYSNNALVDMY  228

Query  2937  VTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTY  2758
                 + E +  +F  +   ++++W   I+     G  + AL     M  + G  PN +T 
Sbjct  229   SKLGDFEASMAIFQNIALPDIVSWNAAIAGCVLHGCHDWALELLGQMK-DAGTFPNKFTL  287

Query  2757  VGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLE  2578
                L AC+ +G    GK++H  + + +   + FVS  L++ Y KC L+  A++VFD M E
Sbjct  288   SSILKACAGIGMKELGKQVHSNLIKMDTESDTFVSVGLIDMYSKCTLVHDARMVFDLMPE  347

Query  2577  PNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGI  2398
              + ++W +++S + Q GE  E + +F+  L+ G   N     + L + A ++       +
Sbjct  348   HDVISWNAIISGYSQNGEDKEAISLFIDMLKEGFGFNRTTLSVILKSTAVLQASEVVKQV  407

Query  2397  HCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKG  2218
             H L +K G + D YVV  L++ Y KC  +  A   F      ++ ++T++I    Q G+G
Sbjct  408   HALAMKAGFEYDSYVVNSLIDSYGKCSHIEDATRIFEECPFGDVASFTSMITAYSQYGQG  467

Query  2217  REAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNAL  2038
              EA+ LF K+L  GL+P     +S+L A  +   ++ G Q+H  I+K GF S  F  NAL
Sbjct  468   EEALKLFLKMLDMGLRPDGFVCSSLLNACANLSAYEQGKQIHVHILKSGFISDVFAGNAL  527

Query  2037  VDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNL  1858
             V+ Y+K   +D++ + F E+ E  IV+W+A+I G  + G   +A+ L  +ML EG+ PN 
Sbjct  528   VNMYAKCGSVDDADRAFLEIPERGIVSWSAMIGGLAQHGQGREALSLFHQMLEEGVFPNH  587

Query  1857  HTYSCILSICGDLPAIEWGKQVHCRIMKP-GFDSNVVVGSTLIDMYAKCGRLGDARKVFD  1681
              T   +L  C     I   KQ    + K  G +      + ++D+  + GRL +A ++ +
Sbjct  588   ITLVSVLCACNHAGLIAEAKQYFESMDKQFGIEPMQEHYACMVDLLGRAGRLDEAVELVN  647

Query  1680  ILPCK-NLVSWNTMLIGYAQHG---FGKEALEI  1594
              +P + N   W  +L     HG    G+ A E+
Sbjct  648   KMPFEANASVWGALLGASRIHGNLELGRHAAEM  680


 Score =   252 bits (643),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 172/539 (32%), Positives = 273/539 (51%), Gaps = 34/539 (6%)
 Frame = -2

Query  2706  EIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCG  2527
             +IH  I ++  + +  + N L+N Y K  +   A+ + D + EP+ V+W++L+S + Q G
Sbjct  2     QIHAHIIKSGFSEDTALRNHLINLYSKRQIFCFARNLIDEIPEPDLVSWSALISGYAQNG  61

Query  2526  EYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVT  2347
                E L  F+    +GV  NEF     L AC+  + L  G  IH ++V  G + D +V  
Sbjct  62    FGKEALSAFIEMHSSGVKCNEFTFPSVLKACSITKDLKGGKQIHGIVVVTGYESDVFVAN  121

Query  2346  GLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKP  2167
              LV  Y KCG+L      F+      + +W AL  G VQ     EAV+ F ++++ G KP
Sbjct  122   TLVVMYAKCGELEDCKRLFDEIPERNVISWNALFSGYVQNDCYGEAVDQFKEMVAEGTKP  181

Query  2166  SERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
             +E + +S+L A T ++++  G ++H +++KLG++S  +  NALVD YSK    + S  IF
Sbjct  182   NEFSLSSILNACTGSEDYSQGKRVHGYLVKLGYDSDLYSNNALVDMYSKLGDFEASMAIF  241

Query  1986  QEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIE  1807
             Q +   DIV+WNA IAG +  G ++ A++LL +M   G  PN  T S IL  C  +   E
Sbjct  242   QNIALPDIVSWNAAIAGCVLHGCHDWALELLGQMKDAGTFPNKFTLSSILKACAGIGMKE  301

Query  1806  WGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYA  1627
              GKQVH  ++K   +S+  V   LIDMY+KC  + DAR VFD++P  +++SWN ++ GY+
Sbjct  302   LGKQVHSNLIKMDTESDTFVSVGLIDMYSKCTLVHDARMVFDLMPEHDVISWNAIISGYS  361

Query  1626  QHGFGKEALEIYSMMQENGVKPNDITFVGVLSACG-----------HgglleegLNH---  1489
             Q+G  KEA+ ++  M + G   N  T   +L +             H   ++ G  +   
Sbjct  362   QNGEDKEAISLFIDMLKEGFGFNRTTLSVILKSTAVLQASEVVKQVHALAMKAGFEYDSY  421

Query  1488  -FNSMKNNYG----ITPRTN-----------HLACMVNLFARKGQTKKAYDFIRSFPE--  1363
               NS+ ++YG    I   T                M+  +++ GQ ++A        +  
Sbjct  422   VVNSLIDSYGKCSHIEDATRIFEECPFGDVASFTSMITAYSQYGQGEEALKLFLKMLDMG  481

Query  1362  -KPDKVVWRCLLSGCNINKDFVLGKYAAEEIL-SIDPNDTSAHVTLSNIYARLNMWDEA  1192
              +PD  V   LL+ C     +  GK     IL S   +D  A   L N+YA+    D+A
Sbjct  482   LRPDGFVCSSLLNACANLSAYEQGKQIHVHILKSGFISDVFAGNALVNMYAKCGSVDDA  540


 Score =   201 bits (512),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 194/366 (53%), Gaps = 4/366 (1%)
 Frame = -2

Query  2406  MGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQ  2227
             M IH  I+K G   D  +   L+N Y K      A N  +    P+L +W+ALI G  Q 
Sbjct  1     MQIHAHIIKSGFSEDTALRNHLINLYSKRQIFCFARNLIDEIPEPDLVSWSALISGYAQN  60

Query  2226  GKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVC  2047
             G G+EA++ F ++ SSG+K +E T+ SVL A + TK+ + G Q+H  ++  G+ S  FV 
Sbjct  61    GFGKEALSAFIEMHSSGVKCNEFTFPSVLKACSITKDLKGGKQIHGIVVVTGYESDVFVA  120

Query  2046  NALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLE  1867
             N LV  Y+K   L++  ++F E+ E ++++WNAL +GY+++  Y +A+   +EM+ EG +
Sbjct  121   NTLVVMYAKCGELEDCKRLFDEIPERNVISWNALFSGYVQNDCYGEAVDQFKEMVAEGTK  180

Query  1866  PNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKV  1687
             PN  + S IL+ C        GK+VH  ++K G+DS++   + L+DMY+K G    +  +
Sbjct  181   PNEFSLSSILNACTGSEDYSQGKRVHGYLVKLGYDSDLYSNNALVDMYSKLGDFEASMAI  240

Query  1686  FDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSAC-GHggl  1510
             F  +   ++VSWN  + G   HG    ALE+   M++ G  PN  T   +L AC G G  
Sbjct  241   FQNIALPDIVSWNAAIAGCVLHGCHDWALELLGQMKDAGTFPNKFTLSSILKACAGIGMK  300

Query  1509  leegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLL  1330
                   H N +K +      T     +++++++      A       PE  D + W  ++
Sbjct  301   ELGKQVHSNLIKMD--TESDTFVSVGLIDMYSKCTLVHDARMVFDLMPEH-DVISWNAII  357

Query  1329  SGCNIN  1312
             SG + N
Sbjct  358   SGYSQN  363



>ref|XP_010932176.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Elaeis guineensis]
 ref|XP_010932177.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Elaeis guineensis]
Length=724

 Score =   440 bits (1132),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 254/731 (35%), Positives = 403/731 (55%), Gaps = 24/731 (3%)
 Frame = -2

Query  3141  ASLRPA*QSQGSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYT  2962
             AS RP     G ++ T+       +L +++  C   K++ SG + HA +IK GS + V  
Sbjct  5     ASRRPKLALGGEAVATS------QTLFRLLLRCAEQKNLQSGSSIHAHIIKSGSWAHVLL  58

Query  2961  NNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGL--SEKALGSFRSMVLE  2788
              N ++ MY     +  A   FD M  R+V++W +LI+SYSH     S      F+ M  +
Sbjct  59    ANSVVIMYAKCGHLATAAAAFDAMRSRDVVSWNSLINSYSHQPPPHSNAVFKLFKRMRAD  118

Query  2787  DGF--TPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLL  2614
              G    PN +T+ G  +A S   A   G+E H    +     + F+ + L++ Y K GLL
Sbjct  119   GGVHVLPNAFTFAGVFTAASASHALSAGREAHCVAIKTANCDDIFLGSSLLSMYCKVGLL  178

Query  2613  KSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVL-VNEFLCGIALGA  2437
               A++VFD ML+ N+V+WA+++S +       E   +F   L  G    NEF+    L A
Sbjct  179   ADARMVFDRMLQRNSVSWAAMISGYAVDKHGAEAFELFRSMLEEGECDTNEFVITSILSA  238

Query  2436  CASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAW  2257
              +    L  G  +H L +K G+     V   L+  Y KC ++  A   F  +S      W
Sbjct  239   VSLPGFLEMGEQVHGLAIKNGLSSFLSVENSLITLYAKCERMDEALLMFESSSEKNSITW  298

Query  2256  TALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIK  2077
             +A+I G  Q G  R+A++LF ++  + ++PSE T+  VL A +D      G Q H F++K
Sbjct  299   SAMITGYAQNGDSRKALSLFSQMQFAEIRPSEFTFVGVLNACSDVMTLIEGTQAHGFLLK  358

Query  2076  LGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKL  1897
             LGF    +V  ALVD Y+K   +D++ K F ++ E DI  W ++I GY+++G +E+A+ L
Sbjct  359   LGFELQVYVKTALVDMYAKCGSIDDARKGFDQLHEADIALWTSMIGGYVQNGEHEEALTL  418

Query  1896  LQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAK  1717
                M  EG+ PN  T + IL  C    A+E GKQ+H + +K GF   + +GS L  +YAK
Sbjct  419   YGRMGREGILPNNLTMASILRACSSRAALEQGKQIHAQTLKYGFSLGIPMGSALSTLYAK  478

Query  1716  CGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGV  1537
             CG L D   VF  +P +++V+WN+++ G++Q+G G EAL+++  M+  G KP+ +TFV +
Sbjct  479   CGNLEDCNCVFRRMPERDVVAWNSIISGFSQNGCGHEALDLFEEMKLEGTKPDHVTFVNL  538

Query  1536  LSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKP  1357
             L AC H GL++ G  +F SM N+YG+ PR  H ACMV++ +R G  ++A DFI + P   
Sbjct  539   LGACSHMGLIDRGWGYFRSMHNDYGLVPRVEHYACMVDILSRAGMLEEAKDFIETVPIDH  598

Query  1356  DKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRK  1177
                +WR +L  C   + F +G YA E ++ +   D+SA++ LSNIYA  + WD+  ++R+
Sbjct  599   GTCLWRIVLGACRSYRSFGIGAYAGERLMELGSQDSSAYILLSNIYAAWSRWDDVERVRR  658

Query  1176  MMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGEV---SMKKL---LIGLTAQLLDAGY  1015
             MM  + + KE GCSW E++++++ F      ++G++    MK +   +  L   + D GY
Sbjct  659   MMSFRGVNKEPGCSWVEIKSRVHAF------VVGDLQHPEMKDIYAEVRRLLDHMTDEGY  712

Query  1014  VPDTKLSF-DY  985
              P + L F DY
Sbjct  713   RPASGLPFCDY  723



>ref|XP_008808560.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Phoenix dactylifera]
Length=853

 Score =   444 bits (1142),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 250/692 (36%), Positives = 404/692 (58%), Gaps = 11/692 (2%)
 Frame = -2

Query  3069  SLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEM  2890
             +LS I++ C      + GK  H+   K+G  + V     L+ MY+    ++  +K+FD M
Sbjct  81    TLSCIVKVCGCLSDRILGKQLHSLCAKFGYGAVVGVGTSLVDMYMKCGCLDEGRKVFDRM  140

Query  2889  PKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTG  2710
             P RNV+TWT+L++ Y+  GL +  L  F  M LE G  PN +T+   +++ +  GA   G
Sbjct  141   PDRNVVTWTSLLTGYTQNGLQDTVLELFFQMQLE-GIRPNPFTFASVVASAAARGAVERG  199

Query  2709  KEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQC  2530
             K  H ++ +       FV N L++ Y KCGL++ A+ VF  M   + V+W S+++     
Sbjct  200   KRAHSQLIKFGYQSTIFVCNSLMSMYSKCGLVQEARRVFSGMANRDAVSWNSMIAG-LVL  258

Query  2529  GEYD-EGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYV  2353
              +YD E L +F R   AGV   +      +  CA+++ L F   +HC +VK G   D  +
Sbjct  259   NKYDFEALELFYRMRVAGVKATQLSFATVIKLCANLKQLVFARQLHCCVVKEGFGSDNNI  318

Query  2352  VTGLVNFYVKCGQLGLAYNTFN-MASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             +T L+  Y KC +L  A+  F+ M+ A  + +WTA+IGGC+Q G    AV LF ++    
Sbjct  319   MTALMVAYSKCSELDDAFELFSSMSGARTVVSWTAIIGGCIQNGDIGRAVFLFNEMRKEN  378

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             ++P++ TY+ +  A      FQV    H+ +IK  +     V  AL+  Y+K     ++ 
Sbjct  379   VEPNDFTYSILSTASPVVSPFQV----HAQVIKTNYQHVPSVGTALLAAYTKLGDTHDAL  434

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD-L  1819
              +F+++   DIVTW+A++A Y ++G  E A+KL +EM  EG++PN  T S  +  C    
Sbjct  435   SVFRDIEGKDIVTWSAMLACYAQAGDSEGAVKLFREMAREGVKPNEFTLSSAIDACASPT  494

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
              A + GKQ H   +K  +   + V S L+ MYAK G +  A++VF+    ++LVSWN+ML
Sbjct  495   AAADQGKQFHAISIKSRYQDAICVNSALVTMYAKRGSIESAQEVFERQSERDLVSWNSML  554

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGI  1459
              GYAQHG+GK+AL+I+  M+  G++ + ITF+GV++AC H GL+EEG  +F+SM  ++ I
Sbjct  555   SGYAQHGYGKKALKIFGEMEARGLEMDGITFIGVITACTHAGLVEEGRRYFDSMVKDHQI  614

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAE  1279
             +P   H ACMV+L++R  + ++A   I+  P   +  VWR LL  C ++++  LG+ AA+
Sbjct  615   SPTMEHYACMVDLYSRASRLEEALSLIKGMPFPANATVWRTLLGACRVHRNVSLGELAAK  674

Query  1278  EILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF-  1102
             +++S++P  ++A+V LSNIYA    W+E A IRK+M ++++KKE GCSW +++NK++ F 
Sbjct  675   KLISLEPMHSAAYVLLSNIYAAAGKWEERANIRKLMDERKVKKEAGCSWIQVKNKVHSFI  734

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPD  1006
             +S  N  L E+   KL   +  +L   GY P+
Sbjct  735   ASDRNHPLSELIYAKLE-EMMIRLKKEGYHPN  765


 Score =   182 bits (463),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 118/432 (27%), Positives = 211/432 (49%), Gaps = 7/432 (2%)
 Frame = -2

Query  2619  LLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALG  2440
             L  +   +FD +L         LL  + Q     E + +FL + R+G  +++      + 
Sbjct  28    LFSAPHQLFDKILPQGLAETNHLLLHYSQNNLNREAVDLFLETHRSGRAIDDSTLSCIVK  87

Query  2439  ACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHA  2260
              C  +     G  +H L  K G      V T LV+ Y+KCG L      F+      +  
Sbjct  88    VCGCLSDRILGKQLHSLCAKFGYGAVVGVGTSLVDMYMKCGCLDEGRKVFDRMPDRNVVT  147

Query  2259  WTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFII  2080
             WT+L+ G  Q G     + LF ++   G++P+  T+ASV+ +       + G + HS +I
Sbjct  148   WTSLLTGYTQNGLQDTVLELFFQMQLEGIRPNPFTFASVVASAAARGAVERGKRAHSQLI  207

Query  2079  KLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIK  1900
             K G+ S  FVCN+L+  YSK  L+ E+ ++F  M   D V+WN++IAG + + +  +A++
Sbjct  208   KFGYQSTIFVCNSLMSMYSKCGLVQEARRVFSGMANRDAVSWNSMIAGLVLNKYDFEALE  267

Query  1899  LLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYA  1720
             L   M   G++    +++ ++ +C +L  + + +Q+HC ++K GF S+  + + L+  Y+
Sbjct  268   LFYRMRVAGVKATQLSFATVIKLCANLKQLVFARQLHCCVVKEGFGSDNNIMTALMVAYS  327

Query  1719  KCGRLGDARKVFDILP-CKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFV  1543
             KC  L DA ++F  +   + +VSW  ++ G  Q+G    A+ +++ M++  V+PND T+ 
Sbjct  328   KCSELDDAFELFSSMSGARTVVSWTAIIGGCIQNGDIGRAVFLFNEMRKENVEPNDFTY-  386

Query  1542  GVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPE  1363
              +LS         +   H   +K NY   P       ++  + + G T  A    R   E
Sbjct  387   SILSTASPVVSPFQV--HAQVIKTNYQHVPSVG--TALLAAYTKLGDTHDALSVFRDI-E  441

Query  1362  KPDKVVWRCLLS  1327
               D V W  +L+
Sbjct  442   GKDIVTWSAMLA  453



>ref|XP_007043839.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOX99670.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=833

 Score =   443 bits (1140),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 241/684 (35%), Positives = 370/684 (54%), Gaps = 1/684 (0%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             +++ C  N   +S    H++++K G+  D++  N LL+MYV    +  A+ LFDEMP+RN
Sbjct  63    LLQRCIQNDDPISAMGLHSEILKRGNCLDLFATNILLNMYVKAQLLSEAEILFDEMPERN  122

Query  2877  VITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
              I++ TLI  Y+      +A+G F  +  E G   N + +   L     +  A  G   H
Sbjct  123   TISFVTLIQGYTQSLQFVEAVGLFTRLHRE-GHELNPFVFTSILKVLVSMEWAELGWNFH  181

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
               I++     N FV   L++ Y  CG +  A+ VFD +   + VTW  +++C+ +   ++
Sbjct  182   ACIYKLGHESNAFVGTALIDTYSVCGCVDFAREVFDGVRCKDMVTWTGMVACYAENDFFE  241

Query  2517  EGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLV  2338
             E L +F      G   N F       AC  +E      G+H  I+K   + D YV   L+
Sbjct  242   EALEVFSHMRLIGFKPNNFTFAGVFKACIGLEAFDVAKGVHGCILKARYEHDIYVGVALL  301

Query  2337  NFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSER  2158
               Y K G +G A   F      ++  W+ +I    Q  +   AV+LFC++  + + P++ 
Sbjct  302   ELYTKSGNIGNAQRVFEEIPKKDVIPWSFMISRFAQSNQSEVAVSLFCRMRRAFVVPNQF  361

Query  2157  TYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEM  1978
             T+AS L A     + ++G Q+H  + K+G +   FV NA++D Y+K   +++S ++F++ 
Sbjct  362   TFASALQACATMGDIELGKQMHGLVHKVGLDLDVFVSNAVMDVYAKCGRIEDSMQLFEKS  421

Query  1977  TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGK  1798
                + V+WN +I GY+R G   +A+ L  EML   +     TYS +L     L A+E G 
Sbjct  422   INRNDVSWNIMIVGYVRCGDAVKALGLFLEMLENRVLATEVTYSSVLCASASLAALELGT  481

Query  1797  QVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHG  1618
             Q+H   +K  +  N VV + LIDMY+KCGR+ DAR VFDI+  ++ VSWN M+ GY+ HG
Sbjct  482   QIHSLAIKTNYAKNTVVDNALIDMYSKCGRIRDARLVFDIMNERDEVSWNAMISGYSMHG  541

Query  1617  FGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHL  1438
              G EAL+I+ MMQ+ G KPN +TFVGVLSAC + GL  +G ++F SM  +YGI P   H 
Sbjct  542   LGIEALKIFQMMQDRGYKPNTLTFVGVLSACSNSGLFYQGQDYFTSMVQDYGIEPCIEHY  601

Query  1437  ACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDP  1258
             +CMV L  R G   KA   I   P +P  +VWR LL  C I+ +  LG+ +A+ IL  +P
Sbjct  602   SCMVWLLGRSGHLYKAAKLIEEIPFEPSVMVWRALLGACIIHNNVELGRLSAQRILEREP  661

Query  1257  NDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLL  1078
              D + HV LSN+YA    W+  + IR+ MK+K +KKE G SW E   +++ FS       
Sbjct  662   RDEATHVLLSNMYAIARRWENVSAIRQSMKKKGMKKEPGLSWVENHGRVHYFSVGDTSHP  721

Query  1077  GEVSMKKLLIGLTAQLLDAGYVPD  1006
                 +  +L  L  +   AG+VP+
Sbjct  722   DMKVINGILEWLNMRTRRAGFVPN  745


 Score =   184 bits (468),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 126/460 (27%), Positives = 221/460 (48%), Gaps = 39/460 (8%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + + + ++C   ++    K  H  ++K   + D+Y    LL +Y     I  AQ++
Sbjct  257   PNNFTFAGVFKACIGLEAFDVAKGVHGCILKARYEHDIYVGVALLELYTKSGNIGNAQRV  316

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F+E+PK++VI W+ +IS ++    SE A+  F  M       PN +T+  AL AC+ +G 
Sbjct  317   FEEIPKKDVIPWSFMISRFAQSNQSEVAVSLFCRM-RRAFVVPNQFTFASALQACATMGD  375

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK++HG + +    L+ FVSN +++ Y KCG ++ +  +F+  +  N V+W  ++  
Sbjct  376   IELGKQMHGLVHKVGLDLDVFVSNAVMDVYAKCGRIEDSMQLFEKSINRNDVSWNIMIVG  435

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + +CG+  + L +FL  L   VL  E      L A AS+  L  G  IH L +K     +
Sbjct  436   YVRCGDAVKALGLFLEMLENRVLATEVTYSSVLCASASLAALELGTQIHSLAIKTNYAKN  495

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
               V   L++ Y KCG++  A   F++ +  +  +W A+I G    G G EA+ +F  +  
Sbjct  496   TVVDNALIDMYSKCGRIRDARLVFDIMNERDEVSWNAMISGYSMHGLGIEALKIFQMMQD  555

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
              G KP+  T+  VL A +++  F  G                       D+++    + +
Sbjct  556   RGYKPNTLTFVGVLSACSNSGLFYQGQ----------------------DYFTS---MVQ  590

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
              + I   +  Y  + W   + G  RSGH  +A KL++E+ F   EP++  +  +L  C  
Sbjct  591   DYGIEPCIEHYSCMVW---LLG--RSGHLYKAAKLIEEIPF---EPSVMVWRALLGACII  642

Query  1821  LPAIEWGKQVHCRIM--KPGFDSNVVVGSTLIDMYAKCGR  1708
                +E G+    RI+  +P  ++  V+   L +MYA   R
Sbjct  643   HNNVELGRLSAQRILEREPRDEATHVL---LSNMYAIARR  679



>ref|XP_004306236.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Fragaria vesca subsp. vesca]
Length=757

 Score =   441 bits (1134),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 239/687 (35%), Positives = 387/687 (56%), Gaps = 3/687 (0%)
 Frame = -2

Query  3063  SQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPK  2884
             + ++ +C+  +SI  G+  H  ++    + D+   NH+L+MY        A+K+FDEMP+
Sbjct  69    ANLVSACSFLRSIEHGRKIHDHILGSNCEQDIVLQNHILNMYGKCGSFWDARKVFDEMPE  128

Query  2883  RNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKE  2704
             RNV++WT+LI+ YS     +KA+  +  M L  G  P+ +T+   + ACS LG    G++
Sbjct  129   RNVVSWTSLIAGYSQNRQEDKAVELYFQM-LRSGCKPDQFTFGSVVKACSGLGNVWLGRQ  187

Query  2703  IHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGE  2524
             +H  + ++E   +    N L + Y K GL+  A  VF  +   + ++W S+++   Q   
Sbjct  188   VHAYVVKSETGSHPIAQNALTSMYTKFGLIADAFDVFTRVATKDLISWGSIIAGFSQLDY  247

Query  2523  YDEGLRIFLRSLRAGVLV-NEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVT  2347
              +E L  F   L  G  + NEF+ G A  AC+ +    +G  IH + +K G+  D +   
Sbjct  248   GNEALAHFKEMLCQGAYIPNEFIFGSAFSACSGLVQPEYGRQIHGMCIKFGLGRDNFAGC  307

Query  2346  GLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKP  2167
              L + Y  CG L  A   F     P+L +W A+I G    G    A++ F ++    L P
Sbjct  308   SLCDMYANCGHLESARTVFFHIDRPDLVSWNAMITGFSNFGDANGAISFFSRMQHMKLIP  367

Query  2166  SERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
              E +  SVL A T +     G Q+HS+IIK   +    VCNAL+  Y+K + LD++F +F
Sbjct  368   DEVSVLSVLSACTSSPTLSQGRQVHSYIIKTALDFTVSVCNALLTMYAKCSNLDDAFVVF  427

Query  1986  QEMTEYDI-VTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAI  1810
             ++M      V+WNA+I   ++     +  +LL+ ML   + P+  T S ++  C D+ ++
Sbjct  428   KDMRNRAASVSWNAIITACMQHNQAGEVFRLLKLMLISEIRPDYITVSNVIGACADIASL  487

Query  1809  EWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGY  1630
             E G Q+HC  +K G    V V + LIDMY KCG L  A+K+F ++   ++VSW+++++GY
Sbjct  488   EVGNQIHCFTVKSGLVFGVTVSNGLIDMYTKCGSLESAQKLFSLMDNPDVVSWSSLIMGY  547

Query  1629  AQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPR  1450
             AQ G G+EALE++  M+  GVKPN++T VGVL+AC H GL+E+G   + +M++ +GI P 
Sbjct  548   AQSGCGEEALELFKTMKALGVKPNEVTLVGVLTACSHIGLVEKGRQVYKTMESEHGIAPT  607

Query  1449  TNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEIL  1270
               H +CMV+L AR G   +A +FI+    +PD VVW+ LL+ C    +  +GK AAE++L
Sbjct  608   REHCSCMVDLLARAGCLHEAEEFIKQVTFEPDIVVWKTLLAACKTRGNTDIGKQAAEKVL  667

Query  1269  SIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSY  1090
              +DP++++A V L NI A    WDE A++R +M++  +KK  G SW E++++I+ F    
Sbjct  668   ELDPSNSAALVLLCNISASSGRWDEVARLRNLMRESGVKKVPGQSWIEIKDRIHVFLVED  727

Query  1089  NMLLGEVSMKKLLIGLTAQLLDAGYVP  1009
             +       +  +L  L  Q+LD G  P
Sbjct  728   SSHPERGQIYAMLEELWLQMLDDGCDP  754


 Score =   237 bits (605),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 145/509 (28%), Positives = 254/509 (50%), Gaps = 8/509 (2%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L +   P + +   ++++C+   ++  G+  HA ++K  + S     N L SMY  F  
Sbjct  157   MLRSGCKPDQFTFGSVVKACSGLGNVWLGRQVHAYVVKSETGSHPIAQNALTSMYTKFGL  216

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
             I  A  +F  +  +++I+W ++I+ +S +    +AL  F+ M+ +  + PN + +  A S
Sbjct  217   IADAFDVFTRVATKDLISWGSIIAGFSQLDYGNEALAHFKEMLCQGAYIPNEFIFGSAFS  276

Query  2742  ACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVT  2563
             ACS L     G++IHG   +     +NF    L + Y  CG L+SA+ VF  +  P+ V+
Sbjct  277   ACSGLVQPEYGRQIHGMCIKFGLGRDNFAGCSLCDMYANCGHLESARTVFFHIDRPDLVS  336

Query  2562  WASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIV  2383
             W ++++     G+ +  +  F R     ++ +E      L AC S   L  G  +H  I+
Sbjct  337   WNAMITGFSNFGDANGAISFFSRMQHMKLIPDEVSVLSVLSACTSSPTLSQGRQVHSYII  396

Query  2382  KCGVKMDQYVVTGLVNFYVKCGQLGLAYNTF-NMASAPELHAWTALIGGCVQQGKGREAV  2206
             K  +     V   L+  Y KC  L  A+  F +M +     +W A+I  C+Q  +  E  
Sbjct  397   KTALDFTVSVCNALLTMYAKCSNLDDAFVVFKDMRNRAASVSWNAIITACMQHNQAGEVF  456

Query  2205  NLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFY  2026
              L   +L S ++P   T ++V+GA  D    +VG Q+H F +K G      V N L+D Y
Sbjct  457   RLLKLMLISEIRPDYITVSNVIGACADIASLEVGNQIHCFTVKSGLVFGVTVSNGLIDMY  516

Query  2025  SKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYS  1846
             +K   L+ + K+F  M   D+V+W++LI GY +SG  E+A++L + M   G++PN  T  
Sbjct  517   TKCGSLESAQKLFSLMDNPDVVSWSSLIMGYAQSGCGEEALELFKTMKALGVKPNEVTLV  576

Query  1845  CILSICGDLPAIEWGKQVHCRIMKP--GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILP  1672
              +L+ C  +  +E G+QV+ + M+   G        S ++D+ A+ G L +A +    + 
Sbjct  577   GVLTACSHIGLVEKGRQVY-KTMESEHGIAPTREHCSCMVDLLARAGCLHEAEEFIKQVT  635

Query  1671  CK-NLVSWNTMLIGYAQHG---FGKEALE  1597
              + ++V W T+L      G    GK+A E
Sbjct  636   FEPDIVVWKTLLAACKTRGNTDIGKQAAE  664


 Score =   223 bits (568),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 160/584 (27%), Positives = 270/584 (46%), Gaps = 19/584 (3%)
 Frame = -2

Query  2883  RNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKE  2704
             +N +     I+S        +AL +F  +     F     TY   +SACS L +   G++
Sbjct  27    KNELFGNDYITSLCRQKHYREALQAFDFLDKNTSFKVFPSTYANLVSACSFLRSIEHGRK  86

Query  2703  IHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGE  2524
             IH  I  +    +  + N ++N YGKCG    A+ VFD M E N V+W SL++ + Q  +
Sbjct  87    IHDHILGSNCEQDIVLQNHILNMYGKCGSFWDARKVFDEMPERNVVSWTSLIAGYSQNRQ  146

Query  2523  YDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTG  2344
              D+ + ++ + LR+G   ++F  G  + AC+ +  +  G  +H  +VK            
Sbjct  147   EDKAVELYFQMLRSGCKPDQFTFGSVVKACSGLGNVWLGRQVHAYVVKSETGSHPIAQNA  206

Query  2343  LVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLK-P  2167
             L + Y K G +  A++ F   +  +L +W ++I G  Q   G EA+  F ++L  G   P
Sbjct  207   LTSMYTKFGLIADAFDVFTRVATKDLISWGSIIAGFSQLDYGNEALAHFKEMLCQGAYIP  266

Query  2166  SERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
             +E  + S   A +   + + G Q+H   IK G     F   +L D Y+    L+ +  +F
Sbjct  267   NEFIFGSAFSACSGLVQPEYGRQIHGMCIKFGLGRDNFAGCSLCDMYANCGHLESARTVF  326

Query  1986  QEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIE  1807
               +   D+V+WNA+I G+   G    AI     M    L P+  +   +LS C   P + 
Sbjct  327   FHIDRPDLVSWNAMITGFSNFGDANGAISFFSRMQHMKLIPDEVSVLSVLSACTSSPTLS  386

Query  1806  WGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVF-DILPCKNLVSWNTMLIGY  1630
              G+QVH  I+K   D  V V + L+ MYAKC  L DA  VF D+      VSWN ++   
Sbjct  387   QGRQVHSYIIKTALDFTVSVCNALLTMYAKCSNLDDAFVVFKDMRNRAASVSWNAIITAC  446

Query  1629  AQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNN--YGI  1459
              QH    E   +  +M  + ++P+ IT   V+ AC     LE G   H  ++K+   +G+
Sbjct  447   MQHNQAGEVFRLLKLMLISEIRPDYITVSNVIGACADIASLEVGNQIHCFTVKSGLVFGV  506

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLL-----SGCNINKDFVLG  1294
             T        +++++ + G  + A     S  + PD V W  L+     SGC    +  L 
Sbjct  507   TVSNG----LIDMYTKCGSLESAQKLF-SLMDNPDVVSWSSLIMGYAQSGCG---EEALE  558

Query  1293  KYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQK  1162
              +   + L + PN+ +  V +    + + + ++  Q+ K M+ +
Sbjct  559   LFKTMKALGVKPNEVTL-VGVLTACSHIGLVEKGRQVYKTMESE  601



>ref|XP_010657139.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Vitis vinifera]
 ref|XP_010657142.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Vitis vinifera]
 ref|XP_010657146.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Vitis vinifera]
 ref|XP_010657152.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Vitis vinifera]
 ref|XP_010657154.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Vitis vinifera]
 ref|XP_010657159.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Vitis vinifera]
 ref|XP_010657164.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Vitis vinifera]
 ref|XP_010657166.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Vitis vinifera]
Length=828

 Score =   443 bits (1139),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 245/683 (36%), Positives = 368/683 (54%), Gaps = 1/683 (0%)
 Frame = -2

Query  3054  IRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNV  2875
             ++ C        GK  H +++K G   D++  N LL+MYV    +  A KLFDEMP+RN 
Sbjct  59    LQDCIQKDEPSRGKGLHCEILKRGGCLDLFAWNILLNMYVKSDFLCDASKLFDEMPERNT  118

Query  2874  ITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHG  2695
             I++ TLI  Y+      +A+  F  +  E G   N + +   L           G  IH 
Sbjct  119   ISFVTLIQGYAESVRFLEAIELFVRLHRE-GHELNPFVFTTILKLLVSTDCGELGWGIHA  177

Query  2694  RIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDE  2515
              IF+     N FV   L++ Y  CG +  A+ VFD +L  + V+W  +++C  +   + E
Sbjct  178   CIFKLGHESNAFVGTALIDAYSVCGRVDVAREVFDGILYKDMVSWTGMVTCFAENDCFKE  237

Query  2514  GLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVN  2335
              L++F +    G   N F       AC  +E    G  +H   +K   ++D YV   L++
Sbjct  238   ALKLFSQMRMVGFKPNNFTFASVFKACLGLEAFDVGKSVHGCALKSRYELDLYVGVALLD  297

Query  2334  FYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERT  2155
              Y K G +  A   F      ++  W+ +I    Q  + +EAV +F ++  + + P++ T
Sbjct  298   LYTKSGDIDDARRAFEEIPKKDVIPWSFMIARYAQSDQSKEAVEMFFQMRQALVLPNQFT  357

Query  2154  YASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMT  1975
             +ASVL A    +   +G Q+H  +IK+G +S  FV NAL+D Y+K   ++ S ++F E  
Sbjct  358   FASVLQACATMEGLNLGNQIHCHVIKIGLHSDVFVSNALMDVYAKCGRMENSMELFAESP  417

Query  1974  EYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQ  1795
               + VTWN +I G+++ G  E+A++L   ML   ++    TYS  L  C  L A+E G Q
Sbjct  418   HRNDVTWNTVIVGHVQLGDGEKALRLFLNMLEYRVQATEVTYSSALRACASLAALEPGLQ  477

Query  1794  VHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGF  1615
             +H   +K  FD ++VV + LIDMYAKCG + DAR VFD++  ++ VSWN M+ GY+ HG 
Sbjct  478   IHSLTVKTTFDKDIVVTNALIDMYAKCGSIKDARLVFDLMNKQDEVSWNAMISGYSMHGL  537

Query  1614  GKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLA  1435
             G+EAL I+  MQE  VKP+ +TFVGVLSAC + GLL++G  +F SM  ++GI P   H  
Sbjct  538   GREALRIFDKMQETEVKPDKLTFVGVLSACANAGLLDQGQAYFTSMIQDHGIEPCIEHYT  597

Query  1434  CMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPN  1255
             CMV L  R G   KA   I   P +P  +VWR LL  C I+ D  LG+ +A+ +L ++P 
Sbjct  598   CMVWLLGRGGHLDKAVKLIDEIPFQPSVMVWRALLGACVIHNDIELGRISAQRVLEMEPQ  657

Query  1254  DTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLG  1075
             D + HV LSN+YA    WD  A +RK MK+K +KKE G SW E Q  ++ F+        
Sbjct  658   DKATHVLLSNMYATAKRWDNVASVRKNMKRKGVKKEPGLSWIESQGTVHSFTVGDTSHPE  717

Query  1074  EVSMKKLLIGLTAQLLDAGYVPD  1006
                +  +L  L  +   AGY+P+
Sbjct  718   VRVINGMLEWLHMKTKKAGYIPN  740


 Score =   250 bits (638),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 145/484 (30%), Positives = 257/484 (53%), Gaps = 4/484 (1%)
 Frame = -2

Query  2772  NHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVF  2593
             N + Y  AL  C        GK +H  I +    L+ F  N L+N Y K   L  A  +F
Sbjct  51    NSHAYANALQDCIQKDEPSRGKGLHCEILKRGGCLDLFAWNILLNMYVKSDFLCDASKLF  110

Query  2592  DAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLG  2413
             D M E NT+++ +L+  + +   + E + +F+R  R G  +N F+    L    S +C  
Sbjct  111   DEMPERNTISFVTLIQGYAESVRFLEAIELFVRLHREGHELNPFVFTTILKLLVSTDCGE  170

Query  2412  FGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCV  2233
              G GIH  I K G + + +V T L++ Y  CG++ +A   F+     ++ +WT ++    
Sbjct  171   LGWGIHACIFKLGHESNAFVGTALIDAYSVCGRVDVAREVFDGILYKDMVSWTGMVTCFA  230

Query  2232  QQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTF  2053
             +    +EA+ LF ++   G KP+  T+ASV  A    + F VG  +H   +K  +    +
Sbjct  231   ENDCFKEALKLFSQMRMVGFKPNNFTFASVFKACLGLEAFDVGKSVHGCALKSRYELDLY  290

Query  2052  VCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEG  1873
             V  AL+D Y+KS  +D++ + F+E+ + D++ W+ +IA Y +S   ++A+++  +M    
Sbjct  291   VGVALLDLYTKSGDIDDARRAFEEIPKKDVIPWSFMIARYAQSDQSKEAVEMFFQMRQAL  350

Query  1872  LEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDAR  1693
             + PN  T++ +L  C  +  +  G Q+HC ++K G  S+V V + L+D+YAKCGR+ ++ 
Sbjct  351   VLPNQFTFASVLQACATMEGLNLGNQIHCHVIKIGLHSDVFVSNALMDVYAKCGRMENSM  410

Query  1692  KVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgg  1513
             ++F   P +N V+WNT+++G+ Q G G++AL ++  M E  V+  ++T+   L AC    
Sbjct  411   ELFAESPHRNDVTWNTVIVGHVQLGDGEKALRLFLNMLEYRVQATEVTYSSALRACASLA  470

Query  1512  lleegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRC  1336
              LE GL  H  ++K  +       +   +++++A+ G  K A   +     K D+V W  
Sbjct  471   ALEPGLQIHSLTVKTTFDKDIVVTN--ALIDMYAKCGSIKDAR-LVFDLMNKQDEVSWNA  527

Query  1335  LLSG  1324
             ++SG
Sbjct  528   MISG  531


 Score =   189 bits (479),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 130/467 (28%), Positives = 220/467 (47%), Gaps = 39/467 (8%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P   + + + ++C   ++   GK+ H   +K   + D+Y    LL +Y    +I+ A++ 
Sbjct  252   PNNFTFASVFKACLGLEAFDVGKSVHGCALKSRYELDLYVGVALLDLYTKSGDIDDARRA  311

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F+E+PK++VI W+ +I+ Y+    S++A+  F  M  +    PN +T+   L AC+ +  
Sbjct  312   FEEIPKKDVIPWSFMIARYAQSDQSKEAVEMFFQM-RQALVLPNQFTFASVLQACATMEG  370

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G +IH  + +     + FVSN L++ Y KCG ++++  +F      N VTW +++  
Sbjct  371   LNLGNQIHCHVIKIGLHSDVFVSNALMDVYAKCGRMENSMELFAESPHRNDVTWNTVIVG  430

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             H Q G+ ++ LR+FL  L   V   E     AL ACAS+  L  G+ IH L VK     D
Sbjct  431   HVQLGDGEKALRLFLNMLEYRVQATEVTYSSALRACASLAALEPGLQIHSLTVKTTFDKD  490

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
               V   L++ Y KCG +  A   F++ +  +  +W A+I G    G GREA+ +F K+  
Sbjct  491   IVVTNALIDMYAKCGSIKDARLVFDLMNKQDEVSWNAMISGYSMHGLGREALRIFDKMQE  550

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
             + +KP + T+  VL A  +      G                         Y  S + D 
Sbjct  551   TEVKPDKLTFVGVLSACANAGLLDQGQA-----------------------YFTSMIQDH  587

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
               +   E   Y  + W   + G  R GH ++A+KL+ E+ F   +P++  +  +L  C  
Sbjct  588   GIEPCIE--HYTCMVW---LLG--RGGHLDKAVKLIDEIPF---QPSVMVWRALLGACVI  637

Query  1821  LPAIEWGKQVHCRI--MKPGFDSNVVVGSTLIDMYAKCGRLGDARKV  1687
                IE G+    R+  M+P   +  V+   L +MYA   R  +   V
Sbjct  638   HNDIELGRISAQRVLEMEPQDKATHVL---LSNMYATAKRWDNVASV  681


 Score = 72.8 bits (177),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 74/148 (50%), Gaps = 2/148 (1%)
 Frame = -2

Query  1971  YDIVTWNALIAGYIRSGHYEQAIKLLQEML--FEGLEPNLHTYSCILSICGDLPAIEWGK  1798
             Y +V  N  +  + R G   Q+ KL QE +      E N H Y+  L  C        GK
Sbjct  13    YAMVCRNNFLIQFSRRGFSVQSAKLTQEFVGHVSPSEFNSHAYANALQDCIQKDEPSRGK  72

Query  1797  QVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHG  1618
              +HC I+K G   ++   + L++MY K   L DA K+FD +P +N +S+ T++ GYA+  
Sbjct  73    GLHCEILKRGGCLDLFAWNILLNMYVKSDFLCDASKLFDEMPERNTISFVTLIQGYAESV  132

Query  1617  FGKEALEIYSMMQENGVKPNDITFVGVL  1534
                EA+E++  +   G + N   F  +L
Sbjct  133   RFLEAIELFVRLHREGHELNPFVFTTIL  160



>ref|XP_006659345.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like 
[Oryza brachyantha]
Length=823

 Score =   443 bits (1139),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 239/693 (34%), Positives = 394/693 (57%), Gaps = 1/693 (0%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P +  L+ ++R+CT +K++L G+  H   +K    ++VY    L++ Y     ++ A  +
Sbjct  122   PNEFLLASVLRACTQSKAVLFGEQVHGIGVKLNLDANVYVGTALINFYAKLGRMDEAMLM  181

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F  +P ++ +TW T+I+ Y  +G    AL  F  M +E G   + +    A+SACS LG 
Sbjct  182   FHALPVKSPVTWNTVITGYVQIGCGGVALELFDMMGIE-GVRSDRFVLASAVSACSALGF  240

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G++IHG  +R     +  V+N L++ Y KC  L  A+ +F+ M   N V+W ++++ 
Sbjct  241   LEGGRQIHGYAYRIAAETDTSVTNVLIDLYCKCSRLSLARKLFNCMEYRNLVSWTTMIAG  300

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
             + Q     E + +     + G   + F C   L +C S+  +  G  +H   +K G++ D
Sbjct  301   YMQNSFDAEAITMSWNMSQGGWQPDGFACTSILNSCGSLAAIWQGKQVHAHAIKAGLESD  360

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
             +YV   L++ Y KC  L  A   F+  +  ++ ++ A+I G  + G   EA+N+F ++  
Sbjct  361   EYVKNALIDMYAKCEHLTEARAVFDALAEDDVISFNAMIEGYAKHGYLAEAMNIFRRMRH  420

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDE  2002
               ++P+  T+ S+LG  +     ++  Q+H  +IK G +   F  +AL+D YSK +L+++
Sbjct  421   CSVRPNLLTFVSLLGLSSSQLAIELSKQIHGLVIKSGTSLDLFAASALIDVYSKCSLVND  480

Query  2001  SFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGD  1822
             +  +F  +   D+V WN++I G+  +   E+A+KL  ++L  G+ PN  T+  ++++   
Sbjct  481   AKAVFNMLHYRDMVIWNSMIFGHAHNEQGEEAVKLFNQLLLSGMAPNEFTFVALVTVAST  540

Query  1821  LPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTM  1642
             L ++ +G+Q H RI+K G D++  V + LIDMYAKCG + + R +F+    K+++ WN+M
Sbjct  541   LASMFYGQQFHARIIKAGVDNDPHVSNALIDMYAKCGFIKEGRMLFESTCGKDVICWNSM  600

Query  1641  LIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYG  1462
             +  YAQHG  +EAL+++ +M+E GV+PN +TFVGVLSAC HGGL++EGL HFNSMK+NY 
Sbjct  601   ISTYAQHGHAEEALQVFRLMREAGVEPNYVTFVGVLSACAHGGLVDEGLLHFNSMKSNYD  660

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAA  1282
             + P   H A +VNLF R G+   A +FI   P KP   VWR LLS C++  +  +GKYA 
Sbjct  661   MEPGLEHYASIVNLFGRSGKLHAAKEFIERMPIKPAAAVWRSLLSACHLFGNAEIGKYAT  720

Query  1281  EEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCF  1102
             E  L  DP D+  +V LSNIYA   +W     +R+ M      KETG SW E+  +++ F
Sbjct  721   EMALLADPTDSGPYVLLSNIYASKGLWAHVHNLRQQMDSAGTVKETGYSWIEVTKEVHTF  780

Query  1101  SSSYNMLLGEVSMKKLLIGLTAQLLDAGYVPDT  1003
              +          +  +L  LT+ +   GYVPDT
Sbjct  781   IARGREHPEAELIYSVLDELTSLIKSLGYVPDT  813


 Score =   269 bits (687),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 166/583 (28%), Positives = 289/583 (50%), Gaps = 4/583 (1%)
 Frame = -2

Query  3069  SLSQIIRSCTT--NKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             SL+Q++ SC    ++      A HA+    G   D++  N LL  Y     +  A+ LFD
Sbjct  22    SLAQVLLSCLAGGDRPPRVVPAIHARATVAGCLDDLFLANLLLRGYSKLGHLHDARHLFD  81

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
              M  RN+++W + IS Y+  G    A+  F +        PN +     L AC+   A  
Sbjct  82    RMHHRNLVSWGSAISMYTQHGGDGCAVSLFAAFWKASCEVPNEFLLASVLRACTQSKAVL  141

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              G+++HG   +     N +V   L+NFY K G +  A L+F A+   + VTW ++++ + 
Sbjct  142   FGEQVHGIGVKLNLDANVYVGTALINFYAKLGRMDEAMLMFHALPVKSPVTWNTVITGYV  201

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
             Q G     L +F      GV  + F+   A+ AC+++  L  G  IH    +   + D  
Sbjct  202   QIGCGGVALELFDMMGIEGVRSDRFVLASAVSACSALGFLEGGRQIHGYAYRIAAETDTS  261

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
             V   L++ Y KC +L LA   FN      L +WT +I G +Q     EA+ +   +   G
Sbjct  262   VTNVLIDLYCKCSRLSLARKLFNCMEYRNLVSWTTMIAGYMQNSFDAEAITMSWNMSQGG  321

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
              +P      S+L +         G Q+H+  IK G  S  +V NAL+D Y+K   L E+ 
Sbjct  322   WQPDGFACTSILNSCGSLAAIWQGKQVHAHAIKAGLESDEYVKNALIDMYAKCEHLTEAR  381

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
              +F  + E D++++NA+I GY + G+  +A+ + + M    + PNL T+  +L +     
Sbjct  382   AVFDALAEDDVISFNAMIEGYAKHGYLAEAMNIFRRMRHCSVRPNLLTFVSLLGLSSSQL  441

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             AIE  KQ+H  ++K G   ++   S LID+Y+KC  + DA+ VF++L  +++V WN+M+ 
Sbjct  442   AIELSKQIHGLVIKSGTSLDLFAASALIDVYSKCSLVNDAKAVFNMLHYRDMVIWNSMIF  501

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGIT  1456
             G+A +  G+EA+++++ +  +G+ PN+ TFV +++              F++     G+ 
Sbjct  502   GHAHNEQGEEAVKLFNQLLLSGMAPNEFTFVALVTVAS-TLASMFYGQQFHARIIKAGVD  560

Query  1455  PRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLS  1327
                +    +++++A+ G  K+      S   K D + W  ++S
Sbjct  561   NDPHVSNALIDMYAKCGFIKEGRMLFESTCGK-DVICWNSMIS  602


 Score = 95.9 bits (237),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 105/194 (54%), Gaps = 10/194 (5%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L +   P + +   ++   +T  S+  G+  HA++IK G  +D + +N L+ MY     
Sbjct  519   LLLSGMAPNEFTFVALVTVASTLASMFYGQQFHARIIKAGVDNDPHVSNALIDMYAKCGF  578

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
             I+  + LF+    ++VI W ++IS+Y+  G +E+AL  FR M  E G  PN+ T+VG LS
Sbjct  579   IKEGRMLFESTCGKDVICWNSMISTYAQHGHAEEALQVFRLM-REAGVEPNYVTFVGVLS  637

Query  2742  ACSCLGAARTGKEIHGRIFRA----EETLNNFVSNCLVNFYGKCGLLKSAQLVFDAM-LE  2578
             AC+  G    G  +H    ++    E  L ++ S  +VN +G+ G L +A+   + M ++
Sbjct  638   ACAHGGLVDEGL-LHFNSMKSNYDMEPGLEHYAS--IVNLFGRSGKLHAAKEFIERMPIK  694

Query  2577  PNTVTWASLLS-CH  2539
             P    W SLLS CH
Sbjct  695   PAAAVWRSLLSACH  708



>ref|XP_004233934.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 
[Solanum lycopersicum]
Length=721

 Score =   439 bits (1130),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 247/686 (36%), Positives = 386/686 (56%), Gaps = 7/686 (1%)
 Frame = -2

Query  3042  TTNKSILSGKAAHAQLIKYGSKSD-VYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITW  2866
             T  K++  G++ H+ LIK GS S  +Y  N ++++Y   H +  A   F E+  ++V++W
Sbjct  24    TRCKNLPKGQSLHSHLIKTGSSSSCIYIANSIVNLYAKCHRLSDAHLAFQEIQTKDVVSW  83

Query  2865  TTLISSYSHMGLSEKALGSFR--SMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGR  2692
              +LI+ YS +G  + +L +     ++ ++   PN +T+ G  ++ S LG + TGK+ H  
Sbjct  84    NSLINGYSQLGRRDSSLSALNLFKLMRQENTLPNPHTFAGIFTSLSTLGDSFTGKQAHCL  143

Query  2691  IFRAEETLNNFVSNCLVNFYGKCGL-LKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDE  2515
              F+     + FV + L+N Y K G  L  A+ +FD M E N+V+  +++S +       E
Sbjct  144   AFKLGYLSDVFVGSSLLNVYCKAGHHLGDARNMFDEMPERNSVSCTTMISGYALQRMVKE  203

Query  2514  GLRIF-LRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLV  2338
              + +F +  L+ G  VNEF+    L A A  E +  G  IHCL +K G      V    V
Sbjct  204   AVGVFSVMLLKRGEDVNEFVFTSVLSAIALPEFVYVGKQIHCLSLKNGFLSAVSVANATV  263

Query  2337  NFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSER  2158
               Y KCG+L  A   F ++S      W+ALI G  Q G   +A+ LF ++   G+ PSE 
Sbjct  264   TMYAKCGRLDDACRAFELSSEKNSITWSALITGYAQNGDCEKALKLFSEMHYRGMIPSEY  323

Query  2157  TYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEM  1978
             T   VL A +D    + G Q+H +++KLGF    ++  ALVD Y+K   + ++ + F+ +
Sbjct  324   TLVGVLNACSDFDALREGKQVHGYLVKLGFEPQMYILTALVDMYAKCGNISDARRGFEYL  383

Query  1977  TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGK  1798
              E DIV W ++IAGY+++G  E A  +   ML EG+ PN  T + +L  C  L A+E GK
Sbjct  384   KEPDIVLWTSMIAGYVKNGDNESAKGMYCRMLMEGVMPNELTMASVLKACSSLAALEQGK  443

Query  1797  QVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHG  1618
             Q+H  I+K GF   V +GS L  MYAK G L D   VF  +P ++LVSWN+M+ G +Q+G
Sbjct  444   QIHAHIVKHGFSLEVPIGSALSTMYAKSGSLHDGNLVFRRMPARDLVSWNSMMSGLSQNG  503

Query  1617  FGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHL  1438
              G EALE++  M   G +P+ +TFV +LSAC H GL++ G + F  M + +GI PR  H 
Sbjct  504   CGTEALELFEEMLHEGTRPDYVTFVNILSACSHMGLVKRGWSIFRMMSDEFGIEPRLEHF  563

Query  1437  ACMVNLFARKGQTKKAYDFIRSFPEKPDK--VVWRCLLSGCNINKDFVLGKYAAEEILSI  1264
             ACMV++  R G+  KA +FI S     D    +WR LLS C   +++ LG YA E+++ +
Sbjct  564   ACMVDMLGRAGELYKAKEFIESAASHVDHGLCLWRILLSACRNYRNYELGAYAGEKLMEL  623

Query  1263  DPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNM  1084
                ++SA+V LSNIY+ L   ++  ++R++M  + + KE GCSW EL+++ + F     +
Sbjct  624   GSQESSAYVLLSNIYSSLGRLEDVERVRRLMNLRGVSKEPGCSWIELKSQFHVFVVGDQL  683

Query  1083  LLGEVSMKKLLIGLTAQLLDAGYVPD  1006
                 + ++  L  LT  + D GY PD
Sbjct  684   HPQIIHIRDELWKLTKLMKDEGYKPD  709


 Score =   252 bits (643),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 146/470 (31%), Positives = 251/470 (53%), Gaps = 4/470 (1%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTF-HEIECAQK  2905
             P   + + I  S +T     +GK AH    K G  SDV+  + LL++Y    H +  A+ 
Sbjct  116   PNPHTFAGIFTSLSTLGDSFTGKQAHCLAFKLGYLSDVFVGSSLLNVYCKAGHHLGDARN  175

Query  2904  LFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             +FDEMP+RN ++ TT+IS Y+   + ++A+G F  M+L+ G   N + +   LSA +   
Sbjct  176   MFDEMPERNSVSCTTMISGYALQRMVKEAVGVFSVMLLKRGEDVNEFVFTSVLSAIALPE  235

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
                 GK+IH    +        V+N  V  Y KCG L  A   F+   E N++TW++L++
Sbjct  236   FVYVGKQIHCLSLKNGFLSAVSVANATVTMYAKCGRLDDACRAFELSSEKNSITWSALIT  295

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
              + Q G+ ++ L++F      G++ +E+     L AC+  + L  G  +H  +VK G + 
Sbjct  296   GYAQNGDCEKALKLFSEMHYRGMIPSEYTLVGVLNACSDFDALREGKQVHGYLVKLGFEP  355

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
               Y++T LV+ Y KCG +  A   F     P++  WT++I G V+ G    A  ++C++L
Sbjct  356   QMYILTALVDMYAKCGNISDARRGFEYLKEPDIVLWTSMIAGYVKNGDNESAKGMYCRML  415

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
               G+ P+E T ASVL A +     + G Q+H+ I+K GF+    + +AL   Y+KS  L 
Sbjct  416   MEGVMPNELTMASVLKACSSLAALEQGKQIHAHIVKHGFSLEVPIGSALSTMYAKSGSLH  475

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
             +   +F+ M   D+V+WN++++G  ++G   +A++L +EML EG  P+  T+  ILS C 
Sbjct  476   DGNLVFRRMPARDLVSWNSMMSGLSQNGCGTEALELFEEMLHEGTRPDYVTFVNILSACS  535

Query  1824  DLPAIEWGKQVHCRIMKP--GFDSNVVVGSTLIDMYAKCGRLGDARKVFD  1681
              +  ++ G  +  R+M    G +  +   + ++DM  + G L  A++  +
Sbjct  536   HMGLVKRGWSIF-RMMSDEFGIEPRLEHFACMVDMLGRAGELYKAKEFIE  584


 Score =   107 bits (266),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 77/286 (27%), Positives = 130/286 (45%), Gaps = 5/286 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +L  ++ +C+   ++  GK  H  L+K G +  +Y    L+ MY     I  A++ 
Sbjct  320   PSEYTLVGVLNACSDFDALREGKQVHGYLVKLGFEPQMYILTALVDMYAKCGNISDARRG  379

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
             F+ + + +++ WT++I+ Y   G +E A G +  M++E G  PN  T    L ACS L A
Sbjct  380   FEYLKEPDIVLWTSMIAGYVKNGDNESAKGMYCRMLME-GVMPNELTMASVLKACSSLAA  438

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                GK+IH  I +   +L   + + L   Y K G L    LVF  M   + V+W S++S 
Sbjct  439   LEQGKQIHAHIVKHGFSLEVPIGSALSTMYAKSGSLHDGNLVFRRMPARDLVSWNSMMSG  498

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIV-KCGVKM  2365
               Q G   E L +F   L  G   +       L AC+ +  +  G  I  ++  + G++ 
Sbjct  499   LSQNGCGTEALELFEEMLHEGTRPDYVTFVNILSACSHMGLVKRGWSIFRMMSDEFGIEP  558

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHA---WTALIGGC  2236
                    +V+   + G+L  A      A++   H    W  L+  C
Sbjct  559   RLEHFACMVDMLGRAGELYKAKEFIESAASHVDHGLCLWRILLSAC  604



>ref|XP_010066066.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial [Eucalyptus grandis]
 ref|XP_010066067.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial [Eucalyptus grandis]
Length=768

 Score =   441 bits (1133),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 236/682 (35%), Positives = 389/682 (57%), Gaps = 3/682 (0%)
 Frame = -2

Query  3048  SCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVIT  2869
             +C++ +S+  G+  H  +   G+++DV  +NH+++MY     +  A+K+FDEM  RNV++
Sbjct  78    ACSSLRSLKHGRRVHDHIRASGARTDVILDNHVINMYGKCGSMADARKVFDEMRHRNVVS  137

Query  2868  WTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRI  2689
             WT+LI+ YS  G +  A+  +  M L+ G  P+H+T+   L ACS LG    G ++H  +
Sbjct  138   WTSLIAGYSQNGQNIDAVRLYFEM-LQSGLLPDHFTFGSVLKACSGLGGVGLGMQLHAHV  196

Query  2688  FRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGL  2509
              ++E   +    N L+  Y K   +  A  V+  + E + ++W+S+++   Q     + L
Sbjct  197   VKSEFGSHLIAQNALIAMYTKLDRIDDACRVYHRIKEKDLISWSSMIAGFSQLNHELQAL  256

Query  2508  RIFLRSLRAGVL-VNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNF  2332
             R F   L  GV   NEF  G    AC S+     G  IH + +K G   +++    L + 
Sbjct  257   RYFKEMLCQGVYRPNEFTFGSVFSACGSLVQPEIGRQIHGICIKFGFAGNKFAGCALCDM  316

Query  2331  YVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTY  2152
             Y K G LG +   F+    P+L +W A + G    G   E ++ F ++    L P + T 
Sbjct  317   YAKFGLLGSSKIVFHQIETPDLISWNAALAGFATNGHSNEMISYFNQMRHLNLHPDDITI  376

Query  2151  ASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTE  1972
              S+L A T     Q G Q+HS+IIK+ F     VCNALV  Y+K + L E+ K FQEM  
Sbjct  377   RSLLCACTSPSSLQQGKQMHSYIIKMAFVLDISVCNALVTMYAKCSNLMEALKAFQEMRH  436

Query  1971  YD-IVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQ  1795
             +D +++WNA++   ++     +  KL + +L   ++P+  T + ++    ++ +++ G Q
Sbjct  437   HDDLISWNAILVACMQHKEPMEVFKLFKLLLISEVKPDYITLTTMIGAYTEMASLDMGSQ  496

Query  1794  VHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGF  1615
             VHC  +K G   +V V + LIDMYAKCG L  AR +FD +   +++SW+++++GYAQ G 
Sbjct  497   VHCYAVKTGLVLDVSVANALIDMYAKCGSLKIARTLFDSIVNPDVISWSSLIVGYAQFGH  556

Query  1614  GKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLA  1435
              +EAL++Y  M+  GVKPN++T VGVL+AC H GL+EEG   + +M+  +GI P   H A
Sbjct  557   AEEALKLYEKMRSLGVKPNEVTIVGVLTACSHVGLVEEGWELYKTMELEHGILPTKEHSA  616

Query  1434  CMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPN  1255
             C+V+L AR G   +A DFI+   + PD VVW+ LL+    +K+  +G++AAE +L +DP 
Sbjct  617   CVVDLLARAGHLYEAKDFIKQMEDTPDIVVWKALLAASKTHKNLEIGRWAAENLLKLDPL  676

Query  1254  DTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLG  1075
             + +AHV L +IYA    WD+  ++R +M++  + K  G SW E++++++ F +  N+   
Sbjct  677   NATAHVLLCSIYASTGHWDDVGRLRSLMRELGVSKVPGQSWIEIKSRVHAFLADDNLHPE  736

Query  1074  EVSMKKLLIGLTAQLLDAGYVP  1009
                + +++  L  QLLD  YVP
Sbjct  737   RDKIYQVMGELWLQLLDHDYVP  758


 Score =   236 bits (602),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 147/511 (29%), Positives = 257/511 (50%), Gaps = 8/511 (2%)
 Frame = -2

Query  2763  TYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAM  2584
             T+VG + ACS L + + G+ +H  I  +    +  + N ++N YGKCG +  A+ VFD M
Sbjct  71    TWVGLVCACSSLRSLKHGRRVHDHIRASGARTDVILDNHVINMYGKCGSMADARKVFDEM  130

Query  2583  LEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGM  2404
                N V+W SL++ + Q G+  + +R++   L++G+L + F  G  L AC+ +  +G GM
Sbjct  131   RHRNVVSWTSLIAGYSQNGQNIDAVRLYFEMLQSGLLPDHFTFGSVLKACSGLGGVGLGM  190

Query  2403  GIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQG  2224
              +H  +VK            L+  Y K  ++  A   ++     +L +W+++I G  Q  
Sbjct  191   QLHAHVVKSEFGSHLIAQNALIAMYTKLDRIDDACRVYHRIKEKDLISWSSMIAGFSQLN  250

Query  2223  KGREAVNLFCKLLSSGL-KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVC  2047
                +A+  F ++L  G+ +P+E T+ SV  A     + ++G Q+H   IK GF    F  
Sbjct  251   HELQALRYFKEMLCQGVYRPNEFTFGSVFSACGSLVQPEIGRQIHGICIKFGFAGNKFAG  310

Query  2046  NALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLE  1867
              AL D Y+K  LL  S  +F ++   D+++WNA +AG+  +GH  + I    +M    L 
Sbjct  311   CALCDMYAKFGLLGSSKIVFHQIETPDLISWNAALAGFATNGHSNEMISYFNQMRHLNLH  370

Query  1866  PNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKV  1687
             P+  T   +L  C    +++ GKQ+H  I+K  F  ++ V + L+ MYAKC  L +A K 
Sbjct  371   PDDITIRSLLCACTSPSSLQQGKQMHSYIIKMAFVLDISVCNALVTMYAKCSNLMEALKA  430

Query  1686  F-DILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHggl  1510
             F ++    +L+SWN +L+   QH    E  +++ ++  + VKP+ IT   ++ A      
Sbjct  431   FQEMRHHDDLISWNAILVACMQHKEPMEVFKLFKLLLISEVKPDYITLTTMIGAYTEMAS  490

Query  1509  leegLN-HFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCL  1333
             L+ G   H  ++K   G+    +    +++++A+ G  K A     S    PD + W  L
Sbjct  491   LDMGSQVHCYAVKT--GLVLDVSVANALIDMYAKCGSLKIARTLFDSIV-NPDVISWSSL  547

Query  1332  LSGCNI--NKDFVLGKYAAEEILSIDPNDTS  1246
             + G     + +  L  Y     L + PN+ +
Sbjct  548   IVGYAQFGHAEEALKLYEKMRSLGVKPNEVT  578


 Score =   223 bits (569),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 138/516 (27%), Positives = 254/516 (49%), Gaps = 7/516 (1%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L +   P   +   ++++C+    +  G   HA ++K    S +   N L++MY     
Sbjct  161   MLQSGLLPDHFTFGSVLKACSGLGGVGLGMQLHAHVVKSEFGSHLIAQNALIAMYTKLDR  220

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
             I+ A +++  + ++++I+W+++I+ +S +    +AL  F+ M+ +  + PN +T+    S
Sbjct  221   IDDACRVYHRIKEKDLISWSSMIAGFSQLNHELQALRYFKEMLCQGVYRPNEFTFGSVFS  280

Query  2742  ACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVT  2563
             AC  L     G++IHG   +     N F    L + Y K GLL S+++VF  +  P+ ++
Sbjct  281   ACGSLVQPEIGRQIHGICIKFGFAGNKFAGCALCDMYAKFGLLGSSKIVFHQIETPDLIS  340

Query  2562  WASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIV  2383
             W + L+     G  +E +  F +     +  ++      L AC S   L  G  +H  I+
Sbjct  341   WNAALAGFATNGHSNEMISYFNQMRHLNLHPDDITIRSLLCACTSPSSLQQGKQMHSYII  400

Query  2382  KCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFN-MASAPELHAWTALIGGCVQQGKGREAV  2206
             K    +D  V   LV  Y KC  L  A   F  M    +L +W A++  C+Q  +  E  
Sbjct  401   KMAFVLDISVCNALVTMYAKCSNLMEALKAFQEMRHHDDLISWNAILVACMQHKEPMEVF  460

Query  2205  NLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFY  2026
              LF  LL S +KP   T  +++GA+T+     +G Q+H + +K G      V NAL+D Y
Sbjct  461   KLFKLLLISEVKPDYITLTTMIGAYTEMASLDMGSQVHCYAVKTGLVLDVSVANALIDMY  520

Query  2025  SKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYS  1846
             +K   L  +  +F  +   D+++W++LI GY + GH E+A+KL ++M   G++PN  T  
Sbjct  521   AKCGSLKIARTLFDSIVNPDVISWSSLIVGYAQFGHAEEALKLYEKMRSLGVKPNEVTIV  580

Query  1845  CILSICGDLPAIEWGKQVHCRI-MKPGFDSNVVVGSTLIDMYAKCGRLGDARK-VFDILP  1672
              +L+ C  +  +E G +++  + ++ G        + ++D+ A+ G L +A+  +  +  
Sbjct  581   GVLTACSHVGLVEEGWELYKTMELEHGILPTKEHSACVVDLLARAGHLYEAKDFIKQMED  640

Query  1671  CKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVK  1564
               ++V W  +L     H    + LEI     EN +K
Sbjct  641   TPDIVVWKALLAASKTH----KNLEIGRWAAENLLK  672


 Score =   137 bits (344),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 91/332 (27%), Positives = 167/332 (50%), Gaps = 13/332 (4%)
 Frame = -2

Query  2217  REAVNLFCKL--LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCN  2044
             REA+  F  L  +      S +T+  ++ A +  +  + G ++H  I   G  +   + N
Sbjct  49    REALEAFDALRKIPGSRISSAQTWVGLVCACSSLRSLKHGRRVHDHIRASGARTDVILDN  108

Query  2043  ALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEP  1864
              +++ Y K   + ++ K+F EM   ++V+W +LIAGY ++G    A++L  EML  GL P
Sbjct  109   HVINMYGKCGSMADARKVFDEMRHRNVVSWTSLIAGYSQNGQNIDAVRLYFEMLQSGLLP  168

Query  1863  NLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVF  1684
             +  T+  +L  C  L  +  G Q+H  ++K  F S+++  + LI MY K  R+ DA +V+
Sbjct  169   DHFTFGSVLKACSGLGGVGLGMQLHAHVVKSEFGSHLIAQNALIAMYTKLDRIDDACRVY  228

Query  1683  DILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGV-KPNDITFVGVLSACGHggll  1507
               +  K+L+SW++M+ G++Q     +AL  +  M   GV +PN+ TF  V SACG   + 
Sbjct  229   HRIKEKDLISWSSMIAGFSQLNHELQALRYFKEMLCQGVYRPNEFTFGSVFSACG-SLVQ  287

Query  1506  eegLNHFNSMKNNYGITPRTNHLACMVNLFAR---KGQTKKAYDFIRSFPEKPDKVVWRC  1336
              E     + +   +G          + +++A+    G +K  +  I    E PD + W  
Sbjct  288   PEIGRQIHGICIKFGFAGNKFAGCALCDMYAKFGLLGSSKIVFHQI----ETPDLISWNA  343

Query  1335  LLSG--CNINKDFVLGKYAAEEILSIDPNDTS  1246
              L+G   N + + ++  +     L++ P+D +
Sbjct  344   ALAGFATNGHSNEMISYFNQMRHLNLHPDDIT  375



>ref|XP_008385706.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Malus domestica]
 ref|XP_008385707.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Malus domestica]
 ref|XP_008385708.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Malus domestica]
Length=821

 Score =   442 bits (1136),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 235/680 (35%), Positives = 383/680 (56%), Gaps = 5/680 (1%)
 Frame = -2

Query  3021  SGKAAHA-QLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSY  2845
             SG+   A Q+       D ++ N +++ Y     +  A++LFD  P +N ITW++LIS Y
Sbjct  61    SGRVDEARQMFDKMPSRDEFSWNTMIAAYANSGRLAEAKQLFDATPSKNSITWSSLISGY  120

Query  2844  SHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLN  2665
                    +A   F  M  E G  P+ YT    L  CS LG  + G  +HG + + +   N
Sbjct  121   CRNESESEAFELFWRMQFE-GHKPSQYTLGSVLRLCSTLGLLQRGALVHGYMTKTQFDNN  179

Query  2664  NFVSNCLVNFYGKCGLLKSAQLVFDAMLE-PNTVTWASLLSCHCQCGEYDEGLRIFLRSL  2488
              FV   LV+ Y KC  +  A+ +F+ + +  N V W  +L+ + Q G+  + ++ F R +
Sbjct  180   IFVVTGLVDMYAKCKRISEAEYLFETLFDRKNHVLWTVMLTGYSQNGDGFKAMK-FFRDM  238

Query  2487  RA-GVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQL  2311
             RA GV  N+F     L A ASV    FG  +H  +V+ G+  + +V + LV+ YVKCG L
Sbjct  239   RAEGVESNQFTFPSVLTASASVLAHSFGAQVHGCVVQSGLGANVFVQSSLVDMYVKCGDL  298

Query  2310  GLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAF  2131
               A           + +W ++I GCV+QG   EA++LF  + S  +K    TY SVL +F
Sbjct  299   NSAKKALRSMEVDNVVSWNSMIVGCVRQGFAEEALSLFKDMRSREMKIDHFTYPSVLNSF  358

Query  2130  TDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWN  1951
                K+    M +H  IIK GF+ +  V NALVD Y+K   +D + ++F+ M++ D+++W 
Sbjct  359   AVMKDMTNAMSIHCLIIKTGFDVYQLVGNALVDMYAKQGNIDAAVEVFKCMSDKDVISWT  418

Query  1950  ALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKP  1771
             +LI GY+R+G +E+A++L  EM   G+ P+    +  LS   +L  +E+G+Q+H   +K 
Sbjct  419   SLITGYVRNGSHEKALRLFCEMRTAGIYPDQFVIASALSASAELTVLEFGQQIHANFIKS  478

Query  1770  GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIY  1591
             G  +++ V ++ + MYAKCG + DA KVFD +  +++++W  +++GYAQ+G GKE+L+ Y
Sbjct  479   GLQASLSVDNSFVAMYAKCGCIEDANKVFDSMQVQDVITWTALIVGYAQNGRGKESLKFY  538

Query  1590  SMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFAR  1411
               M   G +P+ ITF+G++ AC H GLLE+G  +F  M   YGI P + H ACM++L  R
Sbjct  539   DQMILTGAEPDFITFIGLIFACSHAGLLEKGRYYFELMSRVYGIQPGSEHYACMIDLLGR  598

Query  1410  KGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTL  1231
              G+  +A   +     +PD  VW+ LL+ C ++ +  LG+ AA  +  ++P +   +V L
Sbjct  599   SGKLNEAEALVNKMVVEPDGTVWKALLAACRVHGNIELGERAAMNLFKLEPLNAVPYVQL  658

Query  1230  SNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGEVSMKKLL  1051
             SN+Y+  + W++AA+IR++MK K + KE GCSW E  ++++ F S          +   +
Sbjct  659   SNMYSAASRWEDAARIRRLMKSKGILKEPGCSWIETNSQVHTFMSEDRSHSRTAEIYSKV  718

Query  1050  IGLTAQLLDAGYVPDTKLSF  991
               +   + +AGYVPD   + 
Sbjct  719   DEIMMLIKEAGYVPDMNFAL  738


 Score =   228 bits (580),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 139/495 (28%), Positives = 251/495 (51%), Gaps = 12/495 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +L  ++R C+T   +  G   H  + K    ++++    L+ MY     I  A+ L
Sbjct  143   PSQYTLGSVLRLCSTLGLLQRGALVHGYMTKTQFDNNIFVVTGLVDMYAKCKRISEAEYL  202

Query  2901  FDEM-PKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             F+ +  ++N + WT +++ YS  G   KA+  FR M  E G   N +T+   L+A + + 
Sbjct  203   FETLFDRKNHVLWTVMLTGYSQNGDGFKAMKFFRDMRAE-GVESNQFTFPSVLTASASVL  261

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
             A   G ++HG + ++    N FV + LV+ Y KCG L SA+    +M   N V+W S++ 
Sbjct  262   AHSFGAQVHGCVVQSGLGANVFVQSSLVDMYVKCGDLNSAKKALRSMEVDNVVSWNSMIV  321

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
                + G  +E L +F       + ++ F     L + A ++ +   M IHCLI+K G  +
Sbjct  322   GCVRQGFAEEALSLFKDMRSREMKIDHFTYPSVLNSFAVMKDMTNAMSIHCLIIKTGFDV  381

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
              Q V   LV+ Y K G +  A   F   S  ++ +WT+LI G V+ G   +A+ LFC++ 
Sbjct  382   YQLVGNALVDMYAKQGNIDAAVEVFKCMSDKDVISWTSLITGYVRNGSHEKALRLFCEMR  441

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
             ++G+ P +   AS L A  +    + G Q+H+  IK G  +   V N+ V  Y+K   ++
Sbjct  442   TAGIYPDQFVIASALSASAELTVLEFGQQIHANFIKSGLQASLSVDNSFVAMYAKCGCIE  501

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
             ++ K+F  M   D++TW ALI GY ++G  ++++K   +M+  G EP+  T+  ++  C 
Sbjct  502   DANKVFDSMQVQDVITWTALIVGYAQNGRGKESLKFYDQMILTGAEPDFITFIGLIFACS  561

Query  1824  DLPAIEWGK---QVHCRI--MKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-N  1663
                 +E G+   ++  R+  ++PG +      + +ID+  + G+L +A  + + +  + +
Sbjct  562   HAGLLEKGRYYFELMSRVYGIQPGSEHY----ACMIDLLGRSGKLNEAEALVNKMVVEPD  617

Query  1662  LVSWNTMLIGYAQHG  1618
                W  +L     HG
Sbjct  618   GTVWKALLAACRVHG  632


 Score =   106 bits (265),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 86/296 (29%), Positives = 136/296 (46%), Gaps = 13/296 (4%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVY--TNNHLLSMYVTFHEIECAQKLFDEMPK  2884
             ++ S    K + +  + H  +IK G   DVY    N L+ MY     I+ A ++F  M  
Sbjct  354   VLNSFAVMKDMTNAMSIHCLIIKTGF--DVYQLVGNALVDMYAKQGNIDAAVEVFKCMSD  411

Query  2883  RNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKE  2704
             ++VI+WT+LI+ Y   G  EKAL  F  M    G  P+ +    ALSA + L     G++
Sbjct  412   KDVISWTSLITGYVRNGSHEKALRLFCEMRTA-GIYPDQFVIASALSASAELTVLEFGQQ  470

Query  2703  IHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGE  2524
             IH    ++    +  V N  V  Y KCG ++ A  VFD+M   + +TW +L+  + Q G 
Sbjct  471   IHANFIKSGLQASLSVDNSFVAMYAKCGCIEDANKVFDSMQVQDVITWTALIVGYAQNGR  530

Query  2523  YDEGLRIFLRSLRAGVLVNEFLCGIAL-GACASVECLGFGMGIHCLIVKC-GVKMDQYVV  2350
               E L+ + + +  G    +F+  I L  AC+    L  G     L+ +  G++      
Sbjct  531   GKESLKFYDQMILTGA-EPDFITFIGLIFACSHAGLLEKGRYYFELMSRVYGIQPGSEHY  589

Query  2349  TGLVNFYVKCGQLGLAYNTFN-MASAPELHAWTALIGGCVQQGK----GREAVNLF  2197
               +++   + G+L  A    N M   P+   W AL+  C   G      R A+NLF
Sbjct  590   ACMIDLLGRSGKLNEAEALVNKMVVEPDGTVWKALLAACRVHGNIELGERAAMNLF  645



>ref|XP_010473800.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like 
[Camelina sativa]
Length=766

 Score =   440 bits (1131),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 231/645 (36%), Positives = 368/645 (57%), Gaps = 4/645 (1%)
 Frame = -2

Query  3021  SGKAAHA-QLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSY  2845
             SG+   A Q+     + D +T N ++  Y     +  A ++F   P +N I+W  LIS Y
Sbjct  41    SGRVNEARQVFDKMPERDEFTWNTMIVAYSKSGRLSDADQIFRSNPVKNTISWNALISGY  100

Query  2844  SHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLN  2665
                GL ++ALG F  M   DG  PN YT    +  C+ L     G+EIHG   +    L+
Sbjct  101   CKHGLEDEALGLFWEMQF-DGIKPNEYTLGSVIRLCTSLALLLRGEEIHGHTIKTGFDLD  159

Query  2664  NFVSNCLVNFYGKCGLLKSAQLVFDAML-EPNTVTWASLLSCHCQCGEYDEGLRIFLRSL  2488
               V N L+  Y +C  +  A+ +F+ M  E N VTW S+L+ + Q G   + +  F    
Sbjct  160   VNVVNGLLAMYAQCKRISKAEYLFETMSGEKNNVTWTSMLTGYSQNGFAFKAIECFRDLT  219

Query  2487  RAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLG  2308
             R G   N+F     L ACASV     G+ +H  IVK G K + YV + L++ Y KC  L 
Sbjct  220   REGNQSNQFTFPSVLTACASVSARRVGVQVHGCIVKSGFKTNIYVQSALIDMYAKCRDLE  279

Query  2307  LAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFT  2128
              A        A ++ +W ++I GCV+QG   EA++ F ++    +K  + T  S+L  F 
Sbjct  280   TARALLEGMEADDVVSWNSMIVGCVRQGLIEEALSFFGRMHERDMKIDDFTIPSILNCFA  339

Query  2127  DTK-EFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWN  1951
              ++ E ++    H  I+K G+ ++  V NALVD Y+K  ++D + K+F+ M E D+++W 
Sbjct  340   LSRTEIKIASSAHCLIVKTGYGTYKLVNNALVDMYAKRGIMDSALKVFEGMIEKDVISWT  399

Query  1950  ALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKP  1771
             AL+ G   +G YE+A+KL  +M+ EG+ P+    S +LS   +L  +E+G+QVH   +K 
Sbjct  400   ALVTGNTHNGCYEEALKLFCKMIVEGIFPDQIVTSSVLSASAELTLLEFGQQVHGNYIKS  459

Query  1770  GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIY  1591
             GF S++ V ++L+ MY KCG L DA  +F+ +  ++L++W T+++GYA++G  K++LE+Y
Sbjct  460   GFPSSLSVNNSLVTMYTKCGSLDDANVIFNSMEIRDLITWTTLIVGYAKNGKAKDSLELY  519

Query  1590  SMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFAR  1411
              +M  NG+ P+ ITF+G+L AC H GL+EE  ++F+SM+  YGI P   H ACM++LF R
Sbjct  520   YLMIGNGITPDYITFIGLLFACSHAGLIEEAQSYFDSMRAVYGIRPGPEHYACMIDLFGR  579

Query  1410  KGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTL  1231
              G   K  + +     +PD  VW+ +L+    + +   G+ AA+ ++ ++PN+   +V L
Sbjct  580   SGDFVKVEELLNQMEVEPDATVWKAILAASRKHGNIENGERAAKTLMELEPNNAVPYVLL  639

Query  1230  SNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSS  1096
             SN+YA     DEAA +R++MK + + KE GCSW E + K++ F S
Sbjct  640   SNMYAAAGRQDEAANVRRLMKSRNISKEPGCSWVEEKGKVHSFMS  684


 Score =   232 bits (591),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 157/521 (30%), Positives = 256/521 (49%), Gaps = 22/521 (4%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +L  +IR CT+   +L G+  H   IK G   DV   N LL+MY     I  A+ L
Sbjct  123   PNEYTLGSVIRLCTSLALLLRGEEIHGHTIKTGFDLDVNVVNGLLAMYAQCKRISKAEYL  182

Query  2901  FDEMP-KRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             F+ M  ++N +TWT++++ YS  G + KA+  FR +  E G   N +T+   L+AC+ + 
Sbjct  183   FETMSGEKNNVTWTSMLTGYSQNGFAFKAIECFRDLTRE-GNQSNQFTFPSVLTACASVS  241

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
             A R G ++HG I ++    N +V + L++ Y KC  L++A+ + + M   + V+W S++ 
Sbjct  242   ARRVGVQVHGCIVKSGFKTNIYVQSALIDMYAKCRDLETARALLEGMEADDVVSWNSMIV  301

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACA-SVECLGFGMGIHCLIVKCGVK  2368
                + G  +E L  F R     + +++F     L   A S   +      HCLIVK G  
Sbjct  302   GCVRQGLIEEALSFFGRMHERDMKIDDFTIPSILNCFALSRTEIKIASSAHCLIVKTGYG  361

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
               + V   LV+ Y K G +  A   F      ++ +WTAL+ G    G   EA+ LFCK+
Sbjct  362   TYKLVNNALVDMYAKRGIMDSALKVFEGMIEKDVISWTALVTGNTHNGCYEEALKLFCKM  421

Query  2187  LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
             +  G+ P +   +SVL A  +    + G Q+H   IK GF S   V N+LV  Y+K   L
Sbjct  422   IVEGIFPDQIVTSSVLSASAELTLLEFGQQVHGNYIKSGFPSSLSVNNSLVTMYTKCGSL  481

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
             D++  IF  M   D++TW  LI GY ++G  + +++L   M+  G+ P+  T+  +L  C
Sbjct  482   DDANVIFNSMEIRDLITWTTLIVGYAKNGKAKDSLELYYLMIGNGITPDYITFIGLLFAC  541

Query  1827  GDLPAIEWGKQVHCRI-----MKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPC--  1669
                  IE  +     +     ++PG +      + +ID++   GR GD  KV ++L    
Sbjct  542   SHAGLIEEAQSYFDSMRAVYGIRPGPEHY----ACMIDLF---GRSGDFVKVEELLNQME  594

Query  1668  --KNLVSWNTMLIGYAQHG---FGKEALEIYSMMQENGVKP  1561
                +   W  +L    +HG    G+ A +    ++ N   P
Sbjct  595   VEPDATVWKAILAASRKHGNIENGERAAKTLMELEPNNAVP  635



>ref|XP_010277283.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Nelumbo nucifera]
Length=1084

 Score =   449 bits (1155),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 237/687 (34%), Positives = 397/687 (58%), Gaps = 1/687 (0%)
 Frame = -2

Query  3066  LSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMP  2887
              S ++ +CT  ++   G+  HAQ++K G  S++   N LL++Y+   ++   ++LF+EM 
Sbjct  311   FSSVLSACTKVEAFEQGEQLHAQVLKRGFSSEICVCNALLTLYIYHGDLVSTERLFNEMD  370

Query  2886  KRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGK  2707
              R+ +T+ ++IS +   G S++A+  F +M + + F  +  T    LSACS +GA   GK
Sbjct  371   CRDKVTYNSVISGFVKCGNSDRAIQLFENMQVAE-FKLDIVTIASLLSACSSVGALHKGK  429

Query  2706  EIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCG  2527
             ++H    +   + +  +   L++FY KC  +++A   F A    N V W  +L  + Q G
Sbjct  430   QLHSYAIKLGVSTDIRIEGSLLDFYVKCFDIETAHEFFLATKRENVVLWNVMLVAYGQLG  489

Query  2526  EYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVT  2347
                E L IF +    G+  NE+     L  C S+  +G GM IH LI+K G +++ YV +
Sbjct  490   NLRESLDIFSQMQIRGIRPNEYTYPSILRTCTSLGTIGLGMQIHTLIIKTGFELNAYVCS  549

Query  2346  GLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKP  2167
              L++ Y K G L LA       +  ++ +WTA+I G  Q     EA+ LF ++   G++ 
Sbjct  550   VLIDMYAKNGVLELARQILENLTEEDVVSWTAMIAGYAQNDLCIEALTLFEEMQIRGIRS  609

Query  2166  SERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIF  1987
                  +S L A    +   +G Q+H+     G++    + N+L++ Y++   + +++ +F
Sbjct  610   DNIGLSSALSACAGVQALNLGQQIHAQSCVSGYSMDLSIGNSLINLYARCGRIQDAYSVF  669

Query  1986  QEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIE  1807
               +   D ++WN LI+G+ +SGH E+++++  +M   G+  NL T+  ++S C ++  ++
Sbjct  670   DMIDAKDQISWNGLISGFAQSGHSEESLQVFFQMNRVGVGANLFTFGSVVSACANIADLK  729

Query  1806  WGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYA  1627
              GKQ+H +I+K G+DS+   G+ LI +YAKCG + DA K F  +P +N +SWN M+ GY+
Sbjct  730   QGKQIHAQIIKTGYDSDTESGNVLITLYAKCGNIYDAWKKFREMPDRNEISWNAMITGYS  789

Query  1626  QHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRT  1447
             QHG G EAL ++  M++ G+ PN ITFVGVLSAC H GL+ +GL++FNSM   + I PR 
Sbjct  790   QHGCGIEALNLFKEMKQQGLVPNYITFVGVLSACSHVGLVSKGLSYFNSMTTEHDIIPRA  849

Query  1446  NHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILS  1267
              H AC+V++  R G   +A +FI   P  PD +VWR LLS C ++K+  +G+ AA+++L 
Sbjct  850   EHYACVVDILGRAGLLDRAREFIEEMPIVPDAMVWRTLLSACMVHKNIKIGELAAQQLLE  909

Query  1266  IDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYN  1087
             ++P D++ +V LSNIYA    WD   ++R+MMK++ +KKE G SW E  N I+ F     
Sbjct  910   LEPEDSATYVLLSNIYAVARKWDCRDRMRQMMKERGVKKEPGRSWIEANNSIHAFFVGDR  969

Query  1086  MLLGEVSMKKLLIGLTAQLLDAGYVPD  1006
             +      + + L  L  ++ + GYV D
Sbjct  970   LHPLAYKIYEYLEDLNKRVAEIGYVQD  996


 Score =   261 bits (668),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 170/589 (29%), Positives = 290/589 (49%), Gaps = 24/589 (4%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             ++  C  + S+++ K  H +++K G   D    + L+S+Y     ++ A  + D + +++
Sbjct  111   LLEGCLRSGSLINAKCLHGKILKLGFDCDPVLCSQLISIYSGCGHLDDANGMLDNLSQQS  170

Query  2877  VITWTTLIS------SYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
             + +W  ++S      SYSH+      LG F  M+ ++   P+H+T+   L AC       
Sbjct  171   LSSWNIIMSGLVTKKSYSHV------LGLFSQMIAKN-VKPDHFTFSSVLEACF---GGN  220

Query  2715  TG----KEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLL  2548
              G    ++IH  I R     +  V N L+N Y K G + SA L+F+ +   ++ +W +++
Sbjct  221   VGFHYVEQIHAMIIRYGFATDQVVCNPLINLYSKNGYIDSACLIFEELCSRDSKSWVAMI  280

Query  2547  SCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVK  2368
             S   Q    +E L +F +  ++G+ +  ++    L AC  VE    G  +H  ++K G  
Sbjct  281   SGFSQNCHEEEALLLFNQMQQSGITLTPYVFSSVLSACTKVEAFEQGEQLHAQVLKRGFS  340

Query  2367  MDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKL  2188
              +  V   L+  Y+  G L      FN     +   + ++I G V+ G    A+ LF  +
Sbjct  341   SEICVCNALLTLYIYHGDLVSTERLFNEMDCRDKVTYNSVISGFVKCGNSDRAIQLFENM  400

Query  2187  LSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLL  2008
               +  K    T AS+L A +       G QLHS+ IKLG ++   +  +L+DFY K   +
Sbjct  401   QVAEFKLDIVTIASLLSACSSVGALHKGKQLHSYAIKLGVSTDIRIEGSLLDFYVKCFDI  460

Query  2007  DESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC  1828
             + + + F      ++V WN ++  Y + G+  +++ +  +M   G+ PN +TY  IL  C
Sbjct  461   ETAHEFFLATKRENVVLWNVMLVAYGQLGNLRESLDIFSQMQIRGIRPNEYTYPSILRTC  520

Query  1827  GDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWN  1648
               L  I  G Q+H  I+K GF+ N  V S LIDMYAK G L  AR++ + L  +++VSW 
Sbjct  521   TSLGTIGLGMQIHTLIIKTGFELNAYVCSVLIDMYAKNGVLELARQILENLTEEDVVSWT  580

Query  1647  TMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSAC-GHgglleegLNHFNSMKN  1471
              M+ GYAQ+    EAL ++  MQ  G++ ++I     LSAC G   L      H  S  +
Sbjct  581   AMIAGYAQNDLCIEALTLFEEMQIRGIRSDNIGLSSALSACAGVQALNLGQQIHAQSCVS  640

Query  1470  NYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
              Y +     +   ++NL+AR G+ + AY        K D++ W  L+SG
Sbjct  641   GYSMDLSIGN--SLINLYARCGRIQDAYSVFDMIDAK-DQISWNGLISG  686


 Score =   214 bits (545),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 143/505 (28%), Positives = 253/505 (50%), Gaps = 5/505 (1%)
 Frame = -2

Query  2832  LSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVS  2653
             LS+K    F  +  E     +  TY   L  C   G+    K +HG+I +     +  + 
Sbjct  84    LSKKENLDFLHLSGESSIHADFNTYHWLLEGCLRSGSLINAKCLHGKILKLGFDCDPVLC  143

Query  2652  NCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVL  2473
             + L++ Y  CG L  A  + D + + +  +W  ++S       Y   L +F + +   V 
Sbjct  144   SQLISIYSGCGHLDDANGMLDNLSQQSLSSWNIIMSGLVTKKSYSHVLGLFSQMIAKNVK  203

Query  2472  VNEFLCGIALGACASVECLGFGM--GIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAY  2299
              + F     L AC     +GF     IH +I++ G   DQ V   L+N Y K G +  A 
Sbjct  204   PDHFTFSSVLEACFGGN-VGFHYVEQIHAMIIRYGFATDQVVCNPLINLYSKNGYIDSAC  262

Query  2298  NTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTK  2119
               F    + +  +W A+I G  Q     EA+ LF ++  SG+  +   ++SVL A T  +
Sbjct  263   LIFEELCSRDSKSWVAMISGFSQNCHEEEALLLFNQMQQSGITLTPYVFSSVLSACTKVE  322

Query  2118  EFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIA  1939
              F+ G QLH+ ++K GF+S   VCNAL+  Y     L  + ++F EM   D VT+N++I+
Sbjct  323   AFEQGEQLHAQVLKRGFSSEICVCNALLTLYIYHGDLVSTERLFNEMDCRDKVTYNSVIS  382

Query  1938  GYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDS  1759
             G+++ G+ ++AI+L + M     + ++ T + +LS C  + A+  GKQ+H   +K G  +
Sbjct  383   GFVKCGNSDRAIQLFENMQVAEFKLDIVTIASLLSACSSVGALHKGKQLHSYAIKLGVST  442

Query  1758  NVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQ  1579
             ++ +  +L+D Y KC  +  A + F     +N+V WN ML+ Y Q G  +E+L+I+S MQ
Sbjct  443   DIRIEGSLLDFYVKCFDIETAHEFFLATKRENVVLWNVMLVAYGQLGNLRESLDIFSQMQ  502

Query  1578  ENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQT  1399
               G++PN+ T+  +L  C   G +  G+   +++    G        + +++++A+ G  
Sbjct  503   IRGIRPNEYTYPSILRTCTSLGTIGLGM-QIHTLIIKTGFELNAYVCSVLIDMYAKNGVL  561

Query  1398  KKAYDFIRSFPEKPDKVVWRCLLSG  1324
             + A   + +  E+ D V W  +++G
Sbjct  562   ELARQILENLTEE-DVVSWTAMIAG  585


 Score =   174 bits (442),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 114/394 (29%), Positives = 191/394 (48%), Gaps = 23/394 (6%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +   I+R+CT+  +I  G   H  +IK G + + Y  + L+ MY     +E A+++
Sbjct  508   PNEYTYPSILRTCTSLGTIGLGMQIHTLIIKTGFELNAYVCSVLIDMYAKNGVLELARQI  567

Query  2901  FDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGA  2722
              + + + +V++WT +I+ Y+   L  +AL  F  M +  G   ++     ALSAC+ + A
Sbjct  568   LENLTEEDVVSWTAMIAGYAQNDLCIEALTLFEEMQIR-GIRSDNIGLSSALSACAGVQA  626

Query  2721  ARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSC  2542
                G++IH +   +  +++  + N L+N Y +CG ++ A  VFD +   + ++W  L+S 
Sbjct  627   LNLGQQIHAQSCVSGYSMDLSIGNSLINLYARCGRIQDAYSVFDMIDAKDQISWNGLISG  686

Query  2541  HCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMD  2362
               Q G  +E L++F +  R GV  N F  G  + ACA++  L  G  IH  I+K G   D
Sbjct  687   FAQSGHSEESLQVFFQMNRVGVGANLFTFGSVVSACANIADLKQGKQIHAQIIKTGYDSD  746

Query  2361  QYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLS  2182
                   L+  Y KCG +  A+  F         +W A+I G  Q G G EA+NLF ++  
Sbjct  747   TESGNVLITLYAKCGNIYDAWKKFREMPDRNEISWNAMITGYSQHGCGIEALNLFKEMKQ  806

Query  2181  SGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFT-----------FVCNALV  2035
              GL P+  T+  VL A +       G+          FNS T           + C  +V
Sbjct  807   QGLVPNYITFVGVLSACSHVGLVSKGLSY--------FNSMTTEHDIIPRAEHYAC--VV  856

Query  2034  DFYSKSNLLDESFKIFQEMTEY-DIVTWNALIAG  1936
             D   ++ LLD + +  +EM    D + W  L++ 
Sbjct  857   DILGRAGLLDRAREFIEEMPIVPDAMVWRTLLSA  890


 Score = 79.7 bits (195),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 91/189 (48%), Gaps = 5/189 (3%)
 Frame = -2

Query  1872  LEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDAR  1693
             +  + +TY  +L  C    ++   K +H +I+K GFD + V+ S LI +Y+ CG L DA 
Sbjct  101   IHADFNTYHWLLEGCLRSGSLINAKCLHGKILKLGFDCDPVLCSQLISIYSGCGHLDDAN  160

Query  1692  KVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgg  1513
              + D L  ++L SWN ++ G          L ++S M    VKP+  TF  VL AC  G 
Sbjct  161   GMLDNLSQQSLSSWNIIMSGLVTKKSYSHVLGLFSQMIAKNVKPDHFTFSSVLEACFGGN  220

Query  1512  lleegLNHFNSMKNNYGITPRTNHLAC--MVNLFARKGQTKKAYDFIRSFPEKPDKVVWR  1339
             +    +   ++M   YG    T+ + C  ++NL+++ G    A         +  K  W 
Sbjct  221   VGFHYVEQIHAMIIRYGFA--TDQVVCNPLINLYSKNGYIDSACLIFEELCSRDSK-SWV  277

Query  1338  CLLSGCNIN  1312
              ++SG + N
Sbjct  278   AMISGFSQN  286



>ref|XP_010089854.1| hypothetical protein L484_022371 [Morus notabilis]
 gb|EXB38470.1| hypothetical protein L484_022371 [Morus notabilis]
Length=858

 Score =   442 bits (1138),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 243/682 (36%), Positives = 395/682 (58%), Gaps = 20/682 (3%)
 Frame = -2

Query  3024  LSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSY  2845
             ++G+  H Q +K G   DV     L+ MY+    I   +K+FDEM ++NV +WT L++ Y
Sbjct  102   VAGRQVHCQCVKSGFVEDVSVGTSLVDMYMKTEGIRDGRKVFDEMREKNVASWTALLTGY  161

Query  2844  SHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLN  2665
             +H GL++ AL  F  M   +G  PN  T+   + A +       G +IH  + ++    +
Sbjct  162   AHNGLNDFALDLFFQMHF-NGVKPNPLTFATVIGASANRDMVE-GSQIHTMVIKSGYESS  219

Query  2664  NFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLR  2485
              FV N L+N Y K  ++K A+ VFD M   + VTW S+++ +   G   E  R+F     
Sbjct  220   TFVCNSLINMYSKSSMIKDARAVFDIMESRDVVTWNSIIAGYVTNGLDLEAFRMFYSMNL  279

Query  2484  AGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGL  2305
              G  + + L    + +CA+++ L F   +HC ++KCG++ +  + T L+  Y KC ++  
Sbjct  280   TGEKLTQPLFVTLIKSCANLKNLCFARQVHCQVLKCGLQFNHNIRTALMVAYSKCTEMDD  339

Query  2304  AYNTFNMA-SAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFT  2128
             A+  F+M      + +WTA+I G +Q G   +AVNLFC++ S G++P++ TY+ +L A  
Sbjct  340   AFKMFSMVKDVRNVVSWTAMISGYLQNGATEQAVNLFCQMSSEGVRPNDFTYSIILTA--  397

Query  2127  DTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNA  1948
               +     +Q+H+ ++K  +     V  AL+D Y K   ++E+ K+F+ + E DIVTW+A
Sbjct  398   --QPSMFVVQVHAQVVKANYEKSPTVGTALLDAYVKMGNIEEAAKVFELIDEKDIVTWSA  455

Query  1947  LIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSIC-GDLPAIEWGKQVHCRIMKP  1771
             ++AGY + G    A+K+  ++  EG+ PN  T+S ++  C G   A E GKQ H   +K 
Sbjct  456   MLAGYAQMGETNGAVKIFLKLAKEGIRPNEFTFSSVIHACAGPTAAAEQGKQFHALSIKM  515

Query  1770  GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIY  1591
               ++ + V S L+ MYAK G +  A +V+     ++L+SWN+M+ G+AQHG GK+ALEI+
Sbjct  516   RLNNALCVSSALVTMYAKRGNIESANEVYKRQGERDLISWNSMISGFAQHGQGKKALEIF  575

Query  1590  SMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFAR  1411
               M+   +K + ITF+GV+SAC H GL++EG  +F+ M  ++ I+P   H +CMV+L++R
Sbjct  576   EDMRTKQLKMDGITFIGVISACTHAGLVDEGQRYFDMMVKDHHISPIMEHYSCMVDLYSR  635

Query  1410  KGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTL  1231
              G+   A D I   P      VWR LL+ C++ +D  LGK+AAE+++S+ P D++A+V L
Sbjct  636   AGKLGNAMDVINGMPFPAGATVWRTLLAACHVRRDLELGKFAAEKLISLQPEDSAAYVLL  695

Query  1230  SNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGEVS-----  1066
             SNIYA    W E   +RK+M ++++KKE G SW E+++K + F      L G++S     
Sbjct  696   SNIYAATGNWQERNTVRKLMDERKVKKEAGYSWIEVKHKTHSF------LAGDLSHPMAE  749

Query  1065  -MKKLLIGLTAQLLDAGYVPDT  1003
              +   L  L  +L D GY PDT
Sbjct  750   NIYSKLEELRIRLKDMGYQPDT  771


 Score =   251 bits (641),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 159/562 (28%), Positives = 283/562 (50%), Gaps = 24/562 (4%)
 Frame = -2

Query  2994  IKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKAL  2815
             I YGSK         LS+   F     A  LF++ PKR+ +  T L+  YS  G + ++L
Sbjct  19    ISYGSKD--------LSISAEFCSSCNAHHLFEKSPKRDFLESTNLLFEYSRNGFNHESL  70

Query  2814  GSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNF  2635
               F  +    GF  +          C CL     G+++H +  ++    +  V   LV+ 
Sbjct  71    NLFAGLC-RSGFPVDGLALSCTSKVCRCLFDQVAGRQVHCQCVKSGFVEDVSVGTSLVDM  129

Query  2634  YGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLC  2455
             Y K   ++  + VFD M E N  +W +LL+ +   G  D  L +F +    GV  N    
Sbjct  130   YMKTEGIRDGRKVFDEMREKNVASWTALLTGYAHNGLNDFALDLFFQMHFNGVKPNPLTF  189

Query  2454  GIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASA  2275
                +GA A+ + +  G  IH +++K G +   +V   L+N Y K   +  A   F++  +
Sbjct  190   ATVIGASANRDMVE-GSQIHTMVIKSGYESSTFVCNSLINMYSKSSMIKDARAVFDIMES  248

Query  2274  PELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQL  2095
              ++  W ++I G V  G   EA  +F  +  +G K ++  + +++ +  + K      Q+
Sbjct  249   RDVVTWNSIIAGYVTNGLDLEAFRMFYSMNLTGEKLTQPLFVTLIKSCANLKNLCFARQV  308

Query  2094  HSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEY-DIVTWNALIAGYIRSGH  1918
             H  ++K G      +  AL+  YSK   +D++FK+F  + +  ++V+W A+I+GY+++G 
Sbjct  309   HCQVLKCGLQFNHNIRTALMVAYSKCTEMDDAFKMFSMVKDVRNVVSWTAMISGYLQNGA  368

Query  1917  YEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGST  1738
              EQA+ L  +M  EG+ PN  TYS IL+    +  +    QVH +++K  ++ +  VG+ 
Sbjct  369   TEQAVNLFCQMSSEGVRPNDFTYSIILTAQPSMFVV----QVHAQVVKANYEKSPTVGTA  424

Query  1737  LIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPN  1558
             L+D Y K G + +A KVF+++  K++V+W+ ML GYAQ G    A++I+  + + G++PN
Sbjct  425   LLDAYVKMGNIEEAAKVFELIDEKDIVTWSAMLAGYAQMGETNGAVKIFLKLAKEGIRPN  484

Query  1557  DITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLAC----MVNLFARKGQTKKA  1390
             + TF  V+ AC       E    F+++     I  R N+  C    +V ++A++G  + A
Sbjct  485   EFTFSSVIHACAGPTAAAEQGKQFHAL----SIKMRLNNALCVSSALVTMYAKRGNIESA  540

Query  1389  YDFIRSFPEKPDKVVWRCLLSG  1324
              +  +   E+ D + W  ++SG
Sbjct  541   NEVYKRQGER-DLISWNSMISG  561



>gb|KHN09480.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=725

 Score =   438 bits (1127),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 242/690 (35%), Positives = 392/690 (57%), Gaps = 3/690 (0%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRN  2878
             +I +CT+ +S+  GK  H  ++K   + D+   NH+L+MY     ++ A+K FD M  RN
Sbjct  33    LILACTSIRSLKYGKKIHDHILKSNCQPDLVLQNHILNMYGKCGSLKDARKAFDTMQLRN  92

Query  2877  VITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
             V++WT +IS YS  G    A+  +  M L+ G+ P+  T+   + AC   G    G+++H
Sbjct  93    VVSWTIMISGYSQNGQENDAIIMYIQM-LQSGYFPDPLTFGSIIKACCIAGDIDLGRQLH  151

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
             G + ++    +    N L++ Y + G +  A  VF  +   + ++WAS+++   Q G   
Sbjct  152   GHVIKSGYDHHLIAQNALISMYTRFGQIVHASDVFTMISTKDLISWASMITGFTQLGYEI  211

Query  2517  EGLRIFLRSLRAGVL-VNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGL  2341
             E L +F    R G    NEF+ G    AC S+    FG  IH +  K G+  + +    L
Sbjct  212   EALYLFRDMFRQGFYQPNEFIFGSVFSACRSLLEPEFGRQIHGMCAKFGLGRNVFAGCSL  271

Query  2340  VNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSE  2161
              + Y K G L  A   F    +P+L +W A+I      G   EA+  FC+++ +GL P  
Sbjct  272   CDMYAKFGFLPSAIRAFYQIESPDLVSWNAIIAAFSDSGDVNEAIYFFCQMMHTGLMPDG  331

Query  2160  RTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQE  1981
              T+ S+L A         G Q+HS+IIK+G +    VCN+L+  Y+K + L ++F +F++
Sbjct  332   ITFLSLLCACGSPVTINQGTQIHSYIIKIGLDKEAAVCNSLLTMYTKCSNLHDAFNVFKD  391

Query  1980  MTE-YDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEW  1804
             ++E  ++V+WNA+++  ++     +  +L + MLF   +P+  T + IL  C +L ++E 
Sbjct  392   VSENANLVSWNAILSACLQHKQAGEVFRLFKLMLFSENKPDNITITTILGTCAELASLEV  451

Query  1803  GKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQ  1624
             G QVHC  +K G   +V V + LIDMYAKCG L  AR VF      ++VSW+++++GYAQ
Sbjct  452   GNQVHCFSVKSGLVVDVSVSNRLIDMYAKCGSLKHARDVFGSTQNPDIVSWSSLIVGYAQ  511

Query  1623  HGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTN  1444
              G G EAL ++ MM+  GV+PN++T++GVLSAC H GL+EEG + +N+M+   GI P   
Sbjct  512   FGLGHEALNLFRMMKNLGVQPNEVTYLGVLSACSHIGLVEEGWHFYNTMEIELGIPPTRE  571

Query  1443  HLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSI  1264
             H++CMV+L AR G   +A +FI+     PD  +W+ LL+ C  + +  + + AAE IL +
Sbjct  572   HVSCMVDLLARAGCLYEAENFIKKMGFNPDITMWKTLLASCKTHGNVDIAERAAENILKL  631

Query  1263  DPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNM  1084
             DP++++A V LSNI+A +  W E A++R +MKQ  ++K  G SW  ++++I+ F S  N 
Sbjct  632   DPSNSAALVLLSNIHASVGNWKEVARLRNLMKQMGVQKVPGQSWIAVKDQIHVFFSEDNS  691

Query  1083  LLGEVSMKKLLIGLTAQLLDAGYVPDTKLS  994
                   +  +L  L  Q+LD GY P  +L 
Sbjct  692   HQQRGDIYTMLEDLWLQMLDDGYDPCQRLD  721


 Score =   240 bits (612),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 152/513 (30%), Positives = 246/513 (48%), Gaps = 12/513 (2%)
 Frame = -2

Query  2763  TYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAM  2584
             TY   + AC+ + + + GK+IH  I ++    +  + N ++N YGKCG LK A+  FD M
Sbjct  29    TYGNLILACTSIRSLKYGKKIHDHILKSNCQPDLVLQNHILNMYGKCGSLKDARKAFDTM  88

Query  2583  LEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGM  2404
                N V+W  ++S + Q G+ ++ + ++++ L++G   +    G  + AC     +  G 
Sbjct  89    QLRNVVSWTIMISGYSQNGQENDAIIMYIQMLQSGYFPDPLTFGSIIKACCIAGDIDLGR  148

Query  2403  GIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQG  2224
              +H  ++K G          L++ Y + GQ+  A + F M S  +L +W ++I G  Q G
Sbjct  149   QLHGHVIKSGYDHHLIAQNALISMYTRFGQIVHASDVFTMISTKDLISWASMITGFTQLG  208

Query  2223  KGREAVNLFCKLLSSGL-KPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVC  2047
                EA+ LF  +   G  +P+E  + SV  A     E + G Q+H    K G     F  
Sbjct  209   YEIEALYLFRDMFRQGFYQPNEFIFGSVFSACRSLLEPEFGRQIHGMCAKFGLGRNVFAG  268

Query  2046  NALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLE  1867
              +L D Y+K   L  + + F ++   D+V+WNA+IA +  SG   +AI    +M+  GL 
Sbjct  269   CSLCDMYAKFGFLPSAIRAFYQIESPDLVSWNAIIAAFSDSGDVNEAIYFFCQMMHTGLM  328

Query  1866  PNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKV  1687
             P+  T+  +L  CG    I  G Q+H  I+K G D    V ++L+ MY KC  L DA  V
Sbjct  329   PDGITFLSLLCACGSPVTINQGTQIHSYIIKIGLDKEAAVCNSLLTMYTKCSNLHDAFNV  388

Query  1686  F-DILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHggl  1510
             F D+    NLVSWN +L    QH    E   ++ +M  +  KP++IT   +L  C     
Sbjct  389   FKDVSENANLVSWNAILSACLQHKQAGEVFRLFKLMLFSENKPDNITITTILGTCAE-LA  447

Query  1509  leegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLL  1330
               E  N  +      G+    +    +++++A+ G  K A D   S  + PD V W  L+
Sbjct  448   SLEVGNQVHCFSVKSGLVVDVSVSNRLIDMYAKCGSLKHARDVFGS-TQNPDIVSWSSLI  506

Query  1329  SGCNINKDFVLGKYAAE-----EILSIDPNDTS  1246
              G      F LG  A       + L + PN+ +
Sbjct  507   VG---YAQFGLGHEALNLFRMMKNLGVQPNEVT  536


 Score =   224 bits (571),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 139/498 (28%), Positives = 236/498 (47%), Gaps = 3/498 (1%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L +   P  ++   II++C     I  G+  H  +IK G    +   N L+SMY  F +
Sbjct  119   MLQSGYFPDPLTFGSIIKACCIAGDIDLGRQLHGHVIKSGYDHHLIAQNALISMYTRFGQ  178

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
             I  A  +F  +  +++I+W ++I+ ++ +G   +AL  FR M  +  + PN + +    S
Sbjct  179   IVHASDVFTMISTKDLISWASMITGFTQLGYEIEALYLFRDMFRQGFYQPNEFIFGSVFS  238

Query  2742  ACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVT  2563
             AC  L     G++IHG   +     N F    L + Y K G L SA   F  +  P+ V+
Sbjct  239   ACRSLLEPEFGRQIHGMCAKFGLGRNVFAGCSLCDMYAKFGFLPSAIRAFYQIESPDLVS  298

Query  2562  WASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIV  2383
             W ++++     G+ +E +  F + +  G++ +       L AC S   +  G  IH  I+
Sbjct  299   WNAIIAAFSDSGDVNEAIYFFCQMMHTGLMPDGITFLSLLCACGSPVTINQGTQIHSYII  358

Query  2382  KCGVKMDQYVVTGLVNFYVKCGQLGLAYNTF-NMASAPELHAWTALIGGCVQQGKGREAV  2206
             K G+  +  V   L+  Y KC  L  A+N F +++    L +W A++  C+Q  +  E  
Sbjct  359   KIGLDKEAAVCNSLLTMYTKCSNLHDAFNVFKDVSENANLVSWNAILSACLQHKQAGEVF  418

Query  2205  NLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFY  2026
              LF  +L S  KP   T  ++LG   +    +VG Q+H F +K G      V N L+D Y
Sbjct  419   RLFKLMLFSENKPDNITITTILGTCAELASLEVGNQVHCFSVKSGLVVDVSVSNRLIDMY  478

Query  2025  SKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYS  1846
             +K   L  +  +F      DIV+W++LI GY + G   +A+ L + M   G++PN  TY 
Sbjct  479   AKCGSLKHARDVFGSTQNPDIVSWSSLIVGYAQFGLGHEALNLFRMMKNLGVQPNEVTYL  538

Query  1845  CILSICGDLPAIEWGKQVHCRI-MKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPC  1669
              +LS C  +  +E G   +  + ++ G        S ++D+ A+ G L +A      +  
Sbjct  539   GVLSACSHIGLVEEGWHFYNTMEIELGIPPTREHVSCMVDLLARAGCLYEAENFIKKMGF  598

Query  1668  K-NLVSWNTMLIGYAQHG  1618
               ++  W T+L     HG
Sbjct  599   NPDITMWKTLLASCKTHG  616


 Score =   132 bits (332),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 87/313 (28%), Positives = 158/313 (50%), Gaps = 8/313 (3%)
 Frame = -2

Query  2232  QQGKGREAVNLF-CKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFT  2056
             +Q   REA++ F     +S ++    TY +++ A T  +  + G ++H  I+K       
Sbjct  3     KQRHYREALDTFNFHPKNSSIQLESSTYGNLILACTSIRSLKYGKKIHDHILKSNCQPDL  62

Query  2055  FVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFE  1876
              + N +++ Y K   L ++ K F  M   ++V+W  +I+GY ++G    AI +  +ML  
Sbjct  63    VLQNHILNMYGKCGSLKDARKAFDTMQLRNVVSWTIMISGYSQNGQENDAIIMYIQMLQS  122

Query  1875  GLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDA  1696
             G  P+  T+  I+  C     I+ G+Q+H  ++K G+D +++  + LI MY + G++  A
Sbjct  123   GYFPDPLTFGSIIKACCIAGDIDLGRQLHGHVIKSGYDHHLIAQNALISMYTRFGQIVHA  182

Query  1695  RKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGV-KPNDITFVGVLSACGH  1519
               VF ++  K+L+SW +M+ G+ Q G+  EAL ++  M   G  +PN+  F  V SAC  
Sbjct  183   SDVFTMISTKDLISWASMITGFTQLGYEIEALYLFRDMFRQGFYQPNEFIFGSVFSAC-R  241

Query  1518  gglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSF--PEKPDKVV  1345
               L  E     + M   +G+         + +++A+ G    A   IR+F   E PD V 
Sbjct  242   SLLEPEFGRQIHGMCAKFGLGRNVFAGCSLCDMYAKFGFLPSA---IRAFYQIESPDLVS  298

Query  1344  WRCLLSGCNINKD  1306
             W  +++  + + D
Sbjct  299   WNAIIAAFSDSGD  311



>ref|XP_009797200.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Nicotiana sylvestris]
 ref|XP_009797201.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Nicotiana sylvestris]
 ref|XP_009797202.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Nicotiana sylvestris]
 ref|XP_009797203.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Nicotiana sylvestris]
 ref|XP_009797205.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g52630 [Nicotiana sylvestris]
Length=883

 Score =   443 bits (1140),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 242/701 (35%), Positives = 389/701 (55%), Gaps = 15/701 (2%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             + +   ++++C+  K +  GK  H  ++  G +SDV+  N L+ MY    E+  ++ LF+
Sbjct  107   EFTFPSVLKACSIEKELFLGKQIHGIVVVTGFESDVFVANTLVVMYAKCGELLDSRMLFE  166

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
             E+P+RNV++W  L S Y+      +A+  F  M++  G  P+ Y+    L+AC+ LG   
Sbjct  167   EIPERNVVSWNALFSCYTQNDFFSEAMCMFGDMIVS-GVRPDEYSLSNILNACTGLGDIV  225

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS---  2545
              GK+IHG + +     + F SN LV+ Y K G LK A  VF+ ++ P+ V+W ++++   
Sbjct  226   QGKKIHGCLVKLGYGSDPFSSNALVDMYAKGGNLKHAITVFNEIVVPDIVSWNAIIAGCV  285

Query  2544  ---CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCG  2374
                CH Q  +    +R      R+G+  N F    AL ACA++E  G G G+H L++K  
Sbjct  286   LHECHHQAIDMLNQMR------RSGIWPNMFTLSSALKACAALELPGLGQGLHSLLIKKD  339

Query  2373  VKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFC  2194
             + +D +V  GL++ Y KC     A   +++    +L A  A+I G  Q       ++LF 
Sbjct  340   IMLDPFVSVGLIDMYCKCDLTKYARLIYDLMPGKDLIALNAMISGYSQNEADNACLDLFV  399

Query  2193  KLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSN  2014
             +  + G+   + T  +VL +    +   V  Q+H+  +K GF   TFV N+LVD Y K +
Sbjct  400   QTFTQGIGFDQTTLLAVLNSAAGLQAPNVCKQVHALSVKSGFQCDTFVINSLVDSYGKCS  459

Query  2013  LLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILS  1834
              LD++  IF E    D+ ++ +LI  Y   G  E+A+KL  ++   GL+P+    S +L+
Sbjct  460   QLDDAATIFDECPTPDLPSFTSLITAYALLGRGEEAMKLYLKLQGMGLKPDSFVCSSLLN  519

Query  1833  ICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVS  1654
              C +L A E GKQ+H  ++K GF S+V  G++L++MYAKCG + DA   F  +P K +VS
Sbjct  520   ACANLSAYEQGKQIHAHVLKFGFMSDVFAGNSLVNMYAKCGSIEDANCAFSEVPRKGIVS  579

Query  1653  WNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMK  1474
             W+ M+ G AQHG+ K+AL ++  M ++GV PN IT V VL AC H GL+ E   +F +MK
Sbjct  580   WSAMIGGLAQHGYAKKALHLFGEMLKDGVSPNHITLVSVLYACNHAGLVAEAKKYFETMK  639

Query  1473  NNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLG  1294
             +++ I P   H ACM+++  R G+   A D +   P + +  VW  LL    I+K+  +G
Sbjct  640   DSFAIEPTQEHYACMIDVLGRAGKLNDAIDLVNKMPFEANASVWGALLGAARIHKNVEVG  699

Query  1293  KYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNK  1114
             + AAE + ++ P  +  HV L+NIYA + +W + A++R++MK   +KKE G SW E+++ 
Sbjct  700   QRAAEMLFNLQPEKSGTHVLLANIYASVGLWGDVAKVRRLMKDSRVKKEPGMSWIEIKDS  759

Query  1113  IYCFSSSYNMLLGEVSMKKLLIGLTAQLLDAGYVP--DTKL  997
             I+ F       L    +   L  L   +  AGYVP  DT L
Sbjct  760   IFTFIVGDRSHLRNDEIYAKLEELGQLMAKAGYVPMVDTDL  800


 Score =   264 bits (674),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 176/587 (30%), Positives = 294/587 (50%), Gaps = 9/587 (2%)
 Frame = -2

Query  3075  KMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFD  2896
             ++S ++++   +  KS+  G    A L K G  +D    NHL+++Y      + A KL  
Sbjct  6     RLSYTKLLSQLSQTKSLNPGLQIQAHLTKTGLLNDSKHRNHLINLYSKCGVFDYAWKLLA  65

Query  2895  EMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAAR  2716
             E P+ ++++W++LIS Y+  G  + A+ +F  M    G   N +T+   L ACS      
Sbjct  66    ESPEPDLVSWSSLISGYAKNGFGKDAIWAFFKM-HSLGLKCNEFTFPSVLKACSIEKELF  124

Query  2715  TGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHC  2536
              GK+IHG +       + FV+N LV  Y KCG L  ++++F+ + E N V+W +L SC+ 
Sbjct  125   LGKQIHGIVVVTGFESDVFVANTLVVMYAKCGELLDSRMLFEEIPERNVVSWNALFSCYT  184

Query  2535  QCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQY  2356
             Q   + E + +F   + +GV  +E+     L AC  +  +  G  IH  +VK G   D +
Sbjct  185   QNDFFSEAMCMFGDMIVSGVRPDEYSLSNILNACTGLGDIVQGKKIHGCLVKLGYGSDPF  244

Query  2355  VVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSG  2176
                 LV+ Y K G L  A   FN    P++ +W A+I GCV      +A+++  ++  SG
Sbjct  245   SSNALVDMYAKGGNLKHAITVFNEIVVPDIVSWNAIIAGCVLHECHHQAIDMLNQMRRSG  304

Query  2175  LKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESF  1996
             + P+  T +S L A    +   +G  LHS +IK       FV   L+D Y K +L   + 
Sbjct  305   IWPNMFTLSSALKACAALELPGLGQGLHSLLIKKDIMLDPFVSVGLIDMYCKCDLTKYAR  364

Query  1995  KIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLP  1816
              I+  M   D++  NA+I+GY ++      + L  +   +G+  +  T   +L+    L 
Sbjct  365   LIYDLMPGKDLIALNAMISGYSQNEADNACLDLFVQTFTQGIGFDQTTLLAVLNSAAGLQ  424

Query  1815  AIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLI  1636
             A    KQVH   +K GF  +  V ++L+D Y KC +L DA  +FD  P  +L S+ +++ 
Sbjct  425   APNVCKQVHALSVKSGFQCDTFVINSLVDSYGKCSQLDDAATIFDECPTPDLPSFTSLIT  484

Query  1635  GYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegLN-HFNSMKNNYGI  1459
              YA  G G+EA+++Y  +Q  G+KP+      +L+AC +    E+G   H + +K  +G 
Sbjct  485   AYALLGRGEEAMKLYLKLQGMGLKPDSFVCSSLLNACANLSAYEQGKQIHAHVLK--FGF  542

Query  1458  TPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDK--VVWRCLLSG  1324
                      +VN++A+ G  + A     +F E P K  V W  ++ G
Sbjct  543   MSDVFAGNSLVNMYAKCGSIEDAN---CAFSEVPRKGIVSWSAMIGG  586


 Score =   229 bits (583),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 149/517 (29%), Positives = 261/517 (50%), Gaps = 9/517 (2%)
 Frame = -2

Query  3111  GSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVT  2932
             G  I++  R P + SLS I+ +CT    I+ GK  H  L+K G  SD +++N L+ MY  
Sbjct  197   GDMIVSGVR-PDEYSLSNILNACTGLGDIVQGKKIHGCLVKLGYGSDPFSSNALVDMYAK  255

Query  2931  FHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVG  2752
                ++ A  +F+E+   ++++W  +I+         +A+     M    G  PN +T   
Sbjct  256   GGNLKHAITVFNEIVVPDIVSWNAIIAGCVLHECHHQAIDMLNQM-RRSGIWPNMFTLSS  314

Query  2751  ALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPN  2572
             AL AC+ L     G+ +H  + + +  L+ FVS  L++ Y KC L K A+L++D M   +
Sbjct  315   ALKACAALELPGLGQGLHSLLIKKDIMLDPFVSVGLIDMYCKCDLTKYARLIYDLMPGKD  374

Query  2571  TVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHC  2392
              +   +++S + Q    +  L +F+++   G+  ++      L + A ++       +H 
Sbjct  375   LIALNAMISGYSQNEADNACLDLFVQTFTQGIGFDQTTLLAVLNSAAGLQAPNVCKQVHA  434

Query  2391  LIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGRE  2212
             L VK G + D +V+  LV+ Y KC QL  A   F+    P+L ++T+LI      G+G E
Sbjct  435   LSVKSGFQCDTFVINSLVDSYGKCSQLDDAATIFDECPTPDLPSFTSLITAYALLGRGEE  494

Query  2211  AVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVD  2032
             A+ L+ KL   GLKP     +S+L A  +   ++ G Q+H+ ++K GF S  F  N+LV+
Sbjct  495   AMKLYLKLQGMGLKPDSFVCSSLLNACANLSAYEQGKQIHAHVLKFGFMSDVFAGNSLVN  554

Query  2031  FYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHT  1852
              Y+K   ++++   F E+    IV+W+A+I G  + G+ ++A+ L  EML +G+ PN  T
Sbjct  555   MYAKCGSIEDANCAFSEVPRKGIVSWSAMIGGLAQHGYAKKALHLFGEMLKDGVSPNHIT  614

Query  1851  YSCILSICGDLPAIEWGKQVHCRIMKPGF--DSNVVVGSTLIDMYAKCGRLGDARKVFDI  1678
                +L  C     +   K+ +   MK  F  +      + +ID+  + G+L DA  + + 
Sbjct  615   LVSVLYACNHAGLVAEAKK-YFETMKDSFAIEPTQEHYACMIDVLGRAGKLNDAIDLVNK  673

Query  1677  LPCK-NLVSWNTMLIGYAQHG---FGKEALEIYSMMQ  1579
             +P + N   W  +L     H     G+ A E+   +Q
Sbjct  674   MPFEANASVWGALLGAARIHKNVEVGQRAAEMLFNLQ  710



>ref|XP_008390176.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Malus domestica]
 ref|XP_008390177.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Malus domestica]
 ref|XP_008390178.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g13230, mitochondrial [Malus domestica]
Length=833

 Score =   442 bits (1136),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 259/725 (36%), Positives = 383/725 (53%), Gaps = 13/725 (2%)
 Frame = -2

Query  3180  SQGAHPPLPPATTASLRPA*QSQGSSILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHA  3001
             +Q A  P P  TT    P+     S   + A G        +++ C  N    S    H 
Sbjct  34    AQAAQLPPPNFTTHPKLPS-----SEFDSHAYGV-------VLQHCIRNGDARSAMGLHC  81

Query  3000  QLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSYSHMGLSEK  2821
             +++K G   D++ +N LL+MYV    +  A  LFDEM +RNVI++ TLI  +S  G    
Sbjct  82    EILKKGGCLDLFADNILLNMYVKAGMLVDAANLFDEMSERNVISFVTLIQGFSDYGRFVD  141

Query  2820  ALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLNNFVSNCLV  2641
             A+  F  +  E G   N + +   L      G A     +H  I +     + FV   L+
Sbjct  142   AVELFSGLHRE-GHELNQFVFTTILKLLVRTGWAELVWTVHACIHKLAHGSSAFVGTALI  200

Query  2640  NFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYDEGLRIFLRSLRAGVLVNEF  2461
             + Y  CG +  A+ VFD ++  + V W  +++C+ + G  +E L +F +    G   N +
Sbjct  201   DAYSVCGYVNVARDVFDEVVCKDMVAWTGMVACYAENGCSEEALELFSQMRVIGFRPNNY  260

Query  2460  LCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMA  2281
                 AL ACA +E L  G  +H  ++K   + D YV T L++ Y K G +  A   F   
Sbjct  261   TFTGALKACAGLEALNGGKSVHGCVIKSCYEGDLYVGTALLDLYTKFGDIEEARQVFQEM  320

Query  2280  SAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGM  2101
                ++  W+ ++    Q  +  EA++LFC++  + + P++ TYAS L A    +    GM
Sbjct  321   PKNDVVPWSLMVSRYAQSDRCEEALDLFCRMRQAFVVPNQFTYASTLQACATMEHLDFGM  380

Query  2100  QLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSG  1921
             Q+H  + K+G +S  +V NAL+  Y+K   +D+S  +F E    + V+WN +I GY + G
Sbjct  381   QIHCHVTKVGIDSDVYVSNALMGVYAKCGKIDDSMDLFVESPNRNDVSWNTMIVGYAQLG  440

Query  1920  HYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGS  1741
               E+A+ L   M+   +E    TYS  L     L A+E G Q+H   +K  +D + VVG+
Sbjct  441   DGEKALMLFSGMIRCQVEATEVTYSSALHASSGLAALESGVQIHSVTVKTIYDKDTVVGN  500

Query  1740  TLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKP  1561
             +LIDMYAKCG + DAR VFD L  ++ VSWNTM+ GY+ HG   EAL+++ MMQE   KP
Sbjct  501   SLIDMYAKCGNIKDARLVFDKLKQRDEVSWNTMISGYSMHGLALEALKVFEMMQETNCKP  560

Query  1560  NDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDF  1381
             N +TFVGVLSAC + GLL++G  +F+SM  +Y + P   H  CMV L  R G   KA   
Sbjct  561   NKLTFVGVLSACSNAGLLDQGQAYFDSMVQDYDVEPCIEHYTCMVWLLGRSGHLDKAVKL  620

Query  1380  IRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMW  1201
             I   P +P  +VWR LL  C I+ D  LG+ AA+ +L +DP D + HV LSNIYA    W
Sbjct  621   INEIPFEPSIMVWRALLGACVIHNDVELGRTAAKHVLEMDPQDEATHVLLSNIYATAKRW  680

Query  1200  DEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGEVSMKKLLIGLTAQLLDA  1021
             D  A +RK MK+K +KKE G SW E Q  ++ F+           +  +L  L  + L A
Sbjct  681   DNVAYVRKNMKRKGVKKEPGLSWIENQGTVHYFAVGDTSHPDMKLINGMLEWLKLRTLKA  740

Query  1020  GYVPD  1006
             G+VP+
Sbjct  741   GHVPN  745


 Score =   229 bits (584),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 145/519 (28%), Positives = 255/519 (49%), Gaps = 8/519 (2%)
 Frame = -2

Query  2865  TTLISSYSHMGLSEKAL----GSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIH  2698
             TT ++++S  G + +A      +F +         + + Y   L  C   G AR+   +H
Sbjct  21    TTALTTFSRCGFAAQAAQLPPPNFTTHPKLPSSEFDSHAYGVVLQHCIRNGDARSAMGLH  80

Query  2697  GRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGEYD  2518
               I +    L+ F  N L+N Y K G+L  A  +FD M E N +++ +L+      G + 
Sbjct  81    CEILKKGGCLDLFADNILLNMYVKAGMLVDAANLFDEMSERNVISFVTLIQGFSDYGRFV  140

Query  2517  EGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLV  2338
             + + +F    R G  +N+F+    L              +H  I K       +V T L+
Sbjct  141   DAVELFSGLHREGHELNQFVFTTILKLLVRTGWAELVWTVHACIHKLAHGSSAFVGTALI  200

Query  2337  NFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSER  2158
             + Y  CG + +A + F+     ++ AWT ++    + G   EA+ LF ++   G +P+  
Sbjct  201   DAYSVCGYVNVARDVFDEVVCKDMVAWTGMVACYAENGCSEEALELFSQMRVIGFRPNNY  260

Query  2157  TYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEM  1978
             T+   L A    +    G  +H  +IK  +    +V  AL+D Y+K   ++E+ ++FQEM
Sbjct  261   TFTGALKACAGLEALNGGKSVHGCVIKSCYEGDLYVGTALLDLYTKFGDIEEARQVFQEM  320

Query  1977  TEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGK  1798
              + D+V W+ +++ Y +S   E+A+ L   M    + PN  TY+  L  C  +  +++G 
Sbjct  321   PKNDVVPWSLMVSRYAQSDRCEEALDLFCRMRQAFVVPNQFTYASTLQACATMEHLDFGM  380

Query  1797  QVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHG  1618
             Q+HC + K G DS+V V + L+ +YAKCG++ D+  +F   P +N VSWNTM++GYAQ G
Sbjct  381   QIHCHVTKVGIDSDVYVSNALMGVYAKCGKIDDSMDLFVESPNRNDVSWNTMIVGYAQLG  440

Query  1617  FGKEALEIYSMMQENGVKPNDITFVGVLSA-CGHgglleegLNHFNSMKNNYGITPRTNH  1441
              G++AL ++S M    V+  ++T+   L A  G   L      H  ++K  Y       +
Sbjct  441   DGEKALMLFSGMIRCQVEATEVTYSSALHASSGLAALESGVQIHSVTVKTIYDKDTVVGN  500

Query  1440  LACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
                +++++A+ G  K A        ++ D+V W  ++SG
Sbjct  501   --SLIDMYAKCGNIKDARLVFDKLKQR-DEVSWNTMISG  536



>ref|XP_009340625.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009340626.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009340627.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Pyrus x bretschneideri]
Length=821

 Score =   441 bits (1135),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 235/680 (35%), Positives = 382/680 (56%), Gaps = 5/680 (1%)
 Frame = -2

Query  3021  SGKAAHA-QLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKLFDEMPKRNVITWTTLISSY  2845
             SG+   A Q+       D ++ N +++ Y     +  A++LFD  P +N ITW++LIS Y
Sbjct  61    SGRVDEARQMFDKMPSRDEFSWNTMIAAYANSGRLAEAKQLFDATPSKNSITWSSLISGY  120

Query  2844  SHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKEIHGRIFRAEETLN  2665
                    +A   F  M  E G  P+ YT    L  CS LG  + G  +HG + + +   N
Sbjct  121   CRNECESEAFELFWRMQFE-GHKPSQYTLGSVLRLCSTLGLLQRGALVHGYMTKTQFDNN  179

Query  2664  NFVSNCLVNFYGKCGLLKSAQLVFDAMLE-PNTVTWASLLSCHCQCGEYDEGLRIFLRSL  2488
              FV   LV+ Y KC  +  A+ +F  + +  N V W  +L+ + Q G+  + ++ F R +
Sbjct  180   IFVVTGLVDMYAKCKRISEAEYLFVTLPDRKNHVLWTVMLTGYSQNGDGFKAMK-FFRDM  238

Query  2487  RA-GVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKMDQYVVTGLVNFYVKCGQL  2311
             RA GV  N F     L A ASV    FG  +H  +V+ G+  + +V + LV+ YVKCG L
Sbjct  239   RAEGVESNHFTFPSVLTASASVLAHSFGAQVHGCVVQSGLGANVFVQSSLVDMYVKCGDL  298

Query  2310  GLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLLSSGLKPSERTYASVLGAF  2131
               A          ++ +W ++I GCV+QG   EA++LF  + S  +K    TY SVL +F
Sbjct  299   NSAKKALRSMEVDDVVSWNSMIVGCVRQGFAEEALSLFKDMRSREMKIDHFTYPSVLNSF  358

Query  2130  TDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDESFKIFQEMTEYDIVTWN  1951
                K+ +  M +H  IIK GF+ +  V NALVD Y+K   +D + ++F+ M+  D+++W 
Sbjct  359   AAMKDMKNAMSIHCLIIKTGFDVYQLVGNALVDMYAKQGNIDAAVEVFKCMSNKDVISWT  418

Query  1950  ALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDLPAIEWGKQVHCRIMKP  1771
             +LI GY+ +G +E+A++L  EM   G+ P+    +  LS C +L  +E+G+Q+H   +K 
Sbjct  419   SLITGYVHNGSHEKALRLFCEMRTAGIYPDQFVIASTLSACAELTVLEFGQQIHANFIKS  478

Query  1770  GFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTMLIGYAQHGFGKEALEIY  1591
             G  +++ V ++ + MYAKCG + DA +VFD +  +++++W  +++GYAQ+G GKE+L+ Y
Sbjct  479   GLQASLSVDNSFVAMYAKCGCIEDANRVFDSMQVQDVITWTALIVGYAQNGRGKESLKFY  538

Query  1590  SMMQENGVKPNDITFVGVLSACGHgglleegLNHFNSMKNNYGITPRTNHLACMVNLFAR  1411
               M   G +P+ ITF+G++ AC H GLLE+G  +F SM   YGI P   H ACM++L  R
Sbjct  539   DQMILAGAEPDFITFIGLIFACSHAGLLEKGRYYFESMSRVYGIQPGPEHYACMIDLLGR  598

Query  1410  KGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNINKDFVLGKYAAEEILSIDPNDTSAHVTL  1231
              G+  +A   +     +PD  VW+ LL+ C ++ +  LG+ AA  +  ++P +   +V L
Sbjct  599   SGKLNEAEALVNKMVVEPDGTVWKALLAACRVHGNIELGERAATNLFKLEPLNAVPYVQL  658

Query  1230  SNIYARLNMWDEAAQIRKMMKQKELKKETGCSWTELQNKIYCFSSSYNMLLGEVSMKKLL  1051
             SN+Y+  + W++AA+IR++MK K + KE GCSW E  ++++ F S          +   +
Sbjct  659   SNMYSAASRWEDAARIRRLMKSKGILKEPGCSWIETNSQVHTFMSEDRSHSRTAEIYSKV  718

Query  1050  IGLTAQLLDAGYVPDTKLSF  991
               +   + +AGYVPD   + 
Sbjct  719   DEIMMLIKEAGYVPDMNFAL  738


 Score =   229 bits (584),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 140/495 (28%), Positives = 250/495 (51%), Gaps = 12/495 (2%)
 Frame = -2

Query  3081  PLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQKL  2902
             P + +L  ++R C+T   +  G   H  + K    ++++    L+ MY     I  A+ L
Sbjct  143   PSQYTLGSVLRLCSTLGLLQRGALVHGYMTKTQFDNNIFVVTGLVDMYAKCKRISEAEYL  202

Query  2901  FDEMPKR-NVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             F  +P R N + WT +++ YS  G   KA+  FR M  E G   NH+T+   L+A + + 
Sbjct  203   FVTLPDRKNHVLWTVMLTGYSQNGDGFKAMKFFRDMRAE-GVESNHFTFPSVLTASASVL  261

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
             A   G ++HG + ++    N FV + LV+ Y KCG L SA+    +M   + V+W S++ 
Sbjct  262   AHSFGAQVHGCVVQSGLGANVFVQSSLVDMYVKCGDLNSAKKALRSMEVDDVVSWNSMIV  321

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGACASVECLGFGMGIHCLIVKCGVKM  2365
                + G  +E L +F       + ++ F     L + A+++ +   M IHCLI+K G  +
Sbjct  322   GCVRQGFAEEALSLFKDMRSREMKIDHFTYPSVLNSFAAMKDMKNAMSIHCLIIKTGFDV  381

Query  2364  DQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGKGREAVNLFCKLL  2185
              Q V   LV+ Y K G +  A   F   S  ++ +WT+LI G V  G   +A+ LFC++ 
Sbjct  382   YQLVGNALVDMYAKQGNIDAAVEVFKCMSNKDVISWTSLITGYVHNGSHEKALRLFCEMR  441

Query  2184  SSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLD  2005
             ++G+ P +   AS L A  +    + G Q+H+  IK G  +   V N+ V  Y+K   ++
Sbjct  442   TAGIYPDQFVIASTLSACAELTVLEFGQQIHANFIKSGLQASLSVDNSFVAMYAKCGCIE  501

Query  2004  ESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICG  1825
             ++ ++F  M   D++TW ALI GY ++G  ++++K   +M+  G EP+  T+  ++  C 
Sbjct  502   DANRVFDSMQVQDVITWTALIVGYAQNGRGKESLKFYDQMILAGAEPDFITFIGLIFACS  561

Query  1824  DLPAIEWGK---QVHCRI--MKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCK-N  1663
                 +E G+   +   R+  ++PG +      + +ID+  + G+L +A  + + +  + +
Sbjct  562   HAGLLEKGRYYFESMSRVYGIQPGPEHY----ACMIDLLGRSGKLNEAEALVNKMVVEPD  617

Query  1662  LVSWNTMLIGYAQHG  1618
                W  +L     HG
Sbjct  618   GTVWKALLAACRVHG  632


 Score =   109 bits (273),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 87/296 (29%), Positives = 136/296 (46%), Gaps = 13/296 (4%)
 Frame = -2

Query  3057  IIRSCTTNKSILSGKAAHAQLIKYGSKSDVY--TNNHLLSMYVTFHEIECAQKLFDEMPK  2884
             ++ S    K + +  + H  +IK G   DVY    N L+ MY     I+ A ++F  M  
Sbjct  354   VLNSFAAMKDMKNAMSIHCLIIKTGF--DVYQLVGNALVDMYAKQGNIDAAVEVFKCMSN  411

Query  2883  RNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLGAARTGKE  2704
             ++VI+WT+LI+ Y H G  EKAL  F  M    G  P+ +     LSAC+ L     G++
Sbjct  412   KDVISWTSLITGYVHNGSHEKALRLFCEMRTA-GIYPDQFVIASTLSACAELTVLEFGQQ  470

Query  2703  IHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLSCHCQCGE  2524
             IH    ++    +  V N  V  Y KCG ++ A  VFD+M   + +TW +L+  + Q G 
Sbjct  471   IHANFIKSGLQASLSVDNSFVAMYAKCGCIEDANRVFDSMQVQDVITWTALIVGYAQNGR  530

Query  2523  YDEGLRIFLRSLRAGVLVNEFLCGIAL-GACASVECLGFGMGIHCLIVKC-GVKMDQYVV  2350
               E L+ + + + AG    +F+  I L  AC+    L  G      + +  G++      
Sbjct  531   GKESLKFYDQMILAGA-EPDFITFIGLIFACSHAGLLEKGRYYFESMSRVYGIQPGPEHY  589

Query  2349  TGLVNFYVKCGQLGLAYNTFN-MASAPELHAWTALIGGCVQQGK----GREAVNLF  2197
               +++   + G+L  A    N M   P+   W AL+  C   G      R A NLF
Sbjct  590   ACMIDLLGRSGKLNEAEALVNKMVVEPDGTVWKALLAACRVHGNIELGERAATNLF  645



>ref|XP_002280412.1| PREDICTED: pentatricopeptide repeat-containing protein At3g13880 
isoform X2 [Vitis vinifera]
Length=802

 Score =   441 bits (1133),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 246/671 (37%), Positives = 390/671 (58%), Gaps = 15/671 (2%)
 Frame = -2

Query  3081  PLK-MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQK  2905
             PL  ++ +++++  T   S++ GK AH  +IK   K  ++  N+LL MY    E + A+K
Sbjct  16    PLDSVTYTKLVQCSTRTGSLIHGKLAHMHMIKTCFKPCLFLLNNLLYMYCKCGETDVAKK  75

Query  2904  LFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             LFD MPKRNV++W +LIS Y+ MG   + +  F+   + D    + +T+  ALS C    
Sbjct  76    LFDRMPKRNVVSWNSLISGYTQMGFYHEVMNLFKEARMSD-LRLDKFTFSNALSVCGRTL  134

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
               R G+ IH  I  +       ++N L++ Y KCG +  A+LVF++  E ++V+W SL++
Sbjct  135   DLRLGRLIHALITVSGLGGPVLLTNSLIDMYCKCGRIDWARLVFESADELDSVSWNSLIA  194

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGAC-----ASVECLGFGMGIHCLIVK  2380
              + + G  DE LR+ ++ LR G+ +N +  G AL AC     +S+EC   G  +H   VK
Sbjct  195   GYVRIGSNDEMLRLLVKMLRHGLNLNSYALGSALKACGSNFSSSIEC---GKMLHGCAVK  251

Query  2379  CGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGK-----GR  2215
              G+ +D  V T L++ Y K G L  A   F +   P +  + A+I G +Q          
Sbjct  252   LGLDLDVVVGTALLDTYAKIGDLEDATKIFKLMPDPNVVMYNAMIAGFLQMETMADEFAN  311

Query  2214  EAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALV  2035
             EA+ LF ++ S G+KPSE T++S+L A +  + F+ G Q+H+ I K    S  F+ NALV
Sbjct  312   EAMYLFFEMQSRGMKPSEFTFSSILKACSTIEAFECGKQIHAQIFKYNLQSDEFIGNALV  371

Query  2034  DFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLH  1855
             + YS S  +++  K F    + D+V+W +LI G++++G +E  + L  E+LF G +P+  
Sbjct  372   ELYSLSGSIEDGLKCFHSTPKLDVVSWTSLIVGHVQNGQFEGGLTLFHELLFSGRKPDEF  431

Query  1854  TYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDIL  1675
             T S +LS C +L A++ G+Q+H   +K G  +  ++ ++ I MYAKCG +  A   F   
Sbjct  432   TISIMLSACANLAAVKSGEQIHAYAIKTGIGNFTIIQNSQICMYAKCGDIDSANMTFKET  491

Query  1674  PCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegL  1495
                ++VSW+ M+   AQHG  KEA++++ +M+ +G+ PN ITF+GVL AC HGGL+EEGL
Sbjct  492   KNPDIVSWSVMISSNAQHGCAKEAVDLFELMKGSGIAPNHITFLGVLVACSHGGLVEEGL  551

Query  1494  NHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNI  1315
              +F  MK ++GITP   H AC+V+L  R G+  +A  FI     + D V+WR LLS C +
Sbjct  552   RYFEIMKKDHGITPNVKHSACIVDLLGRAGRLAEAESFIMDSGFEGDPVMWRSLLSACRV  611

Query  1314  NKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCS  1135
             +K    GK  AE ++ ++P   +++V L NIY    +   A +IR +MK + +KKE G S
Sbjct  612   HKATDTGKRVAERVIELEPEAAASYVLLYNIYNDAGIQMPATEIRNLMKDRGVKKEPGLS  671

Query  1134  WTELQNKIYCF  1102
             W E+ N ++ F
Sbjct  672   WIEVGNVVHSF  682


 Score =   124 bits (311),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 135/286 (47%), Gaps = 2/286 (1%)
 Frame = -2

Query  2178  GLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDES  1999
             GL     TY  ++   T T     G   H  +IK  F    F+ N L+  Y K    D +
Sbjct  14    GLPLDSVTYTKLVQCSTRTGSLIHGKLAHMHMIKTCFKPCLFLLNNLLYMYCKCGETDVA  73

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDL  1819
              K+F  M + ++V+WN+LI+GY + G Y + + L +E     L  +  T+S  LS+CG  
Sbjct  74    KKLFDRMPKRNVVSWNSLISGYTQMGFYHEVMNLFKEARMSDLRLDKFTFSNALSVCGRT  133

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
               +  G+ +H  I   G    V++ ++LIDMY KCGR+  AR VF+     + VSWN+++
Sbjct  134   LDLRLGRLIHALITVSGLGGPVLLTNSLIDMYCKCGRIDWARLVFESADELDSVSWNSLI  193

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACG-HgglleegLNHFNSMKNNYG  1462
              GY + G   E L +   M  +G+  N       L ACG +     E     +      G
Sbjct  194   AGYVRIGSNDEMLRLLVKMLRHGLNLNSYALGSALKACGSNFSSSIECGKMLHGCAVKLG  253

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
             +         +++ +A+ G  + A    +  P+ P+ V++  +++G
Sbjct  254   LDLDVVVGTALLDTYAKIGDLEDATKIFKLMPD-PNVVMYNAMIAG  298


 Score = 89.0 bits (219),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 100/206 (49%), Gaps = 5/206 (2%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L + R P + ++S ++ +C    ++ SG+  HA  IK G  +     N  + MY    +
Sbjct  421   LLFSGRKPDEFTISIMLSACANLAAVKSGEQIHAYAIKTGIGNFTIIQNSQICMYAKCGD  480

Query  2922  IECAQKLFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALS  2743
             I+ A   F E    ++++W+ +ISS +  G +++A+  F  M    G  PNH T++G L 
Sbjct  481   IDSANMTFKETKNPDIVSWSVMISSNAQHGCAKEAVDLFELMK-GSGIAPNHITFLGVLV  539

Query  2742  ACSCLGAARTGKEIHGRIFRAEETLNNFV--SNCLVNFYGKCGLLKSAQ-LVFDAMLEPN  2572
             ACS  G    G   +  I + +  +   V  S C+V+  G+ G L  A+  + D+  E +
Sbjct  540   ACSHGGLVEEGLR-YFEIMKKDHGITPNVKHSACIVDLLGRAGRLAEAESFIMDSGFEGD  598

Query  2571  TVTWASLLSCHCQCGEYDEGLRIFLR  2494
              V W SLLS        D G R+  R
Sbjct  599   PVMWRSLLSACRVHKATDTGKRVAER  624



>ref|XP_010665377.1| PREDICTED: pentatricopeptide repeat-containing protein At3g13880 
isoform X1 [Vitis vinifera]
 ref|XP_010665378.1| PREDICTED: pentatricopeptide repeat-containing protein At3g13880 
isoform X1 [Vitis vinifera]
 ref|XP_010665379.1| PREDICTED: pentatricopeptide repeat-containing protein At3g13880 
isoform X1 [Vitis vinifera]
Length=804

 Score =   441 bits (1133),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 246/671 (37%), Positives = 390/671 (58%), Gaps = 15/671 (2%)
 Frame = -2

Query  3081  PLK-MSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHEIECAQK  2905
             PL  ++ +++++  T   S++ GK AH  +IK   K  ++  N+LL MY    E + A+K
Sbjct  16    PLDSVTYTKLVQCSTRTGSLIHGKLAHMHMIKTCFKPCLFLLNNLLYMYCKCGETDVAKK  75

Query  2904  LFDEMPKRNVITWTTLISSYSHMGLSEKALGSFRSMVLEDGFTPNHYTYVGALSACSCLG  2725
             LFD MPKRNV++W +LIS Y+ MG   + +  F+   + D    + +T+  ALS C    
Sbjct  76    LFDRMPKRNVVSWNSLISGYTQMGFYHEVMNLFKEARMSD-LRLDKFTFSNALSVCGRTL  134

Query  2724  AARTGKEIHGRIFRAEETLNNFVSNCLVNFYGKCGLLKSAQLVFDAMLEPNTVTWASLLS  2545
               R G+ IH  I  +       ++N L++ Y KCG +  A+LVF++  E ++V+W SL++
Sbjct  135   DLRLGRLIHALITVSGLGGPVLLTNSLIDMYCKCGRIDWARLVFESADELDSVSWNSLIA  194

Query  2544  CHCQCGEYDEGLRIFLRSLRAGVLVNEFLCGIALGAC-----ASVECLGFGMGIHCLIVK  2380
              + + G  DE LR+ ++ LR G+ +N +  G AL AC     +S+EC   G  +H   VK
Sbjct  195   GYVRIGSNDEMLRLLVKMLRHGLNLNSYALGSALKACGSNFSSSIEC---GKMLHGCAVK  251

Query  2379  CGVKMDQYVVTGLVNFYVKCGQLGLAYNTFNMASAPELHAWTALIGGCVQQGK-----GR  2215
              G+ +D  V T L++ Y K G L  A   F +   P +  + A+I G +Q          
Sbjct  252   LGLDLDVVVGTALLDTYAKIGDLEDATKIFKLMPDPNVVMYNAMIAGFLQMETMADEFAN  311

Query  2214  EAVNLFCKLLSSGLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALV  2035
             EA+ LF ++ S G+KPSE T++S+L A +  + F+ G Q+H+ I K    S  F+ NALV
Sbjct  312   EAMYLFFEMQSRGMKPSEFTFSSILKACSTIEAFECGKQIHAQIFKYNLQSDEFIGNALV  371

Query  2034  DFYSKSNLLDESFKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLH  1855
             + YS S  +++  K F    + D+V+W +LI G++++G +E  + L  E+LF G +P+  
Sbjct  372   ELYSLSGSIEDGLKCFHSTPKLDVVSWTSLIVGHVQNGQFEGGLTLFHELLFSGRKPDEF  431

Query  1854  TYSCILSICGDLPAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDIL  1675
             T S +LS C +L A++ G+Q+H   +K G  +  ++ ++ I MYAKCG +  A   F   
Sbjct  432   TISIMLSACANLAAVKSGEQIHAYAIKTGIGNFTIIQNSQICMYAKCGDIDSANMTFKET  491

Query  1674  PCKNLVSWNTMLIGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACGHgglleegL  1495
                ++VSW+ M+   AQHG  KEA++++ +M+ +G+ PN ITF+GVL AC HGGL+EEGL
Sbjct  492   KNPDIVSWSVMISSNAQHGCAKEAVDLFELMKGSGIAPNHITFLGVLVACSHGGLVEEGL  551

Query  1494  NHFNSMKNNYGITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSGCNI  1315
              +F  MK ++GITP   H AC+V+L  R G+  +A  FI     + D V+WR LLS C +
Sbjct  552   RYFEIMKKDHGITPNVKHSACIVDLLGRAGRLAEAESFIMDSGFEGDPVMWRSLLSACRV  611

Query  1314  NKDFVLGKYAAEEILSIDPNDTSAHVTLSNIYARLNMWDEAAQIRKMMKQKELKKETGCS  1135
             +K    GK  AE ++ ++P   +++V L NIY    +   A +IR +MK + +KKE G S
Sbjct  612   HKATDTGKRVAERVIELEPEAAASYVLLYNIYNDAGIQMPATEIRNLMKDRGVKKEPGLS  671

Query  1134  WTELQNKIYCF  1102
             W E+ N ++ F
Sbjct  672   WIEVGNVVHSF  682


 Score =   124 bits (311),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 135/286 (47%), Gaps = 2/286 (1%)
 Frame = -2

Query  2178  GLKPSERTYASVLGAFTDTKEFQVGMQLHSFIIKLGFNSFTFVCNALVDFYSKSNLLDES  1999
             GL     TY  ++   T T     G   H  +IK  F    F+ N L+  Y K    D +
Sbjct  14    GLPLDSVTYTKLVQCSTRTGSLIHGKLAHMHMIKTCFKPCLFLLNNLLYMYCKCGETDVA  73

Query  1998  FKIFQEMTEYDIVTWNALIAGYIRSGHYEQAIKLLQEMLFEGLEPNLHTYSCILSICGDL  1819
              K+F  M + ++V+WN+LI+GY + G Y + + L +E     L  +  T+S  LS+CG  
Sbjct  74    KKLFDRMPKRNVVSWNSLISGYTQMGFYHEVMNLFKEARMSDLRLDKFTFSNALSVCGRT  133

Query  1818  PAIEWGKQVHCRIMKPGFDSNVVVGSTLIDMYAKCGRLGDARKVFDILPCKNLVSWNTML  1639
               +  G+ +H  I   G    V++ ++LIDMY KCGR+  AR VF+     + VSWN+++
Sbjct  134   LDLRLGRLIHALITVSGLGGPVLLTNSLIDMYCKCGRIDWARLVFESADELDSVSWNSLI  193

Query  1638  IGYAQHGFGKEALEIYSMMQENGVKPNDITFVGVLSACG-HgglleegLNHFNSMKNNYG  1462
              GY + G   E L +   M  +G+  N       L ACG +     E     +      G
Sbjct  194   AGYVRIGSNDEMLRLLVKMLRHGLNLNSYALGSALKACGSNFSSSIECGKMLHGCAVKLG  253

Query  1461  ITPRTNHLACMVNLFARKGQTKKAYDFIRSFPEKPDKVVWRCLLSG  1324
             +         +++ +A+ G  + A    +  P+ P+ V++  +++G
Sbjct  254   LDLDVVVGTALLDTYAKIGDLEDATKIFKLMPD-PNVVMYNAMIAG  298


 Score = 89.0 bits (219),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 100/206 (49%), Gaps = 5/206 (2%)
 Frame = -2

Query  3102  ILTTARGPLKMSLSQIIRSCTTNKSILSGKAAHAQLIKYGSKSDVYTNNHLLSMYVTFHE  2923
             +L + R P + ++S ++ +C    ++ SG+  HA  IK G  +     N  + MY    +
Sbjct  421   LL