BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25405_g2_i2 len=1134 path=[4309:0-92 4402:93-119 10223:120-127
10231:128-133 7841:134-228 7936:229-263 10340:264-355 10425:356-360
8066:361-369 1299:370-527 1122:528-570 8272:571-580 8282:581-612
10584:613-637 8337:638-673 8372:674-699 10621:700-718 8416:719-765
1686:766-808 8504:809-819 2276:820-874 8568:875-966 1542:967-1074
8767:1075-1096 8789:1097-1133]

Length=1134
                                                                      Score     E

ref|XP_011013170.1|  PREDICTED: uncharacterized protein LOC105117262    149   4e-36   
ref|XP_011046122.1|  PREDICTED: uncharacterized protein LOC105140824    148   5e-36   
gb|KDP46373.1|  hypothetical protein JCGZ_10213                         148   1e-35   
gb|KHN27576.1|  hypothetical protein glysoja_018688                     144   2e-34   
ref|XP_011016134.1|  PREDICTED: uncharacterized protein LOC105119666    144   3e-34   
ref|XP_006369945.1|  hypothetical protein POPTR_0001s35850g             143   7e-34   
ref|NP_001239838.1|  uncharacterized protein LOC100801064               142   1e-33   
ref|XP_011014132.1|  PREDICTED: uncharacterized protein LOC105117991    141   2e-33   
ref|XP_011013023.1|  PREDICTED: uncharacterized protein LOC105117152    141   3e-33   
ref|XP_011014801.1|  PREDICTED: uncharacterized protein LOC105118...    141   3e-33   
ref|XP_011013686.1|  PREDICTED: uncharacterized protein LOC105117652    141   3e-33   
ref|XP_002324001.2|  hypothetical protein POPTR_0017s10720g             140   4e-33   Populus trichocarpa [western balsam poplar]
ref|XP_004171463.1|  PREDICTED: uncharacterized protein LOC101229786    140   6e-33   
ref|XP_004145690.1|  PREDICTED: uncharacterized protein LOC101221710    140   7e-33   
ref|XP_004516128.1|  PREDICTED: uncharacterized protein LOC101508220    140   7e-33   
ref|XP_006369946.1|  hypothetical protein POPTR_0001s35860g             140   7e-33   
ref|XP_003622294.1|  hypothetical protein MTR_7g032660                  140   8e-33   
ref|XP_002526960.1|  conserved hypothetical protein                     139   1e-32   Ricinus communis
ref|XP_008449999.1|  PREDICTED: uncharacterized protein LOC103491716    139   1e-32   
ref|XP_007140863.1|  hypothetical protein PHAVU_008G147900g             139   2e-32   
ref|XP_002298572.2|  hypothetical protein POPTR_0001s35880g             139   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002526959.1|  conserved hypothetical protein                     138   2e-32   Ricinus communis
ref|XP_011014800.1|  PREDICTED: uncharacterized protein LOC105118...    138   3e-32   
ref|XP_006369948.1|  hypothetical protein POPTR_0001s35900g             138   3e-32   
ref|XP_002298571.2|  hypothetical protein POPTR_0001s35870g             137   5e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011014351.1|  PREDICTED: uncharacterized protein LOC105118161    136   1e-31   
ref|XP_002271723.2|  PREDICTED: uncharacterized protein LOC100242213    135   3e-31   Vitis vinifera
ref|XP_011010496.1|  PREDICTED: uncharacterized protein LOC105115342    134   7e-31   
emb|CAN62582.1|  hypothetical protein VITISV_034667                     134   8e-31   Vitis vinifera
ref|XP_003633839.2|  PREDICTED: uncharacterized protein LOC100254392    133   2e-30   
ref|XP_010029073.1|  PREDICTED: uncharacterized protein LOC104419196    132   3e-30   
ref|XP_003633800.1|  PREDICTED: uncharacterized protein LOC100244128    132   3e-30   
ref|XP_010660831.1|  PREDICTED: uncharacterized protein LOC100264492    132   4e-30   
emb|CBI34825.3|  unnamed protein product                                132   4e-30   
ref|XP_010660832.1|  PREDICTED: uncharacterized protein LOC100268167    132   4e-30   
emb|CAN61289.1|  hypothetical protein VITISV_032473                     132   5e-30   Vitis vinifera
ref|XP_003633822.1|  PREDICTED: uncharacterized protein LOC100249294    132   6e-30   
ref|XP_006432374.1|  hypothetical protein CICLE_v10000431mg             130   1e-29   
emb|CAN65452.1|  hypothetical protein VITISV_003896                     130   1e-29   Vitis vinifera
ref|XP_010660833.1|  PREDICTED: uncharacterized protein LOC100245845    130   2e-29   
ref|XP_006471327.1|  PREDICTED: uncharacterized protein LOC102619778    128   8e-29   
gb|KCW55914.1|  hypothetical protein EUGRSUZ_I01712                     126   8e-29   
gb|KCW55913.1|  hypothetical protein EUGRSUZ_I01711                     127   9e-29   
ref|XP_010029069.1|  PREDICTED: uncharacterized protein LOC104419193    127   2e-28   
ref|XP_010029068.1|  PREDICTED: uncharacterized protein LOC104419192    126   4e-28   
ref|XP_007031665.1|  Uncharacterized protein TCM_017020                 126   4e-28   
ref|XP_010029072.1|  PREDICTED: uncharacterized protein LOC104419195    126   5e-28   
ref|XP_010029070.1|  PREDICTED: uncharacterized protein LOC104419194    124   2e-27   
ref|XP_010694661.1|  PREDICTED: uncharacterized protein LOC104907426    121   2e-26   
ref|XP_010030737.1|  PREDICTED: uncharacterized protein LOC104420628    117   2e-25   
ref|XP_002526961.1|  conserved hypothetical protein                     117   4e-25   Ricinus communis
ref|XP_010694662.1|  PREDICTED: uncharacterized protein LOC104907427    113   1e-23   
ref|XP_008362016.1|  PREDICTED: uncharacterized protein LOC103425707    110   5e-23   
gb|ADN32815.1|  sieve element occlusion a                               110   5e-23   
ref|XP_008362017.1|  PREDICTED: uncharacterized protein LOC103425708    110   8e-23   
ref|XP_011097584.1|  PREDICTED: uncharacterized protein LOC105176465    107   5e-22   
ref|XP_010435652.1|  PREDICTED: uncharacterized protein LOC104719422    106   1e-21   
ref|XP_010550173.1|  PREDICTED: uncharacterized protein LOC104821101    105   2e-21   
ref|NP_186817.1|  uncharacterized protein                               105   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|KDP46375.1|  hypothetical protein JCGZ_10215                         105   4e-21   
ref|XP_004288436.1|  PREDICTED: uncharacterized protein LOC101298363    104   4e-21   
gb|KDP46379.1|  hypothetical protein JCGZ_10219                         104   5e-21   
ref|XP_006408537.1|  hypothetical protein EUTSA_v10020146mg             104   5e-21   
ref|XP_002884266.1|  hypothetical protein ARALYDRAFT_477347             104   7e-21   
ref|XP_006299972.1|  hypothetical protein CARUB_v10016185mg             104   1e-20   
ref|XP_004288435.1|  PREDICTED: uncharacterized protein LOC101298064    103   1e-20   
ref|XP_009124817.1|  PREDICTED: uncharacterized protein LOC103849857    103   1e-20   
ref|XP_010087772.1|  hypothetical protein L484_016342                   102   2e-20   
gb|KFK37630.1|  hypothetical protein AALP_AA3G008200                    102   2e-20   
emb|CDY17992.1|  BnaC03g30640D                                          100   2e-20   
ref|XP_004288433.1|  PREDICTED: uncharacterized protein LOC101296807    102   4e-20   
ref|XP_010087773.1|  hypothetical protein L484_016343                   102   4e-20   
emb|CDY28669.1|  BnaCnng05550D                                          102   4e-20   
ref|XP_007225119.1|  hypothetical protein PRUPE_ppa002624mg             101   4e-20   
ref|XP_010496279.1|  PREDICTED: uncharacterized protein LOC104773380    102   5e-20   
ref|XP_008224076.1|  PREDICTED: uncharacterized protein LOC103323832    100   8e-20   
ref|XP_004288434.1|  PREDICTED: uncharacterized protein LOC101297774    100   1e-19   
ref|NP_001280876.1|  uncharacterized LOC103453287                       100   2e-19   
ref|XP_009346429.1|  PREDICTED: uncharacterized protein LOC103938158  99.8    2e-19   
emb|CBI34821.3|  unnamed protein product                                100   2e-19   
ref|XP_008224078.1|  PREDICTED: uncharacterized protein LOC103323835  99.4    3e-19   
ref|XP_007226977.1|  hypothetical protein PRUPE_ppa002363mg           99.4    3e-19   
emb|CDX77080.1|  BnaC04g38750D                                        99.4    3e-19   
emb|CDY37506.1|  BnaA05g33710D                                        99.4    3e-19   
ref|XP_009124045.1|  PREDICTED: uncharacterized protein LOC103848...  99.4    3e-19   
ref|XP_009124044.1|  PREDICTED: uncharacterized protein LOC103848...  99.4    3e-19   
ref|XP_002271883.2|  PREDICTED: putative disease resistance prote...  99.0    5e-19   Vitis vinifera
emb|CAN64088.1|  hypothetical protein VITISV_006939                   99.0    6e-19   Vitis vinifera
ref|XP_011012451.1|  PREDICTED: uncharacterized protein LOC105116695  97.8    9e-19   
ref|XP_010912936.1|  PREDICTED: uncharacterized protein LOC105038753  97.1    2e-18   
ref|XP_006388019.1|  hypothetical protein POPTR_0395s002002g          92.8    3e-18   
gb|KDO37241.1|  hypothetical protein CISIN_1g014387mg                 94.7    4e-18   
emb|CBI14908.3|  unnamed protein product                              94.7    9e-18   
ref|XP_010663068.1|  PREDICTED: uncharacterized protein LOC100243366  94.7    1e-17   
ref|XP_006378263.1|  hypothetical protein POPTR_0010s06060g           94.4    1e-17   
ref|XP_007226973.1|  hypothetical protein PRUPE_ppa002391mg           94.4    1e-17   
emb|CBI34823.3|  unnamed protein product                              94.7    1e-17   
ref|XP_004304991.1|  PREDICTED: uncharacterized protein LOC101294285  94.0    2e-17   
ref|XP_006439977.1|  hypothetical protein CICLE_v10019128mg           94.0    2e-17   
gb|KDO69426.1|  hypothetical protein CISIN_1g044391mg                 94.0    2e-17   
ref|XP_006470197.1|  PREDICTED: uncharacterized protein LOC102630205  94.0    2e-17   
ref|XP_006378256.1|  hypothetical protein POPTR_0010s06010g           93.6    2e-17   
ref|XP_008224077.1|  PREDICTED: uncharacterized protein LOC103323834  92.8    4e-17   
ref|XP_006440671.1|  hypothetical protein CICLE_v10019121mg           91.3    1e-16   
ref|XP_006477599.1|  PREDICTED: uncharacterized protein LOC102631158  91.3    1e-16   
ref|XP_006476926.1|  PREDICTED: uncharacterized protein LOC102609296  91.3    1e-16   
emb|CBI34824.3|  unnamed protein product                              91.3    1e-16   
ref|XP_006440672.1|  hypothetical protein CICLE_v10019121mg           91.3    1e-16   
ref|XP_002526962.1|  conserved hypothetical protein                   91.3    2e-16   Ricinus communis
gb|KHN29013.1|  hypothetical protein glysoja_008348                   90.9    2e-16   
ref|NP_001240968.1|  uncharacterized protein LOC100799626             90.9    2e-16   
ref|XP_011034021.1|  PREDICTED: uncharacterized protein LOC105132310  90.5    2e-16   
ref|XP_007225209.1|  hypothetical protein PRUPE_ppa002007mg           90.1    3e-16   
emb|CBI34826.3|  unnamed protein product                              89.7    4e-16   
ref|XP_011087135.1|  PREDICTED: uncharacterized protein LOC105168700  89.7    4e-16   
ref|XP_008239602.1|  PREDICTED: uncharacterized protein LOC103338194  89.4    5e-16   
ref|XP_007031664.1|  Uncharacterized protein TCM_017019               89.4    5e-16   
gb|KHG01411.1|  hypothetical protein F383_21965                       89.4    5e-16   
ref|XP_010087771.1|  hypothetical protein L484_016341                 89.4    5e-16   
ref|XP_008340127.1|  PREDICTED: uncharacterized protein LOC103403084  89.4    6e-16   
ref|XP_007137985.1|  hypothetical protein PHAVU_009G171300g           89.0    6e-16   
ref|XP_007137986.1|  hypothetical protein PHAVU_009G171300g           89.0    7e-16   
ref|XP_010102927.1|  hypothetical protein L484_018946                 88.6    9e-16   
ref|XP_007221903.1|  hypothetical protein PRUPE_ppa015869mg           88.2    1e-15   
ref|XP_010674858.1|  PREDICTED: uncharacterized protein LOC104890938  88.2    1e-15   
ref|XP_010682345.1|  PREDICTED: uncharacterized protein LOC104897214  88.2    1e-15   
ref|XP_010248720.1|  PREDICTED: uncharacterized protein LOC104591548  88.2    1e-15   
ref|XP_008224125.1|  PREDICTED: uncharacterized protein LOC103323883  87.8    2e-15   
ref|XP_008224124.1|  PREDICTED: uncharacterized protein LOC103323881  87.4    2e-15   
ref|XP_006379953.1|  hypothetical protein POPTR_0008s18360g           87.4    2e-15   
ref|XP_006378262.1|  hypothetical protein POPTR_0010s060501g          85.5    3e-15   
ref|XP_004236294.1|  PREDICTED: uncharacterized protein LOC101251765  86.7    4e-15   
ref|XP_002526965.1|  conserved hypothetical protein                   86.7    4e-15   Ricinus communis
ref|XP_011097560.1|  PREDICTED: uncharacterized protein LOC105176450  86.7    4e-15   
ref|XP_003590785.1|  Sieve element-occluding protein                  85.9    6e-15   
ref|XP_004161368.1|  PREDICTED: uncharacterized LOC101204444          86.3    6e-15   
gb|AES61036.2|  sieve element occlusion protein                       85.9    6e-15   
gb|KDO69425.1|  hypothetical protein CISIN_1g019680mg                 84.3    7e-15   
gb|EYU17767.1|  hypothetical protein MIMGU_mgv1a002070mg              85.9    7e-15   
ref|XP_006476923.1|  PREDICTED: uncharacterized protein LOC102608...  85.9    8e-15   
ref|XP_006476925.1|  PREDICTED: uncharacterized protein LOC102608...  85.5    8e-15   
gb|KHN05808.1|  hypothetical protein glysoja_038722                   85.9    8e-15   
ref|XP_006476924.1|  PREDICTED: uncharacterized protein LOC102608...  85.9    9e-15   
ref|XP_008464491.1|  PREDICTED: uncharacterized protein LOC103502...  85.5    9e-15   
ref|XP_007211100.1|  hypothetical protein PRUPE_ppa023699mg           85.5    9e-15   
ref|XP_008239364.1|  PREDICTED: uncharacterized protein LOC103337969  85.5    9e-15   
ref|NP_001241263.1|  uncharacterized protein LOC100811452             85.5    9e-15   
ref|XP_008464490.1|  PREDICTED: uncharacterized protein LOC103502...  85.5    9e-15   
ref|XP_008786702.1|  PREDICTED: uncharacterized protein LOC103704947  85.1    1e-14   
gb|KDP26703.1|  hypothetical protein JCGZ_17861                       85.1    1e-14   
ref|XP_009359245.1|  PREDICTED: uncharacterized protein LOC103949844  85.1    1e-14   
ref|XP_008793697.1|  PREDICTED: uncharacterized protein LOC103709939  84.7    2e-14   
ref|XP_006848934.1|  hypothetical protein AMTR_s00166p00029650        84.3    2e-14   
ref|XP_002526966.1|  conserved hypothetical protein                   84.3    2e-14   Ricinus communis
emb|CAN83922.1|  hypothetical protein VITISV_026532                   84.3    2e-14   Vitis vinifera
ref|XP_002282172.1|  PREDICTED: uncharacterized protein LOC100261038  84.3    3e-14   Vitis vinifera
emb|CDP15097.1|  unnamed protein product                              84.0    3e-14   
ref|XP_010904538.1|  PREDICTED: uncharacterized protein LOC105031936  83.6    4e-14   
ref|XP_002526964.1|  conserved hypothetical protein                   83.6    5e-14   Ricinus communis
ref|XP_006439978.1|  hypothetical protein CICLE_v10019109mg           83.2    7e-14   
emb|CBI34827.3|  unnamed protein product                              83.2    7e-14   
ref|XP_007144080.1|  hypothetical protein PHAVU_007G127000g           82.8    7e-14   
ref|XP_002271950.2|  PREDICTED: uncharacterized protein LOC100261056  82.8    8e-14   Vitis vinifera
ref|XP_004236293.1|  PREDICTED: uncharacterized protein LOC101251462  82.8    8e-14   
ref|XP_009592492.1|  PREDICTED: uncharacterized protein LOC104089332  82.8    9e-14   
ref|XP_004309998.1|  PREDICTED: uncharacterized protein LOC101307854  82.0    1e-13   
ref|XP_004138263.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  82.4    1e-13   
emb|CAN65891.1|  hypothetical protein VITISV_041167                   82.0    1e-13   Vitis vinifera
ref|XP_008350940.1|  PREDICTED: uncharacterized protein LOC103414321  82.0    1e-13   
ref|XP_010044527.1|  PREDICTED: uncharacterized protein LOC104433471  82.0    1e-13   
ref|XP_010248721.1|  PREDICTED: uncharacterized protein LOC104591550  81.6    2e-13   
gb|AFN06072.1|  sieve element occlusion protein 1                     81.6    2e-13   
ref|XP_009386688.1|  PREDICTED: uncharacterized protein LOC103973766  81.6    2e-13   
ref|XP_009769607.1|  PREDICTED: uncharacterized protein LOC104220433  81.6    2e-13   
gb|KDP46383.1|  hypothetical protein JCGZ_10223                       80.9    3e-13   
gb|KDP46378.1|  hypothetical protein JCGZ_10218                       80.9    4e-13   
ref|XP_007159683.1|  hypothetical protein PHAVU_002G258300g           80.5    5e-13   
gb|ADN32811.1|  sieve element occlusion b                             80.5    5e-13   
ref|XP_007221911.1|  hypothetical protein PRUPE_ppa001579mg           80.5    5e-13   
ref|XP_004504145.1|  PREDICTED: uncharacterized protein LOC101504...  80.1    5e-13   
ref|XP_004504143.1|  PREDICTED: uncharacterized protein LOC101504...  80.1    6e-13   
ref|XP_006351433.1|  PREDICTED: uncharacterized protein LOC102598958  80.1    6e-13   
gb|ADN32810.1|  sieve element occlusion a                             80.1    7e-13   
ref|XP_003590760.1|  Sieve element-occluding protein                  80.1    7e-13   
ref|XP_008221943.1|  PREDICTED: uncharacterized protein LOC103321871  79.7    8e-13   
ref|XP_010695991.1|  PREDICTED: uncharacterized protein LOC104908569  79.7    8e-13   
ref|NP_001241224.1|  uncharacterized protein LOC100794293             79.7    9e-13   
ref|XP_010026936.1|  PREDICTED: uncharacterized protein LOC104417333  79.3    1e-12   
gb|KEH35012.1|  sieve element occlusion protein                       79.3    1e-12   
gb|KHN13158.1|  hypothetical protein glysoja_040438                   79.0    1e-12   
emb|CAN83923.1|  hypothetical protein VITISV_026533                   79.0    1e-12   Vitis vinifera
ref|XP_002282165.1|  PREDICTED: uncharacterized protein LOC100266247  79.0    1e-12   Vitis vinifera
gb|KHN07967.1|  hypothetical protein glysoja_039841                   78.6    2e-12   
gb|KDP46376.1|  hypothetical protein JCGZ_10216                       79.0    2e-12   
gb|ADN32812.1|  sieve element occlusion c                             78.6    2e-12   
ref|NP_001241461.1|  uncharacterized protein LOC100789215             78.6    2e-12   
ref|XP_010250966.1|  PREDICTED: uncharacterized protein LOC104593030  78.6    2e-12   
ref|XP_004239152.1|  PREDICTED: uncharacterized protein LOC101249174  78.6    2e-12   
ref|XP_006446667.1|  hypothetical protein CICLE_v10015478mg           77.4    3e-12   
gb|KHG12713.1|  hypothetical protein F383_04328                       77.4    5e-12   
ref|XP_009403632.1|  PREDICTED: uncharacterized protein LOC103987147  77.4    5e-12   
gb|KEH20741.1|  sieve element occlusion protein                       77.4    5e-12   
ref|XP_002515051.1|  conserved hypothetical protein                   77.0    6e-12   Ricinus communis
gb|KEH42743.1|  sieve element occlusion protein                       77.0    7e-12   
ref|XP_006341794.1|  PREDICTED: uncharacterized protein LOC102602329  77.0    7e-12   
ref|XP_006438201.1|  hypothetical protein CICLE_v10030843mg           76.6    7e-12   
gb|KDO40196.1|  hypothetical protein CISIN_1g046837mg                 76.3    1e-11   
ref|XP_011071161.1|  PREDICTED: uncharacterized protein LOC105156657  76.3    1e-11   
ref|XP_003590766.1|  Sieve element-occluding protein                  76.3    1e-11   
ref|XP_010040608.1|  PREDICTED: uncharacterized protein LOC104429456  75.9    1e-11   
ref|XP_010320950.1|  PREDICTED: uncharacterized protein LOC101249...  75.9    1e-11   
ref|XP_011100417.1|  PREDICTED: uncharacterized protein LOC105178604  75.9    2e-11   
ref|XP_010904539.1|  PREDICTED: uncharacterized protein LOC105031937  75.5    2e-11   
ref|XP_002515052.1|  conserved hypothetical protein                   75.5    2e-11   Ricinus communis
ref|XP_004239153.1|  PREDICTED: uncharacterized protein LOC101249...  75.5    2e-11   
ref|XP_004310159.1|  PREDICTED: uncharacterized protein LOC101309120  75.5    2e-11   
ref|XP_003590763.1|  Sieve element-occluding protein                  75.1    2e-11   
ref|XP_006483988.1|  PREDICTED: uncharacterized protein LOC102625551  75.1    3e-11   
ref|XP_004299166.1|  PREDICTED: uncharacterized protein LOC101294943  74.7    3e-11   
ref|XP_009769433.1|  PREDICTED: uncharacterized protein LOC104220...  74.7    4e-11   
ref|XP_009769432.1|  PREDICTED: uncharacterized protein LOC104220...  74.7    4e-11   
ref|XP_009622867.1|  PREDICTED: uncharacterized protein LOC104114193  74.7    4e-11   
ref|XP_009767734.1|  PREDICTED: uncharacterized protein LOC104218849  74.7    4e-11   
ref|XP_008444389.1|  PREDICTED: uncharacterized protein LOC103487729  74.3    5e-11   
ref|XP_010045508.1|  PREDICTED: uncharacterized protein LOC104434233  74.3    5e-11   
ref|XP_009333910.1|  PREDICTED: uncharacterized protein LOC103926766  72.8    5e-11   
ref|XP_007227400.1|  hypothetical protein PRUPE_ppb019745mg           69.7    5e-11   
gb|KHN01071.1|  Putative nucleoredoxin 2                              73.6    8e-11   
ref|NP_001239846.1|  uncharacterized protein LOC100801833             73.6    8e-11   
ref|XP_004501847.1|  PREDICTED: uncharacterized protein LOC101501922  73.6    9e-11   
ref|XP_008374367.1|  PREDICTED: uncharacterized protein LOC103437653  73.2    1e-10   
gb|KDP47163.1|  hypothetical protein JCGZ_00054                       73.2    1e-10   
ref|XP_004237262.1|  PREDICTED: uncharacterized protein LOC101263509  73.2    1e-10   
ref|XP_004495321.1|  PREDICTED: uncharacterized protein LOC101490473  73.2    1e-10   
gb|KHN13159.1|  hypothetical protein glysoja_040439                   72.8    1e-10   
ref|XP_008340128.1|  PREDICTED: uncharacterized protein LOC103403085  73.2    1e-10   
emb|CAH59411.1|  hypothetical protein                                 72.4    1e-10   Plantago major [cart-track plant]
ref|NP_001241173.1|  uncharacterized protein LOC100793771             72.8    1e-10   
gb|KDP46382.1|  hypothetical protein JCGZ_10222                       72.8    2e-10   
gb|EYU22546.1|  hypothetical protein MIMGU_mgv1a001374mg              72.8    2e-10   
ref|XP_010069164.1|  PREDICTED: uncharacterized protein LOC104456...  72.4    2e-10   
gb|KCW57422.1|  hypothetical protein EUGRSUZ_H00202                   71.6    2e-10   
emb|CDP13257.1|  unnamed protein product                              72.8    2e-10   
ref|XP_008389748.1|  PREDICTED: uncharacterized protein LOC103452052  72.4    2e-10   
gb|KDO82146.1|  hypothetical protein CISIN_1g005245mg                 72.0    2e-10   
ref|XP_004143056.1|  PREDICTED: uncharacterized protein LOC101208559  72.4    2e-10   
ref|XP_007146208.1|  hypothetical protein PHAVU_006G021400g           72.0    2e-10   
gb|KDO82145.1|  hypothetical protein CISIN_1g005245mg                 72.0    2e-10   
ref|XP_004172103.1|  PREDICTED: uncharacterized LOC101204570          70.5    3e-10   
gb|AHY04439.1|  sieve element occlusion by forisomes 1                71.6    3e-10   
ref|XP_010069159.1|  PREDICTED: uncharacterized protein LOC104456126  71.6    4e-10   
ref|XP_010069161.1|  PREDICTED: uncharacterized protein LOC104456127  71.2    4e-10   
ref|XP_006387170.1|  hypothetical protein POPTR_1619s002001g          67.4    8e-10   
ref|XP_010069166.1|  PREDICTED: uncharacterized protein LOC104456130  70.5    8e-10   
ref|XP_008793699.1|  PREDICTED: uncharacterized protein LOC103709...  69.7    1e-09   
ref|XP_010069165.1|  PREDICTED: uncharacterized protein LOC104456129  70.1    1e-09   
gb|KHG30262.1|  hypothetical protein F383_10527                       70.1    1e-09   
gb|KHG30263.1|  hypothetical protein F383_10527                       70.1    1e-09   
gb|KHG30244.1|  Acid phosphatase 1                                    68.9    1e-09   
ref|XP_008793698.1|  PREDICTED: uncharacterized protein LOC103709...  69.7    1e-09   
ref|XP_006593456.1|  PREDICTED: uncharacterized LOC100807591 isof...  70.1    1e-09   
gb|KHN01070.1|  hypothetical protein glysoja_000738                   70.1    1e-09   
gb|KHN37707.1|  Putative nucleoredoxin 3                              70.1    1e-09   
ref|XP_007044877.1|  Sieve element occlusion e, putative              70.1    1e-09   
ref|NP_001242554.1|  uncharacterized LOC100807591                     69.7    1e-09   
ref|XP_009628800.1|  PREDICTED: uncharacterized protein LOC104119093  69.7    1e-09   
gb|KHG00715.1|  hypothetical protein F383_23634                       69.7    2e-09   
gb|KHG00716.1|  hypothetical protein F383_23634                       69.3    2e-09   
ref|XP_009415984.1|  PREDICTED: uncharacterized protein LOC103996731  69.3    2e-09   
ref|XP_010087775.1|  hypothetical protein L484_016346                 69.3    2e-09   
ref|XP_004150435.1|  PREDICTED: uncharacterized protein LOC101204570  69.3    2e-09   
gb|KHN33832.1|  hypothetical protein glysoja_021713                   68.9    2e-09   
gb|KGN61636.1|  hypothetical protein Csa_2G194880                     68.9    2e-09   
ref|XP_010069163.1|  PREDICTED: uncharacterized protein LOC104456...  68.9    3e-09   
ref|XP_006440670.1|  hypothetical protein CICLE_v10023346mg           68.9    3e-09   
ref|XP_010026373.1|  PREDICTED: uncharacterized protein LOC104416720  68.6    3e-09   
ref|XP_008239606.1|  PREDICTED: uncharacterized protein LOC103338199  68.6    4e-09   
gb|KHG11411.1|  Ornithine aminotransferase                            67.4    8e-09   
ref|XP_010040606.1|  PREDICTED: uncharacterized protein LOC104429454  66.6    9e-09   
ref|XP_007221631.1|  hypothetical protein PRUPE_ppb018052mg           67.4    9e-09   
emb|CAN65453.1|  hypothetical protein VITISV_003897                   66.6    1e-08   
gb|KCW45441.1|  hypothetical protein EUGRSUZ_L00852                   66.6    1e-08   
gb|ABV32453.1|  forisome                                              66.6    2e-08   
ref|XP_010040159.1|  PREDICTED: uncharacterized protein LOC104428938  65.9    2e-08   
ref|XP_008224079.1|  PREDICTED: uncharacterized protein LOC103323836  66.2    2e-08   
ref|XP_010026374.1|  PREDICTED: uncharacterized protein LOC104416722  66.2    2e-08   
ref|XP_004309997.1|  PREDICTED: uncharacterized protein LOC101307557  63.9    2e-08   
emb|CBI16822.3|  unnamed protein product                              65.5    3e-08   
ref|XP_010650784.1|  PREDICTED: uncharacterized protein LOC100255...  65.5    3e-08   
ref|XP_002282178.2|  PREDICTED: uncharacterized protein LOC100255...  65.5    3e-08   
ref|XP_010650779.1|  PREDICTED: uncharacterized protein LOC100255...  65.5    4e-08   
ref|XP_009359248.1|  PREDICTED: uncharacterized protein LOC103949...  65.5    4e-08   
ref|XP_007146049.1|  hypothetical protein PHAVU_006G008500g           65.1    4e-08   
gb|KCW57424.1|  hypothetical protein EUGRSUZ_H00204                   65.1    5e-08   
gb|AFK48396.1|  unknown                                               62.0    5e-08   
gb|KCW63898.1|  hypothetical protein EUGRSUZ_G01580                   64.7    6e-08   
ref|XP_010069162.1|  PREDICTED: uncharacterized protein LOC104456...  64.7    6e-08   
ref|XP_010068525.1|  PREDICTED: uncharacterized protein LOC104455428  64.3    6e-08   
gb|KDP46380.1|  hypothetical protein JCGZ_10220                       64.7    6e-08   
ref|XP_009359246.1|  PREDICTED: uncharacterized protein LOC103949...  64.7    7e-08   
ref|XP_008465187.1|  PREDICTED: uncharacterized protein LOC103502849  64.3    8e-08   
ref|XP_007037798.1|  Sieve element occlusion e, putative              64.3    9e-08   
emb|CDY37507.1|  BnaA05g33720D                                        63.9    1e-07   
emb|CDX77078.1|  BnaC04g38730D                                        63.9    1e-07   
ref|XP_009124043.1|  PREDICTED: uncharacterized protein LOC103848960  63.9    1e-07   
ref|XP_009403631.1|  PREDICTED: uncharacterized protein LOC103987146  63.5    2e-07   
emb|CAN82617.1|  hypothetical protein VITISV_012086                   63.5    2e-07   
gb|EPS71838.1|  hypothetical protein M569_02915                       63.5    2e-07   
ref|XP_010025851.1|  PREDICTED: uncharacterized protein LOC104416113  63.2    2e-07   
ref|XP_010087776.1|  hypothetical protein L484_016347                 63.2    2e-07   
ref|XP_006408536.1|  hypothetical protein EUTSA_v10020071mg           62.8    3e-07   
ref|XP_004168131.1|  PREDICTED: uncharacterized protein LOC101229035  62.0    3e-07   
ref|XP_010496280.1|  PREDICTED: uncharacterized protein LOC104773381  62.4    4e-07   
ref|XP_010485384.1|  PREDICTED: uncharacterized protein LOC104763723  62.4    4e-07   
ref|XP_010435651.1|  PREDICTED: uncharacterized protein LOC104719421  62.0    4e-07   
ref|XP_008465186.1|  PREDICTED: uncharacterized protein LOC103502848  62.0    4e-07   
ref|XP_002884267.1|  hypothetical protein ARALYDRAFT_477348           62.0    4e-07   
ref|NP_566145.1|  uncharacterized protein                             61.2    9e-07   
gb|AAF01550.1|AC009325_20  unknown protein                            61.2    9e-07   
ref|XP_004150407.1|  PREDICTED: uncharacterized protein LOC101217067  60.8    1e-06   
gb|KFK37629.1|  hypothetical protein AALP_AA3G008100                  60.5    1e-06   
ref|XP_004167802.1|  PREDICTED: uncharacterized protein LOC101227924  59.7    2e-06   
ref|XP_008465184.1|  PREDICTED: uncharacterized protein LOC103502847  60.1    2e-06   
gb|KDP45230.1|  hypothetical protein JCGZ_15095                       59.7    2e-06   
ref|NP_001239643.1|  uncharacterized protein LOC100778245             59.7    3e-06   
ref|XP_008465188.1|  PREDICTED: uncharacterized protein LOC103502851  59.3    3e-06   
ref|XP_004150430.1|  PREDICTED: uncharacterized protein LOC101203350  58.9    5e-06   
gb|KGN61639.1|  hypothetical protein Csa_2G196900                     58.9    5e-06   
gb|ADN32804.1|  sieve element occlusion by forisomes 3                58.5    6e-06   
ref|XP_004310160.1|  PREDICTED: uncharacterized protein LOC101309418  58.5    6e-06   
gb|KGN61634.1|  hypothetical protein Csa_2G193380                     58.2    6e-06   
gb|AFN06074.1|  sieve element occlusion protein 1                     58.2    7e-06   
gb|KHN37957.1|  hypothetical protein glysoja_042603                   58.2    8e-06   
gb|ABV32454.1|  sieve element occlusion by forisome 1                 58.2    8e-06   
ref|NP_001240090.1|  uncharacterized protein LOC100818773             57.8    9e-06   
emb|CDX91934.1|  BnaC03g32360D                                        57.8    9e-06   
ref|XP_007145937.1|  hypothetical protein PHAVU_007G280500g           57.8    1e-05   
gb|ACH92804.1|  sieve element-occluding protein 3                     57.8    1e-05   
dbj|BAF01938.1|  hypothetical protein                                 55.5    1e-05   
ref|XP_010100344.1|  hypothetical protein L484_027653                 57.4    1e-05   
ref|XP_008222473.1|  PREDICTED: uncharacterized protein LOC103322347  57.0    1e-05   
ref|XP_006438202.1|  hypothetical protein CICLE_v10030798mg           57.0    2e-05   
gb|KGN61630.1|  hypothetical protein Csa_2G193340                     56.6    2e-05   
ref|XP_004167801.1|  PREDICTED: uncharacterized protein LOC101227691  56.6    2e-05   
ref|XP_009359348.1|  PREDICTED: uncharacterized protein LOC103949937  56.6    2e-05   
gb|KCW83210.1|  hypothetical protein EUGRSUZ_B001512                  56.2    2e-05   
ref|XP_006483987.1|  PREDICTED: uncharacterized protein LOC102625281  56.6    2e-05   
ref|NP_001239787.1|  uncharacterized protein LOC100812318             56.6    2e-05   
ref|NP_001239844.1|  uncharacterized protein LOC100797481             56.6    2e-05   
gb|ACV83947.1|  calcium-regulated/ATP-independent forisome protein    56.6    3e-05   
ref|XP_004150408.1|  PREDICTED: uncharacterized protein LOC101217310  56.6    3e-05   
ref|XP_007146048.1|  hypothetical protein PHAVU_006G008400g           56.2    3e-05   
ref|XP_009134596.1|  PREDICTED: uncharacterized protein LOC103858898  56.6    3e-05   
emb|CDX74311.1|  BnaA03g27360D                                        56.2    3e-05   
ref|XP_002315652.2|  hypothetical protein POPTR_0010s06000g           55.8    4e-05   
gb|ACH92805.1|  sieve element-occluding protein 2                     55.8    4e-05   
ref|XP_003590780.1|  Sieve element-occluding protein                  55.8    4e-05   
gb|KDO82147.1|  hypothetical protein CISIN_1g039432mg                 55.5    4e-05   
emb|CDP05462.1|  unnamed protein product                              55.5    5e-05   
gb|KGN61638.1|  hypothetical protein Csa_2G196890                     55.5    5e-05   
gb|KCW45067.1|  hypothetical protein EUGRSUZ_L01341                   55.1    7e-05   
gb|KDP45224.1|  hypothetical protein JCGZ_15089                       55.1    8e-05   
ref|XP_010524284.1|  PREDICTED: uncharacterized protein LOC104802389  55.1    8e-05   
gb|KDP45223.1|  hypothetical protein JCGZ_15088                       54.3    1e-04   
ref|XP_007029300.1|  Uncharacterized protein TCM_025178               54.3    1e-04   
gb|KFK41194.1|  hypothetical protein AALP_AA2G097500                  54.3    1e-04   
gb|KHN33833.1|  hypothetical protein glysoja_021714                   54.3    1e-04   
gb|ACH92806.1|  sieve element-occluding protein 1                     54.3    1e-04   
ref|XP_003590781.1|  Sieve element-occluding protein                  53.9    1e-04   
ref|XP_008340363.1|  PREDICTED: uncharacterized protein LOC103403330  53.9    2e-04   
ref|XP_010024028.1|  PREDICTED: uncharacterized protein LOC104414576  53.9    2e-04   
ref|XP_008224131.1|  PREDICTED: uncharacterized protein LOC103323888  53.5    2e-04   
ref|XP_008465190.1|  PREDICTED: uncharacterized protein LOC103502853  53.5    2e-04   
ref|XP_007146209.1|  hypothetical protein PHAVU_006G0215000g          53.5    2e-04   
gb|ADN32805.1|  sieve element occlusion by forisomes 4                53.1    3e-04   
ref|XP_004495334.1|  PREDICTED: uncharacterized protein LOC101493939  53.1    3e-04   
ref|XP_004150431.1|  PREDICTED: uncharacterized protein LOC101203597  52.8    3e-04   
ref|XP_008222002.1|  PREDICTED: uncharacterized protein LOC103321927  52.8    3e-04   
ref|XP_004491932.1|  PREDICTED: uncharacterized protein LOC101497031  52.8    4e-04   
gb|KDP45228.1|  hypothetical protein JCGZ_15093                       52.4    4e-04   
gb|KDP45229.1|  hypothetical protein JCGZ_15094                       50.4    5e-04   
ref|XP_010026871.1|  PREDICTED: uncharacterized protein LOC104417261  52.4    5e-04   
gb|KCW60445.1|  hypothetical protein EUGRSUZ_H03164                   51.6    7e-04   
ref|XP_010024030.1|  PREDICTED: uncharacterized protein LOC104414...  52.0    8e-04   
ref|XP_010550172.1|  PREDICTED: uncharacterized protein LOC104821100  52.0    8e-04   
ref|XP_004164423.1|  PREDICTED: uncharacterized LOC101203597          51.2    9e-04   



>ref|XP_011013170.1| PREDICTED: uncharacterized protein LOC105117262 [Populus euphratica]
Length=722

 Score =   149 bits (376),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 90/266 (34%), Positives = 142/266 (53%), Gaps = 30/266 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L   E+W L+L+V  I     I  WI + +YIFL GG++++ V++    
Sbjct  476  AFPFTSLREESLWKDETWRLELLVDGI--DPVILNWIKEGKYIFLYGGDDDEWVRKFTNT  533

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + IR   +T+T+E+          I  FWTRL+
Sbjct  534  ARTVALAARIPLEMVYVGKSSK----REKIRQVIATITAEKLSSVWPDLTMIWFFWTRLE  589

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  SRIQ    +G  +  D +MQ +KKLL Y+ EG     WA+LS    ++A      +
Sbjct  590  SMLYSRIQ----LGKVDDHDPMMQEIKKLLSYDREGG----WAVLSNGSNVVATGHRTSV  641

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK+   + GFD AF+D   ++  ++ P       C  ++P    +IP T  
Sbjct  642  LQTLLEYDLWKELVPVEGFDLAFRDHQGIIHDTARPC------CRFDFPMTTGRIPETMK  695

Query  295  CPQCNHNMHKLVTFSCCHTFVDCPYE  218
            CP+CNH M K  +F CCH  V  PYE
Sbjct  696  CPECNHTMEKFSSFLCCHDEV-IPYE  720



>ref|XP_011046122.1| PREDICTED: uncharacterized protein LOC105140824 [Populus euphratica]
Length=639

 Score =   148 bits (373),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 89/266 (33%), Positives = 142/266 (53%), Gaps = 30/266 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L   E+W L+L+V  I     I  WI + +YIFL GG++++ +++    
Sbjct  392  AFPFTSFREESLWKDETWRLELLVDGI--DPVILNWIKEGKYIFLYGGDDDEWMRKFTNT  449

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + IR   +T+T+E+          I  FWTRL+
Sbjct  450  ARTVALAARIPLEMVYVGKSSK----REKIRRVIATITAEKLSSVWPDLTMIWFFWTRLE  505

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  SRIQ    +G  +  D +MQ +KKLL Y+ EG     WA+LS    ++A      +
Sbjct  506  SMLYSRIQ----LGKLDDHDPMMQEIKKLLSYDREGG----WAVLSNGSNVVATGHRTSV  557

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK+   + GFD AF+D   ++  ++ P       C  ++P    +IP T  
Sbjct  558  LQTLLEYDLWKELVPVKGFDLAFRDHQGIIHDTARPC------CRFDFPMTTGRIPETMK  611

Query  295  CPQCNHNMHKLVTFSCCHTFVDCPYE  218
            CP+CNH M K  +F CCH   D PYE
Sbjct  612  CPECNHTMEKFSSFLCCHD-EDIPYE  636



>gb|KDP46373.1| hypothetical protein JCGZ_10213 [Jatropha curcas]
Length=718

 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 139/258 (54%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L  +E+W L+L++  I     I  WI + +YIFL GG++ + +++    
Sbjct  472  AFPFTSYREESLWKEETWRLELLIDGI--DPTILNWIKEGKYIFLYGGDDVEWIRKFTNT  529

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    +++  +VY+G+S K     D ++   ST+T E+          I  FWTRLQ
Sbjct  530  ARAVAQAARISLEMVYVGKSCK----RDKVQRIISTITVEKLSYVWQDLTMIWFFWTRLQ  585

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y+ EG     WA+LS+   I+       +
Sbjct  586  SMLYSKIQ----LGKIDEHDPMMQEIKKLLSYDKEGG----WAVLSRGSNIVVNGHSTTV  637

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK+N  + GFD +FK+ ++ +          HP C   +PS   +IP    
Sbjct  638  LPTLLEYDIWKENVSLKGFDLSFKEHHDKL------HGIAHPCCRFEFPSTTGRIPERLK  691

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+CN NM K +TF CCH
Sbjct  692  CPECNRNMEKHITFLCCH  709



>gb|KHN27576.1| hypothetical protein glysoja_018688 [Glycine soja]
Length=727

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 142/259 (55%), Gaps = 29/259 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +TS  E+ L  +E+W L+L+V  I    EI  W+ D +YIFL GG++ + V+  + +
Sbjct  470  AYPFTSSREEALWKEETWRLELLVDGI--DQEILNWVKDGKYIFLFGGDDPEWVRRFVKE  527

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVT--------SEQR-IKEFWTRLQ  656
             + + +  Q+   +VY+G+S K    E V ++ D+ +         SEQ  I  FWTRLQ
Sbjct  528  ARRVATATQIPLEMVYVGKSNKR---EQVQKIIDTIIRDKLNTQYWSEQSMIWFFWTRLQ  584

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q  LK   D+  D +MQ +KKLL Y+ +G     W +L++   I+        
Sbjct  585  SMLFSKLQ--LKQTDDD--DHVMQEIKKLLSYDKQGG----WIVLARGSHIVVNGHATTG  636

Query  475  LGVMNEYEK-WKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
            L  + EY+  WK+ A  +GF+ AFK+ Y+M+ S  SP       C   +  ++ +IP   
Sbjct  637  LQTLVEYDAVWKELADRDGFEPAFKNHYDMVHSIVSPC------CRFEFSHSMGRIPERL  690

Query  298  SCPQCNHNMHKLVTFSCCH  242
            +CP+C  NMH L TF CCH
Sbjct  691  TCPECRRNMHVLTTFQCCH  709



>ref|XP_011016134.1| PREDICTED: uncharacterized protein LOC105119666 [Populus euphratica]
Length=724

 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/258 (33%), Positives = 136/258 (53%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L   E+W L+L+V  I    EI  WI++ +YIFL GG++++ V++    
Sbjct  477  AFPFTSLREESLWKDETWRLELLVDGI--DPEILNWINEGKYIFLYGGDDDEWVRKFTSS  534

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + IR   +T+T E+          +  FWTRL+
Sbjct  535  ARAVAQAARIPLEMVYVGKSSK----REKIRQVIATITVEKLSYVWQDLTMMWFFWTRLE  590

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y  EG     WA+LSK   ++       +
Sbjct  591  SMLYSKIQ----LGKLDDHDPMMQEIKKLLSYGREGG----WAVLSKGSNVVVNGHKTTV  642

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK+   + GFD AF+D +  +   + P       C  ++P    +IP T  
Sbjct  643  LQTLLEYDLWKEQVPVKGFDMAFQDHHFQLRGIARPC------CRFDFPMTTGRIPETMK  696

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+CN  M K  TF CCH
Sbjct  697  CPECNSTMEKFSTFLCCH  714



>ref|XP_006369945.1| hypothetical protein POPTR_0001s35850g [Populus trichocarpa]
 gb|ERP66514.1| hypothetical protein POPTR_0001s35850g [Populus trichocarpa]
Length=722

 Score =   143 bits (360),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 87/258 (34%), Positives = 134/258 (52%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L   E+W L+L+V  I     I  WI + +YIFL GG++++  ++    
Sbjct  475  AFPFTSLREESLWRDETWRLELLVDGI--DPVILNWIKEGKYIFLYGGDDDEWARKFTNT  532

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + IR   +T+T E+          I  FWTRL+
Sbjct  533  ARAVAQAARIPLEMVYVGKSSK----REKIRRVIATITVEKLSYVWQDLTMIWFFWTRLE  588

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y+ EG     WA+LSK   ++A      +
Sbjct  589  SMLYSKIQ----LGRLDDHDPMMQEIKKLLSYDREGG----WAVLSKGSNVVANGHRTTV  640

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WKD   + GFD AF+D    +   S P       C  ++P    +IP T  
Sbjct  641  LQTLLEYDMWKDQVPVKGFDLAFQDHQGRIHDISRPC------CRFDFPMTTGRIPETMK  694

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+CN  M K  TF CCH
Sbjct  695  CPECNRTMEKFSTFLCCH  712



>ref|NP_001239838.1| uncharacterized protein LOC100801064 [Glycine max]
 gb|ADN32797.1| sieve element occlusion m [Glycine max]
Length=727

 Score =   142 bits (358),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/259 (35%), Positives = 141/259 (54%), Gaps = 29/259 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +TS  E+ L  +E+W L+L+V  I    EI  W+ D +YIFL GG++ + V+  + +
Sbjct  470  AYPFTSSREEALWKEETWRLELLVDGI--DQEILNWVKDGKYIFLFGGDDPEWVRRFVKE  527

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVT--------SEQR-IKEFWTRLQ  656
             + + +  Q+   +VY+G+S K    E V ++ D+ +         SEQ  I  FWTRLQ
Sbjct  528  ARRVATATQIPLEMVYVGKSNKR---EQVQKIIDTIIRDKLNTQYWSEQSMIWFFWTRLQ  584

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q  LK   D+  D +MQ +KKLL Y+ +G     W +L++   I+        
Sbjct  585  SMLFSKLQ--LKQTDDD--DHVMQEIKKLLSYDKQGG----WIVLARGSHIVVNGHATTG  636

Query  475  LGVMNEYEK-WKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
            L  + EY+  WK+ A  +GF+ AFK+ Y+ + S  SP       C   +  ++ +IP   
Sbjct  637  LQTLVEYDAVWKELADRDGFEPAFKNHYDKVHSIVSPC------CRFEFSHSMGRIPERL  690

Query  298  SCPQCNHNMHKLVTFSCCH  242
            +CP+C  NMH L TF CCH
Sbjct  691  TCPECRRNMHVLTTFQCCH  709



>ref|XP_011014132.1| PREDICTED: uncharacterized protein LOC105117991 [Populus euphratica]
Length=723

 Score =   141 bits (356),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/258 (33%), Positives = 135/258 (52%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L   E+W L+L+V  I     I  WI++ +YIFL GG++++ V++    
Sbjct  476  AFPFTSLREESLWKDETWRLELLVDGI--DPVILNWINEGKYIFLYGGDDDEWVRKFTSS  533

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   IVY+G+S K     + IR   +T+T E+          +  FWTRL+
Sbjct  534  ARAVAQAARIPLEIVYVGKSSK----REKIRRVIATITVEKLSYVWQDLTMMWFFWTRLE  589

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y  EG     WA+LSK   ++       +
Sbjct  590  SMLYSKIQ----LGKLDDHDPMMQEIKKLLSYGREGG----WAVLSKGSNVVVNGHKTTV  641

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK+   + GFD AF+D +  +   + P       C  ++P    +IP T  
Sbjct  642  LQTLLEYDLWKEQVPVKGFDMAFQDHHFQLRGIARPC------CRFDFPMTTGRIPETMK  695

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+CN  M K  TF CCH
Sbjct  696  CPECNSAMEKFSTFLCCH  713



>ref|XP_011013023.1| PREDICTED: uncharacterized protein LOC105117152 [Populus euphratica]
Length=724

 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/258 (33%), Positives = 136/258 (53%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L   E+W L+L+V  I     I  WI++ +YIFL GG++++ V++    
Sbjct  477  AFPFTSLREESLWKDETWRLELLVDGI--DPVILNWINEGKYIFLYGGDDDEWVRKFTSS  534

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + IR   +T+T E+          +  FWTRL+
Sbjct  535  ARAVAQAARIPLEMVYVGKSSK----REKIRQVIATITVEKLSYVWQDLTMMWFFWTRLE  590

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM +S+IQ    +G  +  D +MQ +KKLL Y  EG     WA+LSK   ++       +
Sbjct  591  SMLNSKIQ----LGKLDDHDPMMQEIKKLLSYGREGG----WAVLSKGSNVVVNGHKTTV  642

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK+   + GFD AF+D +  +   + P       C  ++P    +IP T  
Sbjct  643  LQTLLEYDLWKEQVPVKGFDMAFQDHHFQLRGIARPC------CRFDFPMTTGRIPETMK  696

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+CN  M K  TF CCH
Sbjct  697  CPECNSAMEKFSTFLCCH  714



>ref|XP_011014801.1| PREDICTED: uncharacterized protein LOC105118522 isoform X2 [Populus 
euphratica]
Length=722

 Score =   141 bits (355),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 134/258 (52%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L   E+W L+L+V  I     I  WI + +YIFL GG++++ V++    
Sbjct  475  AFPFTSSREESLWRDETWRLELLVDGI--DPVILNWIKEGKYIFLYGGDDDEWVRKFTNT  532

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + IR   +T+T+E+          I  FWTRL+
Sbjct  533  ARTVALAARIPLEMVYVGKSSK----REKIRRVIATITAEKLSSVWPDLTMIWFFWTRLE  588

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S IQ    +G  +  D +MQ +KKLL Y+ EG     WA+LS    ++A       
Sbjct  589  SMLYSWIQ----LGKLDDHDPMMQEIKKLLSYDREGG----WAVLSNGSNVVANGHKTTA  640

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK+   + GFD AF+D   M+   + P       C  ++P    +IP T  
Sbjct  641  LQTLLEYDLWKEQVPVKGFDLAFRDHQGMIHGIARPC------CRFDFPMTTGRIPETMK  694

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+CN  M K  TF CCH
Sbjct  695  CPECNRTMEKFSTFLCCH  712



>ref|XP_011013686.1| PREDICTED: uncharacterized protein LOC105117652 [Populus euphratica]
Length=723

 Score =   141 bits (355),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 134/258 (52%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L   E+W L+L+V  I     I  WI + +YIFL GG++++ V++    
Sbjct  476  AFPFTSLREESLWKDETWRLELLVDGI--DPVILNWIKEGKYIFLYGGDDDEWVRKFTNT  533

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + IR   +T+T+E+          I  FWTRL+
Sbjct  534  ARTVALAARIPLEMVYVGKSSK----REKIRRVIATITAEKLSSVWPDLTMIWFFWTRLE  589

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S IQ    +G  +  D +MQ +KKLL Y+ EG     WA+LS    ++A       
Sbjct  590  SMLYSWIQ----LGKLDDHDPMMQEIKKLLSYDREGG----WAVLSNGSNVVANGHKTTA  641

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK+   + GFD AF+D   M+   + P       C  ++P    +IP T  
Sbjct  642  LQTLLEYDLWKEQVPVKGFDLAFRDHQGMIHGIARPC------CRFDFPMTTGRIPETMK  695

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+CN  M K  TF CCH
Sbjct  696  CPECNRTMEKFSTFLCCH  713



>ref|XP_002324001.2| hypothetical protein POPTR_0017s10720g [Populus trichocarpa]
 gb|EEF04134.2| hypothetical protein POPTR_0017s10720g [Populus trichocarpa]
Length=716

 Score =   140 bits (354),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/258 (33%), Positives = 134/258 (52%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L  +E+W L+L+V  I     I  WI +E+YIF+ GG++ + V++    
Sbjct  474  AFPFTSLREESLWREETWRLELLVDGI--DPVILNWIKEEKYIFMYGGDDVEWVRKFTNT  531

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + IR    T+  E+          I  FWTRL+
Sbjct  532  ARAVAQAARIPLEMVYVGKSRK----REQIRRVMGTINVEKLSYAWQDLTMIWFFWTRLE  587

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y+ EG     WA+LSK   ++    G  +
Sbjct  588  SMLFSKIQ----LGKVDDHDPMMQAIKKLLSYDREGG----WAVLSKGSSVVVNGHGTTV  639

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK+   + GFD AF++ +  +          HP     +P    +IP T  
Sbjct  640  LPTLVEYDLWKEQVPVKGFDLAFQEHHGNL------HDIVHPCSRFEFPMTAGRIPETLK  693

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+CN +M K  TF CCH
Sbjct  694  CPECNRSMEKFTTFLCCH  711



>ref|XP_004171463.1| PREDICTED: uncharacterized protein LOC101229786 [Cucumis sativus]
Length=714

 Score =   140 bits (353),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 82/258 (32%), Positives = 132/258 (51%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W L+L+V  I     +  WI +E YIFL GG++ + +++    
Sbjct  471  AFPFTSVKEEVLWKEETWRLELLVDGI--DPAVLNWIKEERYIFLYGGDDIEWIRKFTTT  528

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + ++   +T+T+E+          I  FWTR++
Sbjct  529  AKTVAQAARIPLEMVYVGKSSK----RERVKKIITTITTEKLGYCWQDLTMIWFFWTRIE  584

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y+ EG     WA+LSK   +I       M
Sbjct  585  SMLYSKIQ----LGKADDCDPLMQEIKKLLSYDKEGG----WAVLSKGSNVILNGHSTTM  636

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  +  ++ WK  A   GFD AFK+ ++ +          HP C   +P    +IP    
Sbjct  637  LPTLGSFDSWKQEAADKGFDIAFKNHHDEL------QGITHPCCRFEFPHTSGRIPENFK  690

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP C+  M KL TF CCH
Sbjct  691  CPGCDRQMEKLTTFLCCH  708



>ref|XP_004145690.1| PREDICTED: uncharacterized protein LOC101221710 [Cucumis sativus]
 gb|KGN58227.1| hypothetical protein Csa_3G597260 [Cucumis sativus]
Length=714

 Score =   140 bits (352),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 82/258 (32%), Positives = 132/258 (51%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W L+L+V  I     +  WI +E YIFL GG++ + +++    
Sbjct  471  AFPFTSVKEEVLWKEETWRLELLVDGI--DPAVLNWIKEERYIFLYGGDDIEWIRKFTTT  528

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + ++   +T+T+E+          I  FWTR++
Sbjct  529  AKTVAQAARIPLEMVYVGKSSK----RERVKKIITTITTEKLGYCWQDLTMIWFFWTRIE  584

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y+ EG     WA+LSK   +I       M
Sbjct  585  SMLYSKIQ----LGKADDCDPLMQEIKKLLSYDKEGG----WAVLSKGSNVILNGHSTTM  636

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  +  ++ WK  A   GFD AFK+ ++ +          HP C   +P    +IP    
Sbjct  637  LPTLGSFDSWKQEATDKGFDIAFKNHHDEL------QGITHPCCRFEFPHTSGRIPENFK  690

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP C+  M KL TF CCH
Sbjct  691  CPGCDRQMEKLTTFLCCH  708



>ref|XP_004516128.1| PREDICTED: uncharacterized protein LOC101508220 [Cicer arietinum]
Length=729

 Score =   140 bits (353),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 95/273 (35%), Positives = 145/273 (53%), Gaps = 32/273 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L   E+W L+L+V  I   +EI  WI + +YIFL GG++   ++  + +
Sbjct  472  AFPFTSSREENLWKDETWRLELLVDGI--DTEILNWIKEGKYIFLYGGDDPDWIRRFVKE  529

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVT--------SEQR-IKEFWTRLQ  656
             + +    Q    +VY+G+S K    E V R+ D+ +         SEQ  I  FWTRLQ
Sbjct  530  ARRVAQATQTPLEMVYLGKSNKR---EQVQRVVDTIIRENLYSHSWSEQSMIWFFWTRLQ  586

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ  LK   D  +D +MQ +KKLL Y+ +G     W +L++   I+        
Sbjct  587  SMLFSKIQ--LKQVDD--NDIVMQEIKKLLSYDKQGG----WFVLARGSQIVVNGHAATG  638

Query  475  LGVMNEYE-KWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
            L  + EYE KWK +A  +GF+ AFK+ Y  + S ++P       C   +  ++ +IP+  
Sbjct  639  LQALVEYELKWKQHADRDGFEPAFKEYYGKLHSVANPC------CRFEFSHSMGRIPDRL  692

Query  298  SCPQCNHNMHKLVTFSCCHTFVDCPYETGFIIS  200
            +CP+C  NMH L TF CCH   D   E  F +S
Sbjct  693  TCPECRRNMHVLTTFQCCH---DDNVEEDFFVS  722



>ref|XP_006369946.1| hypothetical protein POPTR_0001s35860g [Populus trichocarpa]
 gb|ERP66515.1| hypothetical protein POPTR_0001s35860g [Populus trichocarpa]
Length=722

 Score =   140 bits (352),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 85/258 (33%), Positives = 131/258 (51%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L   E+W L+L+V  I     I  WI + +YIFL GG++++  ++    
Sbjct  475  AFPFTSLREESLWRDETWRLELLVDGI--DPVILNWIKEGKYIFLYGGDDDEWARKFANT  532

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + IR   +T+T E+          I  FWTRL+
Sbjct  533  ARAVAQAARIPLEMVYVGKSSK----REKIRRVIATITVEKLSYVWQDLTMIWFFWTRLE  588

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y+ EG     WA+LS    ++A      +
Sbjct  589  SMVYSKIQ----LGRLDDHDPMMQEIKKLLSYDREGG----WAVLSNGSNVVANGHRTTV  640

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK    + GFD AF+D         S      P C  ++P    +IP T  
Sbjct  641  LQTLLEYDLWKAQVPVKGFDLAFRD------HQGSIHDISRPCCRFDFPMTTGRIPETMK  694

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+CN  M K  TF CCH
Sbjct  695  CPECNRTMEKFSTFLCCH  712



>ref|XP_003622294.1| hypothetical protein MTR_7g032660 [Medicago truncatula]
 gb|ABD32254.1| hypothetical protein MtrDRAFT_AC149040g7v2 [Medicago truncatula]
 gb|ADN32809.1| sieve element occlusion e [Medicago truncatula]
 gb|AES78512.1| sieve element occlusion protein [Medicago truncatula]
Length=729

 Score =   140 bits (352),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 149/273 (55%), Gaps = 32/273 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+TL   E+W L+L+V  I   SEI  WI + +YIFL GG++ + ++  + +
Sbjct  471  AFPFTSFKEETLWKDETWRLELLVDGI--DSEILNWIKEGKYIFLYGGDDPEWIKRFVKE  528

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVT--------SEQR-IKEFWTRLQ  656
             +++    +    +VY+G+S K    + V ++CD+ +         SEQ  I  FWTRLQ
Sbjct  529  ARKVAQATRTPLEMVYVGKSNKR---DQVQKVCDTIIREKLYTHSWSEQSMIWFFWTRLQ  585

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ  LK   D  +D +MQ +KKLL Y+ +G     W +L+K   I+        
Sbjct  586  SMLFSKIQ--LKQVDD--NDRVMQEIKKLLSYDKQGG----WIVLAKGSQIVVNGHASTG  637

Query  475  LGVMNEYE-KWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
            L  + EY+  WK++A+ +GF+ AFK+ Y  + +  +P       C   +  ++ +IP+  
Sbjct  638  LQSLIEYDLMWKEHAERDGFETAFKEHYGKLHAVDNPC------CRFEFSHSMGRIPDRL  691

Query  298  SCPQCNHNMHKLVTFSCCHTFVDCPYETGFIIS  200
            +CP+C  NMH L TF CCH   D   E  F +S
Sbjct  692  TCPECRRNMHVLTTFQCCH---DDNVEEDFFVS  721



>ref|XP_002526960.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35447.1| conserved hypothetical protein [Ricinus communis]
Length=685

 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/263 (33%), Positives = 139/263 (53%), Gaps = 31/263 (12%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
             ++ +TS  E+ L  +E+W L+L+V  I     +  W+ +EEYIFL GG++ + V+E   
Sbjct  446  HAFPFTSLREEMLWKEETWRLELLVDGI--DPMLVNWVGEEEYIFLHGGDDVEWVKEFTE  503

Query  811  KIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ--------RIKEFWTRLQ  656
             ++++    Q    +VY+G+S K    +D +R    T+T E+         I  FWTRL 
Sbjct  504  MVRKVSQAAQKPVEMVYLGKSYK----KDKVRKIAKTITDEKLGHSWDPTMIWFFWTRLD  559

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ      +DE +D +   +KKL+ Y+ E      WALLSK   I+       +
Sbjct  560  SMLFSKIQL---RKIDE-NDTLTHEIKKLISYDKEMG----WALLSKGPNIVVNGHSTTV  611

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+KWK+N  + GFD +FK+ ++ + +++ P       C   +PS   +IP    
Sbjct  612  LRALTEYDKWKENVPVKGFDLSFKEHHDKLQNTNGPC------CRFEFPSTFGEIPEHLK  665

Query  295  CPQCNHNMHKLVTFSCCHTFVDC  227
            CP+C  +M K + F CCH   DC
Sbjct  666  CPECLRSMEKHMAFRCCH---DC  685



>ref|XP_008449999.1| PREDICTED: uncharacterized protein LOC103491716 [Cucumis melo]
Length=714

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/258 (31%), Positives = 133/258 (52%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W L+L+V  I     +  WI +E YIFL GG++ + +++    
Sbjct  471  AFPFTSVKEEVLWKEETWRLELLVDGI--DPAVLNWIKEERYIFLYGGDDIEWIRKFTTT  528

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + ++   +T+T+E+          I  FWTR++
Sbjct  529  AKTVAQAARIPLEMVYVGKSSK----RERVKKIITTITTEKLGYCWQDLTMIWFFWTRIE  584

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y+ EG     WA+LSK   +I       +
Sbjct  585  SMLYSKIQ----LGKADDCDPLMQEIKKLLSYDKEGG----WAVLSKGSNVILNGHSTTV  636

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  +  ++ WK  A   GFD AFK+ ++ +          HP C   +P    +IP    
Sbjct  637  LPTLGSFDSWKQEAADKGFDIAFKNHHDEL------QGITHPCCRFEFPHTSGRIPENFK  690

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C+  M KL TF CCH
Sbjct  691  CPECDRQMEKLTTFLCCH  708



>ref|XP_007140863.1| hypothetical protein PHAVU_008G147900g [Phaseolus vulgaris]
 gb|ESW12857.1| hypothetical protein PHAVU_008G147900g [Phaseolus vulgaris]
Length=727

 Score =   139 bits (349),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/259 (35%), Positives = 138/259 (53%), Gaps = 29/259 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +TS  E+ L  +E+W L+L+V  I    +I  WI D +YIFL GG++ + V+  + +
Sbjct  470  AYPFTSSREEVLWKEETWRLELLVDGI--DQDILNWIKDGKYIFLFGGDDPEWVRRFVKE  527

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVT--------SEQR-IKEFWTRLQ  656
             + +    Q+   +VY+G+S K    E V ++ D+ +         SEQ  I  FWTRLQ
Sbjct  528  GRRVAMATQIPLEMVYVGKSNKR---EQVQKIIDTIIRDKLNTQYWSEQSMIWFFWTRLQ  584

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q  LK   D+  D +MQ +KKLL Y+ +G     W +L++   I+        
Sbjct  585  SMLFSKLQ--LKQSDDD--DHVMQEIKKLLSYDKQGG----WIVLARGSHIVVNGHATTG  636

Query  475  LGVMNEYEK-WKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
               + EY+  WKD+A   GF+ AFK+ Y+ + S  SP S         +   + +IP   
Sbjct  637  FQTLVEYDAVWKDHADREGFESAFKNHYDKVHSVVSPCSR------FEFSHAMGRIPERL  690

Query  298  SCPQCNHNMHKLVTFSCCH  242
            +CP+C  NMH L TF CCH
Sbjct  691  TCPECRRNMHVLTTFQCCH  709



>ref|XP_002298572.2| hypothetical protein POPTR_0001s35880g [Populus trichocarpa]
 gb|EEE83377.2| hypothetical protein POPTR_0001s35880g [Populus trichocarpa]
Length=723

 Score =   139 bits (349),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/258 (33%), Positives = 133/258 (52%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L   E+W L+L+V  I     I  WI + +YIFL GG++++ V++    
Sbjct  476  AFPFTSLREESLWKDETWRLELLVDGI--DPVILNWIKEGKYIFLYGGDDDEWVRKFTNT  533

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + IR   +T+T E+          I  FWTRL+
Sbjct  534  ARAVAQAARIPLEMVYVGKSSK----REKIRRVIATITVEKLSYVWQDLTMIWFFWTRLE  589

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  SRIQ    +G  +  D +MQ +KKLL Y+ EG     WA+LS    ++        
Sbjct  590  SMLYSRIQ----LGKLDDHDPMMQEIKKLLSYDREGG----WAVLSNGSNVVVNGHKTTA  641

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK+   + GFD A++D    +   S P       C  ++P  + +IP T  
Sbjct  642  LQTLLEYDLWKEQVPVKGFDLAYRDHQGRIHDISRPC------CRFDFPMTMGRIPETMK  695

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+CN  M K  +F CCH
Sbjct  696  CPECNRTMEKFSSFLCCH  713



>ref|XP_002526959.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35446.1| conserved hypothetical protein [Ricinus communis]
Length=718

 Score =   138 bits (348),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/253 (33%), Positives = 133/253 (53%), Gaps = 20/253 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E++L  +E+W L+L+V  I   S I  WI +E+YI L GG++ + V++    
Sbjct  473  AFPFTTFREESLWREETWRLELLVDGI--DSTILTWIKEEKYILLYGGDDVEWVRKFTNT  530

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSE----QRIKEFWTRLQSMASS  641
             + +    ++   +VY G+S K    + +I        S+      I  FWTR++SM  S
Sbjct  531  ARAVSQAARIPLEMVYAGKSSKRDKVQSIIAAIPVEKLSQYWDPTMIWFFWTRVESMLFS  590

Query  640  RIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMN  461
            +IQ    +G  + +D +MQ +KKLL Y+ EG     WA+LS+   ++       ML  M 
Sbjct  591  KIQ----LGKIDETDPMMQEIKKLLSYDKEGG----WAVLSRGSNVVVNGYSSTMLLTMI  642

Query  460  EYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQCN  281
            EY+ WKD   +NGFD +FK+ +  +          HP C L + S   +IP    CP+C 
Sbjct  643  EYDLWKDKVPVNGFDLSFKEHHNKL------HDLAHPCCRLEFHSTTGRIPERLKCPECL  696

Query  280  HNMHKLVTFSCCH  242
             +M K +TF CCH
Sbjct  697  RSMEKYITFRCCH  709



>ref|XP_011014800.1| PREDICTED: uncharacterized protein LOC105118522 isoform X1 [Populus 
euphratica]
Length=722

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/258 (33%), Positives = 134/258 (52%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L   E+W L+L+V  I     I  WI + +YIFL GG++++ V++    
Sbjct  475  AFPFTSSREESLWRDETWRLELLVDGI--DPVILNWIKEGKYIFLYGGDDDEWVRKFTNT  532

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    +++  +VY+G+S K     + IR   +T+T E+          I  FWTRL+
Sbjct  533  ARTVAQSARIHLEMVYVGKSSK----REKIRRVIATITGEKLSYAWQDLTMIWFFWTRLE  588

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y+ EG     WA+LS    ++A       
Sbjct  589  SMLYSKIQ----LGKLDDHDPMMQEIKKLLSYDREGG----WAVLSNGSNVVANGHKTTA  640

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK    + GFD AF+D   ++   + P S        ++P    +IP T  
Sbjct  641  LQTLLEYDLWKGQVPVKGFDLAFRDHQGLIHDIARPCSR------FDFPMTTGRIPETMK  694

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C+  M K  TF CCH
Sbjct  695  CPECHRTMEKFSTFLCCH  712



>ref|XP_006369948.1| hypothetical protein POPTR_0001s35900g [Populus trichocarpa]
 gb|ERP66517.1| hypothetical protein POPTR_0001s35900g [Populus trichocarpa]
Length=722

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 134/258 (52%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L   E+W L+L+V  I     I  WI++ +YIFL GG++++ V++    
Sbjct  475  AFPFTSLREESLWKDETWRLELLVDGI--DPVILNWINEGKYIFLYGGDDDEWVRKFTNT  532

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + IR   +T+T E+          +  FWTRL+
Sbjct  533  ARAVAQAARIPLEMVYVGKSSK----REKIRRVIATITVEKLSYVWQDLTMMWFFWTRLE  588

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y  EG     WA+LS    ++       +
Sbjct  589  SMLYSKIQ----LGKLDDHDPMMQEIKKLLSYGREGG----WAVLSNGSNVVVNGHKTTV  640

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK+   + GFD AF+D +  +   + P       C  ++P    +IP T  
Sbjct  641  LQTLLEYDLWKEQVPVKGFDMAFQDHHFQLRGIARPC------CRFDFPMTTGRIPETMK  694

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+CN  M K  TF CCH
Sbjct  695  CPECNSTMEKFSTFLCCH  712



>ref|XP_002298571.2| hypothetical protein POPTR_0001s35870g [Populus trichocarpa]
 gb|EEE83376.2| hypothetical protein POPTR_0001s35870g [Populus trichocarpa]
Length=723

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 133/258 (52%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L   E+W L+L+V  I     I  WI + +YIF+ GG++++ V++    
Sbjct  476  AFPFTSLREESLWKDETWRLELLVDGI--DPVILNWIKEGKYIFMYGGDDDEWVRKFTNT  533

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + IR   +T+T E+          I  FWTRL+
Sbjct  534  ARAVAQAARIPLEMVYVGKSSK----REKIRRVIATITVEKLSYVWQDLTMIWFFWTRLE  589

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y+ EG     WA+LS    ++        
Sbjct  590  SMLYSKIQ----LGKLDDHDPMMQEIKKLLSYDREGG----WAVLSNGSNVVVNGHKTTA  641

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK+   + GFD A++D    +   S P       C  ++P  + +IP T  
Sbjct  642  LQTLLEYDLWKEQVPVKGFDLAYRDHQGRIHDISRPC------CRFDFPMTMGRIPETMK  695

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+CN  M K  TF CCH
Sbjct  696  CPECNRTMEKFSTFLCCH  713



>ref|XP_011014351.1| PREDICTED: uncharacterized protein LOC105118161 [Populus euphratica]
Length=722

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/258 (33%), Positives = 133/258 (52%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L   E+W L+L+V  I     I  WI + +YIFL GG++++ V++    
Sbjct  475  AFPFTSLREESLWRDETWRLELLVDGI--DPVILNWIKEGKYIFLYGGDDDEWVRKFTNT  532

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S K     + IR   +T+T E+          I  FWTRL+
Sbjct  533  ARTVAQSARIPLEMVYVGKSSK----REKIRRVIATITGEKLSYFWQDLTMIWFFWTRLE  588

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y+ EG     WA+LS    ++A       
Sbjct  589  SMLYSKIQ----LGKLDDHDPLMQEIKKLLSYDREGG----WAVLSNGSNVVANGHKTTA  640

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK    + GFD AF+D   ++   + P S        ++P    +IP T  
Sbjct  641  LQTLLEYDLWKGQVPVKGFDLAFRDHQGLIHDIARPCSR------FDFPITTGRIPETMK  694

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C+  M K  TF CCH
Sbjct  695  CPECHRTMEKFSTFLCCH  712



>ref|XP_002271723.2| PREDICTED: uncharacterized protein LOC100242213 [Vitis vinifera]
Length=715

 Score =   135 bits (340),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/258 (31%), Positives = 131/258 (51%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +ESW L+L+V  I     I  WI + +YI+L GG + + +++    
Sbjct  469  AFPFTSLREEALWREESWKLELLVDGI--DPTILSWIKEGKYIYLYGGTDMEWIRKFTTT  526

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + I S  ++   +VY+G+S K     + +R C + +T+E+          +  FWTRL+
Sbjct  527  ARAIASTARIPLEMVYVGKSTK----REQVRKCTTAITAEKLSYCWQDLAMVWFFWTRLE  582

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G     D +++ +KKLL Y+ EG     WA+LSK   +        +
Sbjct  583  SMMFSKIQ----LGSTVDVDPMLREIKKLLSYDKEGG----WAVLSKGSFVFVNGHSSSV  634

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L   NEY+ WK+     GFD A  D +  +   + P       C   + S + +IP+T  
Sbjct  635  LPTFNEYDAWKEYVPSKGFDMACSDYHNNLRPDARPC------CRFEFSSTVGRIPDTMK  688

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C  NM K + F CCH
Sbjct  689  CPECLRNMEKYMAFLCCH  706



>ref|XP_011010496.1| PREDICTED: uncharacterized protein LOC105115342 [Populus euphratica]
Length=713

 Score =   134 bits (337),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 81/258 (31%), Positives = 134/258 (52%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L  +E+W L+L+V  I     I  WI +E+YIFL GG + + V++    
Sbjct  474  AFPFTSLREESLWREETWRLELLVDGI--DPVILNWIKEEKYIFLYGGGDVEWVRKFTNT  531

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    ++   +VY+G+S     + + I+    T+  E+          +  FWTRL+
Sbjct  532  ARAVAQAARIPLEMVYVGKSR----EREQIQRVMGTINVEKLSYAWQDLTMMWFFWTRLE  587

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y+ EG     WA+LSK   ++    G  +
Sbjct  588  SMLYSKIQ----LGKLDDHDPMMQEIKKLLSYDREGG----WAVLSKGSRVVVNGHGTTV  639

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ W++   + GFD AF++ +E +          HP     +P    +IP T  
Sbjct  640  LPTLVEYDLWQEQVPVKGFDLAFQEHHENL------HDIVHPCSRFEFPMTAGRIPETLK  693

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C+ +M K  TF CCH
Sbjct  694  CPECHRSMEKFTTFLCCH  711



>emb|CAN62582.1| hypothetical protein VITISV_034667 [Vitis vinifera]
Length=802

 Score =   134 bits (338),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 81/258 (31%), Positives = 127/258 (49%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +ESW L+L+V  I     I  WI + +YI+L GG + + +++    
Sbjct  556  AFPFTSLREEALWREESWKLELLVDGI--DPTILNWIKEGKYIYLYGGTDMEWIRKFTTT  613

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + S  ++   +VY+G+S K     + +R C + +T E+          +  FW RL+
Sbjct  614  ARAVASTARIPLEMVYVGKSKK----REQVRKCTTAITLEKLSYCWPDLAMVWFFWIRLE  669

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G     D +++ +KKLL Y+ EG     WA+LSK   +        +
Sbjct  670  SMMFSKIQ----LGSTVDVDPMLREIKKLLSYDKEGG----WAVLSKGSFVFVNGHSSTV  721

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L    EY  WKD+    GFDRA  D +  +   S P       C   +PS   +IP    
Sbjct  722  LPTFTEYNAWKDDVPPKGFDRACMDFHNKLHGESQPC------CRFEFPSEFGRIPENIK  775

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M K +TF CCH
Sbjct  776  CPECLRIMEKYITFGCCH  793



>ref|XP_003633839.2| PREDICTED: uncharacterized protein LOC100254392 [Vitis vinifera]
Length=766

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/258 (31%), Positives = 126/258 (49%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +ESW L+L+V  I     I  WI + +YI+L GG + + +++    
Sbjct  520  AFPFTSLREEALWREESWKLELLVDGI--DPTILNWIKEGKYIYLYGGTDMEWIRKFTTT  577

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + S  ++   +VY+G S K     + +R C + +T E+          +  FW RL+
Sbjct  578  ARAVASTARIPLEMVYVGNSKK----REQVRKCTTAITLEKLSYCWPDLAMVWFFWIRLE  633

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G     D +++ +KKLL Y+ EG     WA+LSK   +        +
Sbjct  634  SMMFSKIQ----LGSTVDVDPMLREIKKLLSYDKEGG----WAVLSKGSFVFVNGHSSTV  685

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L    EY  WKD+    GFDRA  D +  +   S P       C   +PS   +IP    
Sbjct  686  LPTFTEYNAWKDDVPPKGFDRACMDFHNKLHGESQPC------CRFEFPSEFGRIPENIK  739

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M K +TF CCH
Sbjct  740  CPECLRIMEKYITFGCCH  757



>ref|XP_010029073.1| PREDICTED: uncharacterized protein LOC104419196 [Eucalyptus grandis]
 gb|KCW55917.1| hypothetical protein EUGRSUZ_I01715 [Eucalyptus grandis]
Length=721

 Score =   132 bits (333),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 136/258 (53%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E++L   E+W L+L+V  I     I  WI D +YIF+ GG++ + +++   +
Sbjct  475  AFPFTTLREESLWRDEAWRLELLVDGI--DQTILNWIKDGKYIFMYGGDDIEWIRKFTSE  532

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             +++     ++  +VY+G++ K     + +R    T+  E+          +  FWTRL+
Sbjct  533  ARKVALAANISLEMVYVGKNSK----REKVRRVIETINFEKLSHTWVDLAMVWFFWTRLE  588

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  + SD++MQ +K+LL ++     VG WA+LSK   I     G  +
Sbjct  589  SMLFSKIQ----LGKVDESDDLMQQIKRLLSFDK----VGGWAILSKGSSITVNGHGTTV  640

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ W+++    G+D AFK+ ++ +          HP C   + S   +IP +  
Sbjct  641  LPTLLEYDLWREHVPTKGYDVAFKEHHDKI------HDITHPCCRFEFQSTAGRIPESMR  694

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M KL TF CCH
Sbjct  695  CPECQRKMEKLTTFVCCH  712



>ref|XP_003633800.1| PREDICTED: uncharacterized protein LOC100244128 [Vitis vinifera]
Length=825

 Score =   132 bits (333),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 131/258 (51%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W L+L+V  I     +  W+ + ++I+L GG + + +++    
Sbjct  579  AFPFTSLREEALWKEETWRLELLVDGI--DPTVLNWVKEGKFIYLYGGTDMEWIRKFTTT  636

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + S  ++   +VY+G+S K     + +R C +++T+E           +  FWTRL+
Sbjct  637  AKAVASAARIPLEMVYVGKSNK----REQVRKCITSITTENLSYCWQDLTMVWFFWTRLE  692

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +++ +KKLL Y+ EG     WA+LSK   +        +
Sbjct  693  SMLFSKIQ----LGRGDDDDSMLREIKKLLSYDKEGG----WAVLSKGSFVFVNGHSSTV  744

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L    EY  WKD+    GFD A  D +  + S S P       C   +PS + +IP    
Sbjct  745  LPTFTEYNLWKDDVPPKGFDIACMDFHSKLHSDSQPC------CRFEFPSEVGRIPEKIR  798

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M K +TF CCH
Sbjct  799  CPECLQIMEKYITFGCCH  816



>ref|XP_010660831.1| PREDICTED: uncharacterized protein LOC100264492 [Vitis vinifera]
Length=697

 Score =   132 bits (331),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 129/258 (50%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +ESW L+L+V  I     I  WI + ++I+L GG + + +++    
Sbjct  451  AFPFTSLREEALWREESWKLELLVDGI--DPTILNWIKEGKFIYLYGGTDLEWIRKFTTT  508

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + S  ++   +VY+G+S K     + +R C + +T E+          +  FWTRL+
Sbjct  509  ARAVASAARIPLEMVYVGQSKK----REQVRKCTTAITVEKLSYCWQDLTMVWFFWTRLE  564

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G     D +++ +KKL+ Y+ EG     WA+LS    +        +
Sbjct  565  SMMFSKIQ----LGSTVDVDPMLREIKKLISYDKEGG----WAVLSNGSFVFVNGHSSTV  616

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L    EY  WKD+    GFD A+ D +  + S S P       C   +PS + +IP    
Sbjct  617  LLTFTEYNAWKDDVPPKGFDIAYMDFHSKLHSDSRPC------CRFEFPSEVGRIPENIK  670

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M K +TF CCH
Sbjct  671  CPECLRIMEKYITFGCCH  688



>emb|CBI34825.3| unnamed protein product [Vitis vinifera]
Length=694

 Score =   132 bits (331),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/258 (30%), Positives = 131/258 (51%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W L+L+V  I     +  W+ + ++I+L GG + + +++    
Sbjct  448  AFPFTSLREEALWKEETWRLELLVDGI--DPTVLNWVKEGKFIYLYGGTDMEWIRKFTTT  505

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + S  ++   +VY+G+S K     + +R C +++T++           +  FWTRL+
Sbjct  506  ARAVASAARIPLEMVYVGKSNK----REQVRKCITSITTDNLSYCWQDLTMVWFFWTRLE  561

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +++ +KKLL Y+ EG     WA+LSK   +        +
Sbjct  562  SMLFSKIQ----LGRGDDDDSMLREIKKLLSYDKEGG----WAVLSKGSFVFVNGHSSTV  613

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L    EY  WKD+    GFD A  D +  + S S P       C   +PS + +IP    
Sbjct  614  LPTFTEYNLWKDDVPPKGFDIACMDFHSKLHSDSQPC------CRFEFPSEVGRIPEKIR  667

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M K +TF CCH
Sbjct  668  CPECLRIMEKYITFGCCH  685



>ref|XP_010660832.1| PREDICTED: uncharacterized protein LOC100268167 [Vitis vinifera]
Length=743

 Score =   132 bits (332),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 129/258 (50%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +ESW L+L+V  I     I  WI + ++I+L GG + + +++    
Sbjct  497  AFPFTSLREEALWREESWKLELLVDGI--DPTILNWIKEGKFIYLYGGTDMEWIRKFTTT  554

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + S  ++   +VY+G+S K     + +R C + +T E+          +  FWTRL+
Sbjct  555  ARAVASAARIPLEMVYVGQSKK----REQVRKCTTAITVEKLSYCWQDLTMVWFFWTRLE  610

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G     D +++ +KKL+ Y+ EG     WA+LS    +        +
Sbjct  611  SMMFSKIQ----LGSTVDVDPMLREIKKLISYDKEGG----WAVLSNGSFVFVNGHSSTV  662

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L    EY  WKD+    GFD A+ D +  + S S P       C   +PS + +IP    
Sbjct  663  LLTFTEYNAWKDDVPPKGFDIAYMDFHSKLHSDSRPC------CRFEFPSEVGRIPENIK  716

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M K +TF CCH
Sbjct  717  CPECLRIMEKYITFGCCH  734



>emb|CAN61289.1| hypothetical protein VITISV_032473 [Vitis vinifera]
Length=723

 Score =   132 bits (331),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 129/258 (50%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +ESW L+L+V  I     I  WI + ++I+L GG + + +++    
Sbjct  477  AFPFTSLREEALWREESWKLELLVDGI--DPTILNWIKEGKFIYLYGGTDMEWIRKFTTT  534

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + S  ++   +VY+G+S K     + +R C + +T E+          +  FWTRL+
Sbjct  535  ARAVASAARIPLEMVYVGQSKK----REQVRKCTTAITVEKLSYCWQDLTMVWFFWTRLE  590

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G     D +++ +KKL+ Y+ EG     WA+LS    +        +
Sbjct  591  SMMFSKIQ----LGSTVDVDPMLREIKKLISYDKEGG----WAVLSNGSFVFVNGHSSTV  642

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L    EY  WKD+    GFD A+ D +  + S S P       C   +PS + +IP    
Sbjct  643  LLTFTEYNAWKDDVPPKGFDIAYMDFHSKLHSDSRPC------CRFEFPSEVGRIPENIK  696

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M K +TF CCH
Sbjct  697  CPECLRIMEKYITFGCCH  714



>ref|XP_003633822.1| PREDICTED: uncharacterized protein LOC100249294 [Vitis vinifera]
Length=752

 Score =   132 bits (331),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 77/258 (30%), Positives = 131/258 (51%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W L+L+V  I     +  W+ + ++I+L GG + + +++    
Sbjct  506  AFPFTSLREEALWKEETWRLELLVDGI--DPTVLNWVKEGKFIYLYGGTDMEWIRKFTTT  563

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + S  ++   +VY+G+S K     + +R C +++T++           +  FWTRL+
Sbjct  564  ARAVASAARIPLEMVYVGKSNK----REQVRKCITSITTDNLSYCWQDLTMVWFFWTRLE  619

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +++ +KKLL Y+ EG     WA+LSK   +        +
Sbjct  620  SMLFSKIQ----LGRGDDDDSMLREIKKLLSYDKEGG----WAVLSKGSFVFVNGHSSTV  671

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L    EY  WKD+    GFD A  D +  + S S P       C   +PS + +IP    
Sbjct  672  LPTFTEYNLWKDDVPPKGFDIACMDFHSKLHSDSQPC------CRFEFPSEVGRIPEKIR  725

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M K +TF CCH
Sbjct  726  CPECLRIMEKYITFGCCH  743



>ref|XP_006432374.1| hypothetical protein CICLE_v10000431mg [Citrus clementina]
 gb|ESR45614.1| hypothetical protein CICLE_v10000431mg [Citrus clementina]
Length=716

 Score =   130 bits (328),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/259 (31%), Positives = 137/259 (53%), Gaps = 30/259 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W L+L+V  I     +  WI + +YIFL GG++ + V++    
Sbjct  469  AFPFTSLREEALWKEETWRLELLVDGI--DPLVLDWIKEGKYIFLYGGDDVEWVRKFTTA  526

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + +  ++   +VY+G+S K     + +R   +T+  E+          +  FWTRL+
Sbjct  527  ARSVANTARIPLEMVYVGKSTK----REQVRRIMATLAVEKLGHFWQDLTMVWFFWTRLE  582

Query  655  SMASSRIQYLLKMG-LDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDK  479
            SM  S+IQ    +G  D+  D ++  +KKLL Y+ +G     WALLSK   ++    G  
Sbjct  583  SMLLSKIQ----LGRADDHHDPMVPQIKKLLSYDRDGG----WALLSKGSQVLVNGHGTT  634

Query  478  MLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
            +L  + EY+ WK+   I GFD +F D ++ +   +      HP C   + ++  +IP + 
Sbjct  635  VLPTLLEYDIWKEQVPIKGFDDSFIDHHQKIHGVA------HPCCRFEFSAHSGRIPASM  688

Query  298  SCPQCNHNMHKLVTFSCCH  242
            +CP+C+  M K  TF CCH
Sbjct  689  TCPECHRYMEKFTTFCCCH  707



>emb|CAN65452.1| hypothetical protein VITISV_003896 [Vitis vinifera]
Length=721

 Score =   130 bits (328),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/258 (30%), Positives = 130/258 (50%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W L+L+V  I     +  W+ + ++I+L GG + + +++    
Sbjct  475  AFPFTSLREEALWKEETWRLELLVDGI--DPTVLNWVKEGKFIYLYGGTDMEWIRKFTTT  532

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + S  ++   +VY+G+S K     + +R C +++T+            +  FWTRL+
Sbjct  533  AKAVASAARIPLEMVYVGKSNK----REQVRKCITSITTXNLSYCWQDLTMVWFFWTRLE  588

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +++ +KKLL Y+ EG     WA+LSK   +        +
Sbjct  589  SMLFSKIQ----LGRGDDDDSMLREIKKLLSYDKEGG----WAVLSKGSFVFVNGHSSTV  640

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L    EY  WKD+    GFD A  D +  + S S P       C   +PS + +IP    
Sbjct  641  LPTFTEYNLWKDDVPPKGFDIACMDFHSKLHSDSQPC------CRFEFPSEVGRIPEKIR  694

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M K +TF CCH
Sbjct  695  CPECLXIMEKYITFGCCH  712



>ref|XP_010660833.1| PREDICTED: uncharacterized protein LOC100245845 [Vitis vinifera]
Length=712

 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 132/258 (51%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W L+L+V        I  WI + ++I+L GG + + +++    
Sbjct  466  AFPFTSLREEALWKEETWKLELLVDGT--DPTILNWIKEGKFIYLYGGTDMEWIRKFTTT  523

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + S  ++   +VY+G+S K     + +R C +++T+E+          +  FWTRL+
Sbjct  524  AKAVASAARIPLEMVYVGKSTK----REQVRRCIASITAEKLSHCWQDLTMVWFFWTRLE  579

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +M  +KKLL Y+ EG     WA+LSK         G  +
Sbjct  580  SMLFSKIQ----LGQADDQDPMMHEIKKLLSYDKEGG----WAVLSKGSFTFVNGHGTTI  631

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  +  YE+W+++    GFD A  D +  + S S P       C   + S   +IP+   
Sbjct  632  LPTLLAYEEWQEHVVTKGFDIACMDYHSKVHSDSRPC------CRFEFLSTSGRIPDKMK  685

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C  NM K +TF CCH
Sbjct  686  CPECIRNMEKYITFLCCH  703



>ref|XP_006471327.1| PREDICTED: uncharacterized protein LOC102619778 [Citrus sinensis]
Length=716

 Score =   128 bits (322),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 134/258 (52%), Gaps = 28/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W L+L+V  I     +  WI + +YIFL GG++ + V++    
Sbjct  469  AFPFTSLREEALWKEETWRLELLVDGI--DPLVLDWIKEGKYIFLYGGDDVEWVKKFTTA  526

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSE--------QRIKEFWTRLQS  653
             + + +  ++   +VY+G+S K    E V R+  +    +          +  FWTRL+S
Sbjct  527  ARSVANTARIPLEMVYVGKSTKR---EQVRRIMAALAVEKLGHFWQDLTMVWFFWTRLES  583

Query  652  MASSRIQYLLKMG-LDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            M  S+IQ    +G  D+  D ++  +KKLL Y+ +G     WALLSK   ++    G  +
Sbjct  584  MLLSKIQ----LGRADDHHDPMVPQIKKLLSYDRDGG----WALLSKGSQVLVNGHGTTV  635

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK+   I GFD +F D ++ +   +      HP C   + +   +IP + +
Sbjct  636  LPTLLEYDIWKEQVPIKGFDDSFIDHHQKIHGVA------HPCCRFEFSAYSGRIPASMT  689

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C+  M K  TF CCH
Sbjct  690  CPECHRYMEKFTTFCCCH  707



>gb|KCW55914.1| hypothetical protein EUGRSUZ_I01712 [Eucalyptus grandis]
Length=449

 Score =   126 bits (316),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 79/257 (31%), Positives = 132/257 (51%), Gaps = 27/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E+ L  +E W+L+L+V  +     I  WI + +YIFL GG++ + +++    
Sbjct  203  AFPFTTLREEALWKEEEWTLELLVDGM--DPTILNWIREGKYIFLYGGDDIEWIRKFTTA  260

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCD--------STVTSEQRIKEFWTRLQS  653
             +++    ++   +VY+G+S K    E V R  D        ST      +  FWTRL+S
Sbjct  261  ARQVAMAARIPLEMVYVGKSSKR---EQVQRAIDTINDEKLSSTWQDLTLVWYFWTRLES  317

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S+IQ    +G  +    ++Q +K+LL ++  G     WA+LSK   I+     + +L
Sbjct  318  MFFSKIQ----LGKVDEHGLLIQQLKRLLSFDKAGG----WAILSKGSSIVVNGHRNTVL  369

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSC  293
              + EY+ WK++    G+D AFK+ YE +   +      HP C   + S   +IP +  C
Sbjct  370  PALLEYDLWKEHVPTKGYDVAFKEHYEKIRDVA------HPCCRFEFQSAGGRIPESLRC  423

Query  292  PQCNHNMHKLVTFSCCH  242
            P+C   M KL TF CCH
Sbjct  424  PECQRLMEKLTTFVCCH  440



>gb|KCW55913.1| hypothetical protein EUGRSUZ_I01711 [Eucalyptus grandis]
Length=591

 Score =   127 bits (318),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 75/258 (29%), Positives = 136/258 (53%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E+ L  +E+W L+L+V  I     I  WI++ +YIFL GG++ + +++    
Sbjct  345  AFPFTTLKEEALWKEETWRLELLVDGI--DQTILTWINEGKYIFLYGGDDIEWIRKFTAA  402

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR---------IKEFWTRLQ  656
             +++    ++   +VY+G+S K     + +R   +T+  E+          +  FWTR++
Sbjct  403  ARQVALAARIPLEMVYVGKSNK----REKVRQVIATINVEKLSYTWQDPTLVWYFWTRIE  458

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +K+LL ++  G     WA+LSK   I     G  +
Sbjct  459  SMLFSKIQ----LGKVDEDDPMMQQIKRLLSFDKAGG----WAILSKGSSITVNGHGTTV  510

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY++WK++    GFD  FK+ ++ + + + P       C   + + + +IP +  
Sbjct  511  LPALLEYDQWKEHVSTKGFDVTFKEHHDKIHNETQPC------CRFEFSTMMGRIPESMR  564

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M KL TF CCH
Sbjct  565  CPECQRLMEKLTTFVCCH  582



>ref|XP_010029069.1| PREDICTED: uncharacterized protein LOC104419193 [Eucalyptus grandis]
Length=705

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/258 (29%), Positives = 136/258 (53%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E+ L  +E+W L+L+V  I     I  WI++ +YIFL GG++ + +++    
Sbjct  459  AFPFTTLKEEALWKEETWRLELLVDGI--DQTILTWINEGKYIFLYGGDDIEWIRKFTAA  516

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR---------IKEFWTRLQ  656
             +++    ++   +VY+G+S K     + +R   +T+  E+          +  FWTR++
Sbjct  517  ARQVALAARIPLEMVYVGKSNK----REKVRQVIATINVEKLSYTWQDPTLVWYFWTRIE  572

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +K+LL ++  G     WA+LSK   I     G  +
Sbjct  573  SMLFSKIQ----LGKVDEDDPMMQQIKRLLSFDKAGG----WAILSKGSSITVNGHGTTV  624

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY++WK++    GFD  FK+ ++ + + + P       C   + + + +IP +  
Sbjct  625  LPALLEYDQWKEHVSTKGFDVTFKEHHDKIHNETQPC------CRFEFSTMMGRIPESMR  678

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M KL TF CCH
Sbjct  679  CPECQRLMEKLTTFVCCH  696



>ref|XP_010029068.1| PREDICTED: uncharacterized protein LOC104419192 [Eucalyptus grandis]
Length=722

 Score =   126 bits (316),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/257 (31%), Positives = 132/257 (51%), Gaps = 27/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E+ L  +E W+L+L+V  +     I  WI + +YIFL GG++ + +++    
Sbjct  476  AFPFTTLREEALWKEEEWTLELLVDGM--DPTILNWIREGKYIFLYGGDDIEWIRKFTTA  533

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCD--------STVTSEQRIKEFWTRLQS  653
             +++    ++   +VY+G+S K    E V R  D        ST      +  FWTRL+S
Sbjct  534  ARQVAMAARIPLEMVYVGKSSKR---EQVQRAIDTINDEKLSSTWQDLTLVWYFWTRLES  590

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S+IQ    +G  +    ++Q +K+LL ++  G     WA+LSK   I+     + +L
Sbjct  591  MFFSKIQ----LGKVDEHGLLIQQLKRLLSFDKAGG----WAILSKGSSIVVNGHRNTVL  642

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSC  293
              + EY+ WK++    G+D AFK+ YE +   +      HP C   + S   +IP +  C
Sbjct  643  PALLEYDLWKEHVPTKGYDVAFKEHYEKIRDVA------HPCCRFEFQSAGGRIPESLRC  696

Query  292  PQCNHNMHKLVTFSCCH  242
            P+C   M KL TF CCH
Sbjct  697  PECQRLMEKLTTFVCCH  713



>ref|XP_007031665.1| Uncharacterized protein TCM_017020 [Theobroma cacao]
 gb|EOY02591.1| Uncharacterized protein TCM_017020 [Theobroma cacao]
Length=814

 Score =   126 bits (317),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 131/258 (51%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W L+L+V  I     I  WI +++YIFL GG++ + V++    
Sbjct  568  AFPFTSLREEALWREETWRLELLVDGI--DPIILNWIKEDKYIFLFGGDDVEWVRKFATA  625

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + +  ++   +VY+G+S K     + +R   + + +E+          +  FWTRL+
Sbjct  626  ARSVATAARIPLEMVYVGKSSK----REQVRKVTAIINAEKLSYAWQDQAMVWFFWTRLE  681

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +KKLL Y+ EG     WA+ S+    +       +
Sbjct  682  SMLFSKIQ----LGRADDHDPMMQQIKKLLSYDREGG----WAVFSRGSNTMVNGHSSTV  733

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  +  Y++WK      GF+ AFK+ ++ +   +      HP C   +P+   +IP    
Sbjct  734  LPALGGYDEWKVKVPEIGFESAFKEYHDRLHDVA------HPCCRFEFPTT-TRIPENMR  786

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M K  TF CCH
Sbjct  787  CPECRRFMEKYTTFLCCH  804



>ref|XP_010029072.1| PREDICTED: uncharacterized protein LOC104419195 [Eucalyptus grandis]
 gb|KCW55916.1| hypothetical protein EUGRSUZ_I01714 [Eucalyptus grandis]
Length=722

 Score =   126 bits (316),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 77/258 (30%), Positives = 131/258 (51%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E+ L  +E W L+L+V  +     I  WI D +YIFL GG++ + +++    
Sbjct  478  AFPFTTLREEALWREEKWRLELLVDGM--DPTILNWISDGKYIFLYGGDDIEWIRKFTAA  535

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR---------IKEFWTRLQ  656
             +++    ++   +VY+G+S K     + +R   +T+  E+          +  FWTRL+
Sbjct  536  ARQVALAARIPLEMVYVGKSNK----REKVRQVIATINVEKLSSTWQDPTLVWYFWTRLE  591

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +K+LL ++  G     WA+LS+   I     G  +
Sbjct  592  SMLFSKIQ----LGKADEEDHMMQQIKRLLSFDKAGG----WAVLSRGSAITVNGHGTTV  643

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK++    G+D AFK+ ++ +   +      HP C   + S   +IP    
Sbjct  644  LPALLEYDLWKEHVATKGYDVAFKEHHDKIHDVT------HPCCRFEFQSMGGRIPEGMR  697

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP C   M KL TF CCH
Sbjct  698  CPDCQRRMEKLTTFVCCH  715



>ref|XP_010029070.1| PREDICTED: uncharacterized protein LOC104419194 [Eucalyptus grandis]
 gb|KCW55911.1| hypothetical protein EUGRSUZ_I01709 [Eucalyptus grandis]
Length=720

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 131/258 (51%), Gaps = 29/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E+ L  +E W L+L+V  +     I  WI D +YIFL GG++ + +++    
Sbjct  476  AFPFTTLREEALWKEEKWRLELLVDGM--DPTILNWIRDGKYIFLYGGDDIEWIRKFTAA  533

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR---------IKEFWTRLQ  656
             +++    ++   ++Y+G+S K     + +R   +T+  E+          +  FWTRL 
Sbjct  534  ARQVAQAARIPLEMIYVGKSSK----REKVRQVIATINVEKLSSTWQDLTLVWYFWTRLD  589

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +MQ +K++L ++  G     WALLS+   I     G  +
Sbjct  590  SMLFSKIQ----LGKADEDDPMMQQIKRILSFDKTGG----WALLSRGSAIAVNGHGTTV  641

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY+ WK++    G+D AFKD ++ +   + P       C   + S   +IP    
Sbjct  642  LPALVEYDLWKEHVVTKGYDVAFKDHHDKIRDVTLPC------CRFEFQSAGGRIPEGMR  695

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M KL TF+CCH
Sbjct  696  CPECQRRMEKLTTFACCH  713



>ref|XP_010694661.1| PREDICTED: uncharacterized protein LOC104907426 [Beta vulgaris 
subsp. vulgaris]
Length=759

 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 142/259 (55%), Gaps = 28/259 (11%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
             ++ +TS  E+ L ++E+W L+L+V+ I    +I  WI +E+YIFL GG++ + +++   
Sbjct  494  HAFPFTSSREEALWEQETWRLELLVNGI--DQKILDWIREEKYIFLYGGDDLEWIRKFTN  551

Query  811  KIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRL  659
            + + +   +++   +VY+GRS     +++++R   + +  EQ          +  FWTR+
Sbjct  552  EARAVARALRVPIEMVYVGRS----HNKELVRKVCAAIIVEQLSHCWQDPTMVWYFWTRI  607

Query  658  QSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDK  479
            +SM  S+ Q  L+   D G D I+Q +++L  +  + S  G WA+L+K   I+    G  
Sbjct  608  ESMIFSKFQ--LEKVHDHG-DIILQEIQRL--HSHDKSHAG-WAILAKGSTIVVHGQGKL  661

Query  478  MLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
             L  + E E WK++A  +GF+  +   Y  +         ++P   + +PSN+ +IPN+ 
Sbjct  662  ALTTLQEMEIWKEHALRDGFETGYGSHYREL------HMREYPCHRIEFPSNV-RIPNSM  714

Query  298  SCPQCNHNMHKLVTFSCCH  242
             CP+C  +MH+  +F CCH
Sbjct  715  LCPECRRHMHRYNSFICCH  733



>ref|XP_010030737.1| PREDICTED: uncharacterized protein LOC104420628 [Eucalyptus grandis]
Length=667

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/254 (30%), Positives = 133/254 (52%), Gaps = 21/254 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  +++W+L+L+V+       I  WI D +YIFL GG++ + +++ I++
Sbjct  421  AFPFTKLREEDLWKEQTWTLELLVTA--NDQTILNWIRDGKYIFLYGGDDIEWLRKFIVE  478

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDS-----TVTSEQRIKEFWTRLQSMAS  644
             +++    ++   +VY+G+S K    + VI   ++     T      +  FWTRL+SM  
Sbjct  479  ARQVAQGARIPLEMVYVGKSTKREQAQHVITTINNEKLSHTWQDPTMVWLFWTRLESMLF  538

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S+IQ    +G  +  + +MQ +K+LL ++  G     WA+LS+   I     G  +L  +
Sbjct  539  SKIQ----LGKVDEHNPMMQQIKRLLSFDKAGG----WAMLSRGSTITMDGHGTTVLPAL  590

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQC  284
             EY+ WK+N    G+  AFK+ ++ +  S       H  C L+  S + +IP +  CP C
Sbjct  591  LEYDLWKENVATKGYGMAFKEHHDKIQDS------MHLCCRLDLQSTVGEIPASMRCPDC  644

Query  283  NHNMHKLVTFSCCH  242
               M +L TF C H
Sbjct  645  QSLMEELTTFFCRH  658



>ref|XP_002526961.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35448.1| conserved hypothetical protein [Ricinus communis]
Length=677

 Score =   117 bits (292),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/260 (29%), Positives = 130/260 (50%), Gaps = 28/260 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   +++L   E+W L+L+V  +   + I +W  +E++IF+ GG++ + V+     
Sbjct  427  AFPFTRSRQESLWKDETWRLELLVDGL--DATILRWAFEEKHIFIFGGDDVEWVKTFTAT  484

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ----------RIKEFWTRL  659
             +E+    +    +VY+G   K     D I+    ++  ++           I  FWTRL
Sbjct  485  AREVAHAARFQLELVYVGNRSK----RDKIKQIIDSIEKDKLNTYFWHDLTAIWYFWTRL  540

Query  658  QSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDK  479
            +SM   +IQ   K    E +D IMQ +KKLL YE EG     WA+L++   I+    G K
Sbjct  541  ESMLFCKIQLGNKF---EENDGIMQELKKLLSYEKEGR----WAMLTRGSNIMVNGAGAK  593

Query  478  MLGVMNEYEKWKD-NAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNT  302
            +L  + EY+   D N+    F  +FKD Y  + + +S     H  C  ++P+   + P  
Sbjct  594  VLHALTEYDPLNDLNSPNQDFGLSFKDHYNKINTGTS----VHSCCRFSFPTAARRFPKR  649

Query  301  QSCPQCNHNMHKLVTFSCCH  242
             +CP+C+  M K +  SCCH
Sbjct  650  TTCPECHRIMAKQIVLSCCH  669



>ref|XP_010694662.1| PREDICTED: uncharacterized protein LOC104907427 [Beta vulgaris 
subsp. vulgaris]
Length=819

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 134/258 (52%), Gaps = 28/258 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L ++E+W L+L+V+ I    +I  WI D +YIF+ GG++ + +++   +
Sbjct  563  AFPFTSTREENLWEQETWRLELLVNGI--DPKILDWIRDGKYIFIYGGDDIEWIRKFTRE  620

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
               +   +Q++  +VY+GRS     +++++R     +  EQ         ++  FWTR++
Sbjct  621  AHAVARALQVSMEMVYVGRS----HNKELVRKVGEAIMVEQLSHCWQDPTQVWYFWTRIE  676

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ  L    D G D I+Q ++++    +   + G WA+L+K   I+    G  +
Sbjct  677  SMIFSKIQ--LGRVHDHG-DVILQEIQRI---HSHDKSHGGWAILAKGSTIMVHGQGKLV  730

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + E E WK+ A  +GF+  + + Y  +     P         + +P+ + ++P +  
Sbjct  731  LFTLQELELWKEKALNDGFEVGYGNHYRELHRKEFPCHR------IEFPATI-RVPQSML  783

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP C  +M    +F CCH
Sbjct  784  CPDCRRHMKNFNSFICCH  801



>ref|XP_008362016.1| PREDICTED: uncharacterized protein LOC103425707 [Malus domestica]
Length=681

 Score =   110 bits (276),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 70/261 (27%), Positives = 132/261 (51%), Gaps = 41/261 (16%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            +++ +   +E TL++ + W +  +V+DI     I  WI +E+YIF  GG +N  +Q+   
Sbjct  452  KAFPFHKGIEDTLTNDKEW-ITPIVNDI--HPTIQTWIKEEKYIFFYGGKDNDWIQQFTK  508

Query  811  KIQEICS-----KIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMA  647
            K   I +     ++++N  +  +G+S K   D  ++               FW  ++S+ 
Sbjct  509  KATTIANDPFIKELKINIELFCVGKSPKGGEDLGIL-------------GRFWNGIESLF  555

Query  646  SSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGV  467
             +++        ++ +D + + V+KLL Y+ EG     WA+L+K   ++    G  +L V
Sbjct  556  FTKV--------NKQTDTVTKEVQKLLSYKNEGG----WAVLTKGSTVVVSGHGFTILKV  603

Query  466  MNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQ  287
            +++++ WK+  +  GF+ +FK  YE ++ +      +H  C L+ PS   K+P T  CP+
Sbjct  604  LDDFDTWKNFIKEKGFEFSFKAYYEKVIQT-----MRH-CCRLDIPSVAGKVPETMKCPE  657

Query  286  CNHNMHKLVTFSCCHTFVDCP  224
            C   M   V++ CCHT  D P
Sbjct  658  CPRTMETFVSYKCCHT--DSP  676



>gb|ADN32815.1| sieve element occlusion a [Malus domestica]
Length=681

 Score =   110 bits (276),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 70/261 (27%), Positives = 132/261 (51%), Gaps = 41/261 (16%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            +++ +   +E TL++ + W +  +V+DI     I  WI +E+YIF  GG +N  +Q+   
Sbjct  452  KAFPFHKGIEDTLTNDKEW-ITPIVNDI--HPTIQTWIKEEKYIFFYGGKDNDWIQQFTK  508

Query  811  KIQEICS-----KIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMA  647
            K   I +     ++++N  +  +G+S K   D  ++               FW  ++S+ 
Sbjct  509  KATTIANDPFIKELKINIELFCVGKSPKGGEDLGIL-------------GRFWNGIESLF  555

Query  646  SSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGV  467
             +++        ++ +D + + V+KLL Y+ EG     WA+L+K   ++    G  +L V
Sbjct  556  FTKV--------NKQTDTVTKEVQKLLSYKNEGG----WAVLTKGSTVVVSGHGFTILKV  603

Query  466  MNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQ  287
            +++++ WK+  +  GF+ +FK  YE ++ +      +H  C L+ PS   K+P T  CP+
Sbjct  604  LDDFDTWKNFIKEKGFEFSFKAYYEKVIQT-----MRH-CCRLDIPSVAGKVPETMKCPE  657

Query  286  CNHNMHKLVTFSCCHTFVDCP  224
            C   M   V++ CCHT  D P
Sbjct  658  CPRTMETFVSYKCCHT--DSP  676



>ref|XP_008362017.1| PREDICTED: uncharacterized protein LOC103425708 [Malus domestica]
Length=681

 Score =   110 bits (274),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 131/261 (50%), Gaps = 41/261 (16%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            +++ +   +E T ++ + W +  +V+DI     I  WI +E+YIF  GG +N  +Q+   
Sbjct  452  KAFPFHKGIEDTJTNDKEW-ITPIVNDI--HPTIQTWIXEEKYIFFYGGKDNDWIQQFTK  508

Query  811  KIQEICS-----KIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMA  647
            K   I +     ++++N  +  +G+S K   D  ++               FW  ++S+ 
Sbjct  509  KATTIANDPFIKELKINIELFCVGKSPKGGEDLGIL-------------GRFWNGIESLF  555

Query  646  SSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGV  467
             +++        ++ +D + + V+KLL Y+ EG     WA+L+K   ++    G  +L V
Sbjct  556  FTKV--------NKQTDTVTKEVQKLLSYKNEGG----WAVLTKGSTVVVSGHGFTILKV  603

Query  466  MNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQ  287
            +++++ WK+  +  GF+ +FK  YE ++ +      +H  C L+ PS   K+P T  CP+
Sbjct  604  LDDFDTWKNFIKEKGFEFSFKAYYEKVIQT-----MRH-CCRLDIPSVAGKVPETMKCPE  657

Query  286  CNHNMHKLVTFSCCHTFVDCP  224
            C   M   V++ CCHT  D P
Sbjct  658  CPRTMETFVSYKCCHT--DSP  676



>ref|XP_011097584.1| PREDICTED: uncharacterized protein LOC105176465 [Sesamum indicum]
Length=712

 Score =   107 bits (268),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 125/253 (49%), Gaps = 20/253 (8%)
 Frame = -3

Query  985  YNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILKI  806
            + +    E  L  +E+W L+L+V+ I     +  WI  E YI L GG + + + +  +  
Sbjct  473  FPFEKTKELLLWQEETWRLELLVNGI--DVSLLYWIRSERYIILYGGFDLQAISDFTVTA  530

Query  805  QEICSKIQMNWRIVYIGRSGKTF-----FDEDVIRMCDSTVTSEQRIKEFWTRLQSMASS  641
            + I  ++ +   +VY+G S K+         ++     S    E+ +  FWTR++SM  S
Sbjct  531  RRIIHQLDIPLEMVYVGTSTKSPQELGPLINNIRNQRLSNCWEEEMMWFFWTRVESMLLS  590

Query  640  RIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMN  461
            +IQ   K   DE  D +MQ ++KLL+Y+     +G WAL SK   ++       ++ ++ 
Sbjct  591  KIQVEAK---DE-QDPVMQELEKLLMYD----RMGTWALFSKGSEVMLTGRVPALIHLLQ  642

Query  460  EYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQCN  281
            ++++WK N   + F    K+ Y  +     P +  HP C L +     K P +  CP+C+
Sbjct  643  KFDEWKGNVGHSDFLIELKEQYNRL-----PAADDHPCCQLEFDHTTGKTPVSMICPECH  697

Query  280  HNMHKLVTFSCCH  242
             +M +L  F+CCH
Sbjct  698  RSMEELAVFTCCH  710



>ref|XP_010435652.1| PREDICTED: uncharacterized protein LOC104719422 [Camelina sativa]
Length=740

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/261 (29%), Positives = 130/261 (50%), Gaps = 29/261 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  KE++SL L++  I   S I  WI+ + YIFL GG++   ++   + 
Sbjct  485  AFPFTRSREEELWRKETFSLNLIIDGI--DSVIFNWINPDNYIFLYGGDDLDWIRRFTMA  542

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             +       +   + Y+G+   +  ++   R     + SE              FWTRL+
Sbjct  543  AKATAKDSNVKLEMAYVGKRNHSHREQ--TRRISEVIRSENLSHSWAEPPLMWFFWTRLE  600

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  DE+MQG+KK+L Y+     +G WALLSK   II    G  +
Sbjct  601  SMLYSKIQ----LGKADDHDEVMQGIKKILSYDK----LGGWALLSKGPEIIMIVHG-AI  651

Query  475  LGVMNEYEK-WKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIPN  305
               +N Y++ WK +    G+ +A  D +  E++L +  P S+   + F +  +   +IP 
Sbjct  652  ERTVNVYDRTWKTHVPTKGYTKAMYDHHHDEILLETGKPCSH---FDF-HITARSGRIPE  707

Query  304  TQSCPQCNHNMHKLVTFSCCH  242
              +C +C   M K ++F+CCH
Sbjct  708  KMNCFECQRPMEKYMSFACCH  728



>ref|XP_010550173.1| PREDICTED: uncharacterized protein LOC104821101 [Tarenaya hassleriana]
Length=732

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/261 (30%), Positives = 129/261 (49%), Gaps = 29/261 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L   ESW L LVV  I     I  WI  E YIFL GG +   ++     
Sbjct  476  AFPFTRTREEELWRGESWILNLVVDGI--DPIIFSWIKPETYIFLYGGEDMGWIERFTKA  533

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTV---------TSEQRIKEFWTRLQ  656
             +   +   +   + Y+G+   +  ++  IR    TV         T    +  FWTRL+
Sbjct  534  ARATATDANIKLEMAYVGKRNHSHREQ--IRRISETVKARDLSYSWTDPAMMWFFWTRLE  591

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D++MQG+KK+L Y+     +G WALLSK + I+    G  +
Sbjct  592  SMLYSKIQ----LGKADDHDDVMQGIKKILSYDK----IGGWALLSKGEEIVMIAHG-AI  642

Query  475  LGVMNEYEK-WKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIPN  305
               ++EY++ WK +    G+ +A  D Y   ++  +  P S+   + F +  +   +IP+
Sbjct  643  DRTVSEYDRTWKTDVATKGYKQAIYDHYFDVILRDTGKPCSH---FDF-HITARSGRIPD  698

Query  304  TQSCPQCNHNMHKLVTFSCCH  242
              +C +C+  M K ++F+CCH
Sbjct  699  KMNCFECHRPMEKYLSFACCH  719



>ref|NP_186817.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF01551.1|AC009325_21 unknown protein [Arabidopsis thaliana]
 gb|AAP37684.1| At3g01680 [Arabidopsis thaliana]
 dbj|BAF00055.1| hypothetical protein [Arabidopsis thaliana]
 gb|ADN32814.1| sieve element occlusion b [Arabidopsis thaliana]
 gb|AEE73702.1| uncharacterized protein AT3G01680 [Arabidopsis thaliana]
Length=740

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/261 (29%), Positives = 129/261 (49%), Gaps = 29/261 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  +E++SL L+V  I   S I  WI  + YIFL GG++   ++   + 
Sbjct  485  AFPFTRSREEELWRRETFSLNLIVDGI--DSVIFNWIKPDNYIFLYGGDDLDWIRRFTMA  542

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             +       +N  + Y+G+   +  ++  IR     + SE              FWTRL+
Sbjct  543  AKATAKDSNVNLEMAYVGKRNHSHREQ--IRRISEVIRSENLSHSWAEPALMWFFWTRLE  600

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D++MQG+KK+L Y+     +G WALLSK   I+    G  +
Sbjct  601  SMLYSKIQ----LGKADDHDDVMQGIKKILSYDK----LGGWALLSKGPEIVMIAHG-AI  651

Query  475  LGVMNEYEK-WKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIPN  305
               M+ Y++ WK +    G+ +A  D +  E++  +  P  +   + F +  +   +IP 
Sbjct  652  ERTMSVYDRTWKTHVPTKGYTKAMSDHHHDEVLRETGKPCGH---FDF-HITARSGRIPE  707

Query  304  TQSCPQCNHNMHKLVTFSCCH  242
              +C +C   M K ++FSCCH
Sbjct  708  KMNCFECQRPMEKYMSFSCCH  728



>gb|KDP46375.1| hypothetical protein JCGZ_10215 [Jatropha curcas]
Length=702

 Score =   105 bits (261),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 130/253 (51%), Gaps = 18/253 (7%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            R+Y +    E++L  +E+W+L L+     +   I + I +E +I L GG + + +++   
Sbjct  454  RAYPFKRTKEESLWSEETWNLWLL-GWFGFFYPIRRSIREEMHILLFGGEDLEWLKDFTT  512

Query  811  KIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMC-DSTVTSEQRIKEFWTRLQSMASSRI  635
               ++  + Q+  ++VY+G+      +E++  +  D        +  FW R++SM +S+I
Sbjct  513  AAGQVAEEAQIPLQMVYVGK------NENLEELPNDLYWPRTGDVWFFWNRIESMLASKI  566

Query  634  QYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMNEY  455
            +  +    D  +D I+Q +KK++ Y  EG     WALLSK   I+          V  ++
Sbjct  567  E--IAKYEDNKNDIILQEIKKVVTYHKEGG----WALLSKGDKILVNGRSKIFFRVFKDF  620

Query  454  EKWKDNAQING-FDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSN-LEKIPNTQSCPQCN  281
            EKWK++A IN  FD  F++ Y+ +  +    S  H  C  N+P+  L +IP    CP+C+
Sbjct  621  EKWKEDATINTEFDNRFRNYYDKI--NKGDDSVGHFCCRFNFPATLLGQIPRKMICPECH  678

Query  280  HNMHKLVTFSCCH  242
              M + +T  CCH
Sbjct  679  STMERQITLVCCH  691



>ref|XP_004288436.1| PREDICTED: uncharacterized protein LOC101298363 [Fragaria vesca 
subsp. vesca]
Length=677

 Score =   104 bits (260),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 127/257 (49%), Gaps = 41/257 (16%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            +++ +   +E T +  + W +  +V+DI     I  WI +E+YIF  GG +N+ +Q+   
Sbjct  448  KAFPFHKGIEDTFTSDKEW-ITPIVNDI--HPTIQTWIKEEKYIFFYGGKDNEWIQQFTK  504

Query  811  KIQEICS-----KIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMA  647
            K   I +     ++++N  +  +G+S K   D  ++               FW+ ++S+ 
Sbjct  505  KATAIANDPFIKELKINIELFCVGKSAKGGEDLGIL-------------GRFWSGIESLF  551

Query  646  SSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGV  467
             + +        ++ +D + + V+KLL Y+ E      WA+LSK   ++    G  +L V
Sbjct  552  FTNV--------NKQTDTVTKEVQKLLSYKNESG----WAVLSKGSTVVVSGHGFTILKV  599

Query  466  MNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLEKIPNTQSCP  290
            + ++E+WK+  +  GF+ +FK  ++ ++ +         +C  L+ PS   K+P T  CP
Sbjct  600  LEDFERWKELIKEKGFEVSFKSYHDKVIQTMK-------HCVRLDIPSVAGKVPETMKCP  652

Query  289  QCNHNMHKLVTFSCCHT  239
            +C   M   V++ CCHT
Sbjct  653  ECPRTMETYVSYKCCHT  669



>gb|KDP46379.1| hypothetical protein JCGZ_10219 [Jatropha curcas]
Length=711

 Score =   104 bits (260),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/261 (28%), Positives = 135/261 (52%), Gaps = 27/261 (10%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWI-DDEEYIFLCGGNNNKQVQELI  815
            ++Y +T   E+ L ++E W L+L+V  I     I  W+ ++++YIFL GG+  + + + I
Sbjct  462  KAYPFTKSREEKLWNEEKWGLELLVDSI--DRTILNWVKENKKYIFLYGGDKIEWLTDFI  519

Query  814  LKIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTV--------TSEQRIKEFWTRL  659
               +E+ +K  +  ++VY+G++ +    ED ++   + V         +E  I  FWTR+
Sbjct  520  TTAREVANKATIQLQMVYVGQNARP---EDQLQPLINKVRENSYYYTVTESWI--FWTRI  574

Query  658  QSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDK  479
            +SM SSRIQ  +    D   D I+Q +KK++ Y+ EG     W L  K   +      + 
Sbjct  575  ESMLSSRIQ--MANYDDNEDDTILQEIKKVINYDREGD----WVLFGKGSQVFVNGQSNI  628

Query  478  MLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLE-KIPN  305
            +L  + E+++WKD+     F    K+ Y+ ++ S    ++    CF  ++P+ +  +IP 
Sbjct  629  VLRALKEFDQWKDSLDTKEFGNCLKEHYDKIIKSVDDVAH---LCFRFDFPAAVRSQIPR  685

Query  304  TQSCPQCNHNMHKLVTFSCCH  242
               CP+C+  M +  +F  C+
Sbjct  686  RMICPECHCTMDRKTSFLYCY  706



>ref|XP_006408537.1| hypothetical protein EUTSA_v10020146mg [Eutrema salsugineum]
 gb|ESQ49990.1| hypothetical protein EUTSA_v10020146mg [Eutrema salsugineum]
Length=739

 Score =   104 bits (260),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 126/260 (48%), Gaps = 27/260 (10%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  +E++SL L+V  I   S I  WI+ + YIFL GG++   ++   + 
Sbjct  483  AFPFTRSREEELWRRETFSLNLIVDGI--DSVIFNWINPDNYIFLYGGDDLDWIRRFTMA  540

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             +       +   + Y+G+   +  ++  IR     V++E              FW RL+
Sbjct  541  AKATAKDSNVKLEMAYVGKRNHSHREQ--IRRISEAVSAENLSHSWTEPALMWFFWARLE  598

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  DE+MQG+KK+L Y+     +G WALLSK   I+    G   
Sbjct  599  SMLYSKIQ----LGKADDHDEVMQGIKKILSYDK----LGGWALLSKGPEIVMIVHGAIE  650

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIPNT  302
              V      WK +    G+ +A  D +  E++  +  P  +   + F +  +   +IP+ 
Sbjct  651  RTVSVYDRTWKTHVPTKGYTKAMYDHHHDEVLRETGKPCGH---FDF-HITARSGRIPDK  706

Query  301  QSCPQCNHNMHKLVTFSCCH  242
             +C +C+  M K +TFSCCH
Sbjct  707  MNCFECHRPMEKYMTFSCCH  726



>ref|XP_002884266.1| hypothetical protein ARALYDRAFT_477347 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60525.1| hypothetical protein ARALYDRAFT_477347 [Arabidopsis lyrata subsp. 
lyrata]
Length=740

 Score =   104 bits (259),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 126/258 (49%), Gaps = 29/258 (11%)
 Frame = -3

Query  979  YTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILKIQE  800
            +T   E+ L  +E++SL L+V  I   S I  WI  + YIFL GG++   ++   +  + 
Sbjct  488  FTRSREEELWRRETFSLNLIVDGI--DSVIFNWITPDNYIFLYGGDDLDWIRRFTMAAKA  545

Query  799  ICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQSMA  647
                  +N  + Y+G+   +  ++  IR     + SE              FWTRL+SM 
Sbjct  546  TAKDSNVNLEMAYVGKRNHSHREQ--IRRISEAIRSENLSHSWAEPALMWFFWTRLESML  603

Query  646  SSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGV  467
             S+IQ    +G  +  D++MQG+KK+L Y+     VG WALLSK   I+    G  +   
Sbjct  604  YSKIQ----LGKADDQDDVMQGIKKILSYDK----VGGWALLSKGPEIVMIAHG-AVERT  654

Query  466  MNEYEK-WKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            M+ Y++ WK +    G+ +A  D +  E++  +  P  +   + F +  +   +IP    
Sbjct  655  MSAYDRTWKTHVPTKGYTKAMYDHHHDEVLRETGKPCGH---FDF-HITARSGQIPEKMM  710

Query  295  CPQCNHNMHKLVTFSCCH  242
            C +C   M K ++FSCCH
Sbjct  711  CFECQRPMEKYMSFSCCH  728



>ref|XP_006299972.1| hypothetical protein CARUB_v10016185mg [Capsella rubella]
 gb|EOA32870.1| hypothetical protein CARUB_v10016185mg [Capsella rubella]
Length=1488

 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/261 (29%), Positives = 128/261 (49%), Gaps = 29/261 (11%)
 Frame = -3

Query  988   SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
             ++ +T   E+ L  KE++SL L++  I   S I  WI+ + YIFL GG++   ++   + 
Sbjct  1233  AFPFTKSREEELWRKETFSLNLIIDGI--DSVIFNWINPDNYIFLYGGDDLDWIRRFTMA  1290

Query  808   IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
              +       +   + Y+G+   +  ++  IR     + SE              FWTRL+
Sbjct  1291  AKATAKDSNVKLEMAYVGKRNHSHREQ--IRRIGEVIRSENLSHSWAEPPLMWFFWTRLE  1348

Query  655   SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
             SM  S+IQ    +G  +  DE+MQG+KK+L Y+     +G WALLSK   II    G  +
Sbjct  1349  SMLYSKIQ----LGKADDHDEVMQGIKKILSYDK----LGGWALLSKGPEIIMIVHG-AI  1399

Query  475   LGVMNEYEK-WKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIPN  305
                M  Y++ WK +    G+ +A  D +  E++  +  P  +   + F +  +   +IP 
Sbjct  1400  ERTMTVYDRTWKTHVPTKGYTKAMYDHHHDEVLRETGKPCGH---FDF-HITARSGRIPE  1455

Query  304   TQSCPQCNHNMHKLVTFSCCH  242
               +C +C   M K ++F+CCH
Sbjct  1456  KMNCFECQRPMEKYMSFACCH  1476



>ref|XP_004288435.1| PREDICTED: uncharacterized protein LOC101298064 [Fragaria vesca 
subsp. vesca]
Length=680

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/261 (25%), Positives = 124/261 (48%), Gaps = 41/261 (16%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            +++ +T ++E+ LS      +  VV  +     +  W+ +  YIF  GG +N+ +Q+   
Sbjct  452  KAFPFTEKIEKELSHSHG-EIHSVVEGV--HPSVPSWLKENRYIFFYGGKDNEWIQQFTK  508

Query  811  KIQ-----EICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMA  647
            K        I  + ++   +V +G++ K   D  ++               FWT ++S+ 
Sbjct  509  KATALANDPILKEAKIYIELVCVGKNSKGEDDNGIL-------------GRFWTNIESLF  555

Query  646  SSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGV  467
             +++        D+  D + Q ++KLL Y+ E      WA+L++   ++    G  +L V
Sbjct  556  LTKV--------DKQVDSVSQEIQKLLSYKNESG----WAVLTRGSTVLVTGHGVSVLKV  603

Query  466  MNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQ  287
            + ++EKWK++ +  GF+  FK  Y  ++ +S P       C L+ P +  K+P +  CP 
Sbjct  604  VEDFEKWKEHVKEKGFEFCFKAYYGRVVQASRPC------CRLDIPGSTGKVPESMKCPD  657

Query  286  CNHNMHKLVTFSCCHTFVDCP  224
            C  NM   +++ CCH  +D P
Sbjct  658  CQRNMETYISYKCCH--IDGP  676



>ref|XP_009124817.1| PREDICTED: uncharacterized protein LOC103849857 [Brassica rapa]
Length=745

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 123/260 (47%), Gaps = 27/260 (10%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  +E+ +L L+V  I   S I  WI+ E YIFL GG++   ++   + 
Sbjct  489  AFPFTRAREEELWRRETLTLNLIVDGI--DSVIFNWINPENYIFLYGGDDLDWIRRFTMA  546

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             +       +   + Y+G+   +  +   IR     V +E              FWTRL+
Sbjct  547  AKATAKDSNVKLEMAYVGKRNHSHREH--IRRISEAVRAENLSHSWAEPALMWFFWTRLE  604

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  DE+MQG+KK+L Y+     +G WALLSK   I+    G   
Sbjct  605  SMLYSKIQ----LGKADDHDEVMQGIKKILSYDK----LGGWALLSKGPEIVMITHGAIE  656

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIPNT  302
              V      WK +    G+ +A  D +  E++  +  P S+   + F +  +   +IP  
Sbjct  657  RTVTVYDRTWKTHVPTKGYTKAMYDHHHDEILRETGKPCSH---FDF-HITARSGRIPEK  712

Query  301  QSCPQCNHNMHKLVTFSCCH  242
             +C  C+  M K ++F+CCH
Sbjct  713  MNCFDCHRPMEKYMSFACCH  732



>ref|XP_010087772.1| hypothetical protein L484_016342 [Morus notabilis]
 gb|EXB29853.1| hypothetical protein L484_016342 [Morus notabilis]
Length=682

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/263 (25%), Positives = 124/263 (47%), Gaps = 43/263 (16%)
 Frame = -3

Query  994  FRSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELI  815
              ++ +  E ++ ++DK +W +  VV +I     I+ WI +E+YIF  GG + + +Q+  
Sbjct  453  LEAFPFDLEAQKIITDKVNW-IAPVVRNI--HPTIETWIKEEKYIFFYGGKDTELIQQFT  509

Query  814  LKIQEICSK-----IQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSM  650
             K+  + ++      ++N  +  +G++ +   D  +I               FW  ++S+
Sbjct  510  KKVTALQNEPAFKDTKINIELFLVGKTTRGGEDSSII-------------GRFWNGIESL  556

Query  649  ASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLG  470
              S+          +  D + Q ++KLL Y+ E +    WA+LSK   +I    G  +L 
Sbjct  557  FVSKSH--------KQVDPVTQDIQKLLAYKNESA----WAVLSKGSTVITAGHGSAILK  604

Query  469  VMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQSC  293
            V+ + +KWKD  +  GF+  FK+ +  +  +         YC  ++ P    K+P T  C
Sbjct  605  VVEDVDKWKDVVKEKGFEATFKEYHSRITKTVR-------YCSHIDVPVVAGKVPETLKC  657

Query  292  PQCNHNMHKLVTFSCCHTFVDCP  224
            P+C   M   +++ CCH  +D P
Sbjct  658  PECPRTMETYISYKCCH--IDGP  678



>gb|KFK37630.1| hypothetical protein AALP_AA3G008200 [Arabis alpina]
Length=740

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 123/259 (47%), Gaps = 25/259 (10%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  KE++SL L+V  I   S I  WI+ + YIFL GG++   ++   + 
Sbjct  484  AFPFTRLREEELWRKETFSLNLIVDGI--DSVIFNWINPDNYIFLYGGDDLDWIRRFTMA  541

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTV--------TSEQRIKEFWTRLQS  653
             +       +   + Y+G+   +   E   R+ ++          T    +  FWTRL+S
Sbjct  542  AKATAKDSNVKLEMAYVGKRNHSH-REQTKRISEAVRFENLSHCWTEPALMWFFWTRLES  600

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S+IQ    +G  +  DE+MQG+KK+L Y+     +G WALLSK   I+    G    
Sbjct  601  MLYSKIQ----LGKADDHDEVMQGIKKILSYDK----LGGWALLSKGPEIVMITHGAIER  652

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
             V      WK N    G+ +A  D +  E++  +  P    H    +N  S   +IP   
Sbjct  653  TVSAYDRTWKTNVATKGYTKAMYDHHHDEVLRDTGKPCG--HFDFHINARSG--RIPEKM  708

Query  298  SCPQCNHNMHKLVTFSCCH  242
            +C +C   M K ++F+CCH
Sbjct  709  NCFECQRPMEKYMSFACCH  727



>emb|CDY17992.1| BnaC03g30640D [Brassica napus]
Length=354

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 124/260 (48%), Gaps = 27/260 (10%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  +E+++L L+V  I   + I  WI+   YIFL GG++   ++   + 
Sbjct  98   AFPFTRAREEELWRRETFTLNLIVDGI--DAVIFNWINPGNYIFLYGGDDLDWIRRFTMA  155

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             +       +   + Y+G+   +  ++  IR     V +E              FW RL+
Sbjct  156  AKATAKDSDVKLEMAYVGKRNHSHREQ--IRRISEAVRAENLSHSWAEPALMWFFWARLE  213

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  DE+MQG+KK+L Y+     +G WALLSK   I+    G   
Sbjct  214  SMLYSKIQ----LGKSDDHDEVMQGIKKILSYD----KLGGWALLSKGAEIVMITHGVIE  265

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIPNT  302
              V      WK +    G+ +A  D +  E++  +  P ++   + F +  +   +IP  
Sbjct  266  RTVTVYDRTWKTHVPTKGYSKAMYDHHHDEVLRETGHPCAH---FDF-HITARSGRIPEK  321

Query  301  QSCPQCNHNMHKLVTFSCCH  242
             +C +C+  M K ++F+CCH
Sbjct  322  MNCFECHRPMEKYMSFACCH  341



>ref|XP_004288433.1| PREDICTED: uncharacterized protein LOC101296807 [Fragaria vesca 
subsp. vesca]
Length=671

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 123/261 (47%), Gaps = 39/261 (15%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            +++ +T  +E+ LS      +  +V D ++ S +  +I D +YIF  GG +N+ +Q+   
Sbjct  441  KAFPFTETIEKELSSDSHGGIHSIVVDGIHPS-VPSYIRDNKYIFFYGGKDNEWIQQFTK  499

Query  811  KIQ-----EICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMA  647
            K        I  + ++   +V +G+  K   D  ++               FWT ++S+ 
Sbjct  500  KATALANDPILKEAKIYIELVCVGKGSKGEDDHGIL-------------GRFWTGIESLF  546

Query  646  SSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGV  467
             +++         +  D I Q ++KL+ Y+ E      W LL+K   ++    G   L V
Sbjct  547  LTKVH--------KHVDPIGQEIQKLVSYKNESG----WVLLTKGSTLLVTGHGISALKV  594

Query  466  MNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQ  287
            + ++EKW+++ +  GF+  FK  Y  ++ +  P       C L+ P +  K+P +  CP 
Sbjct  595  VEDFEKWREHVKEKGFEYCFKAYYGKVIQAGRPC------CRLDIPGSTGKVPESMKCPD  648

Query  286  CNHNMHKLVTFSCCHTFVDCP  224
            C+ +M   +++ CCH  +D P
Sbjct  649  CHRSMETFISYKCCH--IDGP  667



>ref|XP_010087773.1| hypothetical protein L484_016343 [Morus notabilis]
 gb|EXB29854.1| hypothetical protein L484_016343 [Morus notabilis]
Length=686

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/262 (25%), Positives = 126/262 (48%), Gaps = 41/262 (16%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            +++ +    E+ +S + +W +  VV++I     I  WI +E+YI   GG +N+ +Q+   
Sbjct  455  KAFPFNKAAEERISKELNW-IGPVVNNI--HPSIQTWIKEEKYILFYGGKDNEWIQQFSK  511

Query  811  KIQEICS------KIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSM  650
            K   + +       +++   +  +G++ K   D  ++               FWT ++S+
Sbjct  512  KATALANDPIIKDTLKIKIELFCVGKTAKGGEDLGIL-------------GRFWTSIESL  558

Query  649  ASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLG  470
              +++         + +D + Q ++KLL Y+ E      WA+LSK + +I    G  +L 
Sbjct  559  FFTKVH-------QQKADPVTQEIQKLLSYKNESG----WAVLSKGQSVIVAGHGFTILR  607

Query  469  VMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCP  290
            V+ E++KWK+  +  GF+  F + +  ++ S      +H  C L+ PS   K+P T  CP
Sbjct  608  VVEEFDKWKEFVKDKGFEVVFMEHHSKVIQS-----VRH-CCRLDIPSVTGKVPETMQCP  661

Query  289  QCNHNMHKLVTFSCCHTFVDCP  224
            +C   M   + + CCH  +D P
Sbjct  662  ECPRTMETFIAYKCCH--IDAP  681



>emb|CDY28669.1| BnaCnng05550D [Brassica napus]
Length=745

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 126/262 (48%), Gaps = 31/262 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  +E+ +L L+V  I   S I  WI+ E YIFL GG++   ++   + 
Sbjct  489  AFPFTRAREEELWRRETLTLNLIVDGI--DSVIFNWINPENYIFLYGGDDLDWIRRFTMA  546

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             +       +   + Y+G+   +  +   IR     V +E              FW RL+
Sbjct  547  AKATAKDSNVKLEMAYVGKRNHSHREH--IRRISEAVRAENLSHSWAEPALMWFFWARLE  604

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMG--D  482
            SM  S+IQ    +G  +  DE+MQG+KK+L Y+     +G WALLSK   I+    G  +
Sbjct  605  SMLYSKIQ----LGKADDHDEVMQGIKKILSYDK----LGGWALLSKGPEIVMITHGAIE  656

Query  481  KMLGVMNEYEKWKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIP  308
            + L V +    WK +    G+ +A  D +  E++  +  P S+   + F +  +   +IP
Sbjct  657  RTLTVYDR--TWKTHVPTKGYTKAMYDHHHDEILRETGKPCSH---FDF-HITARSGRIP  710

Query  307  NTQSCPQCNHNMHKLVTFSCCH  242
               +C  C+  M K ++F+CCH
Sbjct  711  EKMNCFDCHRPMEKYMSFACCH  732



>ref|XP_007225119.1| hypothetical protein PRUPE_ppa002624mg [Prunus persica]
 gb|EMJ26318.1| hypothetical protein PRUPE_ppa002624mg [Prunus persica]
Length=651

 Score =   101 bits (252),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 127/263 (48%), Gaps = 43/263 (16%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSD--KESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQEL  818
            +++ +T   E+ LS   ++ W +  VV DI     +  WI +E+YIF  GG +N  +Q+ 
Sbjct  421  KAFPFTKATEEELSHSHRDRW-VGNVVHDI--HPSLPNWIKEEKYIFFYGGKDNDWIQQF  477

Query  817  ILKIQEICS-----KIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQS  653
              K   + +     + +++  +  +G+  K   D  ++               FW+ ++S
Sbjct  478  TKKASALANDPVFKEAKIHIELFCVGKGSKGEDDHGIL-------------GHFWSGIES  524

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            +  ++          +  D + Q ++KLL Y+ E      WA+LSK   ++    G  +L
Sbjct  525  LFFTKGH--------KQVDPVTQEIQKLLSYKNESG----WAVLSKGSSVLLTGHGVSIL  572

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSC  293
             V+ +++KWKD+ +  GF+  FK  +E +  ++ P       C L+ P +  K+P+T  C
Sbjct  573  RVIEDFDKWKDHVKEKGFEFCFKAYHEKVRLATRPC------CRLDIPGSTGKVPDTMKC  626

Query  292  PQCNHNMHKLVTFSCCHTFVDCP  224
            P C+ +M   +++ CCH  +D P
Sbjct  627  PDCHRSMETFISYKCCH--IDGP  647



>ref|XP_010496279.1| PREDICTED: uncharacterized protein LOC104773380 [Camelina sativa]
Length=740

 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 123/260 (47%), Gaps = 27/260 (10%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  KE++SL L++  I   S I  WI+ + YIFL GG++   ++   + 
Sbjct  485  AFPFTRSREEELWRKETFSLNLIIDGI--DSVIFNWINPDNYIFLYGGDDLDWIRRFTMA  542

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             +       +   + Y+G+   +  ++   R     + SE              FWTRL+
Sbjct  543  AKATAKDSNVKLEMAYVGKRNHSHREQ--TRRISEVIRSENLSHSWAEPPLMWFFWTRLE  600

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  DE+MQG+KK+L Y+     +G WALLSK   II    G   
Sbjct  601  SMLYSKIQ----LGKADDHDEVMQGIKKILSYDK----LGGWALLSKGPEIIMIVHGAIE  652

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIPNT  302
              V      WK +    G+ +A  D +  E++  +  P  +   + F +  +   +IP  
Sbjct  653  RTVTVYDRTWKTHVPTKGYTKAMYDHHHDEILRETGKPCGH---FDF-HITARSGRIPEK  708

Query  301  QSCPQCNHNMHKLVTFSCCH  242
             +C +C   M K ++F+CCH
Sbjct  709  MNCFECQRPMEKYMSFACCH  728



>ref|XP_008224076.1| PREDICTED: uncharacterized protein LOC103323832 [Prunus mume]
Length=685

 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 126/263 (48%), Gaps = 43/263 (16%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDK--ESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQEL  818
            +++ +T   E+ LS    + W +  VV DI     +  WI +E+YIF  GG +N  +Q+ 
Sbjct  455  KAFPFTKATEEELSHSHGDRW-VGNVVQDI--HPSLPNWIKEEKYIFFYGGKDNDWIQQF  511

Query  817  ILKIQEICS-----KIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQS  653
              K   + +     + +++  +  +G+  K   D  ++               FW+ ++S
Sbjct  512  TKKASALANDPVFKEAKIHIELFCVGKGSKGEDDHGIL-------------GHFWSGIES  558

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            +  ++          +  D + Q ++KLL Y+ E      WA+LSK   ++    G  +L
Sbjct  559  LFFTKGH--------KQVDPVTQEIQKLLSYKNESG----WAVLSKGSSVLLTGHGVSIL  606

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSC  293
             V+ +++KWKD+ +  GF+  FK  +E +  ++ P       C L+ P +  K+P+T  C
Sbjct  607  RVIEDFDKWKDHVKEKGFEFCFKAYHEKVRLATRPC------CRLDIPGSTGKVPDTMKC  660

Query  292  PQCNHNMHKLVTFSCCHTFVDCP  224
            P C+ +M   +++ CCH  +D P
Sbjct  661  PDCHRSMETFISYKCCH--IDGP  681



>ref|XP_004288434.1| PREDICTED: uncharacterized protein LOC101297774 [Fragaria vesca 
subsp. vesca]
Length=671

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 123/258 (48%), Gaps = 33/258 (13%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            +++ +T  +E+ LS      +  +V D ++ S +  +I D +YIF  GG +N+ +Q+   
Sbjct  441  KAFPFTETIEKELSSDSHGGIHSIVVDGIHPS-VPSYIRDNKYIFFYGGKDNEWIQQFTK  499

Query  811  KIQEICSKIQMNWRIVYIGRS--GKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMASSR  638
            K   + +   +    +YI     GK    ED     D  +     +  FWT ++S+  ++
Sbjct  500  KATALANDPILKEAKIYIELVCVGKGSEGED-----DHGI-----LGRFWTGIESLFLTK  549

Query  637  IQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMNE  458
            +         +  D I Q ++KL+ Y+ E      W LL+K   ++    G   L V+ +
Sbjct  550  VH--------KHVDPIGQEIQKLVSYKNESG----WVLLTKGSTLLVTGHGISALKVVED  597

Query  457  YEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQCNH  278
            +EKW+++ +  GF+  FK  Y  ++ +  P       C L+ P +  K+P +  CP C+ 
Sbjct  598  FEKWREHVKEKGFEFCFKAYYGKVIQAGRPC------CRLDIPGSTGKVPESMKCPDCHR  651

Query  277  NMHKLVTFSCCHTFVDCP  224
            +M   +++ CCH  +D P
Sbjct  652  SMETFISYKCCH--IDGP  667



>ref|NP_001280876.1| uncharacterized LOC103453287 [Malus domestica]
 gb|ADN32816.1| sieve element occlusion b [Malus domestica]
Length=682

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 111/224 (50%), Gaps = 38/224 (17%)
 Frame = -3

Query  880  IDDEEYIFLCGGNNNKQVQELILKIQEICS-----KIQMNWRIVYIGRSGKTFFDEDVIR  716
            I +++YIF  GG +N  +QE   K   + +     + +++  +  +G+  K   D  ++ 
Sbjct  488  IKEDKYIFFYGGKDNGWIQEFTKKATALANDPIFKEAKIHIELFCVGKGSKGEDDHGIL-  546

Query  715  MCDSTVTSEQRIKEFWTRLQSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVG  536
                         +FWT ++S+  +++           +D++ Q V+KLL Y+ E     
Sbjct  547  ------------GKFWTGIESLFFTKVH--------RPADQVGQEVQKLLSYKNESG---  583

Query  535  VWALLSKEKGIIACDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQ  356
             WA+LSK   ++    G  +L V+ +++KWKD+ +  GF+  FK  +E + + S P    
Sbjct  584  -WAVLSKGHSVVLTGHGVSILRVVEDFDKWKDHVKERGFEFCFKSYHERVRTVSRPC---  639

Query  355  HPYCFLNYPSNLEKIPNTQSCPQCNHNMHKLVTFSCCHTFVDCP  224
               C L+ P +  K+P+T  CP C+ +M   +++ CCH  +D P
Sbjct  640  ---CRLDIPGSTGKVPDTMKCPDCHRSMETFISYKCCH--IDGP  678



>ref|XP_009346429.1| PREDICTED: uncharacterized protein LOC103938158 [Pyrus x bretschneideri]
Length=682

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 108/219 (49%), Gaps = 36/219 (16%)
 Frame = -3

Query  880  IDDEEYIFLCGGNNNKQVQELILKIQ-----EICSKIQMNWRIVYIGRSGKTFFDEDVIR  716
            I +++YIF  GG +N  +QE   K        I  + +++  +  +G+  K   D  ++ 
Sbjct  488  IKEDKYIFFYGGKDNGWIQEFTKKATAFANDPIFKEAKIHIELFCVGKGSKGEDDHGIL-  546

Query  715  MCDSTVTSEQRIKEFWTRLQSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVG  536
                         +FWT ++S+  ++I         + +D++ Q ++KLL Y+ E     
Sbjct  547  ------------GKFWTGIESLFFTKIH--------KPADQVGQEIQKLLSYKNESG---  583

Query  535  VWALLSKEKGIIACDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQ  356
             WA+LSK   ++    G  +L V+ +++KWKD+ +  GF+  FK   E + +++ P    
Sbjct  584  -WAVLSKGHSVVLTGHGVSILRVVEDFDKWKDHVKERGFEFCFKSYLERVRAANRPC---  639

Query  355  HPYCFLNYPSNLEKIPNTQSCPQCNHNMHKLVTFSCCHT  239
               C L+ P +  K+P+T  CP C+  M   +++ CCHT
Sbjct  640  ---CRLDIPGSTGKVPDTMKCPDCHRGMETFISYKCCHT  675



>emb|CBI34821.3| unnamed protein product [Vitis vinifera]
Length=1487

 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/216 (30%), Positives = 109/216 (50%), Gaps = 23/216 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +ESW L+L+V  I     I  WI + ++I+L GG + + +++    
Sbjct  543  AFPFTSLREEALWREESWKLELLVDGI--DPTILNWIKEGKFIYLYGGTDMEWIRKFTTT  600

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + S  ++   +VY+G+S K     + +R C + +T E+          +  FWTRL+
Sbjct  601  ARAVASAARIPLEMVYVGQSKK----REQVRKCTTAITVEKLSYCWQDLTMVWFFWTRLE  656

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G     D +++ +KKL+ Y+ EG     WA+LS    +        +
Sbjct  657  SMMFSKIQ----LGSTVDVDPMLREIKKLISYDKEGG----WAVLSNGSFVFVNGHSSTV  708

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSP  368
            L    EY  WKD+    GFD A+ D +  + S S P
Sbjct  709  LLTFTEYNAWKDDVPPKGFDIAYMDFHSKLHSDSRP  744


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 85/156 (54%), Gaps = 19/156 (12%)
 Frame = -3

Query  988   SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
             ++ +TS  E+ L  +E+W L+L+V        I  WI + ++I+L GG + + +++    
Sbjct  1311  AFPFTSLREEALWKEETWKLELLVDGT--DPTILNWIKEGKFIYLYGGTDMEWIRKFTTT  1368

Query  808   IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
              + + S  ++   +VY+G+S K     + +R C +++T+E+          +  FWTRL+
Sbjct  1369  AKAVASAARIPLEMVYVGKSTK----REQVRRCIASITAEKLSHCWQDLTMVWFFWTRLE  1424

Query  655   SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEG  548
             SM  S+IQ    +G  +  D +M  +KKLL Y+ EG
Sbjct  1425  SMLFSKIQ----LGQADDQDPMMHEIKKLLSYDKEG  1456



>ref|XP_008224078.1| PREDICTED: uncharacterized protein LOC103323835 [Prunus mume]
Length=681

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/256 (25%), Positives = 122/256 (48%), Gaps = 39/256 (15%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQEL--  818
            +++ +   +E  +++   W +  +V+DI     I  WI +E++IF  GG +N  +Q+   
Sbjct  452  KAFPFHKGIEDKITNDREW-ITPIVNDI--HPSIQTWIKEEKFIFFYGGKDNDWIQQFTK  508

Query  817  ---ILKIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMA  647
               I+    +   +++N  +  +G+S K   D  V+               FW  ++S+ 
Sbjct  509  KATIIANDPLIKDLKINIELFCVGKSPKGGEDLGVL-------------GRFWNGIESLF  555

Query  646  SSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGV  467
             + +        ++ +D + + ++KLL Y+ E      WA+LSK   ++    G  +L V
Sbjct  556  FTNV--------NKQTDTVTKEIQKLLSYKNESG----WAVLSKGSTVVVSGHGFTILKV  603

Query  466  MNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQ  287
            +++++ WK   +  GF+ AFK  YE ++ +    S       L+ P+   K+P T  CP+
Sbjct  604  LDDFDTWKTFIKEKGFELAFKAHYEKVIQTMKHCSR------LDIPTVAGKVPETMKCPE  657

Query  286  CNHNMHKLVTFSCCHT  239
            C   M   V++ CCHT
Sbjct  658  CPRTMETYVSYKCCHT  673



>ref|XP_007226977.1| hypothetical protein PRUPE_ppa002363mg [Prunus persica]
 gb|EMJ28176.1| hypothetical protein PRUPE_ppa002363mg [Prunus persica]
Length=681

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 122/256 (48%), Gaps = 39/256 (15%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            +++ +   +E  +++   W +  +V+DI     I  WI +E++IF  GG +N  +Q+   
Sbjct  452  KAFPFHKGIEDKITNDREW-ITPIVNDI--HPSIQTWIKEEKFIFFYGGKDNDWIQQFTK  508

Query  811  KIQEICSK-----IQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMA  647
            K   I +      +++N  +  +G+S K   D  V+               FW  ++S+ 
Sbjct  509  KATIIANDPSIKDLKINIELFCVGKSPKGGEDLGVL-------------GRFWNGIESLF  555

Query  646  SSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGV  467
             + +        ++ +D + + ++KLL Y+ E      WA+LSK   ++    G  +L V
Sbjct  556  FTNV--------NKQTDTVTKEIQKLLSYKNESG----WAVLSKGSTVVVSGHGFTILKV  603

Query  466  MNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQ  287
            +++++ WK   +  GF+ AFK  YE ++ +    S       L+ P+   K+P T  CP+
Sbjct  604  LDDFDTWKTFIKEKGFELAFKAHYEKVIQTMKHCSR------LDIPTVAGKVPETMKCPE  657

Query  286  CNHNMHKLVTFSCCHT  239
            C   M   V++ CCHT
Sbjct  658  CPRTMETYVSYKCCHT  673



>emb|CDX77080.1| BnaC04g38750D [Brassica napus]
Length=739

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 124/260 (48%), Gaps = 27/260 (10%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  +E+++L L+V  I   + I  WI+   YIFL GG++   ++   + 
Sbjct  483  AFPFTRAREEELWRRETFTLNLIVDGI--DAIIFNWINPGNYIFLYGGDDLDWIRRFTMA  540

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             +       +   + Y+G+   +  ++  IR     V +E              FW RL+
Sbjct  541  AKATAKDSNVKLEMAYVGKRNHSHREQ--IRRISEAVRAENLSHSWAEPALMWFFWARLE  598

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  DE+MQG+KK+L Y+     +G WALLSK   I+    G   
Sbjct  599  SMLYSKIQ----LGKSDDHDEVMQGIKKILSYDK----LGGWALLSKGAEIVMITHGVIE  650

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIPNT  302
              V      WK +    G+ +A  D +  E++  +  P ++   + F +  +   +IP  
Sbjct  651  RTVTVYDRTWKTHVPTKGYSKAMYDHHHDEVLRETGHPCAH---FDF-HITARSGRIPEK  706

Query  301  QSCPQCNHNMHKLVTFSCCH  242
             +C +C+  M K ++F+CCH
Sbjct  707  MNCFECHRPMEKYMSFACCH  726



>emb|CDY37506.1| BnaA05g33710D [Brassica napus]
Length=739

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 124/260 (48%), Gaps = 27/260 (10%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  +E+++L L+V  I   + I  WI+   YIFL GG++   ++   + 
Sbjct  483  AFPFTRAREEELWRRETFTLNLIVDGI--DAIIFNWINPGNYIFLYGGDDLDWIRRFTMA  540

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             +       +   + Y+G+   +  ++  IR     V +E              FW RL+
Sbjct  541  AKATAKDSNVKLEMAYVGKRNHSHREQ--IRRISEAVRAENLSHSWAEPALMWFFWARLE  598

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  DE+MQG+KK+L Y+     +G WALLSK   I+    G   
Sbjct  599  SMLYSKIQ----LGKSDDHDEVMQGIKKILSYDK----LGGWALLSKGAEIVMITHGVIE  650

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIPNT  302
              V      WK +    G+ +A  D +  E++  +  P ++   + F +  +   +IP  
Sbjct  651  RTVTVYDRTWKTHVPTKGYSKAMYDHHHDEVLRETGHPCAH---FDF-HITARSGRIPEK  706

Query  301  QSCPQCNHNMHKLVTFSCCH  242
             +C +C+  M K ++F+CCH
Sbjct  707  MNCFECHRPMEKYMSFACCH  726



>ref|XP_009124045.1| PREDICTED: uncharacterized protein LOC103848961 isoform X2 [Brassica 
rapa]
Length=739

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 124/260 (48%), Gaps = 27/260 (10%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  +E+++L L+V  I   + I  WI+   YIFL GG++   ++   + 
Sbjct  483  AFPFTRAREEELWRRETFTLNLIVDGI--DAIIFNWINPGNYIFLYGGDDLDWIRRFTMA  540

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             +       +   + Y+G+   +  ++  IR     V +E              FW RL+
Sbjct  541  AKATAKDSNVKLEMAYVGKRNHSHREQ--IRRISEAVRAENLSHSWAEPALMWFFWARLE  598

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  DE+MQG+KK+L Y+     +G WALLSK   I+    G   
Sbjct  599  SMLYSKIQ----LGKSDDHDEVMQGIKKILSYDK----LGGWALLSKGAEIVMITHGVIE  650

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIPNT  302
              V      WK +    G+ +A  D +  E++  +  P ++   + F +  +   +IP  
Sbjct  651  RTVTVYDRTWKTHVPTKGYSKAMYDHHHDEVLRETGHPCAH---FDF-HITARSGRIPEK  706

Query  301  QSCPQCNHNMHKLVTFSCCH  242
             +C +C+  M K ++F+CCH
Sbjct  707  MNCFECHRPMEKYMSFACCH  726



>ref|XP_009124044.1| PREDICTED: uncharacterized protein LOC103848961 isoform X1 [Brassica 
rapa]
Length=741

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 124/260 (48%), Gaps = 27/260 (10%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  +E+++L L+V  I   + I  WI+   YIFL GG++   ++   + 
Sbjct  485  AFPFTRAREEELWRRETFTLNLIVDGI--DAIIFNWINPGNYIFLYGGDDLDWIRRFTMA  542

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             +       +   + Y+G+   +  ++  IR     V +E              FW RL+
Sbjct  543  AKATAKDSNVKLEMAYVGKRNHSHREQ--IRRISEAVRAENLSHSWAEPALMWFFWARLE  600

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  DE+MQG+KK+L Y+     +G WALLSK   I+    G   
Sbjct  601  SMLYSKIQ----LGKSDDHDEVMQGIKKILSYDK----LGGWALLSKGAEIVMITHGVIE  652

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCY--EMMLSSSSPTSYQHPYCFLNYPSNLEKIPNT  302
              V      WK +    G+ +A  D +  E++  +  P ++   + F +  +   +IP  
Sbjct  653  RTVTVYDRTWKTHVPTKGYSKAMYDHHHDEVLRETGHPCAH---FDF-HITARSGRIPEK  708

Query  301  QSCPQCNHNMHKLVTFSCCH  242
             +C +C+  M K ++F+CCH
Sbjct  709  MNCFECHRPMEKYMSFACCH  728



>ref|XP_002271883.2| PREDICTED: putative disease resistance protein At1g50180 [Vitis 
vinifera]
Length=1344

 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 66/214 (31%), Positives = 111/214 (52%), Gaps = 21/214 (10%)
 Frame = -3

Query  985   YNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILKI  806
             Y +TS  E+ L   E+W L+L+V D+     I  WI   ++I L GG + K +Q      
Sbjct  1131  YPFTSSKEKALWGAETWGLELLVHDV--HPTIQNWIKKGKFICLYGGTDMKWIQTFTTVA  1188

Query  805   QEICSKIQMNWRIVYIGRS--GKTFFDEDVIRMCDSTVT--------SEQRIKEFWTRLQ  656
             +E+ S  ++   +VY+G+S  GK+   E V++ C + ++        S++ +  FW+RL+
Sbjct  1189  KEVASAERIPLEMVYVGKSNVGKSNHRERVLQ-CIAFISMKELSHWWSDRTMVWFWSRLE  1247

Query  655   SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
             SM  S+IQ    +G ++  D +++ +KKLL Y+ EG     WA+LSK    I       +
Sbjct  1248  SMLFSKIQ----LGREDEKDPMLEEIKKLLSYDKEGG----WAMLSKGSSPIFSGSSATV  1299

Query  475   LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSS  374
             L     Y  WK+     GFD+A  D ++ + + S
Sbjct  1300  LPTFLAYHAWKEQVPTKGFDQAVMDYHDQLRNDS  1333



>emb|CAN64088.1| hypothetical protein VITISV_006939 [Vitis vinifera]
Length=1532

 Score = 99.0 bits (245),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 66/214 (31%), Positives = 111/214 (52%), Gaps = 21/214 (10%)
 Frame = -3

Query  985   YNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILKI  806
             Y +TS  E+ L   E+W L+L+V D+     I  WI   ++I L GG + K +Q      
Sbjct  1319  YPFTSSKEKALWGAETWGLELLVHDV--HPTIQNWIKKGKFICLYGGTDMKWIQTFTTVA  1376

Query  805   QEICSKIQMNWRIVYIGRS--GKTFFDEDVIRMCDSTVT--------SEQRIKEFWTRLQ  656
             +E+ S  ++   +VY+G+S  GK+   E V++ C + ++        S++ +  FW+RL+
Sbjct  1377  KEVASAERIPLEMVYVGKSNVGKSNHRERVLQ-CIAFISMKELSHWWSDRTMVWFWSRLE  1435

Query  655   SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
             SM  S+IQ    +G ++  D +++ +KKLL Y+ EG     WA+LSK    I       +
Sbjct  1436  SMLFSKIQ----LGREDEKDPMLEEIKKLLSYDKEGG----WAMLSKGSSPIFSGSSATV  1487

Query  475   LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSS  374
             L     Y  WK+     GFD+A  D ++ + + S
Sbjct  1488  LPTFLAYHAWKEQVPTKGFDQAVMDYHDQLRNDS  1521



>ref|XP_011012451.1| PREDICTED: uncharacterized protein LOC105116695 [Populus euphratica]
Length=715

 Score = 97.8 bits (242),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 72/258 (28%), Positives = 128/258 (50%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W ++L+   I     I  WI+  ++I L GG + + +++  + 
Sbjct  477  AFPFTSLREEALWKEETWKIELLADSI--DPLIVSWIEQGKHICLYGGEDIEWIRKFTVT  534

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR---------IKEFWTRLQ  656
             +E+ SK  +   ++Y+G+S       + +R  +S +T+E+          I  FW RL+
Sbjct  535  AKEVASKAAITLEMLYVGKSNP----REKVRKNNSIITTEKLSHVLPDLTLIWFFWVRLE  590

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q+  K  ++  +D IMQ +  +L ++  GS  G WA++S+    +A   G+ +
Sbjct  591  SMWHSKVQH--KRTVE--NDTIMQEIMTMLSFD--GSDQG-WAVISRGPTDMAKAKGETI  643

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQ  299
            L   +E+E WK+ AQ NGF  A  D    + S          +C  L  P     IP   
Sbjct  644  LKSFDEFEMWKEGAQENGFLPALIDYLHQLHSPF--------HCNRLILPGATGGIPERV  695

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K + + CC
Sbjct  696  VCAECGRPMEKFIMYRCC  713



>ref|XP_010912936.1| PREDICTED: uncharacterized protein LOC105038753 [Elaeis guineensis]
Length=707

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 125/258 (48%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +  +TS  E+ L ++E+W L+ +V +I     I  W+ +  Y+ L GG +   ++     
Sbjct  469  AVPFTSNREEALWNEETWRLEFLVDEI--DPAILAWVREGRYVCLYGGEDIDWIRRFTTA  526

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
            ++ +  + ++   +VY+GRS      ++ ++   +T+T+E+          +  FW RL+
Sbjct  527  LRRVAQEAKIPLEMVYVGRSNP----KERVKKAVATITAEKLSGYWQDPVMVWFFWVRLE  582

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q+    G    +D IMQ V  LL Y+  GS  G WAL+S+    +    G K+
Sbjct  583  SMWHSKMQH----GKTIENDPIMQEVMTLLTYD--GSDEG-WALISRGSVEMVKAQGKKL  635

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLEKIPNTQ  299
            +  + E++KWK   +  GF  A        ++++    + H +C  L  P +  KI    
Sbjct  636  IDCLTEFDKWKAAVEQEGFIPA--------MTNALLPYHTHEHCTRLILPGDTGKITEKV  687

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K + + CC
Sbjct  688  VCTECKRPMEKFILYRCC  705



>ref|XP_006388019.1| hypothetical protein POPTR_0395s002002g, partial [Populus trichocarpa]
 gb|ERP46933.1| hypothetical protein POPTR_0395s002002g, partial [Populus trichocarpa]
Length=277

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/257 (28%), Positives = 123/257 (48%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W ++L+   I     I  WID  +YI L GG + + +++    
Sbjct  39   AFPFTSLKEEALWKEETWQIELLADSI--DPLILYWIDQGKYICLYGGEDIEWIRKFTAT  96

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             +E+ SK  +   ++Y+G+        + +R  +  + +E+          I  FW RL+
Sbjct  97   AKEVASKAAITLEMLYVGKCNP----REKVRENNVIIKNEKLSHVLPDLTLIWFFWVRLE  152

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q  LK  ++  +D IMQ +  +L +  +GS  G WA++S+    +A   G+ +
Sbjct  153  SMWHSKVQ--LKRTVE--NDAIMQEIMTMLSF--DGSDQG-WAVISRGPADMAKAKGETI  205

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L    ++E W+D AQ  GF  A  D    +L+  SP         L  P     IP    
Sbjct  206  LKSFVDFETWRDGAQEKGFLPALID---NLLALHSPLHCNR----LILPGATGSIPEKVV  258

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K + + CC
Sbjct  259  CAECGRPMKKFIMYRCC  275



>gb|KDO37241.1| hypothetical protein CISIN_1g014387mg [Citrus sinensis]
Length=425

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 116/258 (45%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +++  E+ L  +E+W L+L+V  +     I  W+ +  YI L GG +   +++    
Sbjct  186  AYPFSTAREEALWREETWRLELLVDGL--DPVILNWMAEGRYICLYGGEDMDWIRKFTTA  243

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
               +     +   +VY+G+S      +D +R  + T+ SE           I  FW RL+
Sbjct  244  TNAVAKTAGIPLGMVYVGKSNP----KDRVRRNNDTIASENLSHIWQDLTSIWYFWVRLE  299

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q    +G +  +D +MQ + ++L Y+   S+ G WA+ ++    +A   G   
Sbjct  300  SMWYSKVQ----LGRNAETDHVMQEIMRMLTYD---SSEGGWAVFARGSAEMASAKGAIF  352

Query  475  LGVMNEYEK-WKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
            L  M EY   WKD  +  GF  A +D    + +        H    L  P    KIP   
Sbjct  353  LTCMQEYNTVWKDQVEPKGFMPAMRDHLGQLHTP-------HHCNRLVLPGTAGKIPERI  405

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K + + CC
Sbjct  406  ICSECGRVMEKFLMYRCC  423



>emb|CBI14908.3| unnamed protein product [Vitis vinifera]
Length=708

 Score = 94.7 bits (234),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 115/257 (45%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +T+  E++L  +E+W LKL+V DI   + I  W++  +YI + GG N+  +      
Sbjct  470  AYPFTNSKEESLWKEETWRLKLLVDDI--DATIFAWVNQGKYICMYGGVNSDWILNFNTA  527

Query  808  IQEICSKIQMNWRIVYIGRSGK--------TFFDEDVIRMCDSTVTSEQRIKEFWTRLQS  653
             +E+     +   +VY+G+S          TF D   +  C    T    I  FWTR++S
Sbjct  528  AREVAKAAGIQLEMVYVGKSNAKEQVRKTITFIDSRSLGYC---WTDPTNIWFFWTRMES  584

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S+ Q+    G    +D I  GV  +L ++  GS  G W+++      +A   GD +L
Sbjct  585  MLYSKTQH----GKTIENDSIFAGVLTMLSFD--GSDQG-WSVICHGPTEMAKAKGDMIL  637

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQS  296
                EY  W DN Q NGF  A  +  + + +          +C  L  P     IP    
Sbjct  638  KCFTEYSDWSDNVQQNGFMPALNEHLQKLHTPE--------HCNRLILPGINGDIPEKVV  689

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K   + CC
Sbjct  690  CAECGRPMEKYFMYRCC  706



>ref|XP_010663068.1| PREDICTED: uncharacterized protein LOC100243366 [Vitis vinifera]
Length=706

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 115/257 (45%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +T+  E++L  +E+W LKL+V DI   + I  W++  +YI + GG N+  +      
Sbjct  468  AYPFTNSKEESLWKEETWRLKLLVDDI--DATIFAWVNQGKYICMYGGVNSDWILNFNTA  525

Query  808  IQEICSKIQMNWRIVYIGRSGK--------TFFDEDVIRMCDSTVTSEQRIKEFWTRLQS  653
             +E+     +   +VY+G+S          TF D   +  C    T    I  FWTR++S
Sbjct  526  AREVAKAAGIQLEMVYVGKSNAKEQVRKTITFIDSRSLGYC---WTDPTNIWFFWTRMES  582

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S+ Q+    G    +D I  GV  +L ++  GS  G W+++      +A   GD +L
Sbjct  583  MLYSKTQH----GKTIENDSIFAGVLTMLSFD--GSDQG-WSVICHGPTEMAKAKGDMIL  635

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQS  296
                EY  W DN Q NGF  A  +  + + +          +C  L  P     IP    
Sbjct  636  KCFTEYSDWSDNVQQNGFMPALNEHLQKLHTPE--------HCNRLILPGINGDIPEKVV  687

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K   + CC
Sbjct  688  CAECGRPMEKYFMYRCC  704



>ref|XP_006378263.1| hypothetical protein POPTR_0010s06060g [Populus trichocarpa]
 gb|ERP56060.1| hypothetical protein POPTR_0010s06060g [Populus trichocarpa]
Length=685

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 125/257 (49%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W+++L+   I     I  WID  +YI L GG + + +++  + 
Sbjct  447  AFPFTSLKEEALWKEETWNIELLADSI--DPMILSWIDQRKYICLYGGEDMEWIRKFTVT  504

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             +++ S+  +   ++Y+G+S       + +R  +S +T+E+          I  FW RL+
Sbjct  505  AKDVASRAGITLEMLYVGKSNP----REKVRKNNSIITTEKLSHVLPDLTLIWFFWVRLE  560

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q+  K  ++  +D IMQ +  +L++  +GS  G WA++S+    +A   G+ +
Sbjct  561  SMWHSKVQH--KRTVE--NDVIMQEIITMLIF--DGSDQG-WAVISRGPADMAKAKGETI  613

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L    ++E W+D AQ  GF  A  D    + +             L  P     IP    
Sbjct  614  LKSFVDFEIWRDGAQEKGFLPALIDHLHELHTPFHGNR-------LILPGATGSIPERFV  666

Query  295  CPQCNHNMHKLVTFSCC  245
            C  C   M K + + CC
Sbjct  667  CAGCGRPMQKFIMYRCC  683



>ref|XP_007226973.1| hypothetical protein PRUPE_ppa002391mg [Prunus persica]
 gb|EMJ28172.1| hypothetical protein PRUPE_ppa002391mg [Prunus persica]
Length=678

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/262 (24%), Positives = 122/262 (47%), Gaps = 41/262 (16%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWS-LKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELI  815
            +++ +T   E+ LS+      +  VV +I     +   + D++Y+F  GG +N+ + +  
Sbjct  448  QAFPFTETTEKELSNSHGHKWVGNVVKEI--HPTLPNMMKDDKYVFFYGGKDNEWINQFT  505

Query  814  LKIQ-----EICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSM  650
             K        I  + +++  +  +G+  K   D  ++               FWT ++S+
Sbjct  506  KKATAFVNDPIFKEAKIHIELFCVGKGSKGEDDHGIL-------------GRFWTGIESL  552

Query  649  ASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLG  470
              ++I         +  D + Q ++KLL Y+ E      WA+LSK   ++    G  +L 
Sbjct  553  FHTKIH--------KEPDSVSQEIQKLLSYKNESG----WAVLSKGHSLVVTGHGVSILK  600

Query  469  VMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCP  290
            V+ +++KWKD+ +  GF+  F   +E +  ++ P       C L+ P +  K+P T  CP
Sbjct  601  VIEDFDKWKDHVKEKGFEFCFTTYHEKIRVANRPC------CRLDIPGSTGKVPETMKCP  654

Query  289  QCNHNMHKLVTFSCCHTFVDCP  224
             C+ +M   +++ CCH  +D P
Sbjct  655  DCHRSMETFISYKCCH--IDGP  674



>emb|CBI34823.3| unnamed protein product [Vitis vinifera]
Length=1392

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 111/258 (43%), Gaps = 68/258 (26%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +ESW L+L+V  I     I  WI + +YI+L GG + + +++    
Sbjct  520  AFPFTSLREEALWREESWKLELLVDGI--DPTILNWIKEGKYIYLYGGTDMEWIRKFTTT  577

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + S  ++   +VY+G S K     + +R C + +T E+          +  FW RL+
Sbjct  578  ARAVASTARIPLEMVYVGNSKK----REQVRKCTTAITLEKLSYCWPDLAMVWFFWIRLE  633

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G     D +++ +KKLL Y+ EG     WA+LSK         G  +
Sbjct  634  SMMFSKIQ----LGSTVDVDPMLREIKKLLSYDKEGG----WAVLSK---------GSFL  676

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
             G                                       P C   +PS   +IP    
Sbjct  677  HG------------------------------------ESQPCCRFEFPSEFGRIPENIK  700

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M K +TF CCH
Sbjct  701  CPECLRIMEKYITFGCCH  718


 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 88/165 (53%), Gaps = 23/165 (14%)
 Frame = -3

Query  988   SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
             ++ +TS  E+ L  +ESW L+L+V  I     I  WI + +YI+L GG + + +++    
Sbjct  1220  AFPFTSLREEALWREESWKLELLVDGI--DPTILSWIKEGKYIYLYGGTDMEWIRKFTTT  1277

Query  808   IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
              + I S  ++   +VY+G+S K     + +R C + +T+E+          +  FWTRL+
Sbjct  1278  ARAIASTARIPLEMVYVGKSTK----REQVRKCTTAITAEKLSYCWQDLAMVWFFWTRLE  1333

Query  655   SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALL  521
             SM  S+IQ    +G     D +++ +KKLL Y+ EG     WA L
Sbjct  1334  SMMFSKIQ----LGSTVDVDPMLREIKKLLSYDKEGG----WACL  1370



>ref|XP_004304991.1| PREDICTED: uncharacterized protein LOC101294285 [Fragaria vesca 
subsp. vesca]
Length=670

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/258 (25%), Positives = 120/258 (47%), Gaps = 34/258 (13%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            +++ +T   E+ LS      +  +V  I     +  +I + +YIF  GG +N+ +Q+   
Sbjct  441  KAFPFTETTEKELSSDSHGGIYSIVDGI--HPSVPSYIRENKYIFFYGGKDNEWIQQFTK  498

Query  811  KIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRI-KEFWTRLQSMASSRI  635
            K   + +   +    +YI         E V    DS    +  I   FWT ++S+  +++
Sbjct  499  KATALANDPILKEAKIYI---------ELVCVGKDSEGEDDHGILGRFWTGIESLFLTKV  549

Query  634  QYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMNEY  455
                     +  D I Q ++KL+ Y+ E      W L++K   ++    G   L V+ ++
Sbjct  550  H--------KHFDPIGQEIQKLVSYKNESG----WVLVTKGSTLLVTGHGISALKVVEDF  597

Query  454  EKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLEKIPNTQSCPQCNH  278
            EKW+++ +  GF+  FK+ YE ++    P       CF L+ P +  K+P +  CP C+ 
Sbjct  598  EKWREHVKEKGFEICFKEYYENVIQDGRP-------CFRLDIPVSTGKVPESMKCPDCHR  650

Query  277  NMHKLVTFSCCHTFVDCP  224
            +M   +++ CCH  +D P
Sbjct  651  SMETFISYKCCH--IDGP  666



>ref|XP_006439977.1| hypothetical protein CICLE_v10019128mg [Citrus clementina]
 gb|ESR53217.1| hypothetical protein CICLE_v10019128mg [Citrus clementina]
Length=691

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 116/254 (46%), Gaps = 23/254 (9%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +++E E  L   ESW L+L++ DI   + I +W+ +E YI L GG + + ++     
Sbjct  453  AFPFSAEKEAALWKAESWRLELLIDDI--DATILEWMKEERYICLYGGGDIEWIRRFTTS  510

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMC-----DSTVTSEQRIKEFWTRLQSMAS  644
             + +    Q+N  + Y+G++        + R+        T+T    +  FW RL+SM  
Sbjct  511  AKAVARAAQINLGMAYVGKNNAKERFRKISRIVIQENLSHTLTDPTEVWFFWARLESMLY  570

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S++Q+    G     D IMQ V  +L +  +GS  G WA+  +    +A   G+  +  M
Sbjct  571  SKLQH----GATVEDDHIMQEVMTILSF--DGSEQG-WAIFWRGTHEMARAKGEMAVDCM  623

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQSCPQ  287
             E+EKWKD+A   GF     +  + + +          +C  L  P     IP   +C +
Sbjct  624  MEFEKWKDDADQMGFVAGLNNYLQRVHTPR--------HCNRLILPDIHGPIPERLACAE  675

Query  286  CNHNMHKLVTFSCC  245
            C   M     + CC
Sbjct  676  CGRTMEMFFMYRCC  689



>gb|KDO69426.1| hypothetical protein CISIN_1g044391mg [Citrus sinensis]
Length=691

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 116/254 (46%), Gaps = 23/254 (9%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +++E E  L   ESW L+L++ DI   + I +W+ +E YI L GG + + ++     
Sbjct  453  AFPFSAEKEAALWKAESWRLELLIDDI--DATILEWMKEERYICLYGGGDIEWIRRFTTS  510

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMC-----DSTVTSEQRIKEFWTRLQSMAS  644
             + +    Q+N  + Y+G++        + R+        T+T    +  FW RL+SM  
Sbjct  511  AKAVARAAQINLGMAYVGKNNAKERFRKISRIVIQENLSHTLTDPTEVWFFWARLESMLY  570

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S++Q+    G     D IMQ V  +L +  +GS  G WA+  +    +A   G+  +  M
Sbjct  571  SKLQH----GATVEDDHIMQEVMTILSF--DGSEQG-WAIFWRGTHEMARAKGEMAVDCM  623

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQSCPQ  287
             E+EKWKD+A   GF     +  + + +          +C  L  P     IP   +C +
Sbjct  624  MEFEKWKDDADQMGFVAGLNNYLQRVHTPR--------HCNRLILPDIHGPIPERLACAE  675

Query  286  CNHNMHKLVTFSCC  245
            C   M     + CC
Sbjct  676  CGRTMEMFFMYRCC  689



>ref|XP_006470197.1| PREDICTED: uncharacterized protein LOC102630205 [Citrus sinensis]
Length=845

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 116/258 (45%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +++  E+ L  +E+W L+L+V  +     I  W+ +  YI L GG +   +++    
Sbjct  606  AYPFSTAREEALWREETWRLELLVDGL--DPVILNWMAEGRYICLYGGEDMDWIRKFTTA  663

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
               +     +   +VY+G+S      +D +R  + T+ SE           I  FW RL+
Sbjct  664  TNAVAKTAGIPLGMVYVGKSNP----KDRVRRNNDTIASENLSHIWQDLTSIWYFWVRLE  719

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q    +G +  +D +MQ + ++L Y+   S+ G WA+ ++    +A   G   
Sbjct  720  SMWYSKVQ----LGRNAETDHVMQEIMRMLTYD---SSEGGWAVFARGSAEMASAKGAIF  772

Query  475  LGVMNEYEK-WKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
            L  M EY   WKD  +  GF  A +D    + +        H    L  P    KIP   
Sbjct  773  LTCMQEYNTVWKDQVEPKGFMPAMRDHLGQLHTP-------HHCNRLVLPGTAGKIPERI  825

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K + + CC
Sbjct  826  ICSECGRVMEKFLMYRCC  843



>ref|XP_006378256.1| hypothetical protein POPTR_0010s06010g [Populus trichocarpa]
 gb|ERP56053.1| hypothetical protein POPTR_0010s06010g [Populus trichocarpa]
Length=706

 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/258 (27%), Positives = 126/258 (49%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W ++L+   I     I  WID  +YI L GG + + +++  + 
Sbjct  468  AFPFTSLKEEALWKEETWKIELLADSI--DPMILSWIDQGKYICLYGGEDIEWIRKFTVT  525

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             +++ S+  +   ++Y+G+S       + +R  +S +T+E+          I  FW RL+
Sbjct  526  AKDVASRAGITLEMLYVGKSNP----REKVRKNNSIITTEKLSHVLPDLTLIWFFWVRLE  581

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q+  K  ++  +D IMQ +  +L +  +GS  G WA++S+    +A   G+ +
Sbjct  582  SMWHSKVQH--KRTVE--NDAIMQEIMTMLSF--DGSDQG-WAVISRGPADMAKAKGETI  634

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQ  299
            L    ++E WK+ AQ  GF  A  D    + +          +C  L  P     IP   
Sbjct  635  LKSFADFEIWKEGAQEKGFLPALIDHLHELHTPF--------HCNRLILPGATGSIPERV  686

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K + + CC
Sbjct  687  VCAECGRPMEKFIMYRCC  704



>ref|XP_008224077.1| PREDICTED: uncharacterized protein LOC103323834 [Prunus mume]
Length=678

 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/262 (24%), Positives = 120/262 (46%), Gaps = 41/262 (16%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWS-LKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELI  815
            +++ +T   E+ LS+      +  VV +I     +   + D++Y+F  GG +N+ + +  
Sbjct  448  QAFPFTETTEKELSNSHGHKWVGNVVKEI--HPTLPNMMKDDKYVFFYGGKDNEWINQFT  505

Query  814  LKIQ-----EICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSM  650
             K        I  + +++  +  +G+  K   D  ++               FWT ++S+
Sbjct  506  KKATAFINDPIFKEAKIHIELFCVGKGSKGEDDHGIL-------------GRFWTGIESL  552

Query  649  ASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLG  470
              ++I         +  D + Q ++KLL Y+ E      WA+LSK   ++    G  +L 
Sbjct  553  FHTKIH--------KEPDSVSQEIQKLLSYKNESG----WAVLSKGHSLVVTGHGVAILK  600

Query  469  VMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCP  290
            V+ +++KWKD+ +  GF+  F   +E +   + P       C L+ P +  K+P T  CP
Sbjct  601  VIEDFDKWKDHVKEKGFEFCFTTYHEKIRVVNRPC------CRLDIPGSTGKVPETMKCP  654

Query  289  QCNHNMHKLVTFSCCHTFVDCP  224
             C+  M   +++ CCH  +D P
Sbjct  655  DCHRGMETFISYKCCH--IDGP  674



>ref|XP_006440671.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
 gb|ESR53911.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
Length=581

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/264 (27%), Positives = 123/264 (47%), Gaps = 42/264 (16%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+E E+ L  ++SW+L+L+V  I   + I +W+ +E +I L GGN+   +++    
Sbjct  342  AFPFTAETEEALWKEKSWTLELLVGGI--DATILQWMKEERFICLYGGNDAAWIRKFTNS  399

Query  808  IQEICSKIQMNWRIVYIG-RSGKTFFDE--DVIRMCDST--VTSEQRIKEFWTRLQSMAS  644
             + + SK Q+NW + Y+G ++ K   +E   +I   DS+  V     +  FW RL+ M  
Sbjct  400  AKAVASKAQINWGMAYVGKKNAKKRLEEISSIITKEDSSHIVIDGTAMWFFWARLERMLY  459

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGI-IACDMGDKMLGV  467
            S++Q+    G+    D IM+ V  LL +  +GS  G WA+  + K    A   G   +  
Sbjct  460  SKLQH----GMSVEKDNIMREVMTLLSF--DGSDQG-WAIFWRGKTQETASAKGTAAIDC  512

Query  466  MNEYEKWKDNAQINGF----------DRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLE  317
            M ++ +W+++A   GF           R  K C  ++L+  +                  
Sbjct  513  MEKFHEWQNDASQTGFIEGLNNYLHKIRTGKHCNRLILAGVNGA----------------  556

Query  316  KIPNTQSCPQCNHNMHKLVTFSCC  245
             IP    C  C H+M     + CC
Sbjct  557  -IPGRVPCADCGHDMEMFFMYRCC  579



>ref|XP_006477599.1| PREDICTED: uncharacterized protein LOC102631158 [Citrus sinensis]
Length=693

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/264 (27%), Positives = 123/264 (47%), Gaps = 42/264 (16%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+E E+ L  ++SW+L+L+V  I   + I +W+ +E +I L GGN+   +++    
Sbjct  454  AFPFTAETEEALWKEKSWTLELLVGGI--DATILQWMKEERFICLYGGNDAAWIRKFTNS  511

Query  808  IQEICSKIQMNWRIVYIG-RSGKTFFDE--DVIRMCDST--VTSEQRIKEFWTRLQSMAS  644
             + + SK Q+NW + Y+G ++ K   +E   +I   DS+  V     +  FW RL+ M  
Sbjct  512  AKAVASKAQINWGMAYVGKKNAKKRLEEISSIITKEDSSHIVIDGTAMWFFWARLERMLY  571

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGI-IACDMGDKMLGV  467
            S++Q+    G+    D IM+ V  LL +  +GS  G WA+  + K    A   G   +  
Sbjct  572  SKLQH----GMSVEKDNIMREVMTLLSF--DGSDQG-WAIFWRGKTQETASAKGTAAIDC  624

Query  466  MNEYEKWKDNAQINGF----------DRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLE  317
            M ++ +W+++A   GF           R  K C  ++L+  +                  
Sbjct  625  MEKFHEWQNDASQTGFIEGINNYLHKIRTGKHCNRLILAGVNGA----------------  668

Query  316  KIPNTQSCPQCNHNMHKLVTFSCC  245
             IP    C  C H+M     + CC
Sbjct  669  -IPGRVPCADCGHDMEMFFMYRCC  691



>ref|XP_006476926.1| PREDICTED: uncharacterized protein LOC102609296 [Citrus sinensis]
Length=693

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 119/262 (45%), Gaps = 38/262 (15%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +++E E  L   ESW L+L++ DI   S + +W+ DE +I L GG + + ++     
Sbjct  454  AFPFSAEKEAALWKAESWRLELLIDDI--DSTVLEWMKDERFICLYGGEDIEWIRRFTTS  511

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMC-----DSTVTSEQRIKEFWTRLQSMAS  644
             + +    Q+N  + Y+G++        + R+        T+T    +  FW RL+SM  
Sbjct  512  AKAVARAAQINLGMAYVGKNNAKERFRKISRIVIQENLSHTLTDPAEVWFFWARLESMLY  571

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWAL--------LSKEKGIIACDM  488
            S++Q+    G    +D IMQ V  +L +  +GS  G WA+        +++ KG +A D 
Sbjct  572  SKLQH----GATVENDHIMQEVMTILSF--DGSEQG-WAIFWRGTTHEMARAKGEMAVD-  623

Query  487  GDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKI  311
                   M E+EKWKD+A   GF     +  + + +          +C  L  P     I
Sbjct  624  ------CMMEFEKWKDDADQMGFVAGLNNYLQRVHTPR--------HCNRLILPDIHGPI  669

Query  310  PNTQSCPQCNHNMHKLVTFSCC  245
            P   +C +C   M     + CC
Sbjct  670  PERLACAECGRTMEMFFMYRCC  691



>emb|CBI34824.3| unnamed protein product [Vitis vinifera]
Length=664

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/258 (26%), Positives = 110/258 (43%), Gaps = 75/258 (29%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +ESW L+L+V  I     I  WI + ++I+L GG + + +++    
Sbjct  448  AFPFTSLREEALWREESWKLELLVDGI--DPTILNWIKEGKFIYLYGGTDLEWIRKFTTT  505

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + S  ++   +VY+G+S K     + +R C + +T E+          +  FWTRL+
Sbjct  506  ARAVASAARIPLEMVYVGQSKK----REQVRKCTTAITVEKLSYCWQDLTMVWFFWTRLE  561

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G     D +++ +KKL+ Y+ EG     WAL S  +           
Sbjct  562  SMMFSKIQ----LGSTVDVDPMLREIKKLISYDKEGG----WALHSDSR-----------  602

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
                                                     P C   +PS + +IP    
Sbjct  603  -----------------------------------------PCCRFEFPSEVGRIPENIK  621

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C   M K +TF CCH
Sbjct  622  CPECLRIMEKYITFGCCH  639



>ref|XP_006440672.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
 gb|ESR53912.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
Length=693

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/264 (27%), Positives = 123/264 (47%), Gaps = 42/264 (16%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+E E+ L  ++SW+L+L+V  I   + I +W+ +E +I L GGN+   +++    
Sbjct  454  AFPFTAETEEALWKEKSWTLELLVGGI--DATILQWMKEERFICLYGGNDAAWIRKFTNS  511

Query  808  IQEICSKIQMNWRIVYIG-RSGKTFFDE--DVIRMCDST--VTSEQRIKEFWTRLQSMAS  644
             + + SK Q+NW + Y+G ++ K   +E   +I   DS+  V     +  FW RL+ M  
Sbjct  512  AKAVASKAQINWGMAYVGKKNAKKRLEEISSIITKEDSSHIVIDGTAMWFFWARLERMLY  571

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGI-IACDMGDKMLGV  467
            S++Q+    G+    D IM+ V  LL +  +GS  G WA+  + K    A   G   +  
Sbjct  572  SKLQH----GMSVEKDNIMREVMTLLSF--DGSDQG-WAIFWRGKTQETASAKGTAAIDC  624

Query  466  MNEYEKWKDNAQINGF----------DRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLE  317
            M ++ +W+++A   GF           R  K C  ++L+  +                  
Sbjct  625  MEKFHEWQNDASQTGFIEGLNNYLHKIRTGKHCNRLILAGVNGA----------------  668

Query  316  KIPNTQSCPQCNHNMHKLVTFSCC  245
             IP    C  C H+M     + CC
Sbjct  669  -IPGRVPCADCGHDMEMFFMYRCC  691



>ref|XP_002526962.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35449.1| conserved hypothetical protein [Ricinus communis]
Length=1068

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 75/252 (30%), Positives = 123/252 (49%), Gaps = 34/252 (13%)
 Frame = -3

Query  955   LSDKESWS------LKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILKIQEIC  794
             L DK+ W       L+L+V  +   S I  WI D ++I L GG + + +++    ++++ 
Sbjct  835   LKDKDPWKDISILKLELLVEGL--DSPIIDWIKDGKFICLYGGEDMEWIRKFTNTVRKVA  892

Query  793   SKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTS------EQR--IKEFWTRLQSMASSR  638
                ++   ++Y+G+S     +E V+R  ++  T       EQR  I  FW R+QSM +SR
Sbjct  893   EFARIPLEMLYVGKSNP---NERVMRNMETIKTEKLSHCLEQRSLIWLFWYRIQSMWNSR  949

Query  637   IQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMNE  458
              Q    +G     D+IMQ +  LL ++  G     WAL+ KE   +    G   L  +  
Sbjct  950   YQ----LGKKIEDDQIMQELTSLLSFD--GIDECGWALICKETTEMVKARGSDFLNCLLN  1003

Query  457   YEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLEKIPNTQSCPQCN  281
             Y +WK NA   GF  AF+   E ++ SS+P       C+ L  P ++E    +  C QC+
Sbjct  1004  YSEWKKNALQKGFLAAFQ---EKLVGSSAPEE-----CYQLVLPESVENTLGSVDCSQCH  1055

Query  280   HNMHKLVTFSCC  245
             + M + + F CC
Sbjct  1056  YPMERFIAFRCC  1067


 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 55/204 (27%), Positives = 98/204 (48%), Gaps = 14/204 (7%)
 Frame = -3

Query  985  YNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILKI  806
            Y +T   ++ L  ++SW+L+L+V DIL    I KW+ +E+ I L GG + + ++    + 
Sbjct  449  YPFTIGAQEALWREKSWNLELLVDDIL--PSILKWMREEKCICLYGGEDMEWIKMFTTRA  506

Query  805  QEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE----FWTRLQSMASSR  638
              +     ++  +VY+G+   +   +  I    S   S    +E    FW R+ +M  SR
Sbjct  507  PYVAKAADISLEMVYVGKREPSEQVQRHITTITSGGLSHSMTREEQWRFWKRIVNMGHSR  566

Query  637  IQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMNE  458
            +Q    +G     D IMQ +  LL  +A   T GVWA    +  +I    G+++L  +  
Sbjct  567  MQ----LGKTIYEDPIMQEIISLLNLDA---TAGVWAAFGHKSDLIIKAKGNEILNSLIH  619

Query  457  YEKWKDNAQI-NGFDRAFKDCYEM  389
            + +WK + +  + F  A +D   M
Sbjct  620  FVEWKGSVETKDRFVPALQDSLIM  643



>gb|KHN29013.1| hypothetical protein glysoja_008348 [Glycine soja]
Length=696

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/253 (28%), Positives = 117/253 (46%), Gaps = 21/253 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y ++S  E+ L + E+W L L+   I     + +WI + +YI L GG++ + +++    
Sbjct  458  AYPFSSSREEALWNAETWGLVLLADSI--DPSLLEWISEGKYICLYGGDDIEWIRKFTNT  515

Query  808  IQEICSKIQMNWRIVYIGRS--GKTF--FDEDVIRMCDSTVTSEQRIK-EFWTRLQSMAS  644
               +   +Q+   ++Y+G+S  GK     +  V     S V  +  I   FW RL+SM  
Sbjct  516  AYSLARTLQLPLEMIYVGKSNPGKKVQEINNAVQTEKLSNVLPDLAISWFFWVRLESMWH  575

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S+ Q          +D IM  V ++L Y++       WA++S+  G +A   GD  L  +
Sbjct  576  SKSQ----QSKTVENDHIMHEVMRILTYDSGDPG---WAVISQGTGKMAQGKGDTFLKCL  628

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQC  284
            NE+E+WKD A+  G   A  D  + + +        H    L  P     IP+  SC +C
Sbjct  629  NEHEQWKDAAKDKGLLPAMDDYIKELQTP-------HHCNRLILPGTSGGIPDKVSCAEC  681

Query  283  NHNMHKLVTFSCC  245
               M K   + CC
Sbjct  682  GQTMEKFYMYRCC  694



>ref|NP_001240968.1| uncharacterized protein LOC100799626 [Glycine max]
 gb|ADN32787.1| sieve element occlusion e [Glycine max]
Length=703

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/253 (28%), Positives = 117/253 (46%), Gaps = 21/253 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y ++S  E+ L + E+W L L+   I     + +WI + +YI L GG++ + +++    
Sbjct  465  AYPFSSSREEALWNAETWGLVLLADSI--DPSLLEWISEGKYICLYGGDDIEWIRKFTNT  522

Query  808  IQEICSKIQMNWRIVYIGRS--GKTF--FDEDVIRMCDSTVTSEQRIK-EFWTRLQSMAS  644
               +   +Q+   ++Y+G+S  GK     +  V     S V  +  I   FW RL+SM  
Sbjct  523  AYSLARTLQLPLEMIYVGKSNPGKKVQEINNAVQTEKLSNVLPDLAISWFFWVRLESMWH  582

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S+ Q          +D IM  V ++L Y++       WA++S+  G +A   GD  L  +
Sbjct  583  SKSQ----QSKTVENDHIMHEVMRILTYDSGDPG---WAVISQGTGKMAQGKGDTFLKCL  635

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQC  284
            NE+E+WKD A+  G   A  D  + + +        H    L  P     IP+  SC +C
Sbjct  636  NEHEQWKDAAKDKGLLPAMDDYIKELQTP-------HHCNRLILPGTSGGIPDKVSCAEC  688

Query  283  NHNMHKLVTFSCC  245
               M K   + CC
Sbjct  689  GQTMEKFYMYRCC  701



>ref|XP_011034021.1| PREDICTED: uncharacterized protein LOC105132310 [Populus euphratica]
Length=706

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 120/257 (47%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W + L+  +I     I  WI+  ++I L GG + + +++    
Sbjct  468  AFPFTSLREEELWKEETWKIDLLADNI--DPAISSWIEQGKFICLYGGEDIEWIRKFTAT  525

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR---------IKEFWTRLQ  656
             + +    ++   ++Y+G+S      ++  R  +  + +E           I  FW RL+
Sbjct  526  AKAVAKDARIQLEMLYVGKSKP----KEKARKINGVIVNENLSHVLPDLTLIWFFWVRLE  581

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q+  K   D  +D IM+ +  +L ++  GS  G WA++SK    +A   GD +
Sbjct  582  SMWHSKVQH--KRTAD--NDPIMKEIMAMLSFD--GSDQG-WAVISKGSDEMAKAKGDTI  634

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L    ++E WK +A++ GF  A  D    + S S         C L  P     IP    
Sbjct  635  LKSFVDFESWKQSAEVKGFLPALNDHLHELHSPSH-------CCRLILPGATGNIPERIV  687

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K + + CC
Sbjct  688  CAECGRPMEKFIMYRCC  704



>ref|XP_007225209.1| hypothetical protein PRUPE_ppa002007mg [Prunus persica]
 gb|EMJ26408.1| hypothetical protein PRUPE_ppa002007mg [Prunus persica]
Length=730

 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 116/263 (44%), Gaps = 29/263 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +TS  E+ L D+E+W ++L+   +     +  WI D +Y+ L GG + + ++     
Sbjct  480  AYPFTSTKERLLWDEETWRIELLADHL--HPNLFTWITDRKYVCLYGGEDIEWIRNFTKS  537

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +  +  +   ++Y+GRS      E V++   S + +E           I  FW RL+
Sbjct  538  AKSVALEAGIALELLYVGRSKP---KEKVVKQILSIIQTENLSHTLEWNTTIWYFWVRLE  594

Query  655  SMASSRIQYLLKMGLDE------GSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIAC  494
            SM  S+ Q L +            +D IMQG+  +L +   GS+   WA++      +A 
Sbjct  595  SMWQSKGQLLSEQSTTHFKTDNLKNDPIMQGIISMLSF---GSSDRGWAVIGIPSADMAK  651

Query  493  DMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEK  314
              GD ML  M E+  WK  A   GF  A  +  E +   +      H    L  P+    
Sbjct  652  ANGDHMLKSMKEFTDWKIRAADAGFIPALNEHLEGVFKQAP-----HHCTNLILPAT-GI  705

Query  313  IPNTQSCPQCNHNMHKLVTFSCC  245
            +P T +C +C   M +   F CC
Sbjct  706  MPETVACAECGRLMERFSMFRCC  728



>emb|CBI34826.3| unnamed protein product [Vitis vinifera]
Length=659

 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 101/193 (52%), Gaps = 23/193 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W L+L+V  I     +  W+ + ++I+L GG + + +++    
Sbjct  448  AFPFTSLREEALWKEETWRLELLVDGI--DPTVLNWVKEGKFIYLYGGTDMEWIRKFTTT  505

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + S  ++   +VY+G+S K     + +R C +++T+E           +  FWTRL+
Sbjct  506  AKAVASAARIPLEMVYVGKSNK----REQVRKCITSITTENLSYCWQDLTMVWFFWTRLE  561

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D +++ +KKLL Y+ EG     WA+LSK   +        +
Sbjct  562  SMLFSKIQ----LGRGDDDDSMLREIKKLLSYDKEGG----WAVLSKGSFVFVNGHSSTV  613

Query  475  LGVMNEYEKWKDN  437
            L    EY  WKD+
Sbjct  614  LPTFTEYNLWKDD  626



>ref|XP_011087135.1| PREDICTED: uncharacterized protein LOC105168700 [Sesamum indicum]
Length=712

 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 121/262 (46%), Gaps = 31/262 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y ++S  E     +E W L+LVV+ I     I  WI +++ I L GG N + +QE I+ 
Sbjct  466  AYPFSSTKELAKWGEEKWRLELVVNGI--DKSIMTWISEDKVICLYGGENEEWLQEFIMT  523

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + + +  +++  +VY+G+  KT   ++ ++  +  VT+++          I  FWTR++
Sbjct  524  ARNVAAAARISLEMVYVGK--KT--SKERVKRLNEMVTTDRLSHCWNDPTSIWYFWTRME  579

Query  655  SMASSRIQYLLKMGLDE-GSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDM---  488
            SM  S+I +   +   +   D I+  V  +L Y     +   WAL SK  G  A +M   
Sbjct  580  SMMYSKIHHGSTLATAQRPGDHILAEVLTMLTY---ADSHQGWALFSKGSGSRAGEMARA  636

Query  487  -GDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKI  311
             GD ML  + ++  W D+A+  GF  A     E          +   +C       ++ +
Sbjct  637  KGDAMLHALADFGSWTDDAREKGFVPALNVYLE--------GHHTKDHCNQLILPGIDDV  688

Query  310  PNTQSCPQCNHNMHKLVTFSCC  245
            P    C +C+  M K   + CC
Sbjct  689  PEMVVCSECHRPMEKYFMYRCC  710



>ref|XP_008239602.1| PREDICTED: uncharacterized protein LOC103338194 [Prunus mume]
Length=603

 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 67/258 (26%), Positives = 119/258 (46%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T E +Q L + ESW L+LV   I     I  WI+  +YI L GG++ + +++  ++
Sbjct  364  AFPFTDEKDQVLWNAESWRLQLVADGI--DPTILDWIEKGKYICLYGGDDLEWIRKFTVR  421

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIK---------EFWTRLQ  656
             + +     ++  ++Y+GRS  T    + IR  +  + +E   +          FW+R+ 
Sbjct  422  AKVVAGLAGISLELLYVGRSTAT---RERIRKVNKVIETENLSRFWPDYTSNWFFWSRMD  478

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+ ++   +     +DEI++ V  LL Y+  G   G W ++ +     A   G   
Sbjct  479  SMRCSKAKHHKTV----KNDEILKEVMTLLSYDGSG---GGWVMVWRGSNETARANGPLT  531

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLEKIPNTQ  299
            L  ++++E WK+ A  +GF    KD    +    +P      +C  L  P     IP+  
Sbjct  532  LLTLDDFEAWKNEAAKSGFVPTLKD---ELKRRHTPD-----HCIRLIIPGFGPDIPDRV  583

Query  298  SCPQCNHNMHKLVTFSCC  245
             CP C   M K +   CC
Sbjct  584  ECPDCGREMEKFLKIRCC  601



>ref|XP_007031664.1| Uncharacterized protein TCM_017019 [Theobroma cacao]
 gb|EOY02590.1| Uncharacterized protein TCM_017019 [Theobroma cacao]
Length=705

 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 68/261 (26%), Positives = 113/261 (43%), Gaps = 37/261 (14%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E  L   E+W L+L+V  I     I  WI +  +IFL GG +   +++    
Sbjct  467  AFPFTTGRETALWRAETWRLELLVGGI--DPVILNWISEGRFIFLYGGEDMDWIRKFTNA  524

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
            ++        +  +VY+G+S      E V R   +T+T+E+          +  FW R++
Sbjct  525  VRTFARASGFSLEMVYVGKSNP---KERVSRNM-ATITAEKLSFCLPNLTAVWYFWIRME  580

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+ Q    +G ++ +D I + +  LL Y+  G     WALLS+    +    G   
Sbjct  581  SMWYSKYQ----LGKEDENDPITREIMTLLTYDGSGDG---WALLSRGSAELTRAKGSAF  633

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHP---YC-FLNYPSNLEKIP  308
            L  + EY  W  + Q  G   A  D +            QHP   +C  L  P    +IP
Sbjct  634  LTCLTEYNLWAADLQTKGLVPAVHDYF-----------LQHPAPHHCNRLELPGTTGRIP  682

Query  307  NTQSCPQCNHNMHKLVTFSCC  245
               +C  C   M + + + CC
Sbjct  683  ERVTCSDCGRMMERYILYRCC  703



>gb|KHG01411.1| hypothetical protein F383_21965 [Gossypium arboreum]
Length=741

 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 96/198 (48%), Gaps = 30/198 (15%)
 Frame = -3

Query  805  QEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE----------FWTRLQ  656
            + + S   +   +VY+G+S K    E V ++  + +  E+++            FWTRL+
Sbjct  552  RTVASAFGIPLEMVYVGKSNK---REQVKKV--AAIIKERKLSHCWEDPAMVWFFWTRLE  606

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+IQ    +G  +  D I+QG+KKLL Y  EG     WA+LS+   I+       +
Sbjct  607  SMMFSKIQ----LGRADDLDPIVQGIKKLLSYGREGG----WAVLSEGSNILVNGHSTTV  658

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + +Y KW+ N    GF+ +F + ++ +       +  HP C   + +   K P +  
Sbjct  659  LPTLVDYVKWRGNVAEKGFNLSFIEYHDQL------HNVAHPCCRFEFLAT-TKAPESIR  711

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP+C+  M K   F CCH
Sbjct  712  CPECHRVMEKHTAFVCCH  729



>ref|XP_010087771.1| hypothetical protein L484_016341 [Morus notabilis]
 gb|EXB29852.1| hypothetical protein L484_016341 [Morus notabilis]
Length=709

 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 119/253 (47%), Gaps = 28/253 (11%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            +++ +    E+++S++ +W +  +  DI     I  WI++E+YIF  GG + +  Q+   
Sbjct  478  KAFPFNKTAEESVSNQLNW-IGPIARDI--DPVIQTWIEEEKYIFFYGGKDKEWRQQFAE  534

Query  811  KIQEICS-KIQMNWRI-VYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMASSR  638
            K+  + +  +    RI V + R GKT   ED     D  V     +  FWT ++ +  ++
Sbjct  535  KVTTLANDPVFKEARISVELFRVGKTNKGEDEDDGDDHGV-----VGRFWTAIEGLFFTK  589

Query  637  IQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMNE  458
                      +  D + Q ++KLL Y+ E      W +LSK   ++    G  +L V  E
Sbjct  590  AH--------KEVDPVSQEIQKLLSYKNESG----WFVLSKGSTVVVAGHGYTILRVFEE  637

Query  457  YEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQCNH  278
            +EKWK+  +  GF+   K+ +   L +          C L+ P+ + K+P T  CP+C  
Sbjct  638  FEKWKEVVKQKGFEVTIKEYHGKALLTIRQC------CRLDIPTVVGKVPETMKCPECTR  691

Query  277  NMHKLVTFSCCHT  239
             M   V++ CCH 
Sbjct  692  VMESYVSYKCCHV  704



>ref|XP_008340127.1| PREDICTED: uncharacterized protein LOC103403084 [Malus domestica]
Length=743

 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 67/259 (26%), Positives = 123/259 (47%), Gaps = 22/259 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS+ E+ L ++E+W ++L+   I     +  WI + +YI L GG + + +++    
Sbjct  494  AFPFTSQRERLLWEEETWRIELLADAI--HPNLTTWITEGKYICLYGGEDIEWIRKFTKA  551

Query  808  IQEICSKIQMNWRIVYIGRS-GKTFFDEDVIRMCDSTVTSE----QRIKEFWTRLQSMAS  644
             + + S   +   ++Y+GRS  K     ++I++  +   S       I  FW RL+SM  
Sbjct  552  ARNVASDAGIQLEMLYVGRSKAKENVMNNIIKIIQAEKLSHTLDWNLIWFFWIRLESMWQ  611

Query  643  SRIQYLLKMGLDEG------SDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGD  482
            S+ Q L + G  +       SD +MQG+  LL +   GS+   WA++S     ++   G+
Sbjct  612  SKGQLLSEQGKTQSRTDPLKSDPMMQGIISLLSF---GSSDRGWAVISLGSAAMSKANGE  668

Query  481  KMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNT  302
             ML  ++E+  WK+ +   GF  A  +  E +   +      H    L  P+    +P T
Sbjct  669  HMLKSLSEFNDWKNRSSEVGFTPALNEHLEGVHRQAP-----HHCTSLILPAT-GIMPET  722

Query  301  QSCPQCNHNMHKLVTFSCC  245
             +C +C   M +   F CC
Sbjct  723  VACAECGRVMERFSMFRCC  741



>ref|XP_007137985.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
 gb|ESW09979.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
Length=584

 Score = 89.0 bits (219),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 71/256 (28%), Positives = 120/256 (47%), Gaps = 27/256 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TSE E++L  +E WSL+L+V  I     + +W+ D + + L GG + + +++    
Sbjct  346  AFPFTSEKEESLWKQEIWSLELLVDGI--DPTVLEWMADGKLVCLYGGEDLEWIEKFTAT  403

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDS--------TVTSEQRIKEFWTRLQS  653
               +    +    +VY+G+S      + +I+  ++         VTS   I  FWTRL+S
Sbjct  404  ALSVAKAGKFQLEMVYVGKSNAKERMQKMIKTFNTRKFSYFWPNVTS---IWFFWTRLES  460

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S++Q+    G    +DE+M  V  +L ++  GS  G WA+       +A   GD  L
Sbjct  461  MLYSKLQH----GRTVENDEVMSEVMTVLSFD--GSDRG-WAIFCNGATEMARAKGDSAL  513

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSC  293
              + +++KWKD  +  G  +A KD     L  + P    H    L  P +   IP    C
Sbjct  514  VCLQDFDKWKDRVEEEGVVQAMKD----YLDKNKPP---HHCNRLILPGSTGGIPQKVVC  566

Query  292  PQCNHNMHKLVTFSCC  245
             +C   M K   + CC
Sbjct  567  AECGRQMEKYFMYRCC  582



>ref|XP_007137986.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
 gb|ESW09980.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
Length=747

 Score = 89.0 bits (219),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 71/256 (28%), Positives = 120/256 (47%), Gaps = 27/256 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TSE E++L  +E WSL+L+V  I     + +W+ D + + L GG + + +++    
Sbjct  509  AFPFTSEKEESLWKQEIWSLELLVDGI--DPTVLEWMADGKLVCLYGGEDLEWIEKFTAT  566

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDS--------TVTSEQRIKEFWTRLQS  653
               +    +    +VY+G+S      + +I+  ++         VTS   I  FWTRL+S
Sbjct  567  ALSVAKAGKFQLEMVYVGKSNAKERMQKMIKTFNTRKFSYFWPNVTS---IWFFWTRLES  623

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S++Q+    G    +DE+M  V  +L ++  GS  G WA+       +A   GD  L
Sbjct  624  MLYSKLQH----GRTVENDEVMSEVMTVLSFD--GSDRG-WAIFCNGATEMARAKGDSAL  676

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSC  293
              + +++KWKD  +  G  +A KD     L  + P    H    L  P +   IP    C
Sbjct  677  VCLQDFDKWKDRVEEEGVVQAMKD----YLDKNKPP---HHCNRLILPGSTGGIPQKVVC  729

Query  292  PQCNHNMHKLVTFSCC  245
             +C   M K   + CC
Sbjct  730  AECGRQMEKYFMYRCC  745



>ref|XP_010102927.1| hypothetical protein L484_018946 [Morus notabilis]
 gb|EXB94445.1| hypothetical protein L484_018946 [Morus notabilis]
Length=712

 Score = 88.6 bits (218),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 71/258 (28%), Positives = 124/258 (48%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ ++   E+ L D ESW+LKL+V  I   +EI +WI   +YI L GG++   ++E   +
Sbjct  473  AFPFSDGKEEALWDAESWTLKLLVDGI--DAEILQWIAQGKYICLYGGDDINWIREFTSR  530

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSE---------QRIKEFWTRLQ  656
             + +   + +   ++Y+G+S      ++ +R  +ST+ +E           I  FW+RL+
Sbjct  531  AKVVAQALGIQLEMIYVGKSN---VPKERLRKINSTIETEGLSQIWPEMTSIWFFWSRLE  587

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+ +Y    G    +D +++ +  LL Y  +GS  G W  + + +  +A   G   
Sbjct  588  SMRCSKARY----GKTIEADPVLKEIMTLLSY--DGSDQG-WVSVWRGQSEMARANGQLA  640

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLEKIPNTQ  299
            L  + E+++W+  A+  G   A+    E +    SP   QH  C  L  P   + IP   
Sbjct  641  LQTLKEFQQWETQAKQMGLIPAYD---EELKKRHSP---QH--CTRLILPGLGQDIPQKV  692

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K   F CC
Sbjct  693  VCTECGREMEKFFMFRCC  710



>ref|XP_007221903.1| hypothetical protein PRUPE_ppa015869mg [Prunus persica]
 gb|EMJ23102.1| hypothetical protein PRUPE_ppa015869mg [Prunus persica]
Length=647

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 119/261 (46%), Gaps = 44/261 (17%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNN---KQVQE  821
            +++ +T   E+ +S    W   L+    +Y +  D    ++EYIF  GG +    KQ +E
Sbjct  422  KAFPFTEATEKEISKSREWFGNLIRE--IYPTPPDS--KEDEYIFFYGGKDKDWMKQFKE  477

Query  820  LILKIQE--ICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMA  647
                +    I  + ++N ++  +G+  K   D  ++               FWT ++S+ 
Sbjct  478  KATALANDLILKEAKINIKLFCVGKDSKGEDDFGILW-------------RFWTGIESLF  524

Query  646  SSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGV  467
             ++I        ++ +D     ++KLL Y+ E      WA+LSK   ++    G  +L V
Sbjct  525  HTKI--------NKQADSATLEIQKLLSYKNESG----WAVLSKGSSLVVAGHGISILKV  572

Query  466  MNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQ  287
            + +++KWK   +  GF+  F   +  +  +        P C L+ P +  K+P T +CP 
Sbjct  573  IEDFDKWKGQVREKGFEFCFTTYHAKIRLT--------PCCRLDIPGSTGKVPETMNCPD  624

Query  286  CNHNMHKLVTFSCCHTFVDCP  224
            CN +M   +++ CCH  +D P
Sbjct  625  CNRSMETFISYKCCH--IDGP  643



>ref|XP_010674858.1| PREDICTED: uncharacterized protein LOC104890938 [Beta vulgaris 
subsp. vulgaris]
Length=690

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 113/206 (55%), Gaps = 23/206 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L ++E+W L+L+V+ I     I  WI D +YIF+ GG++ + +++  ++
Sbjct  484  AFPFTSIREENLWEQETWRLELLVNGIY--PYILSWIRDGKYIFIYGGDDIEWIRKFTME  541

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE----------FWTRL  659
             + +   +Q+   ++Y+GRS     +++V+R  +  +  E R+            FWTR+
Sbjct  542  ARTVAHALQVPIEMMYVGRS----HNKEVVRKVNEYIMCE-RLSHCFPDPAQEWYFWTRI  596

Query  658  QSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDK  479
            +SM  S+IQ  L    D G D I+Q ++++  Y+   S    WA+L+K   II       
Sbjct  597  ESMIFSKIQ--LGRVHDHG-DVILQEIQRINSYDKSHSG---WAILAKGSTIIVHGQDKL  650

Query  478  MLGVMNEYEKWKDNAQINGFDRAFKD  401
            +L  + E E WK+NA  +GF+  +++
Sbjct  651  VLSTLQELELWKENALKDGFEVGYRN  676



>ref|XP_010682345.1| PREDICTED: uncharacterized protein LOC104897214 [Beta vulgaris 
subsp. vulgaris]
Length=706

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 120/257 (47%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W L L+V  +     I +W+ + +YI L GG +   +Q+   +
Sbjct  468  AFPFTSAREEALWREETWRLDLLVDAV--EPMIFQWMQEGKYICLYGGEDMDWIQKFTAE  525

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSE---------QRIKEFWTRLQ  656
            +       ++   ++Y+G+S      ++ IR  ++ +  +           +  FW RL+
Sbjct  526  LHATAQAARIPLEMLYVGKSNL----KEKIRKINNAIVDQGWSHVLPDVTLVWYFWVRLE  581

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q+  +M ++  +D IMQ +  ++ ++A       WAL+S+    +    GD +
Sbjct  582  SMWHSKMQH--RMTVE--NDRIMQEIVTMMSFDASDQG---WALISRGSTEMTKAKGDTL  634

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  +  + +WK++  + GF +A  D  + + +        H    L  P     IP    
Sbjct  635  LTCLMNFSEWKEDVPLKGFVQAITDYLQKLQTP-------HHCNRLILPGTTGSIPEKVV  687

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K + + CC
Sbjct  688  CAECGRTMDKFIMYRCC  704



>ref|XP_010248720.1| PREDICTED: uncharacterized protein LOC104591548 [Nelumbo nucifera]
Length=700

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 118/253 (47%), Gaps = 19/253 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E++L  +++W L  +V  I    +I  WI +E YI L GG+N + ++  +  
Sbjct  460  AFPFTSNKEESLWKEQTWKLDFLVDGI--DQQILNWIVEERYICLYGGDNLEWMEAFVNA  517

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDST-----VTSEQRIKEFWTRLQSMAS  644
            ++ +  +  ++   +Y+G+S        +  +  S      ++    I  FW RLQ M  
Sbjct  518  LRAVALEDNISIEFMYVGKSKPKEPQAKINGVIMSKKLGHFLSERALIWFFWDRLQRMYY  577

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S+++   K   +   D IMQ V  +L +++       WA++S+    +A   GD++L  +
Sbjct  578  SKMKQPRKNAGEH--DHIMQEVMTMLSFDSSDQE---WAVISRGSFEMARAKGDQILKSI  632

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQC  284
              +E+WK+     GF  A  D     L    P   +H    L  P  +  IP T  C +C
Sbjct  633  RMHEEWKEQVGSKGFIPALND----HLHGHPP---EHHCNRLILPGTVANIPETVPCSEC  685

Query  283  NHNMHKLVTFSCC  245
            N  M K V + CC
Sbjct  686  NRPMEKYVLYRCC  698



>ref|XP_008224125.1| PREDICTED: uncharacterized protein LOC103323883 [Prunus mume]
Length=882

 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/261 (25%), Positives = 117/261 (45%), Gaps = 44/261 (17%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNN---KQVQE  821
            +++ +T   E+ +S    W   L+    +Y +  D    ++EYIF  GG +    KQ +E
Sbjct  657  KAFPFTEAREKEISKSLQWFGNLIRE--IYPTLPDS--KEDEYIFFYGGKDKDWIKQFKE  712

Query  820  LILKIQE--ICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMA  647
                +    I  + ++N ++  +G+  K   D  ++               FWT ++S+ 
Sbjct  713  KATALANDLILKEAKINIKLFCVGKDSKGEDDFGILW-------------RFWTGIESLF  759

Query  646  SSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGV  467
             ++I         + +D     ++KLL Y+ E      WA+LSK   ++    G  +L V
Sbjct  760  HTKIH--------KQADSATLDIQKLLSYKNESG----WAVLSKGSSLVVAGHGISILKV  807

Query  466  MNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQ  287
              +++KWK   +  GF+  F   Y  +  +        P C L+ P +  K+P+T  CP 
Sbjct  808  TEDFDKWKGQVREKGFEFCFTTYYAKIGFT--------PCCRLDIPGSTGKVPDTMKCPD  859

Query  286  CNHNMHKLVTFSCCHTFVDCP  224
            CN +M   +++ CCH  +D P
Sbjct  860  CNRSMETFISYKCCH--IDAP  878



>ref|XP_008224124.1| PREDICTED: uncharacterized protein LOC103323881 [Prunus mume]
Length=666

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/261 (25%), Positives = 117/261 (45%), Gaps = 44/261 (17%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNN---KQVQE  821
            +++ +T   E+ +S    W   L+    +Y +  D    ++EYIF  GG +    KQ +E
Sbjct  441  KAFPFTEAREKEISKSLQWFGNLIRE--IYPTLPDS--KEDEYIFFYGGKDKDWIKQFKE  496

Query  820  LILKIQE--ICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMA  647
                +    I  + ++N ++  +G+  K   D  ++               FWT ++S+ 
Sbjct  497  KATALANDLILKEAKINIKLFCVGKDSKGEDDFGILW-------------RFWTGIESLF  543

Query  646  SSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGV  467
             ++I         + +D     ++KLL Y+ E      WA+LSK   ++    G  +L V
Sbjct  544  HTKIH--------KQADSATLDIQKLLSYKNESG----WAVLSKGSSLVVAGHGISILKV  591

Query  466  MNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQ  287
              +++KWK   +  GF+  F   Y  +  +        P C L+ P +  K+P+T  CP 
Sbjct  592  TEDFDKWKGQVREKGFEFCFTTYYAKIGFT--------PCCRLDIPGSTGKVPDTMKCPD  643

Query  286  CNHNMHKLVTFSCCHTFVDCP  224
            CN +M   +++ CCH  +D P
Sbjct  644  CNRSMETFISYKCCH--IDAP  662



>ref|XP_006379953.1| hypothetical protein POPTR_0008s18360g [Populus trichocarpa]
 gb|ERP57750.1| hypothetical protein POPTR_0008s18360g [Populus trichocarpa]
Length=706

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 118/258 (46%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W + L+  +I     +  WI   ++I L GG + + +++    
Sbjct  468  AFPFTSLREEGLWKEETWKIDLLADNI--DPALSSWIQQGKFICLYGGEDIEWIRKFTAT  525

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR---------IKEFWTRLQ  656
             + +    ++   ++Y+G+S      ++  R  +  + +E           I  FW RL+
Sbjct  526  AKAVAKDARIQLEMLYVGKSNP----KEKARKINGVIVNENLSHVLPDLTLIWFFWVRLE  581

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q+         +D IMQ +  +L ++  GS  G WA++SK    +A   GD +
Sbjct  582  SMWHSKVQH----QRTADNDPIMQEIMTMLSFD--GSDQG-WAVISKGSDEMAKAKGDTI  634

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQ  299
            L    ++E WK +A++ GF  A  D    + S S        +C  L  P     IP   
Sbjct  635  LKSFVDFESWKQSAEVKGFLPALNDHLHELHSPS--------HCNRLILPGATGSIPERI  686

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K + + CC
Sbjct  687  VCAECGRPMEKFIMYRCC  704



>ref|XP_006378262.1| hypothetical protein POPTR_0010s060501g, partial [Populus trichocarpa]
 gb|ERP56059.1| hypothetical protein POPTR_0010s060501g, partial [Populus trichocarpa]
Length=357

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 112/205 (55%), Gaps = 22/205 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W ++L+   I     I  WID  +YI L GG + + +++  + 
Sbjct  131  AFPFTSLREEALWKEETWKIELLADSI--DPMIVSWIDQRKYICLYGGEDMEWIRKFTVT  188

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             +++ S+  +   ++Y+G+S       + +R  +S +T+E+          I  FW RL+
Sbjct  189  AKDVASRAGITLEMLYVGKSNP----REKVRKNNSIITTEKLSHVLPDLTLIWFFWVRLE  244

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q+  K  ++  +D IMQ +  +L++  +GS  G WA++S+    +A   G+ +
Sbjct  245  SMWHSKVQH--KRTVE--NDVIMQEIITMLIF--DGSDQG-WAVISRGSADMAKAKGETI  297

Query  475  LGVMNEYEKWKDNAQINGFDRAFKD  401
            L    ++E+WKD A+ NGF  A  D
Sbjct  298  LKSFVDFERWKDGAKENGFLPALID  322



>ref|XP_004236294.1| PREDICTED: uncharacterized protein LOC101251765 [Solanum lycopersicum]
Length=723

 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 69/258 (27%), Positives = 121/258 (47%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +T   E++L   ESW L+LVV  I     +  W+   ++I L GG +   ++     
Sbjct  485  AYPFTISKEESLWSMESWRLELVVDGI--DPNLMDWMASGKFICLYGGEDMDWIRSFTKS  542

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             Q +  +  +  +++Y+G+S     +++ +R  +ST+T E+          +  FWTR++
Sbjct  543  AQSVAKRAGIELQMLYVGKSN----NKERVRKINSTITDEKLSNCLTDLTSVWYFWTRIE  598

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q    +G     D+IMQ V  +L +  +GS  G WAL+S+    +A      +
Sbjct  599  SMFYSKMQ----LGKTIQEDKIMQEVLTMLSF--DGSDQG-WALISRGSFEMARAKSQII  651

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQ  299
               + +Y  W+D+A+  GF  A     E  L   +P      +C  L  P     IP+  
Sbjct  652  TKTLEDYTTWEDSAKTKGFVPAL---IEYFLQLHTPE-----HCNRLILPGLDGDIPDVI  703

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M +   + CC
Sbjct  704  VCAECGRPMERFFMYRCC  721



>ref|XP_002526965.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35452.1| conserved hypothetical protein [Ricinus communis]
Length=809

 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/257 (26%), Positives = 122/257 (47%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E+ L  +ESW L+L+V+ I     I  WI++  YI L GG + + +++    
Sbjct  571  AFPFTTIREEALWKEESWRLELLVAGI--DPIITNWIEEGRYICLYGGEDMEWIRKFTST  628

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +     +   +VY+G+S      ++ +R   ST+  E+          I  FW R++
Sbjct  629  ARAVAQAAGIPLGMVYVGKSNP----KERVRRNVSTIMVEKLSHYWQDLTSIWYFWVRIE  684

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+ Q    +G    +D +M+ +  +L ++   S+ G WA+ +K    +    G   
Sbjct  685  SMWRSKNQ----LGKTSENDSLMKEIMAMLSFD---SSEGGWAIFTKGTEELVKAKGSIS  737

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  +++Y  WKD  Q  GF  + KD  + + +       +H    L  PS+   IP    
Sbjct  738  LTCLSDYTIWKDQIQQKGFLPSLKDYLKSLHT-------EHHCNRLILPSSAGMIPEKIV  790

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C+ NM + + + CC
Sbjct  791  CTECSRNMERYILYKCC  807



>ref|XP_011097560.1| PREDICTED: uncharacterized protein LOC105176450 [Sesamum indicum]
Length=704

 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 122/259 (47%), Gaps = 24/259 (9%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            R++ ++   E+ L       L+L V+   +  EI+ W+ + +Y+ L GG++ + ++  + 
Sbjct  458  RAFPFSQATEEALWKDGVSGLELFVNG--FHHEIENWVKEGKYVILYGGDDVEWIRNFVS  515

Query  811  KIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSE--------QRIKEFWTRLQ  656
              +++     +   ++Y GRS +   ++D+  + +S V  +          I  FW R++
Sbjct  516  STRQVKEAGHIPLEMLYAGRSNQK--EQDMNNLINSIVNEKLGEILGDVNTISLFWNRIE  573

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
             M  SRI+ L    + E  D ++Q + KLL Y+     +G WA L K   ++    G+ M
Sbjct  574  HMKRSRIR-LGSGKVGEDQDPLLQDITKLLSYD---QIMGRWASLFKGNELVLTGYGNIM  629

Query  475  LGVMNE-YEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
            L  M    E  K+NA    FD  FK+C++      S      P   L  PS+ E+  +  
Sbjct  630  LPTMTRCIEALKENAN-KEFDVTFKECFD------SSQIVDTPPIRLILPSSYERNISVV  682

Query  298  SCPQCNHNMHKLVTFSCCH  242
             C +C+  M K + FSC H
Sbjct  683  LCIECSRVMDKYILFSCDH  701



>ref|XP_003590785.1| Sieve element-occluding protein [Medicago truncatula]
Length=645

 Score = 85.9 bits (211),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 62/253 (25%), Positives = 118/253 (47%), Gaps = 40/253 (16%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEID---KWIDDEEYIFLCGGNNNKQVQE  821
            + + YT + E++++ +  W + L+V       +ID   KW ++E+++ + GG +   +QE
Sbjct  424  KGFPYTEDKEKSITQELKWVVSLLV-------DIDIQIKW-EEEKFVIIYGGKDKAWIQE  475

Query  820  LILKIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMASS  641
                   + +   +        +  KT      I +          + +FWT+++S+   
Sbjct  476  FTKFATALANDTNI--------KQAKT-----SIELLSLESQKPNVVNKFWTKVESL---  519

Query  640  RIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMN  461
               +L KM  ++ +D + Q V+KLL Y+ E      WA+++K   +IA   G  +   ++
Sbjct  520  ---FLTKMNNNDTTDSVKQQVEKLLSYKNETG----WAIVTKGSIVIAVGHGTTVSKTVS  572

Query  460  EYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQCN  281
            E++KWK+ A   GF+ AF + ++ +  S    S+      L       KIP+   CP C 
Sbjct  573  EFDKWKEVAIKKGFEHAFNEHHKKVAPSFHLCSH------LEIHKVAGKIPDFVECPDCR  626

Query  280  HNMHKLVTFSCCH  242
              M   +T+ CCH
Sbjct  627  RRMEVFITYKCCH  639



>ref|XP_004161368.1| PREDICTED: uncharacterized LOC101204444 [Cucumis sativus]
 gb|KGN63518.1| hypothetical protein Csa_1G002870 [Cucumis sativus]
Length=698

 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 65/253 (26%), Positives = 118/253 (47%), Gaps = 21/253 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TSE E+ L   ESW L+L++  I +   I  W  +  YI + GG + + ++E   K
Sbjct  460  AFPFTSEREEELWKTESWRLELLIDGIDF--SILDWAAEGRYICIYGGEDTEWIKEFTSK  517

Query  808  IQEICSKIQMNWRIVYIGR-SGKTFFDEDVIRMCDSTVTS----EQRIKEFWTRLQSMAS  644
             +++     ++ ++ Y+G+ + K    +  I + D+ ++        +  FW RL+SM  
Sbjct  518  TKKVAETANVDLQMAYVGKNNAKERVRKISIMISDNKLSHYWADSTLVWFFWARLESMMY  577

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S++ Y    G    +D IMQ +  LL +  +GS  G WA+     G      G+ +L  +
Sbjct  578  SKLNY----GKTVENDPIMQEIMTLLSF--DGSDKG-WAIFFGRAGETTRAKGETVLSCI  630

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQC  284
              +++WK+  +  GF +A  D  + +    +P    H    L  P     IP    C +C
Sbjct  631  LAFDQWKEEVEEKGFVKALADYLQQL---KTP----HHCNRLILPGLAGNIPENVVCAEC  683

Query  283  NHNMHKLVTFSCC  245
               M K + + CC
Sbjct  684  GRAMEKYLMYRCC  696



>gb|AES61036.2| sieve element occlusion protein [Medicago truncatula]
Length=668

 Score = 85.9 bits (211),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 62/253 (25%), Positives = 118/253 (47%), Gaps = 40/253 (16%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEID---KWIDDEEYIFLCGGNNNKQVQE  821
            + + YT + E++++ +  W + L+V       +ID   KW ++E+++ + GG +   +QE
Sbjct  447  KGFPYTEDKEKSITQELKWVVSLLV-------DIDIQIKW-EEEKFVIIYGGKDKAWIQE  498

Query  820  LILKIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMASS  641
                   + +   +        +  KT      I +          + +FWT+++S+   
Sbjct  499  FTKFATALANDTNI--------KQAKT-----SIELLSLESQKPNVVNKFWTKVESL---  542

Query  640  RIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMN  461
               +L KM  ++ +D + Q V+KLL Y+ E      WA+++K   +IA   G  +   ++
Sbjct  543  ---FLTKMNNNDTTDSVKQQVEKLLSYKNETG----WAIVTKGSIVIAVGHGTTVSKTVS  595

Query  460  EYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQCN  281
            E++KWK+ A   GF+ AF + ++ +  S    S+      L       KIP+   CP C 
Sbjct  596  EFDKWKEVAIKKGFEHAFNEHHKKVAPSFHLCSH------LEIHKVAGKIPDFVECPDCR  649

Query  280  HNMHKLVTFSCCH  242
              M   +T+ CCH
Sbjct  650  RRMEVFITYKCCH  662



>gb|KDO69425.1| hypothetical protein CISIN_1g019680mg [Citrus sinensis]
Length=337

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 121/266 (45%), Gaps = 46/266 (17%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+E E  L   ESW L+L+V  I   + I +W+ +E ++ L GG + + +++    
Sbjct  98   AFPFTAEREAALWKAESWRLELLVDGI--DATILEWMKEERFVCLYGGEDIEWIRQFTNS  155

Query  808  IQEICSKIQMNWRIVYIGRS------GK---TFFDEDVIRMCDSTVTSEQRIKEFWTRLQ  656
             + +    Q+N  + Y+G++      GK       E++      T+     +  FW RL+
Sbjct  156  AKAVARAAQINLGMAYVGKNNAKEKLGKISSIIIQENL----SHTLADSTAVWFFWARLE  211

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWAL--------LSKEKGII  500
            SM  S++Q+    G    +D I++ V  +L +  +GS  G WA+        +++ KG +
Sbjct  212  SMLYSKLQH----GATVENDRILKEVTTVLSF--DGSEQG-WAIFWRGTTHEMARAKGKV  264

Query  499  ACDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSN  323
            A D        M E+EKWKD+A  NGF     +  E + +          +C  L  P  
Sbjct  265  ATD-------CMVEFEKWKDDAYQNGFVPGLNNYLERVRTPD--------HCNRLILPGI  309

Query  322  LEKIPNTQSCPQCNHNMHKLVTFSCC  245
               IP T +C  C   M     + CC
Sbjct  310  HGPIPETVACADCGRVMEMFFLYRCC  335



>gb|EYU17767.1| hypothetical protein MIMGU_mgv1a002070mg [Erythranthe guttata]
Length=719

 Score = 85.9 bits (211),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 114/263 (43%), Gaps = 31/263 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y + +  E  L + E W LKLVV  I     I  WI++ + I L GG+  + +++ I  
Sbjct  471  AYPFATRNESILWEGEKWRLKLVVDGI--DKSILTWINEGKVICLYGGDKIEWIRDFIRT  528

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTS---------EQRIKEFWTRLQ  656
             +   S   +   +VYIG++      ++ ++  + TVTS            I  FWTR++
Sbjct  529  ARNAASSAGIGLEMVYIGKNAT----KERMKRLNETVTSNGLSHCWTDPTSIWYFWTRIE  584

Query  655  SMASSRIQYLLKMGLDEGS--DEIMQGVKKLLVYEAEGSTVGVWALLSKEKGI----IAC  494
            SM  S+  +     +D+    D I + V  +L +  +G     WA+ S+  G     +A 
Sbjct  585  SMMHSKYSHNKGAKIDDDGDVDHIRREVLTMLTFGGDGDR--GWAMFSQGSGAGPGEVAR  642

Query  493  DMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEK  314
              GD ML  + ++E W   A   GF  A  D     +S          +C     S ++ 
Sbjct  643  AKGDAMLSGLKDFETWAPEATRIGFVAALNDYLAGNMSGE--------HCNRLVLSGVDD  694

Query  313  IPNTQSCPQCNHNMHKLVTFSCC  245
            +P T  C +C   M K   + CC
Sbjct  695  VPETVVCAECRKPMEKYFMYRCC  717



>ref|XP_006476923.1| PREDICTED: uncharacterized protein LOC102608617 isoform X1 [Citrus 
sinensis]
Length=698

 Score = 85.9 bits (211),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 121/266 (45%), Gaps = 46/266 (17%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+E E  L   ESW L+L+V  I   + I +W+ +E ++ L GG + + +++    
Sbjct  459  AFPFTAEREAALWKAESWRLELLVDGI--DATILEWMKEERFVCLYGGEDIEWIRQFTNS  516

Query  808  IQEICSKIQMNWRIVYIGRS------GK---TFFDEDVIRMCDSTVTSEQRIKEFWTRLQ  656
             + +    Q+N  + Y+G++      GK       E++      T+     +  FW RL+
Sbjct  517  AKAVARAAQINLGMAYVGKNNAKEKLGKISSIIIQENL----SHTLADSTAVWFFWARLE  572

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWAL--------LSKEKGII  500
            SM  S++Q+    G    +D I++ V  +L +  +GS  G WA+        +++ KG +
Sbjct  573  SMLYSKLQH----GATVENDRILKEVTTVLSF--DGSEQG-WAIFWRGTTHEMARAKGKV  625

Query  499  ACDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSN  323
            A D        M E+EKWKD+A  NGF     +  E + +          +C  L  P  
Sbjct  626  ATD-------CMVEFEKWKDDAYQNGFVPGLHNYLERVRTPD--------HCNRLILPGT  670

Query  322  LEKIPNTQSCPQCNHNMHKLVTFSCC  245
               IP T +C  C   M     + CC
Sbjct  671  HGPIPETVACADCGRVMEMFFLYRCC  696



>ref|XP_006476925.1| PREDICTED: uncharacterized protein LOC102608617 isoform X3 [Citrus 
sinensis]
Length=613

 Score = 85.5 bits (210),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 121/266 (45%), Gaps = 46/266 (17%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+E E  L   ESW L+L+V  I   + I +W+ +E ++ L GG + + +++    
Sbjct  374  AFPFTAEREAALWKAESWRLELLVDGI--DATILEWMKEERFVCLYGGEDIEWIRQFTNS  431

Query  808  IQEICSKIQMNWRIVYIGRS------GK---TFFDEDVIRMCDSTVTSEQRIKEFWTRLQ  656
             + +    Q+N  + Y+G++      GK       E++      T+     +  FW RL+
Sbjct  432  AKAVARAAQINLGMAYVGKNNAKEKLGKISSIIIQENL----SHTLADSTAVWFFWARLE  487

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWAL--------LSKEKGII  500
            SM  S++Q+    G    +D I++ V  +L +  +GS  G WA+        +++ KG +
Sbjct  488  SMLYSKLQH----GATVENDRILKEVTTVLSF--DGSEQG-WAIFWRGTTHEMARAKGKV  540

Query  499  ACDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSN  323
            A D        M E+EKWKD+A  NGF     +  E + +          +C  L  P  
Sbjct  541  ATD-------CMVEFEKWKDDAYQNGFVPGLHNYLERVRTPD--------HCNRLILPGT  585

Query  322  LEKIPNTQSCPQCNHNMHKLVTFSCC  245
               IP T +C  C   M     + CC
Sbjct  586  HGPIPETVACADCGRVMEMFFLYRCC  611



>gb|KHN05808.1| hypothetical protein glysoja_038722 [Glycine soja]
Length=673

 Score = 85.9 bits (211),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 69/256 (27%), Positives = 119/256 (46%), Gaps = 27/256 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TSE E++L  +E WSL+L+V  I     + +W+ D + I L GG + + +++    
Sbjct  435  AFPFTSEKEESLWKQEIWSLELLVDGI--DPTVLEWMTDGKLICLYGGEDLEWIEKFTTT  492

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSE--------QRIKEFWTRLQS  653
               +    +    + Y+G+S      E + +M  +  T +          I  FWTRL+S
Sbjct  493  AISVAKAGKFELEMAYVGKSNA---KERMQKMIKTFTTRKFSYFWPNVTSIWFFWTRLES  549

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S++Q+    G    +D+IM  V  +L ++  GS  G WA+  +    +A   GD  L
Sbjct  550  MLYSKLQH----GRTVENDDIMSQVMTVLSFD--GSDRG-WAIFCRGATEMARAKGDSAL  602

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSC  293
              + +++KWKD  + +G  +A  D     L+ + P    H    L  P +   IP    C
Sbjct  603  ICLQDFDKWKDRIEEDGVVQAMND----YLNKNKPP---HHCNRLILPGSTGGIPQKVVC  655

Query  292  PQCNHNMHKLVTFSCC  245
             +C   M K   + CC
Sbjct  656  AECGRQMEKYFMYRCC  671



>ref|XP_006476924.1| PREDICTED: uncharacterized protein LOC102608617 isoform X2 [Citrus 
sinensis]
Length=693

 Score = 85.9 bits (211),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 121/266 (45%), Gaps = 46/266 (17%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+E E  L   ESW L+L+V  I   + I +W+ +E ++ L GG + + +++    
Sbjct  454  AFPFTAEREAALWKAESWRLELLVDGI--DATILEWMKEERFVCLYGGEDIEWIRQFTNS  511

Query  808  IQEICSKIQMNWRIVYIGRS------GK---TFFDEDVIRMCDSTVTSEQRIKEFWTRLQ  656
             + +    Q+N  + Y+G++      GK       E++      T+     +  FW RL+
Sbjct  512  AKAVARAAQINLGMAYVGKNNAKEKLGKISSIIIQENL----SHTLADSTAVWFFWARLE  567

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWAL--------LSKEKGII  500
            SM  S++Q+    G    +D I++ V  +L +  +GS  G WA+        +++ KG +
Sbjct  568  SMLYSKLQH----GATVENDRILKEVTTVLSF--DGSEQG-WAIFWRGTTHEMARAKGKV  620

Query  499  ACDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSN  323
            A D        M E+EKWKD+A  NGF     +  E + +          +C  L  P  
Sbjct  621  ATD-------CMVEFEKWKDDAYQNGFVPGLHNYLERVRTPD--------HCNRLILPGT  665

Query  322  LEKIPNTQSCPQCNHNMHKLVTFSCC  245
               IP T +C  C   M     + CC
Sbjct  666  HGPIPETVACADCGRVMEMFFLYRCC  691



>ref|XP_008464491.1| PREDICTED: uncharacterized protein LOC103502357 isoform X2 [Cucumis 
melo]
Length=697

 Score = 85.5 bits (210),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 65/253 (26%), Positives = 118/253 (47%), Gaps = 21/253 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TSE E+ L   ESW L+L++  I     I  W  +  YI + GG + + ++E   K
Sbjct  459  AFPFTSEREEALWKTESWRLELLIDGI--DLSILDWAAEGRYICIYGGEDTEWIKEFTSK  516

Query  808  IQEICSKIQMNWRIVYIGR-SGKTFFDEDVIRMCDSTVTS----EQRIKEFWTRLQSMAS  644
             +++     ++ ++ Y+G+ + K    +  I + D+ ++        +  FWTRL+SM  
Sbjct  517  TKKVAETANVDLQMAYVGKNNAKERVRKISIMISDNKLSHYWPDSTLVWFFWTRLESMMY  576

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S++ Y    G    +D IMQ +  LL +  +GS  G WA+     G      G+ +L  +
Sbjct  577  SKLNY----GKTVENDPIMQEIMTLLSF--DGSDKG-WAIFFGRAGETTRAKGETVLSCL  629

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQC  284
              +++WK+  +  GF +A  +  + +    +P    H    L  P     IP    C +C
Sbjct  630  LAFDQWKEEVEEKGFVKALDEYLQQL---KTP----HHCNRLILPGLAGNIPENVVCAEC  682

Query  283  NHNMHKLVTFSCC  245
               M K + + CC
Sbjct  683  GRAMEKYLMYRCC  695



>ref|XP_007211100.1| hypothetical protein PRUPE_ppa023699mg [Prunus persica]
 gb|EMJ12299.1| hypothetical protein PRUPE_ppa023699mg [Prunus persica]
Length=693

 Score = 85.5 bits (210),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 69/258 (27%), Positives = 120/258 (47%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T E EQ L + ESW L+LV + I     I  WI+  +YI L GG++ + +++  ++
Sbjct  454  AFPFTDEKEQVLWNAESWRLQLVANGI--DPIILDWIEKGKYICLYGGDDLEWIRKFTVR  511

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIK---------EFWTRLQ  656
             + +     ++  ++Y+GRS  T    + IR  +  + +E   +          FW+R+ 
Sbjct  512  AKVVAGLAGISLELLYVGRSTAT---RERIRKVNKVIETENLSRFWPDYTSNWFFWSRMD  568

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+ ++   +     +DEI++ V  LL Y  +GS  G W ++ +     A   G   
Sbjct  569  SMRCSKAKHHRTV----ENDEILKEVMTLLSY--DGSDQG-WVMVWRGSNETARANGQLT  621

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLEKIPNTQ  299
            L  ++E+E WK+ A  +GF           LS      ++  +C  L  P     IP+  
Sbjct  622  LHTLDEFEAWKNKAAESGFVPT--------LSDELKRRHKPQHCTRLIIPGFGPDIPDRV  673

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K   F CC
Sbjct  674  ECAECGSEMEKFFMFRCC  691



>ref|XP_008239364.1| PREDICTED: uncharacterized protein LOC103337969 [Prunus mume]
Length=707

 Score = 85.5 bits (210),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 120/258 (47%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T E EQ L + ESW L+LV   I     I  WI+  +YI L GG++ + +++  ++
Sbjct  468  AFPFTDEKEQVLWNAESWRLQLVADGI--DPIILDWIEKGKYICLYGGDDLEWIRKFTVR  525

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIK---------EFWTRLQ  656
             + +     ++  ++Y+GRS  T    + IR  +  + +E   +          FW+R+ 
Sbjct  526  AKVVAGLAGISLELLYVGRSTAT---REQIRKVNKVIKTENLSRFWPDYTSNWFFWSRMD  582

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+ ++   +     +DEI++ V  LL Y  +GS  G W ++ +     A   G   
Sbjct  583  SMRCSKAKHHKTV----ENDEILKEVMTLLSY--DGSDQG-WVMVWRGSNETARANGQLT  635

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLEKIPNTQ  299
            L  ++E+E WK+ A  +GF     D  +          ++  +C  L  P     IP+  
Sbjct  636  LHTLDEFEAWKNKAAESGFVPTLSDELKQ--------RHKPQHCTRLIIPGFGPDIPDRV  687

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C + M K   F CC
Sbjct  688  ECAECGNEMEKFFMFRCC  705



>ref|NP_001241263.1| uncharacterized protein LOC100811452 [Glycine max]
 gb|ADN32785.1| sieve element occlusion c [Glycine max]
Length=698

 Score = 85.5 bits (210),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 69/256 (27%), Positives = 119/256 (46%), Gaps = 27/256 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TSE E++L  +E WSL+L+V  I     + +W+ D + I L GG + + +++    
Sbjct  460  AFPFTSEKEESLWKQEIWSLELLVDGI--DPTVLEWMTDGKLICLYGGEDLEWIEKFTTT  517

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSE--------QRIKEFWTRLQS  653
               +    +    + Y+G+S      E + +M  +  T +          I  FWTRL+S
Sbjct  518  AISVAKAGKFELEMAYVGKSNA---KERMQKMIKTFTTRKFSYFWPNVTSIWFFWTRLES  574

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S++Q+    G    +D+IM  V  +L ++  GS  G WA+  +    +A   GD  L
Sbjct  575  MLYSKLQH----GRTVENDDIMSQVMTVLSFD--GSDRG-WAIFCRGATEMARAKGDSAL  627

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSC  293
              + +++KWKD  + +G  +A  D     L+ + P    H    L  P +   IP    C
Sbjct  628  ICLQDFDKWKDRIEEDGVVQAMND----YLNKNKPP---HHCNRLILPGSTGGIPQKVVC  680

Query  292  PQCNHNMHKLVTFSCC  245
             +C   M K   + CC
Sbjct  681  AECGRQMEKYFMYRCC  696



>ref|XP_008464490.1| PREDICTED: uncharacterized protein LOC103502357 isoform X1 [Cucumis 
melo]
Length=700

 Score = 85.5 bits (210),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 65/253 (26%), Positives = 118/253 (47%), Gaps = 21/253 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TSE E+ L   ESW L+L++  I     I  W  +  YI + GG + + ++E   K
Sbjct  462  AFPFTSEREEALWKTESWRLELLIDGI--DLSILDWAAEGRYICIYGGEDTEWIKEFTSK  519

Query  808  IQEICSKIQMNWRIVYIGR-SGKTFFDEDVIRMCDSTVTS----EQRIKEFWTRLQSMAS  644
             +++     ++ ++ Y+G+ + K    +  I + D+ ++        +  FWTRL+SM  
Sbjct  520  TKKVAETANVDLQMAYVGKNNAKERVRKISIMISDNKLSHYWPDSTLVWFFWTRLESMMY  579

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S++ Y    G    +D IMQ +  LL +  +GS  G WA+     G      G+ +L  +
Sbjct  580  SKLNY----GKTVENDPIMQEIMTLLSF--DGSDKG-WAIFFGRAGETTRAKGETVLSCL  632

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQC  284
              +++WK+  +  GF +A  +  + +    +P    H    L  P     IP    C +C
Sbjct  633  LAFDQWKEEVEEKGFVKALDEYLQQL---KTP----HHCNRLILPGLAGNIPENVVCAEC  685

Query  283  NHNMHKLVTFSCC  245
               M K + + CC
Sbjct  686  GRAMEKYLMYRCC  698



>ref|XP_008786702.1| PREDICTED: uncharacterized protein LOC103704947 [Phoenix dactylifera]
Length=699

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 121/257 (47%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L ++E W L+ ++ +I     I  W+ + +Y+ L GG +   ++     
Sbjct  461  AFPFTSNREEALWNEEIWRLEFLIDEI--DPAILGWMGEGQYVCLYGGEDIDWIRRFTTL  518

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
            ++    + ++   +VY+G+S      ++ ++   +T+ +E+          +  FW RL+
Sbjct  519  LRRAAQEAKIPLEMVYVGKSNP----KERVKKVVATIAAEKLSGYWQDPVMVWFFWVRLE  574

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q+    G    +D IMQ V  +L ++  GS  G WAL+S+    +    G K+
Sbjct  575  SMWHSKMQH----GKTIENDPIMQEVMTMLTFD--GSDEG-WALISRGSVEMVKAQGKKL  627

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            +  ++E++ WK   +  GF +A       M ++  P         L  P +   I    +
Sbjct  628  IDCLSEFDNWKATVEQEGFIQA-------MTNALLPYHTTEHCTRLILPGDTAPITEKVA  680

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K   +SCC
Sbjct  681  CNECKRPMEKFTLYSCC  697



>gb|KDP26703.1| hypothetical protein JCGZ_17861 [Jatropha curcas]
Length=709

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 121/261 (46%), Gaps = 34/261 (13%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +ESW ++L+   I   + I  WI + +YI L GG + + ++     
Sbjct  468  AFPFTSLREEALWKEESWRIELLADAI--DANILAWIQEGKYICLYGGEDIEWIRRFTKT  525

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR---------IKEFWTRLQ  656
               +  +  +   ++Y+G+S       + +R  + T+ SE           I  FW RL+
Sbjct  526  AAVVAKEANIQLEMLYVGKSNP----REKVRKNNVTIQSENLSHVLPDLTLIWFFWVRLE  581

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGI---IACDMG  485
            SM  S++Q+         +D IMQ +  +L ++  GS  G WA+LS   G+   +A   G
Sbjct  582  SMWHSKVQH----NRTVENDSIMQEIVTMLSFD--GSEQG-WAVLSHGSGVNDQMAKAKG  634

Query  484  DKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIP  308
              +L  ++E++ W+  A+ +GF  A     E +    SP      +C  L  P     IP
Sbjct  635  VDILKSLDEFQTWRKTAEESGFVPALN---EYLTGHHSPL-----HCNRLILPGTTGSIP  686

Query  307  NTQSCPQCNHNMHKLVTFSCC  245
                C +C+  M K + + CC
Sbjct  687  EKVVCAECSRPMEKFIMYRCC  707



>ref|XP_009359245.1| PREDICTED: uncharacterized protein LOC103949844 [Pyrus x bretschneideri]
Length=746

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 123/262 (47%), Gaps = 28/262 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T++ E+ L ++E+W ++L+   I     +  WI +++YI L GG + + ++     
Sbjct  497  AFPFTNQRERLLWEEETWRIELLADAI--DPNLSTWITEKKYICLYGGEDIEWIRNFTKA  554

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ--------RIKEFWTRLQS  653
             + +  +  +   ++Y+GRS      E V++   + + +E+         I  FW RL+S
Sbjct  555  ARNVAVEANIQLEMLYVGRSKP---KETVVKNIMNIIQAEKLSHILDLNLIWFFWIRLES  611

Query  652  MASSRIQYLLKMGLDEG------SDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACD  491
            M  S+ Q L + G          SD IMQG+  +L +   GS+   WA++S+   +++  
Sbjct  612  MWQSKGQLLSEQGKTHSPTDPLKSDPIMQGIISMLSF---GSSDRGWAVISQGSPVMSRA  668

Query  490  MGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKI  311
             G+ ML  +  ++ WK+ +   GF  A  +  E +   +      H    L  P+    +
Sbjct  669  NGEHMLKSLGAFKDWKNRSSEVGFIPALNEHLEGVHRQAP-----HHCTSLILPAT-GIM  722

Query  310  PNTQSCPQCNHNMHKLVTFSCC  245
            P T  C +C   M +   F CC
Sbjct  723  PETVQCAECGRLMERFSMFRCC  744



>ref|XP_008793697.1| PREDICTED: uncharacterized protein LOC103709939 [Phoenix dactylifera]
Length=712

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 121/258 (47%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E  L ++E+W L+ +  +I     I  W+ +  Y+ L GG +   ++     
Sbjct  474  AFPFTSNREAALWNEETWRLEFLADEI--DPVILTWVREGRYVCLYGGEDIDWIRRFATS  531

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
            ++ +  + ++   +VY+G+S      ++ ++     + +E+          +  FW RL+
Sbjct  532  LRRVAQEAKIPLEMVYVGKSNP----KERVKKAVGVIAAEKLSGYWQDPVMVWFFWVRLE  587

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q+    G     D IMQ V  +L ++  GS  G WA++S+    +    G K+
Sbjct  588  SMWHSKMQH----GKSIEDDTIMQEVMTMLSFD--GSDEG-WAVISRGSVEMVKSQGKKL  640

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLEKIPNTQ  299
            +  + +++ WK+  +  GF  A        L+++    + H +C  L  P +  +I +  
Sbjct  641  VDCLTQFDAWKETVETEGFIPA--------LTNALIPYHTHEHCTRLILPGDNGRIKHQV  692

Query  298  SCPQCNHNMHKLVTFSCC  245
             C QC   M K + + CC
Sbjct  693  ICAQCKRPMEKFILYRCC  710



>ref|XP_006848934.1| hypothetical protein AMTR_s00166p00029650 [Amborella trichopoda]
 gb|ERN10515.1| hypothetical protein AMTR_s00166p00029650 [Amborella trichopoda]
Length=695

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/258 (26%), Positives = 120/258 (47%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y ++S  E++L  +E+W L+ +V DI     I  W+ +   I L GG + + ++     
Sbjct  457  AYPFSSVREESLWKEETWRLEFLVDDI--DPLILSWVKEPRIICLYGGEDTEWIRAFTSS  514

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVT-------SEQRIKEFWTRLQSM  650
            I+++  + ++   +VY+G+S      E V R+  + +        S+  I  FW RL+SM
Sbjct  515  IKKVIQETRVPIEMVYVGKSNP---RERVRRIISAIIQEKLSGYWSDTMIWYFWVRLESM  571

Query  649  ASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLG  470
              S+  Y    G    +D I+Q V  +L +  +GS  G WA++S+    I   +G K++ 
Sbjct  572  WHSKRHY----GRTIDNDPIVQEVMSMLSF--DGSDEG-WAVMSRGSTEILKTLGKKLME  624

Query  469  VMNEYEKWKDN-AQINGFDRAFKDCYEMMLSSSSPTSYQHP-YCF-LNYPSNLEKIPNTQ  299
             ++ ++ WK N   ++ F  A ++  +          Y  P +C  L  P     I    
Sbjct  625  CLSHFDTWKANITNVDTFIPALREALQ---------PYHKPEHCTRLILPGTTGPIQEKV  675

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K V + CC
Sbjct  676  VCAECGRQMEKYVLYRCC  693



>ref|XP_002526966.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35453.1| conserved hypothetical protein [Ricinus communis]
Length=792

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 120/257 (47%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E+ L  +ESW L+++V  I     I  WID+  Y+ L GG + + ++     
Sbjct  554  AFPFTTIREEALWKEESWRLEILVDGI--DPIITNWIDEGRYVCLYGGEDMEWIRNFTNT  611

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +     +   +VY+G+S      ++ +R   ST+  E+          I  FW R++
Sbjct  612  ARAVAQASGIPLGMVYVGKSNP----KERVRRNVSTIMVEKLSHYWQDLTSIWYFWVRIE  667

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+ Q    +G +  +D +M+ +  +L ++   S+ G WA+ S+    +    G+  
Sbjct  668  SMWRSKNQ----LGKNSENDLVMKEIMSMLSFD---SSEGGWAIFSRMADEVVKAKGNIF  720

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  +++Y  WKD  Q  GF  + KD  + + +       +H    L  PS+   IP    
Sbjct  721  LTCLSDYTVWKDQIQQKGFLPSVKDYLKGLHT-------EHHCNRLILPSSAGMIPEKIV  773

Query  295  CPQCNHNMHKLVTFSCC  245
            C  C  NM + + + CC
Sbjct  774  CTDCGLNMERYILYKCC  790



>emb|CAN83922.1| hypothetical protein VITISV_026532 [Vitis vinifera]
Length=714

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 113/253 (45%), Gaps = 21/253 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L   E+W ++L+   I     I  WI +  YI L GG + + +++  + 
Sbjct  476  AFPFTSLREEGLWKGETWRMELLADTI--DPIIHNWISEGSYICLFGGEDMEWIRKFCIL  533

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDS-----TVTSEQRIKEFWTRLQSMAS  644
             + I     +   ++Y+G+S      + +  +  +     T+     +  FW RL+SM  
Sbjct  534  AKAIARAAGIRLEMLYVGKSNPREKIQKINAIISTDNLSHTLPDLHLVWFFWVRLESMWY  593

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S++Q+    G    SD IMQ +  +L ++  GS  G W + SK  G +    G+ ++  +
Sbjct  594  SKMQH----GKTVESDPIMQEIVSMLSFD--GSDQG-WVVFSKGSGEMTKAKGENIVRCL  646

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQC  284
            ++Y+ WK+N    GF  A  D    + +        H    L  P     IP    C +C
Sbjct  647  SDYDVWKNNVSSKGFLGALNDYLREIHTP-------HHCNRLILPGTTGSIPERVVCAEC  699

Query  283  NHNMHKLVTFSCC  245
               M K V + CC
Sbjct  700  GRPMEKFVMYRCC  712



>ref|XP_002282172.1| PREDICTED: uncharacterized protein LOC100261038 [Vitis vinifera]
 emb|CBI16823.3| unnamed protein product [Vitis vinifera]
Length=714

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 113/253 (45%), Gaps = 21/253 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L   E+W ++L+   I     I  WI +  YI L GG + + +++  + 
Sbjct  476  AFPFTSLREEGLWKGETWRMELLADTI--DPIIHNWISEGSYICLFGGEDMEWIRKFCIL  533

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDS-----TVTSEQRIKEFWTRLQSMAS  644
             + I     +   ++Y+G+S      + +  +  +     T+     +  FW RL+SM  
Sbjct  534  AKAIARAAGIRLEMLYVGKSNPREKIQKINAIISTDNLSHTLPDLHLVWFFWVRLESMWY  593

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S++Q+    G    SD IMQ +  +L ++  GS  G W + SK  G +    G+ ++  +
Sbjct  594  SKMQH----GKTVESDPIMQEIVSMLSFD--GSDQG-WVVFSKGSGEMTKAKGENIVRCL  646

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQC  284
            ++Y+ WK+N    GF  A  D    + +        H    L  P     IP    C +C
Sbjct  647  SDYDVWKNNVSSKGFLGALNDYLREIHTP-------HHCNRLILPGTTGSIPERVVCAEC  699

Query  283  NHNMHKLVTFSCC  245
               M K V + CC
Sbjct  700  GRPMEKFVMYRCC  712



>emb|CDP15097.1| unnamed protein product [Coffea canephora]
Length=705

 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 120/258 (47%), Gaps = 29/258 (11%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
             +Y +T   E+ L  +E+W L+L+V  I     I +WI  +++I L GG +   ++    
Sbjct  466  HAYPFTLTKEEQLWKEETWRLELLVDGI--DPAILEWIIQDKFICLYGGADIGWIRSFTT  523

Query  811  KIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRL  659
              +++ +   ++  +VY+G++      ++ +R  +S +T E           +  FWTR+
Sbjct  524  AARKVANAAGISLEMVYVGKNNT----KERVRKINSQITGENLSHCWSDPTYVWYFWTRV  579

Query  658  QSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDK  479
            +SM  S++Q   K   D   D+IMQ V  +L ++  GS  G WAL+S+    +A    + 
Sbjct  580  ESMLYSKMQNQ-KTAQD---DKIMQEVMTILSFD--GSDEG-WALISRGSAEMARAKSET  632

Query  478  MLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
            M   + E+  W+D+A+  GF  A  D  + + +        H    L  P     IP   
Sbjct  633  MSQSLEEFTNWEDDAKEKGFVPALNDYLKRLHTP-------HHCNRLILPGTAGGIPELV  685

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K   + CC
Sbjct  686  VCSECGRQMEKYFMYRCC  703



>ref|XP_010904538.1| PREDICTED: uncharacterized protein LOC105031936 [Elaeis guineensis]
Length=707

 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 116/254 (46%), Gaps = 23/254 (9%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E  L ++E+W L+ +V +I     I  W+ +  Y+ L GG +   ++     
Sbjct  469  AFPFTTNREAALWNEETWRLEFLVDEI--DPMILTWVREGRYVCLYGGEDIDWIRRFTTV  526

Query  808  IQEICSKIQMNWRIVYIGRSGK-----TFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMAS  644
            ++ +  + ++   +VY+G+S                   S+      +  FW RL+SM  
Sbjct  527  LRRVAHEAKIPLDMVYVGKSSSKERVKKAVAAIAAEKLSSSWQDPVMVWFFWVRLESMWH  586

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S++Q+    G    +D IMQ V  LL ++  GS  G WA++S+    +    G K++  +
Sbjct  587  SKMQH----GKSIDNDSIMQEVMTLLSFD--GSDEG-WAIISRGSLEMVKSQGKKLVECL  639

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLEKIPNTQSCPQ  287
            N++E+WK   +  GF  A        L+++    + H +C  L  P    +I     C +
Sbjct  640  NQFEQWKATVETEGFIPA--------LTNALLPYHTHEHCTRLILPGENGRIQEHVICAE  691

Query  286  CNHNMHKLVTFSCC  245
            C   M K + + CC
Sbjct  692  CRRPMEKFILYRCC  705



>ref|XP_002526964.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35451.1| conserved hypothetical protein [Ricinus communis]
Length=805

 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 117/257 (46%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E+ L  +ESW L+L+V  I     I  WI++  YI L GG + + +++    
Sbjct  567  AFPFTTIREEALWKEESWRLELLVDGI--DPIITNWIEEGRYICLYGGEDMEWIRKFTST  624

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +     +   +VY+G+S      ++ +R   +T+  E+          I  FW R++
Sbjct  625  ARAVAQAAGIPLGMVYVGKSNP----KERVRRNIATIMVEKLSHYWQDLTSIWYFWVRIE  680

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+ Q    +G    +D +M+ +  +L ++   S+ G WA+ +     I    G   
Sbjct  681  SMWRSKNQ----LGKTSENDSLMKEIMAMLSFD---SSEGGWAIFTGGTDEIVKAKGSIF  733

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  ++EY  WKD  Q  GF  + KD  + + +        H    L  P +   IP    
Sbjct  734  LTCLSEYTSWKDQIQQKGFLPSLKDYLKGLHTD-------HHCNRLILPGSAGTIPERIV  786

Query  295  CPQCNHNMHKLVTFSCC  245
            C  C+ NM + + + CC
Sbjct  787  CSDCSRNMERYIMYKCC  803



>ref|XP_006439978.1| hypothetical protein CICLE_v10019109mg [Citrus clementina]
 gb|ESR53218.1| hypothetical protein CICLE_v10019109mg [Citrus clementina]
Length=698

 Score = 83.2 bits (204),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 70/264 (27%), Positives = 121/264 (46%), Gaps = 42/264 (16%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+E E  L   ESW  +L+V  I   + I +W+ +E ++ L GG + + +++    
Sbjct  459  AFPFTAEREAALWKAESWRPELLVDGI--DATILEWMKEERFVCLYGGEDIEWIRQFTNS  516

Query  808  IQEICSKIQMNWRIVYIGRS------GKTFFDEDVIRM-CDSTVTSEQRIKEFWTRLQSM  650
             + +   +Q+N  + Y+G++      GK      VI+     T+     +  FW RL+SM
Sbjct  517  AKAVARAVQINLGMAYVGKNNAKEKLGK--ISSIVIQENLSHTLADSTAMWFFWARLESM  574

Query  649  ASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWAL--------LSKEKGIIAC  494
              S++Q+    G    +D I++ V  +L +  +GS  G WA+        +++ KG +A 
Sbjct  575  LYSKLQH----GATVENDRILKEVTTVLSF--DGSEQG-WAIFWKGTTHEMARAKGKVAT  627

Query  493  DMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLE  317
            D        M E+EKWKD+A  NGF     +  E + +          +C  L  P    
Sbjct  628  D-------CMVEFEKWKDDAYQNGFVPGLNNYLERVRTPD--------HCNRLILPGIHG  672

Query  316  KIPNTQSCPQCNHNMHKLVTFSCC  245
             IP T +C  C   M     + CC
Sbjct  673  PIPETVACADCGRVMEMFFLYRCC  696



>emb|CBI34827.3| unnamed protein product [Vitis vinifera]
Length=685

 Score = 83.2 bits (204),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 116/253 (46%), Gaps = 21/253 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E+ L  + +W L  +V  I  R  I +WI   + I L GG++ + +Q     
Sbjct  447  AFPFTASREEDLWKEATWKLDFLVDGIDPR--ISEWIAAGKIICLYGGDDIEWIQRFTTI  504

Query  808  IQEICSKIQMNWRIVYIGRSG-KTFFDEDVIRMCDSTVTSEQR----IKEFWTRLQSMAS  644
             +++     ++  +VY+G+S  K     ++  + +  ++   +    I  FW R++SM  
Sbjct  505  AKKVAESAGISLEMVYVGKSNPKELVYTNIKTIIEDKLSHHLKGLTSIWYFWVRIESMLY  564

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S+    +++G     D  MQ + K+L ++   S  G WALLSK    I    GD  L  +
Sbjct  565  SK----MRLGQTVEKDPTMQEILKMLSFD--NSHEG-WALLSKGSEEITKAKGDSFLTCL  617

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQC  284
             +Y +W+ + Q  GF +A KD     L    P  + + +  L        IP T  C +C
Sbjct  618  RQYNQWEVHVQKKGFLQALKD----HLLQIHPPHHCNQFELLVAAG---MIPETLVCSEC  670

Query  283  NHNMHKLVTFSCC  245
               M K   + CC
Sbjct  671  GRKMEKFFVYRCC  683



>ref|XP_007144080.1| hypothetical protein PHAVU_007G127000g [Phaseolus vulgaris]
 gb|ESW16074.1| hypothetical protein PHAVU_007G127000g [Phaseolus vulgaris]
Length=668

 Score = 82.8 bits (203),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 103/228 (45%), Gaps = 45/228 (20%)
 Frame = -3

Query  901  RSEIDKWIDDEEYIFLCGGNNNKQVQELILKIQEICSKIQMNWRIVYIGRSGKTFFDEDV  722
               I  WI +++YI + GG++ + +Q+                      +   TF ++  
Sbjct  471  HPHISTWIREQKYILIYGGSDKEWIQQF--------------------TKYATTFANDST  510

Query  721  IRMCDST-----VTSEQR--IKEFWTRLQSMASSRIQYLLKMGLDEGSDEIMQGVKKLLV  563
            ++  +       V  E R  ++ FW+ ++S+  ++         +   D + Q V+++L 
Sbjct  511  LKEANIQIELFCVEKEDRNFLRRFWSGIESLFVTK--------ANNTVDAVTQEVQRMLS  562

Query  562  YEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMML  383
            Y+ E      WA+L K   ++    G  +L  ++E+EKWK+     GF+ +FK+ +E ++
Sbjct  563  YKNETG----WAVLCKGSYVLLSGHGTTILKTVSEFEKWKEGVMKKGFEPSFKEHHERIV  618

Query  382  SSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQCNHNMHKLVTFSCCHT  239
             ++      H    L  P+   K+P T  CP+C   M   +++ CCH+
Sbjct  619  RTT------HRCVHLEIPNIAGKLPETIKCPECGRTMEIFISYKCCHS  660



>ref|XP_002271950.2| PREDICTED: uncharacterized protein LOC100261056 [Vitis vinifera]
Length=713

 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 116/253 (46%), Gaps = 21/253 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E+ L  + +W L  +V  I  R  I +WI   + I L GG++ + +Q     
Sbjct  475  AFPFTASREEDLWKEATWKLDFLVDGIDPR--ISEWIAAGKIICLYGGDDIEWIQRFTTI  532

Query  808  IQEICSKIQMNWRIVYIGRSG-KTFFDEDVIRMCDSTVTSEQR----IKEFWTRLQSMAS  644
             +++     ++  +VY+G+S  K     ++  + +  ++   +    I  FW R++SM  
Sbjct  533  AKKVAESAGISLEMVYVGKSNPKELVYTNIKTIIEDKLSHHLKGLTSIWYFWVRIESMLY  592

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S+    +++G     D  MQ + K+L ++   S  G WALLSK    I    GD  L  +
Sbjct  593  SK----MRLGQTVEKDPTMQEILKMLSFD--NSHEG-WALLSKGSEEITKAKGDSFLTCL  645

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQC  284
             +Y +W+ + Q  GF +A KD     L    P  + + +  L        IP T  C +C
Sbjct  646  RQYNQWEVHVQKKGFLQALKD----HLLQIHPPHHCNQFELLVAAG---MIPETLVCSEC  698

Query  283  NHNMHKLVTFSCC  245
               M K   + CC
Sbjct  699  GRKMEKFFVYRCC  711



>ref|XP_004236293.1| PREDICTED: uncharacterized protein LOC101251462 [Solanum lycopersicum]
Length=724

 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 123/258 (48%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +T   E++L + ESW L+LVV  I     +  W+   ++I L GG +   ++     
Sbjct  486  AYPFTLSKEESLWNMESWRLELVVDGI--DPNLIDWMASGKFICLYGGEDMDWIRNFTKS  543

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +  +  ++ +++Y+G+S     +++ +R  +S +T+E           +  FWTR++
Sbjct  544  ARSVAQRAGIDLQMLYVGKSN----NKERVRRINSMITAENLSYCLMDLTSVWYFWTRIE  599

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q    +G     D++MQ V  +L +  +GS  G WAL+S+    +A      +
Sbjct  600  SMFYSKMQ----LGKTIQEDKVMQEVLTMLSF--DGSDQG-WALISRGSFEMARAKSQII  652

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQ  299
               +++Y  W+++A++ GF  A     E  L   +P      +C  L  P     IP   
Sbjct  653  TKTLDDYTVWEEDARVKGFVPAL---IEYFLQLHTPE-----HCNRLILPGLDGDIPEMI  704

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M +   + CC
Sbjct  705  VCAECGRPMERFFMYRCC  722



>ref|XP_009592492.1| PREDICTED: uncharacterized protein LOC104089332 [Nicotiana tomentosiformis]
Length=712

 Score = 82.8 bits (203),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 69/258 (27%), Positives = 122/258 (47%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +T   ++ L   ESW L+LVV  I     I +W+   +YI L GG + + +++    
Sbjct  474  AYPFTMAKQEELWSIESWRLELVVDGI--DQNIIEWMTAGKYICLYGGEDVEWIEKFTTS  531

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSE---------QRIKEFWTRLQ  656
             + +  +  ++  ++Y+G+S     ++D +R  +S +  E           +  FWTRL+
Sbjct  532  AKSVAHRAGIDLHMIYVGKSN----NKDRVRRINSIIRKENLSYCLDDVMSVWYFWTRLE  587

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q    +G     D+IMQ V  +L +  +GS  G WA++S+    +A      +
Sbjct  588  SMFYSKMQ----LGQTIKDDKIMQEVLTMLSF--DGSDQG-WAVISRGSFEMARAKSVVI  640

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQ  299
               + ++  W+++A+  GF  A  D +   L   +P   QH  C  L  P     IP   
Sbjct  641  TKTLEDFHVWEEDAREKGFVLALIDYF---LHLHTP---QH--CNRLILPGLDVDIPEMI  692

Query  298  SCPQCNHNMHKLVTFSCC  245
            +C +C   M K   + CC
Sbjct  693  TCAECGRQMDKFFMYRCC  710



>ref|XP_004309998.1| PREDICTED: uncharacterized protein LOC101307854 [Fragaria vesca 
subsp. vesca]
Length=596

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/259 (27%), Positives = 118/259 (46%), Gaps = 22/259 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +TS  E+ L ++E+W ++L+   I     +  WI + +YI L GG +   ++     
Sbjct  347  AYPFTSNRERLLWEEETWRIELLADAI--DQTLLNWIAERKYICLYGGEDINWIRNFTRT  404

Query  808  IQEICSKIQMNWRIVYIGRSG-KTFFDEDVIRMCD----STVTSEQRIKEFWTRLQSMAS  644
             + +  +  +   ++Y+G+S  K    +D+IR+      S       I  FW RL+SM  
Sbjct  405  AKNVALEAGIQLELLYLGKSKQKERVVKDIIRVIKEEKLSHTIDSNLIWFFWVRLESMWQ  464

Query  643  SRIQYLLKMGLDEGSDE------IMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGD  482
            S+ Q + ++     +D       IMQG+  LL +   GST   WAL++     +A   G+
Sbjct  465  SKGQLMSELSKANFTDHNIKNDIIMQGIVSLLSF---GSTDRGWALIALPSSEMAKANGE  521

Query  481  KMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNT  302
             M   +N+++ WK      GF  A  + Y   +   +P    H    L  P+    +P T
Sbjct  522  HMSKSLNDFKIWKPKHDEVGFTPALNE-YLTGVYRDAP----HHCTNLILPAT-GIMPET  575

Query  301  QSCPQCNHNMHKLVTFSCC  245
             SC +C   M +   F CC
Sbjct  576  VSCSECGRIMERYAMFRCC  594



>ref|XP_004138263.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101204444 
[Cucumis sativus]
Length=694

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/253 (25%), Positives = 116/253 (46%), Gaps = 15/253 (6%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TSE E+ L   ESW L+L++  I +   I  W  +  YI + GG + + ++E   K
Sbjct  450  AFPFTSEREEELWKTESWRLELLIDGIDF--SILDWAAEGRYICIYGGEDTEWIKEFTSK  507

Query  808  IQEICSKIQMNWRIVYIGR-SGKTFFDEDVIRMCDSTVTS----EQRIKEFWTRLQSMAS  644
             +++     ++ ++ Y+G+ + K    +  I + D+ ++        +  FW RL+SM  
Sbjct  508  TKKVAETANVDLQMAYVGKNNAKERVRKISIMISDNKLSHYWADSTLVWFFWARLESMMY  567

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S++ Y    G    +D IMQ +  LL +  +GS  G WA+     G      G+ +L  +
Sbjct  568  SKLNY----GKTVENDPIMQEIMTLLSF--DGSDKG-WAIFFGRAGETTRAKGETVLSCI  620

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQC  284
              +++WK+  +  GF +A  D  + + +         P    N       IP    C +C
Sbjct  621  LAFDQWKEEVEEKGFVKALADYLQQLKTPHHCNRLILPGLAGNI-GIAGNIPENVVCAEC  679

Query  283  NHNMHKLVTFSCC  245
               M K + + CC
Sbjct  680  GRAMEKYLMYRCC  692



>emb|CAN65891.1| hypothetical protein VITISV_041167 [Vitis vinifera]
Length=693

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/257 (27%), Positives = 109/257 (42%), Gaps = 40/257 (16%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +T+  E++L  +E+W LKL+V             +  +YI + GG N+  +      
Sbjct  466  AYPFTNSKEESLWKEETWRLKLLV-------------NQGKYICMYGGVNSDWILNFNTA  512

Query  808  IQEICSKIQMNWRIVYIGRSGK--------TFFDEDVIRMCDSTVTSEQRIKEFWTRLQS  653
             +E+     +   +VY+G+S          TF D   +  C    T    I  FWTR++S
Sbjct  513  AREVAKAAGIQLEMVYVGKSNAKEQVRKTITFIDSRSLGYC---WTDPTNIWFFWTRMES  569

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S+ Q+    G    +D I  GV  +L ++  GS  G W+++      +A   GD +L
Sbjct  570  MLYSKTQH----GKTIENDSIFAGVLTMLSFD--GSDQG-WSVICHGPTEMAKAKGDMIL  622

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQS  296
                EY  W DN Q NGF  A  +  + + +          +C  L  P     IP    
Sbjct  623  KCFTEYSDWSDNVQQNGFMPALNEHLQKLHTPE--------HCNRLILPGINGDIPEKVV  674

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K   + CC
Sbjct  675  CAECGRPMEKYFMYRCC  691



>ref|XP_008350940.1| PREDICTED: uncharacterized protein LOC103414321 [Malus domestica]
Length=744

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/260 (26%), Positives = 123/260 (47%), Gaps = 26/260 (10%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS+ E+ L ++E+W ++L+ +D L ++ +  WI D +YI L GG + + ++     
Sbjct  497  AFPFTSQKERMLWEEETWRIELL-ADALDQN-LYTWITDRKYICLYGGEDIEWIRNFTKA  554

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ--------RIKEFWTRLQS  653
             + +  +  +   ++Y+G+S      E V++   S + +E+         I  FW RL+S
Sbjct  555  ARNVAREAGIQLELLYVGKSKA---KEKVVKNIISIIQAEKLSHTLEVNLIWFFWIRLES  611

Query  652  MASSRIQYLLKMGLDEG----SDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMG  485
            M  S+ Q L +    +     SD IMQG+  +L +   GS+   WA+++     ++   G
Sbjct  612  MWQSKGQILSEQSRTQTDHLKSDRIMQGIISMLSF---GSSDRGWAVIALGSADMSKANG  668

Query  484  DKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPN  305
            + ML  + EY  WK      GF  A  +  E +   +      H    L  P+    +P 
Sbjct  669  EHMLRSLREYNNWKIRPTEIGFTPALNEYLEGVHKQAP-----HHCTNLILPAT-GIMPE  722

Query  304  TQSCPQCNHNMHKLVTFSCC  245
            T +C +C   M +   F CC
Sbjct  723  TVACAECGRLMERFSMFRCC  742



>ref|XP_010044527.1| PREDICTED: uncharacterized protein LOC104433471 [Eucalyptus grandis]
 gb|KCW86613.1| hypothetical protein EUGRSUZ_B03241 [Eucalyptus grandis]
Length=699

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 113/257 (44%), Gaps = 30/257 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +TSE E+ L   E W ++L+   +     I  WI + +YI L GG + + +++    
Sbjct  462  AYPFTSEREEALWKSEKWRIELLAGPV--EPLIFTWISEGKYICLYGGEDIEWIRKFTNT  519

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +    Q+   ++Y+G+S       + +R   +T+ +E           I  FW RL+
Sbjct  520  ARAVAKAAQIPLEMLYVGKSNT----REKLRNNSNTILAENLSHVLPDLTLIWFFWVRLE  575

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q     G    +D IMQ +  +L +  +GS  G WA++ +    +A   GD +
Sbjct  576  SMWHSKVQ----QGKSVDNDPIMQEIMMMLSF--DGSDHG-WAVICRGAD-VAKAKGDVI  627

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + +Y+ WKD     GF  A         S        H    L  PS    IP    
Sbjct  628  LKTLLDYDSWKDRIGQMGFLPALG-------SHIHDEKTPHHCNRLILPSTTGTIPERVV  680

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K + + CC
Sbjct  681  CAECGRVMEKFIMYRCC  697



>ref|XP_010248721.1| PREDICTED: uncharacterized protein LOC104591550 [Nelumbo nucifera]
Length=718

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/258 (27%), Positives = 123/258 (48%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T + E+ L ++E WS+  VV+ I     +  WI + + I L GG +   +++    
Sbjct  479  AFPFTRKREEDLWNQERWSMVFVVNGI--DETMLSWIREGKPICLYGGEDINWIRKFTST  536

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR---------IKEFWTRLQ  656
            ++ +  +++++  ++Y+G+S      ++ +R   + ++SE+          I  FW RL+
Sbjct  537  MRSVTDELKISIEMMYVGKSNP----KERVRSNINAISSEKLSYYLPELTFIWFFWVRLE  592

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+ Q     G     D IM+ V  LL ++  GS  G WA+L    G +    G++M
Sbjct  593  SMWYSKTQ----QGRTIADDNIMREVMSLLTFD--GSNQG-WAILGHGNGEMTKASGNRM  645

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEK-IPNTQ  299
            L  +  +  WK+NA  +GF  A           +S  S +H    L  P  L K +    
Sbjct  646  LEALESFPTWKENAVRDGFIPALARVL------ASYHSKEH-CASLVLPRALGKDVHEHI  698

Query  298  SCPQCNHNMHKLVTFSCC  245
            +C +CN  M K V + CC
Sbjct  699  TCAECNRPMEKYVLYRCC  716



>gb|AFN06072.1| sieve element occlusion protein 1 [Nicotiana tabacum]
Length=719

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/258 (27%), Positives = 123/258 (48%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +T   E+ L   ESW L+LVV  I     + +W+   ++I L GG + + ++     
Sbjct  481  AYPFTISKEEALWSVESWRLELVVDGI--DQNLIEWMTSGKFICLYGGEDIEWIRSFTKS  538

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +  +  ++  ++Y+G+S     +++ +R  +S VT+E           +  FWTR++
Sbjct  539  AKSVAQRAGIDLLMMYVGKSN----NKERVRRINSMVTAENLSYCLMDLTSVWYFWTRIE  594

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q    +G     D+IMQ V  +L +  +GS  G WAL+S+    +A      +
Sbjct  595  SMFYSKMQ----LGKTIQEDKIMQEVLTMLSF--DGSDQG-WALISRGSFEMARAKSQII  647

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQ  299
               +++Y  W+++A+  GF  A  D +   L   +P   QH  C  L  P     IP   
Sbjct  648  TKTLDDYTVWEEDAREKGFVPALIDYF---LQLHTP---QH--CNRLILPGLDGDIPEMI  699

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M +   + CC
Sbjct  700  VCAECGRPMERFFMYRCC  717



>ref|XP_009386688.1| PREDICTED: uncharacterized protein LOC103973766 [Musa acuminata 
subsp. malaccensis]
Length=702

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 121/258 (47%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E  L  +E+W L+ +V DI    ++  W+ +  ++ L GG + + ++   + 
Sbjct  464  AFPFTSNRELALWKEETWRLEFMVDDI--DPDMLAWVREGRHVCLYGGEDIEWIRRFTMV  521

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
            ++ +  + ++   +VY+G+S      +D +R   S +  E+          +  FW RL+
Sbjct  522  MRRVSQEAKIPIEMVYVGKSSP----KDRVRKAISVIAREKLSGYWQDPVMVWFFWVRLE  577

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q+    G    +D IM  V  +L +  +GS  G WA++S+    +    G  +
Sbjct  578  SMWYSKMQH----GRTIENDPIMLEVMTMLSF--DGSDEG-WAIVSRGSMEMVKAHGKMI  630

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLEKIPNTQ  299
            +  +++++ WK   + +GF  A  +    +        + H +C  L  P +  +I    
Sbjct  631  VDCLSQFDSWKGKVEEDGFVPALTEALLPL--------HTHEHCTRLILPGDTGRIKEEV  682

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K V + CC
Sbjct  683  VCAECKRPMEKFVLYRCC  700



>ref|XP_009769607.1| PREDICTED: uncharacterized protein LOC104220433 [Nicotiana sylvestris]
Length=719

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/258 (27%), Positives = 123/258 (48%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +T   E+ L   ESW L+LVV  I     + +W+   ++I L GG + + ++     
Sbjct  481  AYPFTISKEEALWSVESWRLELVVDGI--DQNLIEWMTSGKFICLYGGEDIEWIRSFTKS  538

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +  +  ++  ++Y+G+S     +++ +R  +S VT+E           +  FWTR++
Sbjct  539  AKSVAQRAGIDLLMMYVGKSN----NKERVRRINSMVTAENLSYCLMDLTSVWYFWTRIE  594

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q    +G     D+IMQ V  +L +  +GS  G WAL+S+    +A      +
Sbjct  595  SMFYSKMQ----LGKTIQEDKIMQEVLTMLSF--DGSDQG-WALISRGSFEMARAKSQII  647

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQ  299
               +++Y  W+++A+  GF  A  D +   L   +P   QH  C  L  P     IP   
Sbjct  648  TKTLDDYTVWEEDAREKGFVPALIDYF---LQLHTP---QH--CNRLILPGLDGDIPEMI  699

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M +   + CC
Sbjct  700  VCAECGRPMERFFMYRCC  717



>gb|KDP46383.1| hypothetical protein JCGZ_10223 [Jatropha curcas]
Length=709

 Score = 80.9 bits (198),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 64/257 (25%), Positives = 113/257 (44%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E+ L  +ESW L+L+V  I     +  W+ +  YI L GG + + +++    
Sbjct  471  AFPFTTLREEALWKEESWRLELLVDGI--DPMVLNWMQEGRYICLYGGEDMEWIRKFTNT  528

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +     +   +VY+G+S      ++ +R   +T+  E+          I  FW R++
Sbjct  529  ARAVAQSAGIPLGMVYVGKSNP----KERVRRNIATIIVEKLSHYWQDLTSIWYFWVRIE  584

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+ Q    +G    +D IM+ +  +L ++      G WA+ ++    I    G+  
Sbjct  585  SMWRSKNQ----LGRTPENDPIMKEIMTMLSFDGSD---GGWAIFTRGSDEIVRAKGNIF  637

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  +  Y  WKD  Q  GF    K+     L  S+P   +H    L  P     IP    
Sbjct  638  LTCLANYSAWKDQIQQKGFMPTLKE----QLYLSAP---EHHCNRLVLPGAAGMIPERIV  690

Query  295  CPQCNHNMHKLVTFSCC  245
            C  C  +M K + + CC
Sbjct  691  CSDCGRSMEKFIMYRCC  707



>gb|KDP46378.1| hypothetical protein JCGZ_10218 [Jatropha curcas]
Length=688

 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 64/259 (25%), Positives = 119/259 (46%), Gaps = 31/259 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E+ L  KESW LKL+V+ +     +  W  +E+Y+ L GG++ + +++    
Sbjct  449  AFPFTTSREEELWSKESWGLKLLVNGL--DPAVINWAAEEKYVCLYGGDDIEWIRKFTNT  506

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTV--------TSEQRIKEFWTRLQS  653
             +++     +   ++Y+G+S      + V R  ++ +          +  I  FW R++S
Sbjct  507  AKQVAKSAGIPLEMLYVGKSNPK---KRVARNIETIIWENLSHLWEDKTYIWYFWVRIES  563

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSK--EKGIIACDMGDK  479
            M  S+ Q    +G     D IM+ + K+L +++E      WA+ +K  +  I+    G+ 
Sbjct  564  MWRSKNQ----LGGKTKDDPIMKKIMKVLSFDSEAG----WAIFAKGFDNQIVVEARGNI  615

Query  478  MLGVMNEYEKWK-DNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNT  302
            +L  +  Y KWK D  Q   F  A KD  E           QH    L +P +  K    
Sbjct  616  ILSCLENYTKWKSDGTQQKEFIAAVKDAVE------DAVKEQHHCNRLTFPPDDGKTSEI  669

Query  301  QSCPQCNHNMHKLVTFSCC  245
              C  C++ M + + + CC
Sbjct  670  -PCADCDNIMERFILYKCC  687



>ref|XP_007159683.1| hypothetical protein PHAVU_002G258300g [Phaseolus vulgaris]
 gb|ESW31677.1| hypothetical protein PHAVU_002G258300g [Phaseolus vulgaris]
Length=702

 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 65/253 (26%), Positives = 115/253 (45%), Gaps = 21/253 (8%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y ++   E+ L + E W L L+   I     +  WI + +YI L GG++   +++    
Sbjct  464  AYPFSISKEEALWNNEKWGLVLLADSI--DPSLLYWISEGKYICLYGGDDMDWIRKFTRT  521

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSE-----QRIKEFWTRLQSMAS  644
               + + +Q+   ++Y+G+S      ++ I    +   S        I  FW RL+SM  
Sbjct  522  AYALAAALQLPLEMIYVGKSNPGKKVQETINAIQAEKLSNVLPDLAIIWFFWVRLESMWH  581

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S+ Q+   +     +D IM  V ++L Y++  S    WA++S+  G +A   GD  L  +
Sbjct  582  SKSQHSKTVE----NDNIMHEVMRILTYDSGDSG---WAVISEGTGSMAQGKGDAFLRCL  634

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQC  284
            NE E+WKD A+  G   A  D  + + +        H    L  P +   +P++  C +C
Sbjct  635  NEREQWKDTAKDIGILPAMADYIQGLQAP-------HHCNRLILPGSSGGVPDSVVCAEC  687

Query  283  NHNMHKLVTFSCC  245
               M K   + CC
Sbjct  688  GKTMEKFYMYRCC  700



>gb|ADN32811.1| sieve element occlusion b [Solanum phureja]
Length=823

 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 117/258 (45%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  +++W+++L+   I     I  WI + + I L GG + + ++     
Sbjct  584  AFPFTKAREEALWKEQTWNIELLADSI--DQNIFTWISEGKCICLYGGEDIEWIRSFTSA  641

Query  808  IQEICSKIQMNWRIVYIGRSG---KTFFDEDVIRM--CDSTVTSEQRIKEFWTRLQSMAS  644
             + + +  ++   ++Y+G+     +   +  +I+M      V  +  I  FW RL+SM  
Sbjct  642  TRAVANAARVPLEMLYVGKKNPKERVRKNSSIIQMENLSHVVQDQTLIWFFWERLESMWH  701

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            SR Q      +   +D I+Q +  +L Y+  GS +G WA+ S+    +    GD ++ VM
Sbjct  702  SRTQ----QDIPGETDPILQEIVTILSYD--GSDLG-WAVFSRGLAEMTRGKGDLIVQVM  754

Query  463  NEYEKWKDNAQ-----INGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
              +++W+D        +   DR  +D +       SP    H    L  PS    IP   
Sbjct  755  KGFDRWRDEVSDVTTFVPALDRQLRDLH-------SP----HHCTRLILPSTTGHIPERV  803

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C+  M K + + CC
Sbjct  804  VCAECSRPMEKFIMYRCC  821



>ref|XP_007221911.1| hypothetical protein PRUPE_ppa001579mg [Prunus persica]
 gb|EMJ23110.1| hypothetical protein PRUPE_ppa001579mg [Prunus persica]
Length=799

 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 123/263 (47%), Gaps = 29/263 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L ++E+W ++L+ +D L ++ I+ WI + +YI L GG + + ++     
Sbjct  549  AFPFTSSKEKLLWEEETWRMELL-ADSLDQNLIN-WIAEGKYICLYGGEDIEWIRNFTRA  606

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ--------RIKEFWTRLQS  653
             +++ ++  +   ++Y+G+S      E V++   +T+  E+         I  FW RL+S
Sbjct  607  AKKVAAESGIQLELLYVGKSKP---KEKVVKNIMTTIQFEKLSHTLEWNLIWFFWVRLES  663

Query  652  MASSRIQYLLKMGLDEG-------SDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIAC  494
            M  SR Q L    L  G       SD +MQG+  +L +   GS+   WA++      ++ 
Sbjct  664  MWQSRGQQLQTEALRSGRLTDSLKSDLVMQGIISMLSF---GSSDRGWAVIGTGSAGMSK  720

Query  493  DMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEK  314
              G+ M   +NE+  W       GF  A  +  + +   +      H    L  P+    
Sbjct  721  ANGEHMFRSLNEFNLWNRRVNEIGFVPALNEYLDGVYKQAP-----HHCTNLILPAT-GL  774

Query  313  IPNTQSCPQCNHNMHKLVTFSCC  245
            +P T +C +C   M +   F CC
Sbjct  775  MPETVACAECGRLMERFTMFRCC  797



>ref|XP_004504145.1| PREDICTED: uncharacterized protein LOC101504285 isoform X3 [Cicer 
arietinum]
Length=704

 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 63/257 (25%), Positives = 116/257 (45%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y ++S  E+ L  +E+W L L+   I     + +W+   +YI L GG++ + +++    
Sbjct  466  AYPFSSLKEEALWKEETWGLALLADTI--DESLFEWVSAGKYICLYGGDDIEWIRKFTSS  523

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             + +   +Q+   I+Y+G+S       + IR  + T+  E+             FW RL+
Sbjct  524  AKSMAKTLQIPLEIMYVGKSNPG----EKIRKINKTINEEKLSNVLAYPTINWFFWVRLE  579

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q     G    +D+IM  + ++L +++       WA++S+    +    GD  
Sbjct  580  SMWHSKLQ----QGNTVENDQIMLEIVRILSFDSSDQG---WAVISQGTVKMTQGKGDSF  632

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + E+E+WKDNA+  G   A  D  + + +        H    L  P    + P    
Sbjct  633  LKCVVEFEEWKDNAKDKGVLAAMDDYIQGIQTP-------HHCNRLILPGVDGRTPEQII  685

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K   + CC
Sbjct  686  CAECRQPMEKFYMYRCC  702



>ref|XP_004504143.1| PREDICTED: uncharacterized protein LOC101504285 isoform X1 [Cicer 
arietinum]
 ref|XP_004504144.1| PREDICTED: uncharacterized protein LOC101504285 isoform X2 [Cicer 
arietinum]
Length=706

 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 63/257 (25%), Positives = 116/257 (45%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y ++S  E+ L  +E+W L L+   I     + +W+   +YI L GG++ + +++    
Sbjct  468  AYPFSSLKEEALWKEETWGLALLADTI--DESLFEWVSAGKYICLYGGDDIEWIRKFTSS  525

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             + +   +Q+   I+Y+G+S       + IR  + T+  E+             FW RL+
Sbjct  526  AKSMAKTLQIPLEIMYVGKSNPG----EKIRKINKTINEEKLSNVLAYPTINWFFWVRLE  581

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q     G    +D+IM  + ++L +++       WA++S+    +    GD  
Sbjct  582  SMWHSKLQ----QGNTVENDQIMLEIVRILSFDSSDQG---WAVISQGTVKMTQGKGDSF  634

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + E+E+WKDNA+  G   A  D  + + +        H    L  P    + P    
Sbjct  635  LKCVVEFEEWKDNAKDKGVLAAMDDYIQGIQTP-------HHCNRLILPGVDGRTPEQII  687

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K   + CC
Sbjct  688  CAECRQPMEKFYMYRCC  704



>ref|XP_006351433.1| PREDICTED: uncharacterized protein LOC102598958 [Solanum tuberosum]
Length=723

 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 67/258 (26%), Positives = 122/258 (47%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +T   E++L + ESW L+LVV  I     +  W+   ++I L GG +   ++     
Sbjct  485  AYPFTISKEESLWNMESWRLELVVDGI--DPNLIDWMASGKFICLYGGEDMDWIRNFTKS  542

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +  +  ++ +++Y+G+S     +++ +R  +S +T+E           +  FWTR++
Sbjct  543  ARSVAQRAGIDLQMLYVGKSN----NKERVRRINSMITAENLSYCLMDLTSVWYFWTRIE  598

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q    +G     D++MQ V  +L +  +GS  G WAL+S+    +A      +
Sbjct  599  SMFYSKMQ----LGKTIQEDKVMQEVLTMLSF--DGSDQG-WALISRGSFEMARAKSQII  651

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQ  299
               + +Y  W+++A+  GF  A     E  L   +P   QH  C  L  P     IP   
Sbjct  652  TKTLEDYTIWEEDARSKGFVPAL---IEYFLQLHTP---QH--CNRLILPGLDGDIPEMI  703

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M +   + CC
Sbjct  704  VCAECGRAMERFFMYRCC  721



>gb|ADN32810.1| sieve element occlusion a [Solanum phureja]
Length=723

 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 67/258 (26%), Positives = 122/258 (47%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +T   E++L + ESW L+LVV  I     +  W+   ++I L GG +   ++     
Sbjct  485  AYPFTISKEESLWNMESWRLELVVDGI--DPNLIDWMASGKFICLYGGEDMDWIRNFTKS  542

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             + +  +  ++ +++Y+G+S     +++ +R  +S +T+E           +  FWTR++
Sbjct  543  ARSVAQRAGIDLQMLYVGKSN----NKERVRRINSMITAENLSYCLMDLTSVWYFWTRIE  598

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q    +G     D++MQ V  +L +  +GS  G WAL+S+    +A      +
Sbjct  599  SMFYSKMQ----LGKTIQEDKVMQEVLTMLSF--DGSDQG-WALISRGSFEMARAKSQII  651

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQ  299
               + +Y  W+++A+  GF  A     E  L   +P   QH  C  L  P     IP   
Sbjct  652  TKTLEDYTIWEEDARSKGFVPAL---IEYFLQLHTP---QH--CNRLILPGLDGDIPEMI  703

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M +   + CC
Sbjct  704  VCAECGRAMERFFMYRCC  721



>ref|XP_003590760.1| Sieve element-occluding protein [Medicago truncatula]
 gb|ADN32808.1| sieve element occlusion c [Medicago truncatula]
 gb|AES61011.1| sieve element occlusion protein [Medicago truncatula]
Length=671

 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 58/255 (23%), Positives = 109/255 (43%), Gaps = 44/255 (17%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELI-  815
            +++ +T + E  +    +W +  VV +I     I  W +  ++IF  GG++ + +Q+   
Sbjct  447  KAFPFTMDDEIRIQKDRNWIVS-VVGNI--DRNISIWTEQNKHIFFYGGHDKEWIQQFTK  503

Query  814  ----LKIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMA  647
                L       + +++  + Y+ +  K                    +  FW+ ++S+ 
Sbjct  504  YATALANDATIKEAKISIELFYVDKEDKNL------------------VSRFWSGIESLF  545

Query  646  SSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGV  467
             ++I         + +D + Q V+K+L Y+ E      WALLSK   ++    G  +L  
Sbjct  546  VTKIH--------KTTDVVTQEVQKMLSYKNETG----WALLSKGPSVVLSGHGTTILKT  593

Query  466  MNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQ  287
            + E+EKWKD     GF+ AF + +      ++     H    L  P    K+P T  CP 
Sbjct  594  VAEFEKWKDVVIKKGFEFAFTEYH------TNVARVTHRCSHLEIPIVAGKLPETIKCPD  647

Query  286  CNHNMHKLVTFSCCH  242
            C   M   +++ CCH
Sbjct  648  CPSTMEIFISYKCCH  662



>ref|XP_008221943.1| PREDICTED: uncharacterized protein LOC103321871 [Prunus mume]
Length=843

 Score = 79.7 bits (195),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 63/263 (24%), Positives = 117/263 (44%), Gaps = 29/263 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L ++E+W ++L+   I     +  WI + +YI L GG + + ++     
Sbjct  593  AFPFTSSKEKLLWEEETWRIELLADSI--DQNLINWIAEGKYICLYGGEDMEWIRNFTRA  650

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ--------RIKEFWTRLQS  653
             +++ ++  +   ++Y+G+S      E V++   + +  E+         I  FW RL+S
Sbjct  651  AKKVAAESGIQLELLYVGKSKP---KEKVVKNIMTAIQFEKLSHTLEWNLIWFFWVRLES  707

Query  652  MASSRIQYLLKMGLDEG-------SDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIAC  494
            M  SR Q L    L  G       SD +MQG+  +L +   GS+   WA++      ++ 
Sbjct  708  MWQSRGQQLQTEALRSGRLTDSLKSDAVMQGIISMLSF---GSSDRGWAVIGTGSAGMSK  764

Query  493  DMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEK  314
              G+ M   +NE+  W       GF  A  +  + +   +      H    L  P+    
Sbjct  765  ANGEHMFKSLNEFNLWNRRVNEIGFVPALNEYLDGVYKQAP-----HHCTNLILPAT-GL  818

Query  313  IPNTQSCPQCNHNMHKLVTFSCC  245
            +P T +C +C   M +   F CC
Sbjct  819  MPETVACAECGRLMERFTMFRCC  841



>ref|XP_010695991.1| PREDICTED: uncharacterized protein LOC104908569 [Beta vulgaris 
subsp. vulgaris]
Length=698

 Score = 79.7 bits (195),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 118/257 (46%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E++L  +ESW L+L V  I  R  I  WI   +YI + GG +   ++     
Sbjct  460  AFPFTTMKEESLWREESWRLELFVDSIEPR--ILDWIPQGKYICVYGGEDIDWIRAFTDN  517

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
             +++ +   ++  ++Y+G++      ++ +R     ++ E           +  FWTRL+
Sbjct  518  AKQVAATAGIDLELMYVGKTNA----KERMRKITGNISEENLSHFLPDLTSMWYFWTRLE  573

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
             M  S++Q+    G     D IMQ V  +L ++  GS  G WA +      +A   GD +
Sbjct  574  CMLYSKMQH----GRSVERDIIMQEVMTVLSFD--GSDQG-WATMWFGSHEMARGKGDTI  626

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L     +++W++NA+I GF  A K+  + + +        H    L  P     IP +  
Sbjct  627  LECFQMFQEWEENARIKGFLPALKEHLQQLHTP-------HHCNRLILPGVEGGIPESVV  679

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K   + CC
Sbjct  680  CAECGRTMEKYFMYRCC  696



>ref|NP_001241224.1| uncharacterized protein LOC100794293 [Glycine max]
 gb|ADN32801.1| sieve element occlusion s [Glycine max]
Length=669

 Score = 79.7 bits (195),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 54/250 (22%), Positives = 113/250 (45%), Gaps = 34/250 (14%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            R++ +T+  E+ ++ +  W   ++ S       I   I +++YIF  GGN+   +Q+   
Sbjct  445  RAFPFTTLNEEKINSENDWVGSVLGS---IHPSISTSIKEQKYIFFYGGNDKDWIQQFTK  501

Query  811  KIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMASSRIQ  632
             +  + +   +        +  K   +   +   D ++     ++ FW+ ++S+  +++ 
Sbjct  502  YVTALANDAAI--------KEAKISIELFCVDKEDKSL-----VRRFWSGIESLFVTKVH  548

Query  631  YLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMNEYE  452
                    + +D + Q V+K+L Y+ E      W+LLSK   ++    G  +L  + E+E
Sbjct  549  --------KQADAVTQEVQKMLSYKNETG----WSLLSKGPSVVVSGHGTTILKTVAEFE  596

Query  451  KWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQCNHNM  272
            KWK+     GF   FK+ ++ ++ ++      H    L  P+   K+P T  C  C   M
Sbjct  597  KWKEVVIKKGFAVTFKEYHQKIVGTT------HRCSHLEIPNVAGKLPETIKCSDCPRVM  650

Query  271  HKLVTFSCCH  242
               +++ CCH
Sbjct  651  EIFISYKCCH  660



>ref|XP_010026936.1| PREDICTED: uncharacterized protein LOC104417333 [Eucalyptus grandis]
 gb|KCW83234.1| hypothetical protein EUGRSUZ_B00175 [Eucalyptus grandis]
Length=713

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/258 (26%), Positives = 110/258 (43%), Gaps = 27/258 (10%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T E E+ L  +ESW L L++ D L    I KW +   YI L GG +   +++    
Sbjct  471  AFPFTKEREEALWKEESWKLSLII-DGLDDGTISKWTEQGSYICLYGGEDLGWIRKFTNA  529

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSE---------QRIKEFWTRLQ  656
             + +     +   ++Y+G+S      ++ ++   + +TSE         +    FW RL+
Sbjct  530  AKNVAKIANIPLGMIYLGKSNA----KERVKRIAAAITSENLSHCWKDPRYFWFFWARLE  585

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALL-SKEKGIIACDMGDK  479
            SM  S++Q+    G+   +D +M  +  +L Y  +GS  G WA+     +  +A      
Sbjct  586  SMLHSKLQH----GMSTENDPVMHEIMTILSY--DGSDQG-WAIFCHAAEPTMARAKAKN  638

Query  478  MLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
            +L  M E   WKD     GF  A +D        S      H    L  P     IP   
Sbjct  639  VLDSMEEINDWKDGIDEKGFIPALQDHLRQKEIDSP-----HHCSRLILPGIDGGIPERV  693

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K + + CC
Sbjct  694  VCAECGRVMEKFIMYRCC  711



>gb|KEH35012.1| sieve element occlusion protein [Medicago truncatula]
Length=706

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 69/258 (27%), Positives = 115/258 (45%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TSE E++L  +E WSL+L+V  I     +  W+ + + I L GG + + ++     
Sbjct  468  AFPFTSEKEESLWKQEIWSLELLVDGI--DPALLDWMTEGKIICLYGGEDLEWIETFTKT  525

Query  808  IQEICSKIQMNWRIVYIGRSGK--------TFFDEDVIRMCDSTVTSEQRIKEFWTRLQS  653
               +         +VY+G+S          T F+          VTS   I  FW RL+S
Sbjct  526  AMNVARTSNFELEMVYVGKSNAKERMQRMITTFNNKKFSYFFPNVTS---IWFFWARLES  582

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S++Q+    G    +D+IM  V  +L +  +GS  G WA+  +    +A   GD  L
Sbjct  583  MLYSKLQH----GRTVENDKIMSEVMTVLSF--DGSDRG-WAIFCRGPSEMARAKGDTAL  635

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHP-YC-FLNYPSNLEKIPNTQ  299
              + +++KWK   + +G+  A  D  + +         Q P +C  L  P +   IP   
Sbjct  636  TSLRDFDKWKHRIEQDGWVPALNDYIKEI---------QQPHHCNRLILPGSTGGIPQKV  686

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K   + CC
Sbjct  687  VCAECGRQMEKYFMYRCC  704



>gb|KHN13158.1| hypothetical protein glysoja_040438 [Glycine soja]
Length=669

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/252 (22%), Positives = 113/252 (45%), Gaps = 38/252 (15%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDIL--YRSEIDKWIDDEEYIFLCGGNNNKQVQEL  818
            R++ +T+  E+ ++ +  W     V  +L      I   I +++YIF  GGN+   +Q+ 
Sbjct  445  RAFPFTTLNEEQINRENDW-----VGPVLGGIHPSISTSIKEQKYIFFYGGNDKDWIQQF  499

Query  817  ILKIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMASSR  638
               +  + +   +        +  K   +   +   D ++     ++ FW+ ++S+  ++
Sbjct  500  TKYVTALANDAAI--------KEAKISIELFCVDKEDKSL-----VRRFWSGIESLFVTK  546

Query  637  IQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMNE  458
            +         + +D + Q V+K+L Y+ E      W+LLSK   ++    G  +L  + E
Sbjct  547  VH--------KQADAVTQEVQKMLSYKNETG----WSLLSKGPSVVVSGHGTTILKTVAE  594

Query  457  YEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQCNH  278
            +EKWK+     GF   FK+ ++ ++ ++      H    L  P+   K+P T  C  C  
Sbjct  595  FEKWKEVVIKKGFAVTFKEYHQKIVGTT------HRCSHLEIPNVAGKLPETIKCSDCPR  648

Query  277  NMHKLVTFSCCH  242
             M   +++ CCH
Sbjct  649  VMEIFISYKCCH  660



>emb|CAN83923.1| hypothetical protein VITISV_026533 [Vitis vinifera]
Length=673

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 115/260 (44%), Gaps = 31/260 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ ++   E+ L  + +W ++L+ + I     I  WI + +YI L GG++ + +Q     
Sbjct  431  AFPFSKSREEGLWKEVTWGIELLAAAI--HPMIVDWISEGKYICLYGGDDIEWIQRFTDV  488

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDS--------TVTSEQRIKEFWTRLQS  653
             + + S   +   ++Y+G+S      E V +  DS         +     +  FW RL+S
Sbjct  489  AKAVESAADIKLEMLYVGKSN---LREKVRKNNDSIAQENLSHVLPDLSSVWFFWARLES  545

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSK---EKGIIACDMGD  482
            M  S++Q+    G +   D IMQ +  +L ++  G   G WA+  +   E   +    GD
Sbjct  546  MWHSKVQH---GGENAERDPIMQEIVSMLSFD--GGDHG-WAVFGRGWGEMSQMTKAKGD  599

Query  481  KMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPN  305
             ++G + +Y  WK+N    GF  A  D          P  +   +C  L  P    + P+
Sbjct  600  TIVGCLRDYHVWKNNIATKGFVGAVNDYL--------PQLHTPHHCNRLVLPGTTGRTPD  651

Query  304  TQSCPQCNHNMHKLVTFSCC  245
              +C +C   M K + + CC
Sbjct  652  RVACAECGRPMEKFIMYRCC  671



>ref|XP_002282165.1| PREDICTED: uncharacterized protein LOC100266247 [Vitis vinifera]
Length=712

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 115/260 (44%), Gaps = 31/260 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ ++   E+ L  + +W ++L+ + I     I  WI + +YI L GG++ + +Q     
Sbjct  470  AFPFSKSREEGLWKEVTWGIELLAAAI--HPMIVDWISEGKYICLYGGDDIEWIQRFTDV  527

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDS--------TVTSEQRIKEFWTRLQS  653
             + + S   +   ++Y+G+S      E V +  DS         +     +  FW RL+S
Sbjct  528  AKAVESAADIKLEMLYVGKSN---LREKVRKNNDSIAQENLSHVLPDLSSVWFFWARLES  584

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSK---EKGIIACDMGD  482
            M  S++Q+    G +   D IMQ +  +L ++  G   G WA+  +   E   +    GD
Sbjct  585  MWHSKVQH---GGENAERDPIMQEIVSMLSFD--GGDHG-WAVFGRGWGEMSQMTKAKGD  638

Query  481  KMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPN  305
             ++G + +Y  WK+N    GF  A  D          P  +   +C  L  P    + P+
Sbjct  639  TIVGCLRDYHVWKNNIATKGFVGAVNDYL--------PQLHTPHHCNRLVLPGTTGRTPD  690

Query  304  TQSCPQCNHNMHKLVTFSCC  245
              +C +C   M K + + CC
Sbjct  691  RVACAECGRPMEKFIMYRCC  710



>gb|KHN07967.1| hypothetical protein glysoja_039841 [Glycine soja]
Length=550

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 114/256 (45%), Gaps = 27/256 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TSE E++L  +E WSL+L+V  I     + +W+ + + I L GG + + +++    
Sbjct  312  AFPFTSEKEESLWKQEIWSLELLVDGI--DPTVLEWMTEGKLICLYGGEDLEWIEKFTAT  369

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSE--------QRIKEFWTRLQS  653
               +    +    + Y G+S      E + +M  +  T +          I  FWTRL+S
Sbjct  370  AISVAKAGKFELEMAYAGKSNA---KERMQKMIKTFTTRKFSYFWPNVTSIWFFWTRLES  426

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S++ +    G     DEIM  V  +L +  +GS  G WA+  +    +A   GD  L
Sbjct  427  MLYSKLLH----GRTVEKDEIMSEVMTVLSF--DGSDRG-WAIFCRGATEMARAKGDSAL  479

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSC  293
              + +++KWK   + +G   A  D     L+ + P    H    L  P +   IP    C
Sbjct  480  RCLQDFDKWKGRIEEDGVVHAIND----YLNKNKPP---HHCNRLILPGSTGGIPQKVVC  532

Query  292  PQCNHNMHKLVTFSCC  245
             +C   M K   + CC
Sbjct  533  AECGRQMEKYFMYRCC  548



>gb|KDP46376.1| hypothetical protein JCGZ_10216 [Jatropha curcas]
Length=1116

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/243 (28%), Positives = 116/243 (48%), Gaps = 33/243 (14%)
 Frame = -3

Query  937   WSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILKIQEICSKIQMNWRIVYI  758
             WSL L+V ++  R  I KW++++  + L GG +   ++      +E+     ++  ++Y+
Sbjct  893   WSLDLIVDELNPR--IRKWVENDYIVCLYGGGDINWIKNFTRTAKEVSKSATIHLEMLYV  950

Query  757   GRSG---------KTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMASSRIQYLLKMGLDE  605
             G+S          ++F +E++  +    +     +  FW R++SM  SR Q +  +   E
Sbjct  951   GKSNLNHRGWRNIESFEEEELSHVWRDRLG----LIWFWYRIKSMWLSRYQIVKTI---E  1003

Query  604   GSDEIMQGVKKLLVYEAEGSTVGVWALLSK--EKGIIACDMGDKMLGVMNEYEKWKDNAQ  431
             G DEIMQ +  LL +++  S  G WA+++K  + G+IA   G   L  ++ +E WK+ A 
Sbjct  1004  G-DEIMQELTTLLSFDS--SECG-WAIMNKGSKPGVIAKAKGSDFLDCLSNFENWKEEAS  1059

Query  430   INGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLEKIPNTQSCPQCNHNMHKLVTF  254
               GF    K   E +     P       CF L  P   E    T  C  C+ +M + +TF
Sbjct  1060  QKGFVPTLK---EKLTHLHKPED-----CFQLVLPELAETKLETGECCHCHRSMQRFITF  1111

Query  253   SCC  245
              CC
Sbjct  1112  KCC  1114



>gb|ADN32812.1| sieve element occlusion c [Solanum phureja]
Length=818

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 116/258 (45%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E  L  +++W+++L+   I     +  WI + + I L GG + + ++     
Sbjct  579  AFPFTKARETALWKEQTWNIELLADSI--DQNVFTWISEGKCICLYGGEDIEWIRSFTSA  636

Query  808  IQEICSKIQMNWRIVYIGRSG---KTFFDEDVIRM--CDSTVTSEQRIKEFWTRLQSMAS  644
             + + +  ++   ++Y+G+     +   +  +I+M      V  +  I  FW RL+SM  
Sbjct  637  TRAVANAARVPLEMLYVGKKNPKERVRKNSSIIQMENLSHVVQDQTLIWFFWERLESMWH  696

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            SR Q      +   +D I+Q +  +L Y+  GS +G WA+ S+    +    GD ++ VM
Sbjct  697  SRTQ----QDIPGETDPILQEIVTILSYD--GSDLG-WAVFSRGLAEMTRGKGDLIVQVM  749

Query  463  NEYEKWKDNAQ-----INGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
              +++W+D        +   DR  +D +       SP    H    L  PS    +P   
Sbjct  750  KGFDRWRDEVSDITTFVPALDRQLRDLH-------SP----HHCTRLILPSTTGHVPERV  798

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C+  M K + + CC
Sbjct  799  VCAECSRPMEKFIMYRCC  816



>ref|NP_001241461.1| uncharacterized protein LOC100789215 [Glycine max]
 gb|ADN32786.1| sieve element occlusion d [Glycine max]
Length=705

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 114/256 (45%), Gaps = 27/256 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TSE E++L  +E WSL+L+V  I     + +W+ + + I L GG + + +++    
Sbjct  467  AFPFTSEKEESLWKQEIWSLELLVDGI--DPTVLEWMTEGKLICLYGGEDLEWIEKFTAT  524

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSE--------QRIKEFWTRLQS  653
               +    +    + Y G+S      E + +M  +  T +          I  FWTRL+S
Sbjct  525  AISVAKAGKFELEMAYAGKSNA---KERMQKMIKTFTTRKFSYFWPNVTSIWFFWTRLES  581

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S++ +    G     DEIM  V  +L +  +GS  G WA+  +    +A   GD  L
Sbjct  582  MLYSKLLH----GRTVEKDEIMSEVMTVLSF--DGSDRG-WAIFCRGATEMARAKGDSAL  634

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSC  293
              + +++KWK   + +G   A  D     L+ + P    H    L  P +   IP    C
Sbjct  635  RCLQDFDKWKGRIEEDGVVHAIND----YLNKNKPP---HHCNRLILPGSTGGIPQKVVC  687

Query  292  PQCNHNMHKLVTFSCC  245
             +C   M K   + CC
Sbjct  688  AECGRQMEKYFMYRCC  703



>ref|XP_010250966.1| PREDICTED: uncharacterized protein LOC104593030 [Nelumbo nucifera]
Length=747

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 112/268 (42%), Gaps = 32/268 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+  E++L  +++W L  VV  I     I  W+ +  Y+ L GG + + +++ +  
Sbjct  490  AFPFTTAKEESLWKEQTWRLDFVVDGI--DPTILNWVAEGRYVCLYGGEDLEWIEKFVTA  547

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTV-----TSEQRIKEFWTRLQSMAS  644
             + +  +  +    VY+G+S        +I    +       T    I  FW RLQSM  
Sbjct  548  ARYVAQEENIPLEFVYVGKSKPRLPLSRIIDFIKAKNLGNYWTERTLIWFFWARLQSMYY  607

Query  643  SRIQYLLKMGLDEG--------------SDEIMQGVKKLLVYEAEGSTVGVWALLSKEKG  506
            S+ Q   K   D                SD +M  +  +L +++       WA++S+   
Sbjct  608  SKTQLPSKTTTDNDNKIQQHLPSSKTSESDHVMHEIMNMLSFDSSDQG---WAIISRGTA  664

Query  505  IIACDMGDKMLGVMNEYEKWKDNAQI-NGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYP  329
             ++   GD++   +++Y  WK +     G   A  D        S PT  +H    L  P
Sbjct  665  EMSRSKGDQIYSSISQYNDWKVHIPTKGGVIPALNDHLH-----SHPT--EHHCNRLILP  717

Query  328  SNLEKIPNTQSCPQCNHNMHKLVTFSCC  245
              + +IP T  C +C   M K + + CC
Sbjct  718  GTVGRIPETVPCSECTRPMEKYILYRCC  745



>ref|XP_004239152.1| PREDICTED: uncharacterized protein LOC101249174 [Solanum lycopersicum]
Length=795

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 115/258 (45%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E  L  ++SW+++L+   I     I  WI + + I L GG + + ++     
Sbjct  556  AFPFTKARETALWKEQSWNIELLADSI--DQNIFTWISEGKCICLYGGEDIEWIRSFTSS  613

Query  808  IQEICSKIQMNWRIVYIGRSG---KTFFDEDVIRM--CDSTVTSEQRIKEFWTRLQSMAS  644
             + + +  ++   ++Y+G+     +   +  +I+M      V  +  I  FW RL+SM  
Sbjct  614  TRAVANAARVPLEMLYVGKKNPKERVRKNSSIIQMENLSHVVQDQTLIWFFWERLESMWH  673

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            SR Q      +   SD I+Q +  +L Y+  GS +G WA+ S+    +    GD ++ VM
Sbjct  674  SRTQ----QDIPGESDPILQEIVTILSYD--GSDLG-WAVFSRGLAEMTRGKGDLIVQVM  726

Query  463  NEYEKWKDNAQ-----INGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
              +++W++        +   DR  +D +       SP    H    L  PS    IP   
Sbjct  727  KGFDRWRNEVSDITTFVPALDRQLRDLH-------SP----HHCTRLILPSTSGHIPERV  775

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K + + CC
Sbjct  776  VCAECGRPMDKFIMYRCC  793



>ref|XP_006446667.1| hypothetical protein CICLE_v10015478mg [Citrus clementina]
 gb|ESR59907.1| hypothetical protein CICLE_v10015478mg [Citrus clementina]
Length=403

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 97/203 (48%), Gaps = 23/203 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +++  E+ L  +E+W L+L+V  +     I  W+ +  YI L GG +   +++    
Sbjct  214  AYPFSTAREEALWREETWRLELLVDGL--DPVILNWMAEGRYICLYGGEDMDWIRKFTAA  271

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
               +     +   +VY+G+S      +D +R  + T+ SE           I  FW RL+
Sbjct  272  TNAVAKTAGIPLGMVYVGKSNP----KDRVRRNNDTIASENLSHIWQDLTSIWYFWVRLE  327

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q    +G +  +D +MQ + ++L Y+   S+ G WA+ ++    +A   G   
Sbjct  328  SMWYSKVQ----LGRNAETDHVMQEIMRMLTYD---SSEGGWAVFARGSAEMASAKGAIF  380

Query  475  LGVMNEYEK-WKDNAQINGFDRA  410
            L  M EY   WKD  +  GF  A
Sbjct  381  LTCMQEYNTVWKDQVEPKGFMPA  403



>gb|KHG12713.1| hypothetical protein F383_04328 [Gossypium arboreum]
Length=762

 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 90/170 (53%), Gaps = 15/170 (9%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L  +E+W L L+V  I     +  WI +E+YIFL GG++ + ++     
Sbjct  601  AFPFTSLREEALWREETWRLDLLVDGI--DPTVLTWIKEEKYIFLYGGDDIEWIRRFANS  658

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTS-----EQRIKEFWTRLQSMAS  644
             + + S  ++   +VY+G+S K    + V  + ++   S     +  I  FW+RL+SM  
Sbjct  659  ARSVASASRIPLEMVYVGKSNKREQVKKVTGIINAEKLSYAWQDQAMIWFFWSRLESMLF  718

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIAC  494
            S+IQ    +G  +  D ++Q +KKLL Y  EG     WA+LS+   I+  
Sbjct  719  SKIQ----LGRGDDQDPMLQQIKKLLSYGREGG----WAVLSRGSNIVTT  760



>ref|XP_009403632.1| PREDICTED: uncharacterized protein LOC103987147 [Musa acuminata 
subsp. malaccensis]
Length=699

 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 61/259 (24%), Positives = 119/259 (46%), Gaps = 31/259 (12%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            +++ +TS  E+ L  +E W L+ +V +I     +  W+ +  ++ L GG   + ++E   
Sbjct  460  QAFPFTSNREEALWKEELWRLEFLVDEI--DPIMLGWVKEGRHVCLYGGEKIEWIREFTN  517

Query  811  KIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRL  659
             ++ +  +  +   +VY+G+S      ++ ++   + + +E+          +  FW RL
Sbjct  518  VMKRVSQEANIPIEMVYVGKSNP----KERVKKAINVIANEKLSGYWQDPVMVWFFWVRL  573

Query  658  QSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDK  479
            +SM  S++Q     G    +D IM+ V  +L ++  GS  G WA++S     +    G K
Sbjct  574  ESMWHSKMQS----GRTIDNDPIMREVMTMLSFD--GSDDG-WAIISHGSMDMVKSHGRK  626

Query  478  MLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLEKIPNT  302
            ++  + +++ WK + Q  GF  A     E          + H +C  L  P +  +I   
Sbjct  627  IIDCLLQFDSWKGSVQEQGFVPALTGALE--------PYHTHEHCTRLILPGDTGRITEQ  678

Query  301  QSCPQCNHNMHKLVTFSCC  245
              C +CN  M K V + CC
Sbjct  679  VVCAECNRPMEKFVLYRCC  697



>gb|KEH20741.1| sieve element occlusion protein [Medicago truncatula]
Length=704

 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 118/259 (46%), Gaps = 33/259 (13%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y ++S  E+ L   E+W L L+   I     +  W+   +YI L GG++ + +++    
Sbjct  466  AYPFSSLREEALWKDETWGLALLADTI--DPLLFDWVTAGKYICLYGGDDMEWIRKFTSA  523

Query  808  IQEICSKIQMNWRIVYIGRS---------GKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQ  656
             + +   +Q+   ++Y+G+S          KT +DE++     + +T    I  FW RL+
Sbjct  524  AKSMARTLQIPLEMMYVGKSNPGQKVKRINKTIYDENL----SNVLTDPTIIWFFWVRLE  579

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++Q          +D+IM  + ++L +++  S +G WA+LS+    +    GD  
Sbjct  580  SMWHSKLQ----QSKTVENDQIMLEIMRILSFDS--SDLG-WAVLSQGTVRMTQGKGDSF  632

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHP-YC-FLNYPSNLEKIPNT  302
            L  ++E ++WK +    G   A  D  +           Q P +C  L  P     IP+ 
Sbjct  633  LKCLDELDEWKGDVNDKGVLTAMDDYIQ---------GIQQPHHCNRLILPGVDGTIPDK  683

Query  301  QSCPQCNHNMHKLVTFSCC  245
              C +C   M K   + CC
Sbjct  684  IVCAECGQPMEKFYMYRCC  702



>ref|XP_002515051.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47605.1| conserved hypothetical protein [Ricinus communis]
Length=701

 Score = 77.0 bits (188),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 65/263 (25%), Positives = 118/263 (45%), Gaps = 37/263 (14%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L   E+W + L+   I     I  WI   +YI L GG + + +++  + 
Sbjct  459  AFPFTSVREEALWRAENWKIDLLADTI--DPIIHSWIQQGKYICLYGGEDIEWIRKFTMT  516

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
               +     ++  ++Y+G+S       + +R  +  + +E+          I  FW RL+
Sbjct  517  ANALAQAAGIDLEMLYVGKSNP----REKVRKNNIIIQNEKLSHVLQDLTLIWFFWVRLE  572

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGI----IACDM  488
            SM  S++Q+         +D IMQ +  +L +  +GS  G WA++SK  G     +A   
Sbjct  573  SMWHSKVQH----NRTVENDIIMQEIVTMLSF--DGSDQG-WAVISKGSGAENRQLAKAK  625

Query  487  GDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHP-YC-FLNYPSNLEK  314
            G  +L   ++Y+ W++ A+  GF  A  D             + +P +C  L  P     
Sbjct  626  GSDILNCFDDYQSWREIAEEEGFVPAILDYLH---------GHHNPLHCNRLILPGTTGS  676

Query  313  IPNTQSCPQCNHNMHKLVTFSCC  245
            IP    C +C+  M K + + CC
Sbjct  677  IPEKVVCAECSRPMEKFIMYRCC  699



>gb|KEH42743.1| sieve element occlusion protein [Medicago truncatula]
Length=664

 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 117/258 (45%), Gaps = 52/258 (20%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEID-KWIDDEEYIFLCGGNNNKQVQELI  815
            + + +T   E++++ +  W     V  +L   +I  KW +D+  + +CGG + + +Q+  
Sbjct  449  KGFPFTKTKEESMTQELMW-----VDSVLVGIDIKIKWREDD-IVIICGGKDKEWIQQFT  502

Query  814  LKIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVT-----SEQR--IKEFWTRLQ  656
                             Y G       ++  I+  ++++      S+Q+  +  FW +++
Sbjct  503  K----------------YFG----ALVNDATIKQTNTSIELICLESQQQNVVNTFWKKVE  542

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            S+  ++        + E ++ + Q V+KLL Y+ E      WA+++K   +IA   G  +
Sbjct  543  SLFVTK--------MHEKTNSVTQQVEKLLSYKNESG----WAIVTKGSIVIAVGHGTTV  590

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L    E+  WK +    GF+ +F++ +  + SS    S+      L  P+   KIP+   
Sbjct  591  LKTFAEFGTWKGDVSTKGFEHSFREYHNTIASSVHICSH------LEIPNVDGKIPDFIK  644

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP C+  M   +++ CCH
Sbjct  645  CPDCHRTMEVYISYKCCH  662



>ref|XP_006341794.1| PREDICTED: uncharacterized protein LOC102602329 [Solanum tuberosum]
Length=811

 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/258 (23%), Positives = 116/258 (45%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E  L  +++W+++L+   I     +  WI + + I L GG + + ++     
Sbjct  572  AFPFTKARETALWKEQTWNIELLADSI--DQNVFTWISEGKCICLYGGEDIEWIRSFTSA  629

Query  808  IQEICSKIQMNWRIVYIGRSG---KTFFDEDVIRM--CDSTVTSEQRIKEFWTRLQSMAS  644
             + + +  ++   ++Y+G+     +   +  +I++      V  +  I  FW RL+SM  
Sbjct  630  TRAVANAARVPLEMLYVGKKNPKERVRKNSSIIQIENLSHVVQDQTLIWFFWERLESMWH  689

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            SR Q      +   +D I+Q +  +L Y+  GS +G WA+ S+    +    GD ++ VM
Sbjct  690  SRTQ----QDIPGETDPILQEIVTILSYD--GSDLG-WAVFSRGLAEMTRGKGDLIVQVM  742

Query  463  NEYEKWKDNAQ-----INGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
              +++W+D        +   DR  +D +       SP    H    L  PS    +P   
Sbjct  743  KGFDRWRDEVSDVTTFVPALDRQLRDLH-------SP----HHCTRLILPSTTGHVPERV  791

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C+  M K + + CC
Sbjct  792  VCAECSRPMEKFIMYRCC  809



>ref|XP_006438201.1| hypothetical protein CICLE_v10030843mg [Citrus clementina]
 gb|ESR51441.1| hypothetical protein CICLE_v10030843mg [Citrus clementina]
Length=706

 Score = 76.6 bits (187),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 63/257 (25%), Positives = 116/257 (45%), Gaps = 30/257 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ ++   E+ L  +E+W + L+   +     I  WI ++++I L GG + + +++    
Sbjct  469  AFPFSVAREEALWKEETWRIDLLADSV--DPVIPTWIMEQKHICLYGGEDLEWIRKFTAL  526

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR---------IKEFWTRLQ  656
            +  +     +   ++Y+G+S      ++ +R   ST+T E+          I  FW RL+
Sbjct  527  MGAVARAAGIALEMLYVGKSNP----KEKVRRSISTITVEKLSHTLPDPTLIWFFWVRLE  582

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+    +K G     D IMQ +  +L ++  GS  G WA++S+   + A    + +
Sbjct  583  SMWHSK----MKFGRKVQQDPIMQEIVTMLSFD--GSDQG-WAVISRGPHM-AKAKDETI  634

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY KW+ N     F  A  D     L+ + P    H    L  P    +IP    
Sbjct  635  LKCLTEYNKWEPNVPEKSFVVAMND----YLNENRPP---HHCNRLILPGEAGRIPEKVV  687

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M + + + CC
Sbjct  688  CAECGRRMEEFIMYRCC  704



>gb|KDO40196.1| hypothetical protein CISIN_1g046837mg [Citrus sinensis]
Length=658

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 111/256 (43%), Gaps = 55/256 (21%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T+E E+ L  ++ W+L+L+V DI   + I +W+ +E +I L GGN+   +++    
Sbjct  448  AFPFTAETEEALWKEKPWTLELLVGDI--DATILEWMKEERFICLYGGNDEAWIRKFRNS  505

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE-----FWTRLQSMAS  644
             +++ SK Q+NW + Y+G+       E++      T +S   I       FW RL+ M  
Sbjct  506  AKDVASKAQINWGMAYVGKKNAKKRLEEISSSITKTESSHIVIDATKMWFFWARLERMLY  565

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
             ++Q+   MG  + +                          ++ KG  A D        M
Sbjct  566  WKLQH--GMGKTQET--------------------------ARAKGTAAID-------CM  590

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHP--YCFLNYPSNLE-KIPNTQSC  293
             ++ +W+D+A  NGF +A  +  + +          HP  +C     + +   IP T  C
Sbjct  591  EKFHEWQDDALRNGFIQALNNYLQKI----------HPGKHCNRLILAGVNGAIPGTVQC  640

Query  292  PQCNHNMHKLVTFSCC  245
              C  +M     + CC
Sbjct  641  ADCGRDMEMFFMYHCC  656



>ref|XP_011071161.1| PREDICTED: uncharacterized protein LOC105156657 [Sesamum indicum]
Length=768

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/261 (25%), Positives = 116/261 (44%), Gaps = 33/261 (13%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L    +W+++L+   I  R  I  WI +   I + GG++ + +++  L 
Sbjct  526  AFPFTKAQERALWADTTWNIQLLADAIDPR--IPDWIKENYVICIYGGDDIEWIRKFTLA  583

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ-----RIKE-------FWT  665
             +   + + ++  ++Y+G+       ++ +R+C   +  E+      + E       FW 
Sbjct  584  ARAAATSLHIHLEMLYVGKRNP----KEKVRLCHEVIDKEKLSNVFSVTEYYDYVWYFWV  639

Query  664  RLQSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMG  485
            RL SM +S+ Q    MG+   +D IMQ +  +L   A  S+   WA+ S+    I    G
Sbjct  640  RLWSMWNSKKQ----MGMTVENDRIMQEIMDVL---ALDSSEKGWAVFSRANFEITKSNG  692

Query  484  DKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIP  308
            DK+L V+  Y  W     I   D   K  + M+L       +   +C  L  P +   IP
Sbjct  693  DKLLPVLENYRDW-----IYKVDDPNK--FVMVLDEELKRVHPDHHCNRLILPGHAGYIP  745

Query  307  NTQSCPQCNHNMHKLVTFSCC  245
                C +C   M K V + CC
Sbjct  746  ERVVCSECGKTMDKYVMYRCC  766



>ref|XP_003590766.1| Sieve element-occluding protein [Medicago truncatula]
 gb|ADN32806.1| sieve element occlusion a [Medicago truncatula]
 gb|AES61017.1| sieve element occlusion protein [Medicago truncatula]
Length=664

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 117/258 (45%), Gaps = 52/258 (20%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEID-KWIDDEEYIFLCGGNNNKQVQELI  815
            + + +T   E++++ +  W     V  +L   +I  KW +D+  + +CGG + + +Q+  
Sbjct  449  KGFPFTKTKEESMTQELMW-----VDSVLVGIDIKIKWREDD-IVIICGGKDKEWIQQFT  502

Query  814  LKIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVT-----SEQR--IKEFWTRLQ  656
                             Y G       ++  I+  ++++      S+Q+  +  FW +++
Sbjct  503  ----------------KYFG----ALVNDATIKQTNTSIELICLESQQQNVVNTFWKKVE  542

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            S+  ++        + E ++ + Q V+KLL Y+ E      WA+++K   +IA   G  +
Sbjct  543  SLFVTK--------MHEKTNSVTQQVEKLLSYKNESG----WAIVTKGSIVIAVGHGTTV  590

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L    E+  WK +    GF+ +F++ +  + SS    S+      L  P+   KIP+   
Sbjct  591  LKTFAEFGTWKGDVSTKGFEYSFREYHNTIASSVHICSH------LEIPNVDGKIPDFIK  644

Query  295  CPQCNHNMHKLVTFSCCH  242
            CP C+  M   +++ CCH
Sbjct  645  CPDCHRTMEVYISYKCCH  662



>ref|XP_010040608.1| PREDICTED: uncharacterized protein LOC104429456 [Eucalyptus grandis]
Length=633

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 103/221 (47%), Gaps = 52/221 (24%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T E E+ L  +ESW+LKL++ D L    +++W+    YI L GG + + +++L   
Sbjct  87   AFPFTKEREEALWREESWTLKLII-DGLDDGTMEEWVRLGSYICLFGGEDLEWIRKLTAT  145

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR---------IKEFWTRLQ  656
             +E+     +   +VY+G+S      ++ +R   +T+TSE+             FW RL+
Sbjct  146  AKEVAKTAGIVLGMVYVGKSNS----KERVRRTAATITSEKLSYCWNDPRFFWLFWARLE  201

Query  655  SMASS---------------RIQYLLKMGL-DEGSDEIMQGVKKLLVYEAEGSTVGVWAL  524
            SM  S               RIQ +L  GL DEG     QGV   +V EAEG+ V     
Sbjct  202  SMLHSKVHLGNSIENDPLLPRIQTILNFGLSDEGWAVFCQGVGPDMV-EAEGNIV-----  255

Query  523  LSKEKGIIACDMGDKMLGVMNEYEKWKDNAQINGFDRAFKD  401
                            L  + E++KWKD+A   GF  A +D
Sbjct  256  ----------------LENLEEFDKWKDDANQKGFVNALRD  280



>ref|XP_010320950.1| PREDICTED: uncharacterized protein LOC101249457 isoform X2 [Solanum 
lycopersicum]
Length=694

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 115/258 (45%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E  L  +++W+++L+   I     +  WI + + I L GG + + ++     
Sbjct  455  AFPFTKARETALWKEQTWNVELLADSI--DQNVFTWISEGKCICLYGGEDIEWIRSFTSS  512

Query  808  IQEICSKIQMNWRIVYIGRSG---KTFFDEDVIRM--CDSTVTSEQRIKEFWTRLQSMAS  644
             + + +   +   ++Y+G+     +   +  +I+M      V  +  I  FW RL+SM  
Sbjct  513  TRAVANAAGVPLEMLYVGKKNPKERVRKNSSIIQMENLSHVVQDQTLIWFFWERLESMWH  572

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            SR Q      +   +D I+Q +  +L Y+  GS +G WA+ S+    +    GD ++ VM
Sbjct  573  SRTQ----QDIPGETDPILQEIVTILSYD--GSDLG-WAVFSRGLAEMTRGKGDLIVQVM  625

Query  463  NEYEKWKDNAQ-----INGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
              +++W++        +   DR  +D +       SP    H    L  PS    IP   
Sbjct  626  KGFDRWRNEVSDITTFVPALDRQLRDLH-------SP----HHCTRLILPSTSGHIPERV  674

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C+  M K + + CC
Sbjct  675  VCAECSRPMEKFIMYRCC  692



>ref|XP_011100417.1| PREDICTED: uncharacterized protein LOC105178604 [Sesamum indicum]
Length=665

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/245 (25%), Positives = 114/245 (47%), Gaps = 21/245 (9%)
 Frame = -3

Query  979  YTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILKIQE  800
            +T++ E  L   E+W ++L+++ ++  S ID W+ + ++I L GG + + +++    +  
Sbjct  438  FTAKREAELWANETWGVELLLNYVV-PSAID-WVKEGKHICLYGGTDIEWIRQFTSTLLG  495

Query  799  ICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMASSRIQYLLK  620
            +    Q+  +++++ +  K     + I   D      ++   FW RL S+  SR+Q    
Sbjct  496  VSQHAQIQLKMIHMDQRVKM---NNTIATSDDVTLDLKQTMAFWARLHSIWQSRVQS---  549

Query  619  MGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMNEYEKWKD  440
             G+   SDEI++ V K+      G     WA++S     +A  MGD +L  + EY+KWK+
Sbjct  550  -GMFPESDEIIRNVFKMFSLNQSGRG---WAIVSSGAKEMAIGMGDTVLKALLEYDKWKE  605

Query  439  NAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEK-IPNTQSCPQCNHNMHKL  263
            +    GF  A ++ Y   + +S        YC     S   + +P    C +C   M   
Sbjct  606  SVVSRGFVPALRE-YMTHVGTSI-------YCNTFAVSKTSRGLPEKMICFECRGQMKMS  657

Query  262  VTFSC  248
              F C
Sbjct  658  TRFVC  662



>ref|XP_010904539.1| PREDICTED: uncharacterized protein LOC105031937 [Elaeis guineensis]
Length=595

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/257 (28%), Positives = 124/257 (48%), Gaps = 30/257 (12%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            ++Y ++   EQ L ++++W+++ ++ DI     I  W+ D   I L G NN   VQ+L  
Sbjct  356  KAYPFSVSREQELWEEQNWTIEFLLDDI--DPLISYWMQDGRIICLYGSNNIGWVQDLTS  413

Query  811  KIQEICSKIQMNWRIVYIGRSGKTFFDED-------VIRMCDSTVTSEQRIKEFWTRLQS  653
            +I++I ++  +   ++Y+G S    +DED       +I+   S+   +  I  FW RL+S
Sbjct  414  QIKDI-TRAGILLELIYVGSS----YDEDTRDILSTIIKEKLSSYLPQTTISIFWLRLES  468

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDM-GDKM  476
            + SS+    L++G  + SD IM  VK LL +E+       W L+SK        + G+K+
Sbjct  469  ILSSK----LRLGNTDKSDFIMNEVKSLLSFESSKKG---WLLISKGSSTEILKLYGNKV  521

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNL-EKIPNTQ  299
            L +++ ++ W    +  GF  A +      L   S   + + Y    Y  +L EKI    
Sbjct  522  LELLSLFQVWGHKVRKWGFMGAIRKA----LDPPSVIDHCNYYSITPYTEDLNEKI---S  574

Query  298  SCPQCNHNMHKLVTFSC  248
             C +C   M K   + C
Sbjct  575  LCKKCKCPMEKNFMYQC  591



>ref|XP_002515052.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47606.1| conserved hypothetical protein [Ricinus communis]
Length=603

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/257 (27%), Positives = 123/257 (48%), Gaps = 35/257 (14%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELIL  812
            +++ ++S  E+ L ++ESWSL+ +V DI     + +W++++  I + G +N   ++E   
Sbjct  370  KAFPFSSSREEQLWEEESWSLQFLVDDI--DPLLTRWVEEDRNICIYGSDNLDWIREFNA  427

Query  811  KIQEI-CSKIQMNWRIVYIGRSGKTFFDEDVIRMCD----STVTSEQRIKEFWTRLQSMA  647
            K + I  S +Q+   +VY+G    T      + + +    S+  S  +++ FW RL+SM 
Sbjct  428  KFETIRSSDVQLE--MVYVGNKNLTELVRHTLAIIEKETHSSSLSFTKLQFFWLRLESMR  485

Query  646  SSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSK--EKGIIACDMGDKML  473
             S+    L+MG    S+ I +GV  LL    EG     WA++ +     I+  + G +M+
Sbjct  486  RSK----LRMGESISSEHIQKGVAALLDSTDEG-----WAVIGRGNTTDIVKVE-GREMI  535

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHP---YCFLNYPSNL-EKIPN  305
              +N++ +W DN    GF  A +   E       P S   P      L Y   L EKI  
Sbjct  536  ECLNKFSEWGDNVAKLGFLGALRTALE-------PPSTLEPCNHIKILPYAEGLVEKI--  586

Query  304  TQSCPQCNHNMHKLVTF  254
              +C +C   + K + +
Sbjct  587  -VACDKCKRPVKKYILY  602



>ref|XP_004239153.1| PREDICTED: uncharacterized protein LOC101249457 isoform X1 [Solanum 
lycopersicum]
Length=789

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 115/258 (45%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E  L  +++W+++L+   I     +  WI + + I L GG + + ++     
Sbjct  550  AFPFTKARETALWKEQTWNVELLADSI--DQNVFTWISEGKCICLYGGEDIEWIRSFTSS  607

Query  808  IQEICSKIQMNWRIVYIGRSG---KTFFDEDVIRM--CDSTVTSEQRIKEFWTRLQSMAS  644
             + + +   +   ++Y+G+     +   +  +I+M      V  +  I  FW RL+SM  
Sbjct  608  TRAVANAAGVPLEMLYVGKKNPKERVRKNSSIIQMENLSHVVQDQTLIWFFWERLESMWH  667

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            SR Q      +   +D I+Q +  +L Y+  GS +G WA+ S+    +    GD ++ VM
Sbjct  668  SRTQ----QDIPGETDPILQEIVTILSYD--GSDLG-WAVFSRGLAEMTRGKGDLIVQVM  720

Query  463  NEYEKWKDNAQ-----INGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
              +++W++        +   DR  +D +       SP    H    L  PS    IP   
Sbjct  721  KGFDRWRNEVSDITTFVPALDRQLRDLH-------SP----HHCTRLILPSTSGHIPERV  769

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C+  M K + + CC
Sbjct  770  VCAECSRPMEKFIMYRCC  787



>ref|XP_004310159.1| PREDICTED: uncharacterized protein LOC101309120 [Fragaria vesca 
subsp. vesca]
Length=779

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/264 (25%), Positives = 116/264 (44%), Gaps = 27/264 (10%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +T+  E+ L ++E W ++L+   +     +  WI + +YI L GG +   ++E    
Sbjct  525  AYPFTNNRERLLWEEEKWRIELLADSL--DQNLVTWIHEGKYICLYGGEDITWIREFTRA  582

Query  808  IQEICSKIQMNWRIVYIGRS-GKTFFDEDVIRMCD----STVTSEQRIKEFWTRLQSMAS  644
             + +  +  +   ++Y+G+S  K    + ++RM +    S V     I  FW RL+SM  
Sbjct  583  AKSVALEAGIQLELLYVGKSKAKEQKLKSIMRMIEEEKLSHVLHWNLIWFFWIRLESMWQ  642

Query  643  SRIQYLLKMGLDEG-----------SDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIA  497
            S+ Q L    L              +D +++G+  LL +   GST   WA++      ++
Sbjct  643  SKGQQLKNELLSSSQLSTTDSFSLRNDPVLKGIISLLSF---GSTERGWAVIGTGSADMS  699

Query  496  CDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLE  317
               G+ ML  + EY  W+   +  GF  A  D    +  S+      H    L  P+   
Sbjct  700  KANGEHMLRSLKEYSAWELKRRELGFTPALNDHLAGVYKSAP-----HHCTNLILPAT-G  753

Query  316  KIPNTQSCPQCNHNMHKLVTFSCC  245
             +P T +C +C   M +   F CC
Sbjct  754  LMPETVACAECGRLMERYTMFRCC  777



>ref|XP_003590763.1| Sieve element-occluding protein [Medicago truncatula]
 gb|ADN32807.1| sieve element occlusion b [Medicago truncatula]
 gb|AES61014.1| sieve element occlusion protein [Medicago truncatula]
Length=669

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 76/147 (52%), Gaps = 18/147 (12%)
 Frame = -3

Query  682  IKEFWTRLQSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGI  503
            +  FW +++S+  +++         E ++ + Q V+KLL Y+ E      WA+++K   +
Sbjct  532  VNNFWKKVESLFVTKMH--------EKTNTVTQQVEKLLSYKNETG----WAIVTKGSIV  579

Query  502  IACDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSN  323
             +   G  +L  ++E++KWKD A   GF+ AF++ +  + S+    S+      L  P+ 
Sbjct  580  TSVGHGTSVLKTVSEFDKWKDVAINKGFEFAFREHHHKVASTVHICSH------LEIPNV  633

Query  322  LEKIPNTQSCPQCNHNMHKLVTFSCCH  242
              KIP+   CP C+  M   +++ CCH
Sbjct  634  AGKIPDFIECPDCHRTMEVFISYKCCH  660



>ref|XP_006483988.1| PREDICTED: uncharacterized protein LOC102625551 [Citrus sinensis]
Length=706

 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 115/257 (45%), Gaps = 30/257 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ ++   E+ L  +E+W + L+   +     I  WI ++++I L GG + + +++    
Sbjct  469  AFPFSVAREEALWKEETWRIDLLADSV--DPVIPTWIMEQKHICLYGGEDLEWIRKFTAL  526

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR---------IKEFWTRLQ  656
            +  +     +   ++Y+G+S      ++ +R   ST+T E+          I  FW RL+
Sbjct  527  MGAVARAAGIALEMLYVGKSNP----KEKVRRSISTITVEKLSHTLPDPTLIWFFWVRLE  582

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+    +K G     D IMQ +  +L ++  GS  G WA++S+   + A    + +
Sbjct  583  SMWHSK----MKFGRKVQQDPIMQEIVTMLSFD--GSDQG-WAVISRGPHM-AKAKDETI  634

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  + EY  W+ N     F  A  D     L+ + P    H    L  P    +IP    
Sbjct  635  LKCLTEYTTWEPNVPEKSFVVAMND----YLNENRPP---HHCNRLILPGEAGRIPEKVV  687

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M + + + CC
Sbjct  688  CAECGRRMEEFIMYRCC  704



>ref|XP_004299166.1| PREDICTED: uncharacterized protein LOC101294943 [Fragaria vesca 
subsp. vesca]
Length=703

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 66/257 (26%), Positives = 111/257 (43%), Gaps = 28/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ ++ E E  L + ESW L+LV   I    EI KWID  +YI L G  + + ++   ++
Sbjct  464  AFPFSDEKENALWNAESWRLELVTDGI--DPEILKWIDQGKYICLFGSEDIEWIRRFTVR  521

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             +++  +  +   +VY GRS  +   ++ +   +  + +E   +          FW+RL 
Sbjct  522  AKDVAKRAGIPLELVYAGRSTAS---KEKLWKLNKIIEAENLSRTWSDYTSTWFFWSRLD  578

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+ ++     +D+  D I++ V  LL Y  +GS  G W +L           G   
Sbjct  579  SMRCSKAKH--HKTIDD--DTILREVMSLLSY--DGSDHG-WVMLWLGSADTVRANGHLT  631

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
               ++++E WK  A   GF    K+    +     P    H    L  P     IP+   
Sbjct  632  TSTLDDFEAWKPAAAELGFLPELKN---QLKQRHEP----HHCTRLIIPGFGPDIPDKVV  684

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K   F CC
Sbjct  685  CTECGREMEKFFMFRCC  701



>ref|XP_009769433.1| PREDICTED: uncharacterized protein LOC104220293 isoform X2 [Nicotiana 
sylvestris]
Length=702

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 118/257 (46%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +T   ++ L   ESW L+LVV  I     I +W+   +YI L GG + + +++    
Sbjct  464  AYPFTMAKQEELWSIESWRLELVVDGI--DQNIIEWMTAGKYICLYGGEDVEWIEKFTTS  521

Query  808  IQEICSKIQMNWRIVYIGRSGK--------TFFDEDVIRMCDSTVTSEQRIKEFWTRLQS  653
             + +  +  ++  ++Y+G+S K            ++ +  C   V S   +  FW RL+S
Sbjct  522  AKGVAHRAGIDLHMIYVGKSSKKDRVRRINIIIRKENLSYCLDDVMS---VWYFWKRLES  578

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S++Q    +G     D+IMQ V  +L +  +GS  G W L+S+    +A      + 
Sbjct  579  MFYSKMQ----LGQTIKDDKIMQEVLTMLSF--DGSDQG-WVLISRGSFEMARANSVVIT  631

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQS  296
              + ++  W+++A+  GF  A  D +   L   +P   QH  C  L  P     IP   +
Sbjct  632  KTLEDFHVWEEDAREKGFVLALIDYF---LHLHTP---QH--CNRLILPGLDVDIPEMIT  683

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K   + CC
Sbjct  684  CAECGRPMDKFFMYRCC  700



>ref|XP_009769432.1| PREDICTED: uncharacterized protein LOC104220293 isoform X1 [Nicotiana 
sylvestris]
Length=706

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 118/257 (46%), Gaps = 29/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +T   ++ L   ESW L+LVV  I     I +W+   +YI L GG + + +++    
Sbjct  468  AYPFTMAKQEELWSIESWRLELVVDGI--DQNIIEWMTAGKYICLYGGEDVEWIEKFTTS  525

Query  808  IQEICSKIQMNWRIVYIGRSGK--------TFFDEDVIRMCDSTVTSEQRIKEFWTRLQS  653
             + +  +  ++  ++Y+G+S K            ++ +  C   V S   +  FW RL+S
Sbjct  526  AKGVAHRAGIDLHMIYVGKSSKKDRVRRINIIIRKENLSYCLDDVMS---VWYFWKRLES  582

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S++Q    +G     D+IMQ V  +L +  +GS  G W L+S+    +A      + 
Sbjct  583  MFYSKMQ----LGQTIKDDKIMQEVLTMLSF--DGSDQG-WVLISRGSFEMARANSVVIT  635

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQS  296
              + ++  W+++A+  GF  A  D +   L   +P   QH  C  L  P     IP   +
Sbjct  636  KTLEDFHVWEEDAREKGFVLALIDYF---LHLHTP---QH--CNRLILPGLDVDIPEMIT  687

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K   + CC
Sbjct  688  CAECGRPMDKFFMYRCC  704



>ref|XP_009622867.1| PREDICTED: uncharacterized protein LOC104114193 [Nicotiana tomentosiformis]
 gb|AFN06073.1| sieve element occlusion protein 2 [Nicotiana tabacum]
Length=786

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 113/258 (44%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  +++W+++L+   I     I  WI + + I L GG + + +++    
Sbjct  547  AFPFTKAREEALWREQTWNIELLADSI--DQNIFTWIGEGKCICLYGGEDIEWIRDFTTV  604

Query  808  IQEICSKIQMNWRIVYIGRSG---KTFFDEDVIRM--CDSTVTSEQRIKEFWTRLQSMAS  644
             + + +  ++   ++Y+G+     +   +  +I++      V  +  I  FW RL+SM  
Sbjct  605  TRAVANAARIPLEMLYVGKRNPKERVRKNSAIIQVENLSHVVQDQTLIWFFWERLESMWH  664

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            SR Q      +   +D I+Q +  +L Y+  GS  G WA+ S+    +    GD M+ VM
Sbjct  665  SRTQ----QDIPGETDPILQEIVTILSYD--GSDQG-WAVFSRGLAEMTRGKGDLMVQVM  717

Query  463  NEYEKWKDNAQ-----INGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
              +E+WK         +   DR  +  +             H    L  P     IP   
Sbjct  718  RGFERWKHEVTDITEFVPSVDRQLRALHT-----------PHHCTRLILPGTTGHIPERV  766

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C+  M K + +SCC
Sbjct  767  VCAECSRPMEKFIMYSCC  784



>ref|XP_009767734.1| PREDICTED: uncharacterized protein LOC104218849 [Nicotiana sylvestris]
Length=793

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 112/258 (43%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  +++W+++L+   I     I  WI + + I L GG + + ++     
Sbjct  554  AFPFTKAREEALWREQTWNIELLADSI--DQNIFTWIGEGKCICLYGGEDIEWIRAFTTA  611

Query  808  IQEICSKIQMNWRIVYIGRSG---KTFFDEDVIRM--CDSTVTSEQRIKEFWTRLQSMAS  644
             + + +  ++   ++Y+G+     +   +  +I++      V  +  I  FW RL+SM  
Sbjct  612  TRAVANAARIPLEMLYVGKRNPKERVRKNSAIIQVENLSHVVQDQTLIWFFWERLESMWH  671

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            SR Q      +   +D I+Q +  +L Y+  GS  G WA+ S+    +    GD M+ VM
Sbjct  672  SRTQ----QDIPGETDPILQEIVTILSYD--GSDQG-WAVFSRGLAEMTRGKGDLMVQVM  724

Query  463  NEYEKWKDNAQ-----INGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
              +E+WK         +   DR  +  +             H    L  P     IP   
Sbjct  725  RGFERWKHEVTDITEFVPSVDRQLRALHT-----------PHHCTRLILPGTTGHIPERV  773

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C+  M K + +SCC
Sbjct  774  VCAECSRPMEKFIMYSCC  791



>ref|XP_008444389.1| PREDICTED: uncharacterized protein LOC103487729 [Cucumis melo]
Length=703

 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 67/262 (26%), Positives = 115/262 (44%), Gaps = 36/262 (14%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +TS  E++L  +E+W L+L+V  +     I +W++  +YI + GG +   ++    K
Sbjct  464  AYPFTSAREESLWKEETWRLELLVDSV--EPLIFQWMETGKYICILGGEDLAWIRGFSAK  521

Query  808  IQEICSKIQMNWRIVYIGRS----------GKTFFDEDVIRMCDSTVTSEQRIKEFWTRL  659
               +     +N  I+Y+G+S               D+ +  + D T+     I  FW RL
Sbjct  522  ALGVAKDAGINLEILYVGKSNPGEKIKKNIAAILADKVIHTLVDPTL-----IWFFWVRL  576

Query  658  QSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDK  479
            +SM  S+ Q     G     D +MQ    +L +++       WAL  K    I     + 
Sbjct  577  ESMWYSKTQR----GNTIEDDPVMQETMTMLSFDSGDQG---WALFCKGSTDILRAKAET  629

Query  478  MLGVMNEY-EKWKDNAQINGFDRAF-KDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIP  308
            +  V++ Y E+WK + Q  GF  A  KD  ++         +   +C  L  PS+   IP
Sbjct  630  ITNVVDGYEERWKVHVQEEGFIPAMSKDLQDI---------HTPEHCNRLILPSSNGTIP  680

Query  307  NTQSCPQCNHNMHKLVTFSCCH  242
                C +C   M K + + CC+
Sbjct  681  EKVVCSECGSAMEKFIMYRCCN  702



>ref|XP_010045508.1| PREDICTED: uncharacterized protein LOC104434233 [Eucalyptus grandis]
Length=1094

 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 109/209 (52%), Gaps = 28/209 (13%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T E E+ L  +ESW+LKL++ D L    + +W+    YI L GG + + +++L   
Sbjct  201  AFPFTKEREEALWREESWTLKLII-DGLDDGTMVEWVRRGSYICLFGGEDLECIRKLTAT  259

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR---------IKEFWTRLQ  656
             +E+     +   +VY+G+S      ++ +R   +T+TSE+             FW RL+
Sbjct  260  AKEVAKIAGIMLGMVYVGKSNS----KEGVRRTAATITSEKLSYCWNDPRFFWLFWARLE  315

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEA--EGSTVGVWALLSKEKG--IIACDM  488
            SM  S++     +G    +D ++  ++ +L ++   EG     WA+  +  G  ++A + 
Sbjct  316  SMLHSKVH----LGNSIENDPLLPWIQTILNFDRSDEG-----WAVFCQGVGPDMVAAE-  365

Query  487  GDKMLGVMNEYEKWKDNAQINGFDRAFKD  401
            G+ +L  M E++KWKD+A   GF  A +D
Sbjct  366  GNIVLESMEEFDKWKDDANQKGFVNALRD  394


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/203 (25%), Positives = 96/203 (47%), Gaps = 40/203 (20%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +  E E+ L  +E W+LKL+V   L    I +W+    YI L GG + + +++L   
Sbjct  568  AFPFAKEREEALWREERWTLKLIVGG-LDDGTIKEWVRQGSYICLFGGEDLEWIRKLTAT  626

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR---------IKEFWTRLQ  656
             +E+     +   +VY+G+S      ++ ++   +T+ SE+             FW RL+
Sbjct  627  TKEVAKIAGIMLGMVYVGKSNS----KEGLQRTAATIISEELSHCWNDPIFFWLFWARLE  682

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S++   L+  ++  +D ++QG++++L                  + I     G+ +
Sbjct  683  SMFHSKMH--LRKSIE--NDPLLQGIQEIL------------------RDI----PGNNV  716

Query  475  LGVMNEYEKWKDNAQINGFDRAF  407
            L  + E+ KWKD+A   GF  A 
Sbjct  717  LESIEEFNKWKDDANQKGFLNAL  739



>ref|XP_009333910.1| PREDICTED: uncharacterized protein LOC103926766 [Pyrus x bretschneideri]
Length=317

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 117/257 (46%), Gaps = 28/257 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T E EQ L + ESW L+LV   I     I + I+   ++ L G ++   +++   +
Sbjct  78   AFPFTDEKEQQLWNAESWRLELVADGI--DPNILEGIEKGRFVCLYGSDDLDWIRKFTDR  135

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKE---------FWTRLQ  656
             + +     ++  +VY+GRS  T   ++ IR  + T+ +E   +          FW+R+ 
Sbjct  136  AKNVAKLAGISLDLVYVGRSTAT---KERIRKVNKTIETENLSRFWPDYTSNWFFWSRMD  192

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+ ++     LD  +D I++ V  LL Y+  GS  G W ++ +     A   G   
Sbjct  193  SMRCSKAKH--HKTLD--NDNILREVMTLLSYD--GSDQG-WVMVWRGSNERARANGHLT  245

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQS  296
            L  +++++ WK  A   GF    +D    +    +P   QH    L  P     IP+  +
Sbjct  246  LLTLDDFDAWKATAADKGFVPTLQD---ELGRRHTP---QH-CTRLVIPGFGPDIPDRIA  298

Query  295  CPQCNHNMHKLVTFSCC  245
            C +C   M K   F CC
Sbjct  299  CAECGREMEKFFMFRCC  315



>ref|XP_007227400.1| hypothetical protein PRUPE_ppb019745mg [Prunus persica]
 gb|EMJ28599.1| hypothetical protein PRUPE_ppb019745mg [Prunus persica]
Length=125

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 67/135 (50%), Gaps = 14/135 (10%)
 Frame = -3

Query  628  LLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMNEYEK  449
            +    +++ +D     ++KLL Y+ E      WA+LSK   ++    G  +L V+ +++K
Sbjct  1    MFHTKINKQADLATLEIQKLLSYKNESG----WAVLSKGSSLVVAGHGISILKVIEDFDK  56

Query  448  WKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQCNHNMH  269
            WK   +  GF+  F   +  +  +        P C L+ P +  K+P T +CP CN +M 
Sbjct  57   WKGQVREKGFEFCFTTYHAKIRLT--------PCCRLDIPGSTGKVPETMNCPDCNRSME  108

Query  268  KLVTFSCCHTFVDCP  224
              +++ CCH  +D P
Sbjct  109  TFISYKCCH--IDGP  121



>gb|KHN01071.1| Putative nucleoredoxin 2 [Glycine soja]
Length=568

 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 95/220 (43%), Gaps = 31/220 (14%)
 Frame = -3

Query  901  RSEIDKWIDDEEYIFLCGGNNNKQVQELILKIQEICSKIQMNWRIVYIGRSGKTFFDEDV  722
               I  WI +++YI + GG++ + + +         +   +        +  K   +   
Sbjct  371  HPHISTWIREQKYILIYGGSDKEWIHQFTKYATAFANDAAL--------KDAKIHIELFC  422

Query  721  IRMCDSTVTSEQRIKEFWTRLQSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGST  542
            +   D +      ++ FW+ ++S+  ++    +        D + Q V+K+L Y+ E   
Sbjct  423  VEKEDKSF-----LRRFWSGIESLFVTKAHNTV--------DAVTQEVQKMLSYKNETG-  468

Query  541  VGVWALLSKEKGIIACDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTS  362
               WA+L K   ++    G  +L  + E+EKWK++    GF+ +FK+ +E +  +     
Sbjct  469  ---WAVLCKGSSVVMSGHGTTILKTLAEFEKWKEDVVKKGFEPSFKEHHERIRRT-----  520

Query  361  YQHPYCFLNYPSNLEKIPNTQSCPQCNHNMHKLVTFSCCH  242
              H    L  P+   K+P T  CP+C   M   +++ C H
Sbjct  521  -HHRCIHLEIPNAAGKLPETIRCPECGRIMEIFISYKCNH  559



>ref|NP_001239846.1| uncharacterized protein LOC100801833 [Glycine max]
 gb|ADN32793.1| sieve element occlusion g [Glycine max]
Length=669

 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 95/220 (43%), Gaps = 31/220 (14%)
 Frame = -3

Query  901  RSEIDKWIDDEEYIFLCGGNNNKQVQELILKIQEICSKIQMNWRIVYIGRSGKTFFDEDV  722
               I  WI +++YI + GG++ + + +         +   +        +  K   +   
Sbjct  472  HPHISTWIREQKYILIYGGSDKEWIHQFTKYATAFANDAAL--------KDAKIHIELFC  523

Query  721  IRMCDSTVTSEQRIKEFWTRLQSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGST  542
            +   D +      ++ FW+ ++S+  ++    +        D + Q V+K+L Y+ E   
Sbjct  524  VEKEDKSF-----LRRFWSGIESLFVTKAHNTV--------DAVTQEVQKMLSYKNETG-  569

Query  541  VGVWALLSKEKGIIACDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTS  362
               WA+L K   ++    G  +L  + E+EKWK++    GF+ +FK+ +E +  +     
Sbjct  570  ---WAVLCKGSSVVMSGHGTTILKTLAEFEKWKEDVVKKGFEPSFKEHHERIRRT-----  621

Query  361  YQHPYCFLNYPSNLEKIPNTQSCPQCNHNMHKLVTFSCCH  242
              H    L  P+   K+P T  CP+C   M   +++ C H
Sbjct  622  -HHRCIHLEIPNAAGKLPETIRCPECGRIMEIFISYKCNH  660



>ref|XP_004501847.1| PREDICTED: uncharacterized protein LOC101501922 [Cicer arietinum]
Length=705

 Score = 73.6 bits (179),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 66/258 (26%), Positives = 115/258 (45%), Gaps = 31/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T E E++L  +E WSL+L+V  I     +  W+ + + I L GG + + ++     
Sbjct  467  AFPFTREKEESLWKQEIWSLELLVDGI--DPTVLDWMTEGKIICLYGGEDLEWIETFTQT  524

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSE--------QRIKEFWTRLQS  653
               +      +  +VY+G+S      E + RM  +  T +          I  FW RL+S
Sbjct  525  AMNLARTGNFDLEMVYVGKSNA---KERMQRMISTFNTKKFSYFWPNVTSIWFFWARLES  581

Query  652  MASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKML  473
            M  S++Q     G    +D+IM  V  +L ++  GS  G WA+  +    +A   GD  L
Sbjct  582  MLYSKLQ----QGKTVENDKIMSEVMTVLSFD--GSDRG-WAIFCRGPSEMARAKGDTAL  634

Query  472  GVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHP-YC-FLNYPSNLEKIPNTQ  299
              + +++KWK   + +G+  A  +  + +         Q P +C  L  P +   IP   
Sbjct  635  TSLRDFDKWKHKIEQDGWVPALGEYIKEI---------QQPHHCNRLILPGSTGGIPQKV  685

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M K   + CC
Sbjct  686  VCAECGRQMEKYFMYRCC  703



>ref|XP_008374367.1| PREDICTED: uncharacterized protein LOC103437653 [Malus domestica]
Length=712

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 69/258 (27%), Positives = 117/258 (45%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T E EQ L + ESW L+LV   I     I + I+   ++ L G ++   +++   K
Sbjct  473  AFPFTDEKEQQLWNAESWRLELVADGI--DQSILEGIEKGTFVCLYGSDDLDWIRKFTNK  530

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIK---------EFWTRLQ  656
             + +     ++  +VY+GRS  T   ++ IR  + T+ +E   +          FW+R+ 
Sbjct  531  AKNVAKLAGISLDLVYVGRSTAT---KERIRKVNKTIETENLSRCWPEYTSTWFFWSRMD  587

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+ ++   +     SD I++ V  LL Y+  GS  G W ++ +     A   G   
Sbjct  588  SMRCSKAKHHKTLE----SDNILKEVMTLLSYD--GSDQG-WVMVWRGSNERARANGHLT  640

Query  475  LGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCF-LNYPSNLEKIPNTQ  299
            L  ++ ++ WK  A  NGF    +D    +    +P   QH  C  L  P     IP+  
Sbjct  641  LLTLDXFDAWKAAAAENGFVPTLQD---ZLGRRHTP---QH--CTRLVIPGFGPDIPDRI  692

Query  298  SCPQCNHNMHKLVTFSCC  245
            +C +C   M K   F CC
Sbjct  693  ACAECGLEMEKFFMFRCC  710



>gb|KDP47163.1| hypothetical protein JCGZ_00054 [Jatropha curcas]
Length=748

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/260 (25%), Positives = 116/260 (45%), Gaps = 33/260 (13%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L ++ESWS++L+   I   + I  WI + +YI L GG + + ++     
Sbjct  508  AFPFTSLREEALWEEESWSIELMADGI--DANIPAWIQEGKYICLYGGEDIEWIRRFTTT  565

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
               +  +  +   ++Y+G+        + +R  ++ +  E+          ++ FW RL+
Sbjct  566  AAAVAIEANIQLEMLYVGKINL----REKVRKINTIIQIEKLSHVLSDLALMQFFWFRLE  621

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKG---IIACDMG  485
            SM  S++    K       D IMQ +  +L ++A   T   WA++SK  G    +A   G
Sbjct  622  SMYYSKV----KNNRTVEKDSIMQEIITMLTFDA---TEQGWAVVSKGSGGNDQMAKAKG  674

Query  484  DKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPN  305
              +L   +E+  WK  A   GF  A     E +L   +      P+C     +  E +P 
Sbjct  675  SLILRSFDEFRSWKHIADERGFVPAL---IEYLLLHQN-----KPHCNRLIMAFNENLPR  726

Query  304  TQSCPQCNHNMHKLVTFSCC  245
             Q C +C   M   + + CC
Sbjct  727  QQLCAECGRPMEMFMMYRCC  746



>ref|XP_004237262.1| PREDICTED: uncharacterized protein LOC101263509 [Solanum lycopersicum]
Length=788

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/258 (22%), Positives = 116/258 (45%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E  L  +++W+++L+   I     +  WI + + I L GG + + ++     
Sbjct  549  AFPFTKARETALWKEQTWNIELLADSI--DQNVFTWISEGKCICLYGGEDIEWIRSFTSA  606

Query  808  IQEICSKIQMNWRIVYIGRSG---KTFFDEDVIRM--CDSTVTSEQRIKEFWTRLQSMAS  644
             + + +  ++   ++Y+G+     +   +  +I++      V  +  I  FW RL+SM  
Sbjct  607  TRAVANAARVPLEMLYVGKKNPKERIRKNNSIIQIENLSHVVQDQTLIWFFWERLESMWH  666

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            SR Q      +   +D I+Q +  +L Y+  GS +G WA+ S+    +    GD ++ VM
Sbjct  667  SRTQ----QDIPGETDPILQEIVTILSYD--GSDLG-WAVFSRGLVEMTRGKGDLIVQVM  719

Query  463  NEYEKWKDNAQ-----INGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
              +++W++        +   DR  +D +       SP    H    L  PS    +P   
Sbjct  720  KGFDRWRNEVSDITTFVPALDRQLRDLH-------SP----HHCTRLILPSTTGHVPERV  768

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C+  M K + + CC
Sbjct  769  ICAECSRPMEKFIMYRCC  786



>ref|XP_004495321.1| PREDICTED: uncharacterized protein LOC101490473 [Cicer arietinum]
Length=667

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/260 (21%), Positives = 117/260 (45%), Gaps = 56/260 (22%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKESWSLKLVVSDILYRSEID---KWIDDEEYIFLCGGNNNKQVQE  821
            + + ++   E++++    W   L+V       +ID   KW ++E+ + + GG + + +Q+
Sbjct  445  KGFPFSKSKEESMTQSLMWVDSLLV-------DIDIKIKW-EEEKSVIIYGGKDKEWIQQ  496

Query  820  LILKIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVT-----SEQ--RIKEFWTR  662
                                  +S     ++  I+   +++      S+Q   +  FW +
Sbjct  497  F--------------------TKSAGALANDATIKQAKTSIELFCLESQQPTTVSNFWKK  536

Query  661  LQSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGD  482
            ++S+  +++         E ++ + Q V+KLL Y+ E      WA+++K   + +   G 
Sbjct  537  VESLFVTKMH--------EKTNTVTQQVEKLLSYKNETG----WAIVTKGSIVTSVGHGT  584

Query  481  KMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNT  302
             +L  + E++KWKD     GF+ AF++ +  + ++    S+      L  P+   KIP+ 
Sbjct  585  TILKAVAEFDKWKDVVVTKGFEFAFREHHHKVANTFHLCSH------LEIPNVAGKIPDF  638

Query  301  QSCPQCNHNMHKLVTFSCCH  242
              CP C+  M   +++ CCH
Sbjct  639  IECPDCHRTMEVFISYKCCH  658



>gb|KHN13159.1| hypothetical protein glysoja_040439 [Glycine soja]
Length=662

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 95/221 (43%), Gaps = 31/221 (14%)
 Frame = -3

Query  901  RSEIDKWIDDEEYIFLCGGNNNKQVQELILKIQEICSKIQMNWRIVYIGRSGKTFFDEDV  722
               I  WI +++YI + GG++ + + +         +   +        +  K   +   
Sbjct  465  HPHISTWIREQKYILIYGGSDKEWIHQFTKHATAFANDAAL--------KDAKIHIELFC  516

Query  721  IRMCDSTVTSEQRIKEFWTRLQSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGST  542
            +   D +      ++ FW+ ++S+  ++    +        D + Q V+K+L Y+ E   
Sbjct  517  VEKEDKSF-----LRRFWSGIESLFVTKAHNTV--------DAVTQEVQKMLSYKNETG-  562

Query  541  VGVWALLSKEKGIIACDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTS  362
               WA+L K   ++    G  +L  + E+EKWK+     GF+ +FK+ +E +  +     
Sbjct  563  ---WAVLCKGSSVVMSGHGTTILKTVAEFEKWKEFVVKKGFEPSFKEHHERIRRT-----  614

Query  361  YQHPYCFLNYPSNLEKIPNTQSCPQCNHNMHKLVTFSCCHT  239
              H    L  P+   K+P T  CP+C   M   +++ C H+
Sbjct  615  -HHRCIHLEIPNAAGKLPETIRCPECGRIMEIFISYKCNHS  654



>ref|XP_008340128.1| PREDICTED: uncharacterized protein LOC103403085 [Malus domestica]
Length=873

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 116/267 (43%), Gaps = 36/267 (13%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS+ E+ L ++E+W ++L+   I     +  WI + +YI L GG +   ++     
Sbjct  622  AFPFTSQRERLLWEEETWRIELLADSI--DQNLITWITEGKYICLYGGEDIDWIRNFTKS  679

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQR--------IKEFWTRLQS  653
             + +  +  +   ++Y+G+       E V+R   + + +E+         I  FW RL+S
Sbjct  680  AKNVAREAGIQLELLYVGKRNP---KEKVVRNIMNVIQAEKLSHTLEWNLIWFFWMRLES  736

Query  652  MASSRIQYLLKMGLDEG--------SDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIA  497
            M  S+   +    +  G        +D +MQG+  +L +   GS+   WA++      ++
Sbjct  737  MWQSKGHQMQSEAIRSGRLRTDNMKNDPVMQGIISMLSF---GSSDRGWAVIGAGSSEMS  793

Query  496  CDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSP---TSYQHPYCFLNYPS  326
               G+ M   ++EY  W       GF RA  + Y   +   +P   TS   P   L    
Sbjct  794  KANGEHMHRSLSEYSLWNKRVDEIGFVRALNE-YLTGVYKEAPHHCTSLILPATGL----  848

Query  325  NLEKIPNTQSCPQCNHNMHKLVTFSCC  245
                +P T +C +C   M +   F CC
Sbjct  849  ----MPETVACAECGRLMERFTMFRCC  871



>emb|CAH59411.1| hypothetical protein [Plantago major]
Length=391

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/261 (23%), Positives = 117/261 (45%), Gaps = 33/261 (13%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L     W+++L+   I  R  I +W  +   I L GG + + +++  + 
Sbjct  149  AFPFTKIREKALWADVDWTIELLADSIDPR--IPEWTRENRVICLYGGEDIEWIRKFTIA  206

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ-----RIKE-------FWT  665
             +++ + +Q+   ++Y+G+          ++ C   +  E+      +KE       FW 
Sbjct  207  ARKVATALQIPLEMLYVGKRNP----RAKVQHCHEVIDREKLSHVFSVKEYYDYVWYFWI  262

Query  664  RLQSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMG  485
            RL SM +S+ Q    +G+   +D IMQ +  +L Y+   S+   WA+ S+    +   MG
Sbjct  263  RLWSMWNSKKQ----LGMTVDNDLIMQEIMDILTYD---SSEQGWAVFSRGNHEMTKGMG  315

Query  484  DKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIP  308
            + ++ V++ Y+ W       G      D +  +L  +   ++   +C  L  PS    IP
Sbjct  316  ETVVSVLDNYQYW-------GHKVDHPDKFVPVLDEAIRGTHPEHHCNKLILPSYTGYIP  368

Query  307  NTQSCPQCNHNMHKLVTFSCC  245
                C +C   M K V + CC
Sbjct  369  ERVVCSECGKIMDKYVMYRCC  389



>ref|NP_001241173.1| uncharacterized protein LOC100793771 [Glycine max]
 gb|ADN32800.1| sieve element occlusion r [Glycine max]
Length=669

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 95/221 (43%), Gaps = 31/221 (14%)
 Frame = -3

Query  901  RSEIDKWIDDEEYIFLCGGNNNKQVQELILKIQEICSKIQMNWRIVYIGRSGKTFFDEDV  722
               I  WI +++YI + GG++ + + +         +   +        +  K   +   
Sbjct  472  HPHISTWIREQKYILIYGGSDKEWIHQFTKHATAFANDAAL--------KDAKIHIELFC  523

Query  721  IRMCDSTVTSEQRIKEFWTRLQSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGST  542
            +   D +      ++ FW+ ++S+  ++    +        D + Q V+K+L Y+ E   
Sbjct  524  VEKEDKSF-----LRRFWSGIESLFVTKAHNTV--------DAVTQEVQKMLSYKNETG-  569

Query  541  VGVWALLSKEKGIIACDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTS  362
               WA+L K   ++    G  +L  + E+EKWK+     GF+ +FK+ +E +  +     
Sbjct  570  ---WAVLCKGSSVVMSGHGTTILKTVAEFEKWKEFVVKKGFEPSFKEHHERIRRT-----  621

Query  361  YQHPYCFLNYPSNLEKIPNTQSCPQCNHNMHKLVTFSCCHT  239
              H    L  P+   K+P T  CP+C   M   +++ C H+
Sbjct  622  -HHRCIHLEIPNAAGKLPETIRCPECGRIMEIFISYKCNHS  661



>gb|KDP46382.1| hypothetical protein JCGZ_10222 [Jatropha curcas]
Length=714

 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 67/282 (24%), Positives = 129/282 (46%), Gaps = 45/282 (16%)
 Frame = -3

Query  991  RSYNYTSEVEQTLSDKE-SWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELI  815
            R++ +T E E+ L D+  SW L L+  D + ++ +D W ++E+YI + GG+    +Q+  
Sbjct  444  RAFPFTEEREEALWDQNTSWKLDLLF-DGIDKTVMD-WGEEEKYICIYGGDELDWIQKFT  501

Query  814  LKIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDS-----TVTSEQRIKEFWTRLQSM  650
             K +++     +   +VY+GR       + +I   +S     ++  ++ I  FW R+ SM
Sbjct  502  KKARDVADDANIPLEMVYVGRRNSKERVKKIIETIESEKLSRSLQDQRLIWYFWVRIASM  561

Query  649  ASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDM------  488
              S+ Q  LK   +  +D  M+ + K+L++++E         L K++G+   +M      
Sbjct  562  WYSKNQ--LKKTTE--NDPTMKEIMKMLIFDSESGWAIFTQRLKKDQGMKDNEMKDNEMK  617

Query  487  -------------------GDKMLGVMNEYEKWKDNAQIN-GFDRAFKDCYEMMLSSSSP  368
                               G+ +L  +  Y +WKD  Q   GF +A +   +  + ++  
Sbjct  618  ENVMKGKEMKDSEIRVEAKGNIILTCLENYSRWKDLIQKKGGFVQALRGEIQKEVKAAK-  676

Query  367  TSYQHPYC-FLNYPSNLEKIPNTQSCPQCNHNMHKLVTFSCC  245
                  +C  L  P++  K+P    C  C  NM K++ + CC
Sbjct  677  -----SHCNRLALPNDEGKLPQKIVCADCPKNMEKMIMYRCC  713



>gb|EYU22546.1| hypothetical protein MIMGU_mgv1a001374mg [Erythranthe guttata]
Length=831

 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 119/261 (46%), Gaps = 31/261 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T E E+ L   + W++ L+  +I  R  I  W+++ + I L GG + + ++    K
Sbjct  587  AFPFTGEHEKYLWASKIWNITLLADNIDAR--IPLWVEENKVICLYGGEDIQWIRNFTRK  644

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ-------------RIKEFW  668
             +E+   + +   ++Y+G+       ++ +R C+ T+  E+              +  FW
Sbjct  645  AREVAEALHVPLEMLYVGKRNP----KEKVRSCNETIAKERLSNVFAAGDDYYDYVWFFW  700

Query  667  TRLQSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDM  488
             RL  + +SR     K+G+   +D IM+ +  +L Y++  S    WA  S     I    
Sbjct  701  VRLWGLWNSR----KKIGMTVENDVIMREILDVLAYDS--SNHQGWAAFSWSNRDITKGN  754

Query  487  GDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIP  308
             +K++ V++ Y +W    +++  DR F    +  L    P   +H    L  P++  +I 
Sbjct  755  AEKLMPVLDNYAQWA--YKVDRPDR-FVRALDEELQGFHP---EHHCTRLILPASDGQIS  808

Query  307  NTQSCPQCNHNMHKLVTFSCC  245
                C +C   M K V +SCC
Sbjct  809  ERVVCSECGKTMDKFVLYSCC  829



>ref|XP_010069164.1| PREDICTED: uncharacterized protein LOC104456128 isoform X3 [Eucalyptus 
grandis]
Length=665

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 118/256 (46%), Gaps = 50/256 (20%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKE--SWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELI  815
            ++ ++  VE+TL  K   SW  +L+++D++   +I++ I  ++YI L G  +NK + E  
Sbjct  450  AFPFSESVEKTLLSKPGISW-FQLLLTDMVI-PKINEAIKSQKYILLYGAEDNKAIHE--  505

Query  814  LKIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMASSRI  635
              I+E   KI                  ED + +    VT  Q    FW+RL+S+  S++
Sbjct  506  --IEEPVKKII-----------------EDRVPIAAYNVTKNQL---FWSRLESLMLSKL  543

Query  634  QYLLKMGLDEGSDEIMQGVKKLLV-YEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMNE  458
            Q   K  + E    +MQ V  L   ++ +G     +A+L++   ++  D    +  V+++
Sbjct  544  Q--TKADVHEP---LMQDVLSLYTNFKKDGG----FAVLTRGSRVVINDSIVDVTKVLSQ  594

Query  457  YEK-WKDNAQIN--GFDRAFKDCYEMMLSSSSPTSYQHPYCFLNY-PSNLEKIPNTQSCP  290
            YE  WK   + N   FD AFK+  E +        Y  P C   Y P+ +  IP    CP
Sbjct  595  YETNWKGPVKRNEMTFDAAFKEHRERV--------YVLPRCHHFYIPNMVGYIPEDVKCP  646

Query  289  QCNHNMHKLVTFSCCH  242
             C   M   V F CCH
Sbjct  647  ICPRMMKNFVKFECCH  662



>gb|KCW57422.1| hypothetical protein EUGRSUZ_H00202 [Eucalyptus grandis]
Length=328

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 118/256 (46%), Gaps = 50/256 (20%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKE--SWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELI  815
            ++ ++  VE+TL  K   SW  +L+++D++   +I++ I  ++YI L G  +NK + E  
Sbjct  113  AFPFSESVEKTLLSKPGISW-FQLLLTDMVI-PKINEAIKSQKYILLYGAEDNKAIHE--  168

Query  814  LKIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMASSRI  635
              I+E   KI                  ED + +    VT  Q    FW+RL+S+  S++
Sbjct  169  --IEEPVKKI-----------------IEDRVPIAAYNVTKNQL---FWSRLESLMLSKL  206

Query  634  QYLLKMGLDEGSDEIMQGVKKLLV-YEAEGSTVGVWALLSKEKGIIACDMGDKMLGVMNE  458
            Q   K  + E    +MQ V  L   ++ +G     +A+L++   ++  D    +  V+++
Sbjct  207  Q--TKADVHEP---LMQDVLSLYTNFKKDGG----FAVLTRGSRVVINDSIVDVTKVLSQ  257

Query  457  YEK-WKDNAQIN--GFDRAFKDCYEMMLSSSSPTSYQHPYCFLNY-PSNLEKIPNTQSCP  290
            YE  WK   + N   FD AFK+  E +        Y  P C   Y P+ +  IP    CP
Sbjct  258  YETNWKGPVKRNEMTFDAAFKEHRERV--------YVLPRCHHFYIPNMVGYIPEDVKCP  309

Query  289  QCNHNMHKLVTFSCCH  242
             C   M   V F CCH
Sbjct  310  ICPRMMKNFVKFECCH  325



>emb|CDP13257.1| unnamed protein product [Coffea canephora]
Length=812

 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/258 (22%), Positives = 116/258 (45%), Gaps = 30/258 (12%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +T   E+ L  +E+W ++L+   I     +  W+++  YI L GG + + +++    
Sbjct  573  AFPFTKTKEEALWREETWRIELLADSI--DPNLFHWVNENRYICLYGGEDIEWIRKFTNT  630

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ---------RIKEFWTRLQ  656
            ++   +   +   ++Y+G+S      ++ +R  +S + +E           I  FW RL+
Sbjct  631  VRGAANAAGIRLEMLYVGKSNP----KERVRRNNSIIQAENLSHILTDLTLIWFFWVRLE  686

Query  655  SMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKM  476
            SM  S+ Q+    G+   +D IMQ +  +L +  +GS  G WA+  +    +A    + +
Sbjct  687  SMWHSKNQH----GMTVENDPIMQEIVTMLSF--DGSDQG-WAVFCRGSHEMAKGKAETI  739

Query  475  LGVMNEYEKWKDN-AQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLEKIPNTQ  299
               M+++++WKD     +GF  A  D    + +        H    L  P     IP   
Sbjct  740  YECMSQFDRWKDKVVYPDGFVIAMNDHLRELHTP-------HHCNRLILPGPTGHIPERV  792

Query  298  SCPQCNHNMHKLVTFSCC  245
             C +C   M + + + CC
Sbjct  793  VCAECGRPMERFIMYRCC  810



>ref|XP_008389748.1| PREDICTED: uncharacterized protein LOC103452052 [Malus domestica]
Length=832

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/264 (25%), Positives = 119/264 (45%), Gaps = 30/264 (11%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ +TS  E+ L D+E+W ++L+ +D L ++ I  WI + +YI L GG +   ++     
Sbjct  581  AFPFTSNREKLLWDEETWRMELL-ADSLDQNLI-TWITEGKYICLYGGEDIDWIRNFTKS  638

Query  808  IQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDSTVTSEQ--------RIKEFWTRLQS  653
             +++  +  +   ++Y+GRS      E V+R   + + +E+         I  FW RL+S
Sbjct  639  AKKMAQEAGIQLELLYVGRSKP---KEKVVRNIMNIIQAEKLSHTLEWNLIWFFWLRLES  695

Query  652  MASSRIQYLLKMGLDEG--------SDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIA  497
            M  S+ Q +       G        +D +MQG+  +L +   GS+   WA++      ++
Sbjct  696  MWQSKGQQIQSEAFRSGQFRTDNIKNDAVMQGIISMLSF---GSSDRGWAVIGAGSSDMS  752

Query  496  CDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYCFLNYPSNLE  317
               G+ M   + E+  W       GF  A  + Y   +   +P    H    L  P+   
Sbjct  753  KANGEHMHRSLREFNLWNRRVSEIGFVPALNE-YLAGVYKEAP----HHCTSLILPAT-G  806

Query  316  KIPNTQSCPQCNHNMHKLVTFSCC  245
             +P T +C +C   M +   F CC
Sbjct  807  LMPETVACAECGRLMERFTMFRCC  830



>gb|KDO82146.1| hypothetical protein CISIN_1g005245mg [Citrus sinensis]
Length=527

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 110/254 (43%), Gaps = 24/254 (9%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ ++   E+ L  +E+W + L+   +     I  WI ++++I L GG + + V++    
Sbjct  290  AFPFSVAREEALWKEETWRIDLLADSV--DPVIPTWIMEQKHICLYGGEDLEWVRKFTAL  347

Query  808  IQEICSKIQMNWRIVYIGRS-----GKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMAS  644
            +  +     +   ++Y+G+S      +       +     T+     I  FW RL+SM  
Sbjct  348  MGAVARAAGIALEMLYVGKSNPKEKARRIISTISVEKLSHTLPDPTLIWFFWVRLESMWH  407

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S+    +K G     D IMQ +  +L ++  GS  G WA++S+   + A    + +L  +
Sbjct  408  SK----MKFGTKVQQDPIMQEIVTMLSFD--GSDQG-WAVISRGPHM-AKAKDETILKCL  459

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQSCPQ  287
             EY  W+ N     F  A  D       + + T Y   +C  L  P    +IP    C +
Sbjct  460  TEYTTWEPNVPEKSFVVAMNDYL-----NENRTPY---HCNRLILPGEAGRIPEKVVCAE  511

Query  286  CNHNMHKLVTFSCC  245
            C   M + + + CC
Sbjct  512  CGRRMEEFIMYRCC  525



>ref|XP_004143056.1| PREDICTED: uncharacterized protein LOC101208559 [Cucumis sativus]
 gb|KGN62332.1| hypothetical protein Csa_2G349660 [Cucumis sativus]
Length=703

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 115/262 (44%), Gaps = 36/262 (14%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            +Y +TS  E++L  +E+W L+L+V  +     I +W++  +YI + GG +   ++    K
Sbjct  464  AYPFTSAREESLWKEETWRLELLVDSV--EPLIFQWMEAGKYICILGGEDLAWIRGFSAK  521

Query  808  IQEICSKIQMNWRIVYIGRS----------GKTFFDEDVIRMCDSTVTSEQRIKEFWTRL  659
               +     +N  I+Y+G+S               D+ +  + D T+     I  FW RL
Sbjct  522  ALGVAKDAGINLEILYVGKSNPGEKIKKNIAGILADKMIRTLVDPTL-----IWFFWVRL  576

Query  658  QSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDK  479
            +SM  S+ Q     G     D +MQ    +L +++       WAL  K    I     + 
Sbjct  577  ESMWYSKTQR----GNTIEDDPVMQETMTMLSFDSGDQG---WALFCKGSTDILRAKAET  629

Query  478  MLGVMNEYE-KWKDNAQINGFDRAF-KDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIP  308
            +  V++ YE +WK + +  GF  A  KD  ++         +   +C  L  PS+   IP
Sbjct  630  ITNVVDGYEERWKVHVKEEGFIPAMTKDLQDI---------HTPEHCNRLILPSSNGTIP  680

Query  307  NTQSCPQCNHNMHKLVTFSCCH  242
                C +C   M K + + CC+
Sbjct  681  EKVVCSECGSAMEKFIMYRCCN  702



>ref|XP_007146208.1| hypothetical protein PHAVU_006G021400g [Phaseolus vulgaris]
 gb|ESW18202.1| hypothetical protein PHAVU_006G021400g [Phaseolus vulgaris]
Length=684

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/215 (28%), Positives = 102/215 (47%), Gaps = 33/215 (15%)
 Frame = -3

Query  865  YIFLCGGNNNKQVQELILKIQEICSKIQMNWRIVYIGRSGKTF-FDEDVIRMCDSTVTSE  689
            YIF+ GG+N K V++    ++++              ++  TF   E  I        S 
Sbjct  488  YIFIYGGSNTKWVEDFTTVVEKL--------------KNNGTFNLVETTIESYKLGSESP  533

Query  688  QRIKEFWTRLQSMASSRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEK  509
            + +  FW  + ++ +SR +  +K G +E  D   + ++KLL  + + +    WA+L+K  
Sbjct  534  KIVPRFWITIDNLLASRKR--IKKGGEEVKDSTTREIQKLLFLKQDPNG---WAILTKGS  588

Query  508  GIIACDMGDKMLGVMNEYEKWKDNAQIN---GFDRAFKDCYEMMLSSSSPTSYQHPYCFL  338
             +     G+ ML  + ++E WK  A+++    FD AFKD YE     + P   +H   F 
Sbjct  589  HVKLLGHGEAMLITVRDFEGWK--AKLDHEVSFDVAFKDYYEKCKVKTVPKKCEHRE-FA  645

Query  337  NYPSN-LEKIPNTQSCP-QCNHNMH-KLVTFSCCH  242
            NYP++ L  +P    CP +C H M    V + CCH
Sbjct  646  NYPTDILAHLP----CPNKCGHEMEVASVKYQCCH  676



>gb|KDO82145.1| hypothetical protein CISIN_1g005245mg [Citrus sinensis]
Length=706

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 110/254 (43%), Gaps = 24/254 (9%)
 Frame = -3

Query  988  SYNYTSEVEQTLSDKESWSLKLVVSDILYRSEIDKWIDDEEYIFLCGGNNNKQVQELILK  809
            ++ ++   E+ L  +E+W + L+   +     I  WI ++++I L GG + + V++    
Sbjct  469  AFPFSVAREEALWKEETWRIDLLADSV--DPVIPTWIMEQKHICLYGGEDLEWVRKFTAL  526

Query  808  IQEICSKIQMNWRIVYIGRS-----GKTFFDEDVIRMCDSTVTSEQRIKEFWTRLQSMAS  644
            +  +     +   ++Y+G+S      +       +     T+     I  FW RL+SM  
Sbjct  527  MGAVARAAGIALEMLYVGKSNPKEKARRIISTISVEKLSHTLPDPTLIWFFWVRLESMWH  586

Query  643  SRIQYLLKMGLDEGSDEIMQGVKKLLVYEAEGSTVGVWALLSKEKGIIACDMGDKMLGVM  464
            S+    +K G     D IMQ +  +L ++  GS  G WA++S+   + A    + +L  +
Sbjct  587  SK----MKFGTKVQQDPIMQEIVTMLSFD--GSDQG-WAVISRGPHM-AKAKDETILKCL  638

Query  463  NEYEKWKDNAQINGFDRAFKDCYEMMLSSSSPTSYQHPYC-FLNYPSNLEKIPNTQSCPQ  287
             EY  W+ N     F  A  D       + + T Y   +C  L  P    +IP    C +
Sbjct  639  TEYTTWEPNVPEKSFVVAMNDYL-----NENRTPY---HCNRLILPGEAGRIPEKVVCAE  690

Query  286  CNHNMHKLVTFSCC  245
            C   M + + + CC
Sbjct  691  CGRRMEEFIMYRCC  704



>ref|XP_004172103.1| PREDICTED: uncharacterized LOC101204570 [Cucumis sativus]
Length=309

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/226 (26%), Positives = 94/226 (42%), Gaps = 31/226 (14%)
 Frame = -3

Query  901  RSEIDKWIDDEEYIFLCGGNNNKQVQELILKIQEICSKIQM-----NWRIVYIGRSGKTF  737
            +  +  WID E+ I   GG +   +Q+   K+ +I +   M      + IV+IG +  T 
Sbjct  102  QPRLQSWIDQEKTIIFYGGKDIDWIQKFEEKVMDIKNDRSMRDNGITFEIVHIGINKNTT  161

Query  736  FDEDVIRMCDSTVTSEQRIKEFWTRLQSMASSRIQYLLKMGLDEGS-DEIMQGVKKLLVY  560
              ED          +   +  FW            +++K  L   S  E  + + +L+ Y
Sbjct  162  KGED---------DNNSNMVRFWISQWGF------FIIKSQLTGSSASETTEDILRLISY  206

Query  559  EAEGSTVGVWALLSKEKGIIACDMGDKMLGVMNEYEKWKDNAQINGFDRAFKDCYEMMLS  380
            E E      WA+L+     +    G+ +LGV      WK N  + GF  +FKD +E + S
Sbjct  207  ENENG----WAILTVGSAPLVVARGNLVLGVFENLNAWKKNLNLKGFPNSFKDYFEQLAS  262

Query  379  SSSPTSYQHPYCFLNYPSNLEKIPNTQSCPQCNHNMHKLVTFSCCH  242
                 ++Q     L  P     IP   +CP+C   M   + F+CCH
Sbjct  263  R----THQCEKVIL--PGFSGWIPMIVNCPECPRFMETGINFNCCH  302



>gb|AHY04439.1| sieve element occlusion by forisomes 1 [Dipteryx panamensis]
Length=651

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/224 (27%), Positives = 94/224 (42%), Gaps = 45/224 (20%)
 Frame = -3

Query  880  IDDEEYIFLCGGNNNKQVQELILKIQEICSKIQMNWRIVYIGRSGKTFFDEDVIRMCDST  701
            ++ E YIF+ GG +NK +Q+  L + ++                       D I+  D+ 
Sbjct  455  VEPESYIFIYGGTDNKWIQDFTLAVDKVKR--------------------HDTIKRADAI  494

Query  700  VTSEQRIKE------FWTRLQSMASSRIQYLLKMGLDEGSD-EIMQGVKKLLVYEAEGST  542
            +   Q  K+      FW  ++S    + Q        E  D +I   VK LL  + +   
Sbjct  495  IEHHQLAKDDSIVPRFWIGIESKTHKKHQ--------EAVDCQIQTIVKSLLCLKRDPQG  546

Query  541  VGVWALLSKEKGIIACDMGDKMLGVMNEYEKWKDNA-QINGFDRAFKDCYEMMLSSSSPT  365
               WA+LSK   +     G+ ML  + ++E WKD   +  GFD A K+ Y+  + S    
Sbjct  547  ---WAILSKGNNVKILGHGEPMLQTLTQFESWKDKVLEKEGFDIALKEFYDGKVES---L  600

Query  364  SYQHPYCFLNYPSNLEKIPNTQSCPQ--CNHNMHKL-VTFSCCH  242
            SY+ P  +LN  S    +  T +CP   C   M    V + CCH
Sbjct  601  SYRQPCEYLNIDSQSSSVIATITCPNPTCGRVMEVTSVNYRCCH  644



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2725021258018