BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25402_g4_i7 len=595 path=[601:0-192 10674:193-213 10695:214-229
831:230-260 862:261-272 874:273-278 880:279-292 10772:293-305
10816:306-308 10821:309-313 10830:314-314 916:315-317 919:318-323
10837:324-341 10855:342-343 10857:344-345 10859:346-386
10885:387-388 10887:389-408 11120:409-415 1017:416-449 1051:450-459
1061:460-493 11150:494-498 1100:499-569 1171:570-594]

Length=595
                                                                      Score     E

emb|CBI37963.3|  unnamed protein product                                116   7e-30   
ref|XP_006423551.1|  hypothetical protein CICLE_v10029685mg             116   1e-29   
ref|XP_006487294.1|  PREDICTED: auxin-induced protein 10A5-like         116   1e-29   
gb|KDO46704.1|  hypothetical protein CISIN_1g036136mg                   115   2e-29   
ref|XP_010647435.1|  PREDICTED: auxin-induced protein 15A               115   2e-29   
ref|XP_009799352.1|  PREDICTED: auxin-induced protein 15A-like          115   2e-29   
ref|XP_004300216.1|  PREDICTED: indole-3-acetic acid-induced prot...    115   2e-29   
ref|XP_003523506.1|  PREDICTED: indole-3-acetic acid-induced prot...    115   3e-29   
ref|XP_010246393.1|  PREDICTED: auxin-induced protein 15A-like          115   3e-29   
ref|XP_010246391.1|  PREDICTED: auxin-induced protein 15A-like          115   4e-29   
ref|XP_007200097.1|  hypothetical protein PRUPE_ppa019366mg             115   4e-29   
emb|CBI37961.3|  unnamed protein product                                114   5e-29   
ref|XP_011088521.1|  PREDICTED: auxin-induced protein 15A-like          114   5e-29   
emb|CAN65271.1|  hypothetical protein VITISV_040138                     114   5e-29   Vitis vinifera
gb|EYU18551.1|  hypothetical protein MIMGU_mgv1a018365mg                114   5e-29   
ref|XP_006423553.1|  hypothetical protein CICLE_v10029881mg             114   6e-29   
ref|XP_008237080.1|  PREDICTED: auxin-induced protein 15A-like          114   6e-29   
ref|XP_010246396.1|  PREDICTED: auxin-induced protein 15A-like          114   8e-29   
ref|XP_010246394.1|  PREDICTED: auxin-induced protein 15A-like          114   8e-29   
ref|XP_002312998.1|  hypothetical protein POPTR_0009s12930g             114   9e-29   Populus trichocarpa [western balsam poplar]
ref|XP_006423540.1|  hypothetical protein CICLE_v10029650mg             114   9e-29   
ref|XP_009368370.1|  PREDICTED: auxin-induced protein 15A-like          114   9e-29   
ref|XP_004301667.1|  PREDICTED: uncharacterized protein LOC101297356    117   9e-29   
ref|XP_008236177.1|  PREDICTED: auxin-induced protein 15A               114   1e-28   
ref|XP_007201545.1|  hypothetical protein PRUPE_ppa017462mg             114   1e-28   
ref|XP_011088527.1|  PREDICTED: auxin-induced protein 15A-like          114   1e-28   
ref|XP_011047001.1|  PREDICTED: indole-3-acetic acid-induced prot...    114   1e-28   
ref|XP_009358224.1|  PREDICTED: auxin-induced protein 15A-like          114   1e-28   
emb|CAN70456.1|  hypothetical protein VITISV_035060                     113   1e-28   Vitis vinifera
ref|XP_002306150.1|  hypothetical protein POPTR_0004s17180g             113   1e-28   Populus trichocarpa [western balsam poplar]
emb|CDP15258.1|  unnamed protein product                                115   1e-28   
ref|XP_010649236.1|  PREDICTED: auxin-induced protein 15A-like          114   1e-28   
ref|XP_009368374.1|  PREDICTED: auxin-induced protein 15A-like          113   1e-28   
ref|XP_009347322.1|  PREDICTED: auxin-induced protein 15A-like          113   1e-28   
ref|XP_006360733.1|  PREDICTED: auxin-induced protein 15A-like          113   2e-28   
ref|XP_009764192.1|  PREDICTED: auxin-induced protein 15A-like          112   2e-28   
ref|XP_010246392.1|  PREDICTED: auxin-induced protein 15A-like          113   2e-28   
ref|XP_004250226.1|  PREDICTED: auxin-induced protein 15A-like          112   2e-28   
ref|XP_004290377.1|  PREDICTED: indole-3-acetic acid-induced prot...    112   2e-28   
ref|XP_010108330.1|  hypothetical protein L484_000421                   113   2e-28   
ref|XP_010312906.1|  PREDICTED: auxin-induced protein 15A-like          112   3e-28   
ref|XP_004293889.1|  PREDICTED: indole-3-acetic acid-induced prot...    112   3e-28   
ref|XP_006362801.1|  PREDICTED: indole-3-acetic acid-induced prot...    113   3e-28   
ref|XP_008360591.1|  PREDICTED: auxin-induced protein 15A-like          112   3e-28   
gb|KDP34544.1|  hypothetical protein JCGZ_11094                         112   3e-28   
gb|KDP27620.1|  hypothetical protein JCGZ_19625                         112   3e-28   
ref|XP_002312996.1|  hypothetical protein POPTR_0009s12950g             112   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_009620278.1|  PREDICTED: auxin-induced protein 15A-like          112   3e-28   
ref|XP_008369486.1|  PREDICTED: auxin-induced protein 15A-like          112   3e-28   
ref|XP_009368351.1|  PREDICTED: auxin-induced protein 15A-like          112   4e-28   
ref|XP_006360736.1|  PREDICTED: indole-3-acetic acid-induced prot...    112   4e-28   
ref|XP_011088529.1|  PREDICTED: auxin-induced protein 15A-like          112   4e-28   
ref|XP_006352409.1|  PREDICTED: auxin-induced protein 15A-like          112   4e-28   
ref|XP_004231003.1|  PREDICTED: auxin-induced protein 15A-like          112   4e-28   
ref|XP_010312723.1|  PREDICTED: auxin-induced protein 15A-like          112   4e-28   
emb|CAN70455.1|  hypothetical protein VITISV_035059                     112   4e-28   Vitis vinifera
ref|XP_004250224.1|  PREDICTED: auxin-induced protein X15-like          112   5e-28   
ref|XP_010647509.1|  PREDICTED: auxin-induced protein X15               112   5e-28   
gb|KDP27617.1|  hypothetical protein JCGZ_19622                         112   6e-28   
ref|XP_009368354.1|  PREDICTED: auxin-induced protein 15A-like          111   6e-28   
ref|XP_006352413.1|  PREDICTED: auxin-induced protein 15A-like          111   6e-28   
ref|XP_011088523.1|  PREDICTED: uncharacterized protein LOC105169727    114   7e-28   
ref|XP_002276271.1|  PREDICTED: auxin-induced protein 15A               111   7e-28   Vitis vinifera
ref|XP_009592061.1|  PREDICTED: auxin-induced protein 15A-like          111   7e-28   
ref|XP_009793415.1|  PREDICTED: auxin-induced protein 15A-like          111   7e-28   
gb|KDP27603.1|  hypothetical protein JCGZ_19608                         112   7e-28   
emb|CAN79758.1|  hypothetical protein VITISV_009898                     111   7e-28   Vitis vinifera
ref|XP_006359618.1|  PREDICTED: auxin-induced protein 15A-like          111   7e-28   
ref|XP_009601953.1|  PREDICTED: auxin-induced protein 15A-like          111   7e-28   
ref|XP_010315344.1|  PREDICTED: auxin-induced protein 15A-like          111   8e-28   
gb|EYU35271.1|  hypothetical protein MIMGU_mgv1a020811mg                111   8e-28   
ref|XP_002276391.1|  PREDICTED: auxin-induced protein 15A               111   8e-28   Vitis vinifera
ref|XP_009592053.1|  PREDICTED: auxin-induced protein 15A-like          111   8e-28   
ref|XP_002276347.1|  PREDICTED: auxin-induced protein 15A-like          111   8e-28   Vitis vinifera
emb|CDO96966.1|  unnamed protein product                                111   9e-28   
ref|XP_010647407.1|  PREDICTED: auxin-induced protein X15-like          111   9e-28   
ref|XP_002306152.1|  hypothetical protein POPTR_0004s17230g             111   9e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006359712.1|  PREDICTED: auxin-induced protein 15A-like          111   9e-28   
emb|CDO96969.1|  unnamed protein product                                111   9e-28   
gb|AAM12778.1|  auxin-induced SAUR-like protein                         111   9e-28   Capsicum annuum
ref|XP_002271395.1|  PREDICTED: auxin-induced protein 15A               111   9e-28   Vitis vinifera
emb|CBI17630.3|  unnamed protein product                                110   1e-27   
ref|XP_004301666.1|  PREDICTED: uncharacterized protein LOC101297064    114   1e-27   
ref|XP_009347320.1|  PREDICTED: auxin-induced protein 15A-like          111   1e-27   
ref|XP_002276058.2|  PREDICTED: auxin-induced protein X15               111   1e-27   Vitis vinifera
ref|XP_004230990.1|  PREDICTED: auxin-induced protein 15A-like          110   1e-27   
ref|XP_010315356.1|  PREDICTED: auxin-induced protein 15A-like          110   1e-27   
ref|XP_006359717.1|  PREDICTED: auxin-induced protein 15A-like          110   1e-27   
ref|XP_008448012.1|  PREDICTED: auxin-induced protein 15A-like          110   1e-27   
ref|XP_006349639.1|  PREDICTED: auxin-induced protein 15A-like          110   1e-27   
ref|XP_007135904.1|  hypothetical protein PHAVU_009G001600g             111   1e-27   
ref|XP_010271569.1|  PREDICTED: auxin-induced protein 15A-like          111   1e-27   
ref|XP_010244080.1|  PREDICTED: auxin-induced protein 15A-like          111   1e-27   
ref|XP_002312994.1|  auxin-responsive family protein                    110   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_002271464.1|  PREDICTED: auxin-induced protein 15A               111   2e-27   Vitis vinifera
gb|EYU37890.1|  hypothetical protein MIMGU_mgv1a022439mg                110   2e-27   
ref|XP_009620280.1|  PREDICTED: auxin-induced protein 15A-like          110   2e-27   
ref|XP_011088530.1|  PREDICTED: auxin-induced protein 15A-like          110   2e-27   
emb|CDY02656.1|  BnaC02g07790D                                          110   2e-27   
emb|CDY38475.1|  BnaA10g16830D                                          110   2e-27   
ref|XP_009770357.1|  PREDICTED: auxin-induced protein 15A-like          110   2e-27   
gb|KDP27614.1|  hypothetical protein JCGZ_19619                         110   2e-27   
ref|XP_002276204.1|  PREDICTED: auxin-induced protein X15               110   2e-27   Vitis vinifera
emb|CDX94145.1|  BnaC07g37790D                                          110   2e-27   
ref|XP_007201447.1|  hypothetical protein PRUPE_ppa013863mg             110   2e-27   
ref|XP_002306151.1|  hypothetical protein POPTR_0004s17190g             110   2e-27   Populus trichocarpa [western balsam poplar]
emb|CDO96970.1|  unnamed protein product                                110   2e-27   
ref|XP_004300228.1|  PREDICTED: indole-3-acetic acid-induced prot...    110   2e-27   
ref|XP_009766736.1|  PREDICTED: auxin-induced protein 15A-like          110   2e-27   
ref|XP_010086682.1|  hypothetical protein L484_000889                   110   2e-27   
ref|XP_008365898.1|  PREDICTED: auxin-induced protein 15A-like          110   2e-27   
ref|XP_010315343.1|  PREDICTED: auxin-induced protein 15A-like          110   2e-27   
ref|XP_004230984.1|  PREDICTED: auxin-induced protein 15A-like          110   2e-27   
emb|CAN79759.1|  hypothetical protein VITISV_009899                     110   2e-27   Vitis vinifera
ref|XP_009126229.1|  PREDICTED: auxin-induced protein 15A-like          110   2e-27   
gb|KGN43197.1|  hypothetical protein Csa_7G008440                       110   2e-27   
ref|XP_004301662.1|  PREDICTED: uncharacterized protein LOC101295922    113   2e-27   
gb|KDP27613.1|  hypothetical protein JCGZ_19618                         110   2e-27   
gb|EYU35291.1|  hypothetical protein MIMGU_mgv1a017210mg                110   2e-27   
ref|XP_009126235.1|  PREDICTED: auxin-induced protein 15A-like          110   2e-27   
ref|XP_003631553.1|  PREDICTED: auxin-induced protein X15-like          110   2e-27   
ref|XP_010315351.1|  PREDICTED: auxin-induced protein 15A-like          110   3e-27   
ref|XP_009620276.1|  PREDICTED: auxin-induced protein 15A-like          110   3e-27   
ref|XP_008372889.1|  PREDICTED: auxin-induced protein 15A-like          110   3e-27   
emb|CBI17627.3|  unnamed protein product                                112   3e-27   
ref|XP_009592041.1|  PREDICTED: auxin-induced protein 15A-like          110   3e-27   
ref|XP_002272231.1|  PREDICTED: auxin-induced protein X15-like          110   3e-27   Vitis vinifera
ref|XP_010263886.1|  PREDICTED: auxin-induced protein 15A-like          110   3e-27   
ref|XP_007199585.1|  hypothetical protein PRUPE_ppb023607mg             110   3e-27   
emb|CDY53265.1|  BnaA02g03890D                                          110   3e-27   
ref|XP_002271501.1|  PREDICTED: auxin-induced protein X15               110   3e-27   Vitis vinifera
ref|XP_010649235.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    113   3e-27   
ref|XP_002272387.1|  PREDICTED: auxin-induced protein 15A-like          110   3e-27   Vitis vinifera
emb|CBI17628.3|  unnamed protein product                                109   3e-27   
ref|XP_009620275.1|  PREDICTED: auxin-induced protein 15A-like          109   3e-27   
gb|KDP34545.1|  hypothetical protein JCGZ_11095                         110   3e-27   
ref|XP_009770355.1|  PREDICTED: auxin-induced protein 15A-like          109   3e-27   
ref|XP_008225927.1|  PREDICTED: auxin-induced protein 15A-like          109   3e-27   
ref|XP_008382353.1|  PREDICTED: auxin-induced protein 15A-like          109   3e-27   
ref|XP_010315355.1|  PREDICTED: auxin-induced protein 15A-like          109   3e-27   
ref|XP_010536042.1|  PREDICTED: auxin-induced protein 15A-like          109   4e-27   
ref|XP_009772683.1|  PREDICTED: auxin-induced protein 15A-like          109   4e-27   
gb|KFK26026.1|  hypothetical protein AALP_AA8G193900                    110   4e-27   
ref|XP_007041971.1|  SAUR-like auxin-responsive protein family, p...    109   4e-27   
gb|KDP34553.1|  hypothetical protein JCGZ_11103                         110   4e-27   
ref|XP_006352414.1|  PREDICTED: auxin-induced protein 15A-like          109   4e-27   
ref|XP_002276227.1|  PREDICTED: auxin-induced protein 15A               109   4e-27   Vitis vinifera
gb|AAM12777.1|  putative auxin-induced SAUR-like protein                109   4e-27   Capsicum annuum
ref|XP_010248232.1|  PREDICTED: auxin-induced protein X10A-like         110   4e-27   
ref|XP_008369425.1|  PREDICTED: auxin-induced protein 15A-like          109   4e-27   
ref|XP_002313000.1|  hypothetical protein POPTR_0009s12910g             109   4e-27   Populus trichocarpa [western balsam poplar]
ref|XP_009766735.1|  PREDICTED: auxin-induced protein 15A-like          109   4e-27   
ref|XP_004250217.1|  PREDICTED: auxin-induced protein X15-like          109   4e-27   
ref|XP_010649243.1|  PREDICTED: auxin-induced protein 15A               109   5e-27   
emb|CDY71214.1|  BnaAnng36540D                                          109   5e-27   
ref|XP_006352406.1|  PREDICTED: auxin-induced protein 15A-like          109   5e-27   
emb|CDY25466.1|  BnaC09g39810D                                          109   5e-27   
ref|XP_010664793.1|  PREDICTED: auxin-induced protein 15A               109   5e-27   
ref|XP_009770668.1|  PREDICTED: auxin-induced protein 15A-like          109   5e-27   
ref|XP_009379590.1|  PREDICTED: auxin-induced protein 15A-like          109   5e-27   
gb|KCW55457.1|  hypothetical protein EUGRSUZ_I01359                     109   6e-27   
ref|XP_006359634.1|  PREDICTED: auxin-induced protein 15A-like          108   6e-27   
ref|XP_011088528.1|  PREDICTED: auxin-induced protein X15-like          109   6e-27   
ref|XP_010271400.1|  PREDICTED: auxin-induced protein 6B-like           109   6e-27   
ref|XP_007041977.1|  SAUR-like auxin-responsive protein family, p...    109   6e-27   
ref|XP_006286674.1|  hypothetical protein CARUB_v10002645mg             108   6e-27   
gb|EYU37903.1|  hypothetical protein MIMGU_mgv1a022749mg                108   7e-27   
ref|XP_009760902.1|  PREDICTED: auxin-induced protein 15A-like          108   7e-27   
ref|XP_006400352.1|  hypothetical protein EUTSA_v10015118mg             109   7e-27   
gb|EYU23191.1|  hypothetical protein MIMGU_mgv1a020984mg                108   7e-27   
ref|XP_006400344.1|  hypothetical protein EUTSA_v10015117mg             108   8e-27   
ref|XP_010255167.1|  PREDICTED: auxin-induced protein X10A-like         109   8e-27   
ref|XP_004166275.1|  PREDICTED: auxin-induced protein 10A5-like         108   8e-27   
emb|CBI17626.3|  unnamed protein product                                108   8e-27   
ref|XP_008392043.1|  PREDICTED: auxin-induced protein 15A-like          108   8e-27   
emb|CAN62606.1|  hypothetical protein VITISV_016867                     108   8e-27   Vitis vinifera
ref|XP_010271401.1|  PREDICTED: uncharacterized protein LOC104607462    112   8e-27   
ref|XP_002271427.1|  PREDICTED: auxin-induced protein 15A               108   8e-27   Vitis vinifera
ref|XP_008237039.1|  PREDICTED: auxin-induced protein 15A-like          108   9e-27   
emb|CDY25469.1|  BnaC09g39840D                                          108   9e-27   
ref|XP_009368355.1|  PREDICTED: auxin-induced protein 15A-like          110   9e-27   
ref|XP_006359632.1|  PREDICTED: auxin-induced protein 15A-like          108   9e-27   
ref|XP_006359630.1|  PREDICTED: auxin-induced protein 15A-like          108   9e-27   
ref|XP_008391973.1|  PREDICTED: auxin-induced protein 15A-like          108   9e-27   
emb|CBI37953.3|  unnamed protein product                                109   9e-27   
ref|XP_006359633.1|  PREDICTED: auxin-induced protein 15A-like          108   1e-26   
gb|KDP27610.1|  hypothetical protein JCGZ_19615                         108   1e-26   
ref|XP_009591874.1|  PREDICTED: auxin-induced protein 15A-like          108   1e-26   
emb|CDY02652.1|  BnaC02g07830D                                          108   1e-26   
ref|XP_002271660.2|  PREDICTED: uncharacterized protein LOC100252964    112   1e-26   Vitis vinifera
ref|XP_006359629.1|  PREDICTED: auxin-induced protein 15A-like          108   1e-26   
gb|EYU40409.1|  hypothetical protein MIMGU_mgv1a017192mg                108   1e-26   
ref|XP_009615593.1|  PREDICTED: auxin-induced protein 15A-like          108   1e-26   
gb|AFK35784.1|  unknown                                                 108   1e-26   
ref|XP_008237035.1|  PREDICTED: auxin-induced protein 15A-like          108   1e-26   
ref|XP_009615596.1|  PREDICTED: auxin-induced protein 15A-like          108   1e-26   
gb|AFK33527.1|  unknown                                                 108   1e-26   
ref|XP_008448001.1|  PREDICTED: auxin-induced protein 15A               108   1e-26   
ref|XP_010028670.1|  PREDICTED: auxin-induced protein 15A-like          108   1e-26   
ref|XP_009619474.1|  PREDICTED: auxin-induced protein 15A-like          108   1e-26   
ref|XP_008391974.1|  PREDICTED: auxin-induced protein 15A-like          108   1e-26   
ref|XP_010527467.1|  PREDICTED: auxin-induced protein 15A-like          108   1e-26   
ref|XP_006423537.1|  hypothetical protein CICLE_v10029871mg             108   1e-26   
ref|XP_009126238.1|  PREDICTED: auxin-induced protein 15A-like          108   1e-26   
emb|CDY02650.1|  BnaC02g07850D                                          108   1e-26   
dbj|BAA25434.1|  SAUR                                                   108   1e-26   Raphanus sativus
gb|KDP27609.1|  hypothetical protein JCGZ_19614                         108   1e-26   
emb|CDP20901.1|  unnamed protein product                                108   1e-26   
ref|XP_006352412.1|  PREDICTED: auxin-induced protein 15A-like          108   1e-26   
ref|XP_007041975.1|  SAUR-like auxin-responsive protein family, p...    108   1e-26   
ref|XP_010420537.1|  PREDICTED: auxin-induced protein 15A-like          108   2e-26   
ref|XP_007199079.1|  hypothetical protein PRUPE_ppa019112mg             108   2e-26   
ref|XP_010248164.1|  PREDICTED: auxin-induced protein 15A-like          108   2e-26   
ref|XP_009615595.1|  PREDICTED: auxin-induced protein 15A-like          107   2e-26   
ref|XP_008392045.1|  PREDICTED: auxin-induced protein 15A-like          108   2e-26   
gb|ABL97983.1|  auxin-induced protein-like                              108   2e-26   Brassica rapa
gb|EYU37893.1|  hypothetical protein MIMGU_mgv1a023686mg                107   2e-26   
emb|CDY02654.1|  BnaC02g07810D                                          108   2e-26   
ref|XP_009770356.1|  PREDICTED: auxin-induced protein 15A-like          107   2e-26   
ref|XP_007131725.1|  hypothetical protein PHAVU_011G036500g             107   2e-26   
gb|EYU37902.1|  hypothetical protein MIMGU_mgv1a026564mg                107   2e-26   
gb|KGN61887.1|  hypothetical protein Csa_2G258830                       108   2e-26   
emb|CDY71365.1|  BnaAnng37150D                                          108   2e-26   
ref|XP_010315346.1|  PREDICTED: auxin-induced protein 15A-like          108   2e-26   
gb|EYU37886.1|  hypothetical protein MIMGU_mgv11b016999mg               107   2e-26   
emb|CDY53266.1|  BnaA02g03880D                                          108   2e-26   
emb|CDY02660.1|  BnaC02g07750D                                          107   2e-26   
ref|XP_002276185.1|  PREDICTED: auxin-induced protein X15               107   2e-26   Vitis vinifera
ref|XP_009799442.1|  PREDICTED: auxin-induced protein 15A-like          109   2e-26   
ref|XP_008237099.1|  PREDICTED: auxin-induced protein 15A-like          108   2e-26   
ref|XP_007041974.1|  SAUR-like auxin-responsive protein family, p...    107   2e-26   
ref|XP_004172954.1|  PREDICTED: auxin-induced protein X10A-like         108   2e-26   
gb|EYU40728.1|  hypothetical protein MIMGU_mgv1a022834mg                107   2e-26   
ref|XP_006494594.1|  PREDICTED: auxin-induced protein 10A5-like         108   2e-26   
ref|XP_010315354.1|  PREDICTED: auxin-induced protein 15A-like          107   2e-26   
ref|XP_006352411.1|  PREDICTED: auxin-induced protein X15-like          107   2e-26   
ref|XP_006362802.1|  PREDICTED: auxin-induced protein 15A-like          107   2e-26   
emb|CDP18416.1|  unnamed protein product                                108   2e-26   
gb|KGN43203.1|  hypothetical protein Csa_7G008990                       107   2e-26   
ref|XP_006289998.1|  hypothetical protein CARUB_v10003628mg             107   2e-26   
ref|XP_004289828.1|  PREDICTED: indole-3-acetic acid-induced prot...    108   2e-26   
gb|EYU40724.1|  hypothetical protein MIMGU_mgv1a024905mg                107   2e-26   
ref|XP_009764193.1|  PREDICTED: auxin-induced protein 15A-like          107   2e-26   
ref|XP_006286648.1|  hypothetical protein CARUB_v10002518mg             107   2e-26   
ref|XP_009368357.1|  PREDICTED: indole-3-acetic acid-induced prot...    107   2e-26   
ref|XP_008237032.1|  PREDICTED: indole-3-acetic acid-induced prot...    107   3e-26   
gb|EYU37898.1|  hypothetical protein MIMGU_mgv1a019710mg                107   3e-26   
ref|XP_010492794.1|  PREDICTED: auxin-induced protein X10A-like         107   3e-26   
ref|XP_010028671.1|  PREDICTED: indole-3-acetic acid-induced prot...    107   3e-26   
gb|EYU37888.1|  hypothetical protein MIMGU_mgv1a023157mg                107   3e-26   
ref|XP_009793414.1|  PREDICTED: auxin-induced protein 15A-like          107   3e-26   
ref|XP_008457635.1|  PREDICTED: auxin-induced protein 15A-like          107   3e-26   
ref|XP_004290376.1|  PREDICTED: indole-3-acetic acid-induced prot...    107   3e-26   
ref|XP_009368350.1|  PREDICTED: auxin-induced protein 15A-like          107   3e-26   
gb|KDP34554.1|  hypothetical protein JCGZ_11104                         107   3e-26   
ref|XP_004309347.1|  PREDICTED: indole-3-acetic acid-induced prot...    107   3e-26   
ref|XP_007201445.1|  hypothetical protein PRUPE_ppa013846mg             107   3e-26   
ref|XP_003522807.1|  PREDICTED: auxin-induced protein 10A5-like         107   3e-26   
ref|XP_007200892.1|  hypothetical protein PRUPE_ppb015877mg             107   3e-26   
ref|XP_008391976.1|  PREDICTED: auxin-induced protein 15A-like          107   3e-26   
ref|XP_002271620.1|  PREDICTED: auxin-induced protein 15A               107   3e-26   Vitis vinifera
gb|KGN61878.1|  hypothetical protein Csa_2G258740                       107   3e-26   
ref|XP_006487310.1|  PREDICTED: auxin-induced protein X10A-like         107   3e-26   
emb|CDX70790.1|  BnaC03g08740D                                          107   3e-26   
ref|NP_197309.1|  small auxin up RNA 24                                 107   3e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDX78776.1|  BnaA03g06880D                                          107   3e-26   
emb|CDX70786.1|  BnaC03g08700D                                          107   3e-26   
ref|XP_009379575.1|  PREDICTED: auxin-induced protein 15A-like          107   3e-26   
ref|XP_002871799.1|  hypothetical protein ARALYDRAFT_909816             107   3e-26   
ref|XP_009627044.1|  PREDICTED: auxin-induced protein X10A-like         109   3e-26   
ref|XP_009347325.1|  PREDICTED: indole-3-acetic acid-induced prot...    107   4e-26   
emb|CBI37960.3|  unnamed protein product                                107   4e-26   
emb|CDY38479.1|  BnaA10g16790D                                          107   4e-26   
ref|XP_006577905.1|  PREDICTED: auxin-induced protein X10A-like         107   4e-26   
ref|XP_010246403.1|  PREDICTED: auxin-induced protein 15A-like          107   4e-26   
ref|XP_003527610.1|  PREDICTED: auxin-induced protein 10A5-like         107   4e-26   
gb|EYU35280.1|  hypothetical protein MIMGU_mgv1a023363mg                107   4e-26   
ref|XP_009129147.1|  PREDICTED: auxin-induced protein 15A-like          108   4e-26   
ref|NP_179717.1|  SAUR-like auxin-responsive protein                    107   4e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDY02661.1|  BnaC02g07740D                                          107   4e-26   
gb|KDP34546.1|  hypothetical protein JCGZ_11096                         107   4e-26   
ref|XP_006423544.1|  hypothetical protein CICLE_v10030006mg             108   4e-26   
ref|XP_006289917.1|  hypothetical protein CARUB_v10003533mg             107   4e-26   
ref|XP_009131641.1|  PREDICTED: indole-3-acetic acid-induced prot...    107   4e-26   
ref|XP_007200657.1|  hypothetical protein PRUPE_ppa016788mg             107   4e-26   
ref|XP_009131624.1|  PREDICTED: auxin-induced protein 15A-like          107   4e-26   
gb|EYU40725.1|  hypothetical protein MIMGU_mgv1a017774mg                107   4e-26   
ref|XP_010101888.1|  hypothetical protein L484_015478                   107   4e-26   
ref|XP_009126232.1|  PREDICTED: auxin-induced protein 15A-like          107   4e-26   
ref|XP_010647476.1|  PREDICTED: auxin-induced protein X15               107   4e-26   
gb|KCW55443.1|  hypothetical protein EUGRSUZ_I01345                     107   4e-26   
ref|XP_002306149.1|  hypothetical protein POPTR_0004s17170g             107   4e-26   
ref|XP_002271793.1|  PREDICTED: auxin-induced protein X15               107   5e-26   
ref|XP_007200638.1|  hypothetical protein PRUPE_ppa013834mg             107   5e-26   
ref|XP_009121028.1|  PREDICTED: auxin-induced protein 15A-like          107   5e-26   
emb|CBI37962.3|  unnamed protein product                                108   5e-26   
emb|CBI37949.3|  unnamed protein product                                106   5e-26   
gb|KDP27616.1|  hypothetical protein JCGZ_19621                         107   5e-26   
ref|XP_008382371.1|  PREDICTED: auxin-induced protein 15A-like          107   5e-26   
emb|CDX70794.1|  BnaC03g08780D                                          106   5e-26   
ref|XP_006290038.1|  hypothetical protein CARUB_v10003672mg             107   5e-26   
ref|XP_009760922.1|  PREDICTED: auxin-induced protein 15A-like          106   5e-26   
ref|XP_002271594.1|  PREDICTED: auxin-induced protein 15A-like          107   5e-26   
ref|XP_010255168.1|  PREDICTED: uncharacterized protein LOC104595902    109   5e-26   
gb|KFK26043.1|  hypothetical protein AALP_AA8G195900                    106   5e-26   
emb|CDY02648.1|  BnaC02g07870D                                          107   5e-26   
gb|EYU37891.1|  hypothetical protein MIMGU_mgv1a023887mg                106   5e-26   
gb|ACU16335.1|  unknown                                                 106   5e-26   
emb|CDY25470.1|  BnaC09g39850D                                          107   5e-26   
ref|XP_008448014.1|  PREDICTED: auxin-induced protein 15A-like          107   5e-26   
gb|EYU37887.1|  hypothetical protein MIMGU_mgv1a022037mg                106   6e-26   
gb|KDP34550.1|  hypothetical protein JCGZ_11100                         107   6e-26   
gb|KHN25445.1|  Auxin-induced protein 15A                               106   6e-26   
emb|CAN62609.1|  hypothetical protein VITISV_016870                     110   6e-26   
gb|EYU37897.1|  hypothetical protein MIMGU_mgv11b017186mg               106   6e-26   
emb|CDX78773.1|  BnaA03g06850D                                          106   6e-26   
ref|XP_006423546.1|  hypothetical protein CICLE_v10029651mg             106   6e-26   
ref|XP_009379588.1|  PREDICTED: auxin-induced protein 15A-like          106   6e-26   
gb|EYU35295.1|  hypothetical protein MIMGU_mgv1a023063mg                105   6e-26   
ref|XP_004230981.1|  PREDICTED: auxin-induced protein 15A-like          106   7e-26   
ref|NP_197304.1|  SAUR-like auxin-responsive protein                    106   7e-26   
gb|KDP34547.1|  hypothetical protein JCGZ_11097                         106   7e-26   
ref|XP_007201446.1|  hypothetical protein PRUPE_ppa013847mg             106   7e-26   
ref|XP_002276412.1|  PREDICTED: auxin-induced protein 15A               106   7e-26   
ref|XP_008237040.1|  PREDICTED: auxin-induced protein 15A-like          106   7e-26   
ref|XP_007131728.1|  hypothetical protein PHAVU_011G036800g             106   7e-26   
ref|XP_006423549.1|  hypothetical protein CICLE_v10030017mg             106   7e-26   
ref|XP_011088524.1|  PREDICTED: auxin-induced protein 15A-like          106   7e-26   
ref|XP_010271402.1|  PREDICTED: auxin-induced protein X10A-like         106   7e-26   
ref|XP_009615592.1|  PREDICTED: auxin-induced protein 15A-like          106   8e-26   
ref|XP_008382372.1|  PREDICTED: auxin-induced protein 15A-like          106   8e-26   
ref|XP_008448016.1|  PREDICTED: auxin-induced protein 15A-like          106   8e-26   
ref|XP_007200851.1|  hypothetical protein PRUPE_ppa026539mg             106   8e-26   
ref|XP_007201668.1|  hypothetical protein PRUPE_ppa022319mg             106   8e-26   
ref|XP_004144829.1|  PREDICTED: auxin-induced protein X15-like          106   8e-26   
ref|XP_004166277.1|  PREDICTED: auxin-induced protein X10A-like         106   8e-26   
ref|XP_009799437.1|  PREDICTED: auxin-induced protein 15A-like          106   8e-26   
ref|XP_003631579.1|  PREDICTED: auxin-induced protein X15               106   8e-26   
ref|XP_010246401.1|  PREDICTED: auxin-induced protein 15A-like          106   9e-26   
ref|XP_002306156.1|  hypothetical protein POPTR_0004s17290g             106   9e-26   
ref|XP_010246398.1|  PREDICTED: auxin-induced protein 15A-like          106   9e-26   
ref|XP_002271891.1|  PREDICTED: auxin-induced protein 15A               106   9e-26   
ref|XP_010536039.1|  PREDICTED: auxin-induced protein 15A-like          106   9e-26   
ref|XP_009126237.1|  PREDICTED: auxin-induced protein 15A-like          106   9e-26   
gb|KDP34548.1|  hypothetical protein JCGZ_11098                         106   9e-26   
ref|XP_004162911.1|  PREDICTED: auxin-induced protein X10A-like         106   1e-25   
ref|XP_009347321.1|  PREDICTED: auxin-induced protein 15A-like          106   1e-25   
ref|XP_009121026.1|  PREDICTED: auxin-induced protein 15A-like          106   1e-25   
ref|XP_009131625.1|  PREDICTED: auxin-induced protein 15A-like          106   1e-25   
ref|XP_008358419.1|  PREDICTED: indole-3-acetic acid-induced prot...    106   1e-25   
emb|CDY15832.1|  BnaC02g34510D                                          107   1e-25   
ref|XP_009121024.1|  PREDICTED: auxin-induced protein 15A-like          106   1e-25   
ref|XP_011037241.1|  PREDICTED: uncharacterized protein LOC105134501    108   1e-25   
gb|EYU40723.1|  hypothetical protein MIMGU_mgv1a024510mg                105   1e-25   
gb|EYU40730.1|  hypothetical protein MIMGU_mgv1a023017mg                106   1e-25   
ref|XP_010536046.1|  PREDICTED: auxin-induced protein 15A-like          107   1e-25   
ref|XP_002306154.1|  hypothetical protein POPTR_0004s17260g             105   1e-25   
gb|EYU35307.1|  hypothetical protein MIMGU_mgv1a020911mg                105   1e-25   
ref|XP_009379576.1|  PREDICTED: auxin-induced protein 15A-like          106   1e-25   
ref|XP_007201444.1|  hypothetical protein PRUPE_ppa013844mg             106   1e-25   
ref|XP_006487311.1|  PREDICTED: auxin-induced protein X15-like          105   1e-25   
ref|XP_008369481.1|  PREDICTED: auxin-induced protein 15A-like          106   1e-25   
ref|XP_009368378.1|  PREDICTED: auxin-induced protein 15A-like          106   1e-25   
ref|XP_009368353.1|  PREDICTED: auxin-induced protein 15A-like          105   1e-25   
emb|CDX70787.1|  BnaC03g08710D                                          105   1e-25   
ref|XP_008345408.1|  PREDICTED: auxin-induced protein 15A-like          106   1e-25   
ref|XP_007041970.1|  SAUR-like auxin-responsive protein family, p...    105   1e-25   
ref|XP_004173149.1|  PREDICTED: auxin-induced protein X10A-like         106   1e-25   
ref|XP_002313747.1|  auxin-responsive family protein                    105   1e-25   
ref|XP_010492793.1|  PREDICTED: indole-3-acetic acid-induced prot...    107   1e-25   
ref|XP_006400345.1|  hypothetical protein EUTSA_v10015858mg             105   1e-25   
ref|XP_009764194.1|  PREDICTED: auxin-induced protein 15A-like          106   1e-25   
ref|XP_003631580.1|  PREDICTED: auxin-induced protein 15A               105   1e-25   
ref|NP_197306.1|  SAUR-like auxin-responsive protein                    105   1e-25   
ref|NP_197307.1|  SAUR-like auxin-responsive protein                    105   1e-25   
ref|XP_007199401.1|  hypothetical protein PRUPE_ppa026172mg             105   1e-25   
ref|XP_004505827.1|  PREDICTED: auxin-induced protein X10A-like         105   1e-25   
ref|XP_004248873.1|  PREDICTED: auxin-induced protein 15A-like          105   1e-25   
gb|KHN33698.1|  Auxin-induced protein 15A                               106   1e-25   
emb|CBI37951.3|  unnamed protein product                                105   1e-25   
ref|XP_009121020.1|  PREDICTED: auxin-induced protein 15A-like          105   1e-25   
gb|KCW55445.1|  hypothetical protein EUGRSUZ_I01347                     105   1e-25   
gb|EYU35293.1|  hypothetical protein MIMGU_mgv1a021368mg                105   1e-25   
ref|XP_008237037.1|  PREDICTED: indole-3-acetic acid-induced prot...    105   1e-25   
ref|XP_003540900.2|  PREDICTED: auxin-induced protein X10A-like         106   1e-25   
gb|KHN25461.1|  Auxin-induced protein X10A                              105   1e-25   
ref|XP_010539005.1|  PREDICTED: auxin-induced protein X15-like          105   1e-25   
ref|XP_009379578.1|  PREDICTED: auxin-induced protein 15A-like          105   1e-25   
ref|XP_002306157.1|  hypothetical protein POPTR_0004s17300g             105   1e-25   
ref|XP_010472101.1|  PREDICTED: auxin-induced protein X15               105   1e-25   
ref|XP_009366349.1|  PREDICTED: auxin-induced protein 15A-like          105   1e-25   
ref|XP_009126231.1|  PREDICTED: auxin-induced protein 15A-like          105   1e-25   
gb|KCW55450.1|  hypothetical protein EUGRSUZ_I01352                     105   1e-25   
ref|XP_006289130.1|  hypothetical protein CARUB_v10002553mg             105   2e-25   
ref|XP_009368356.1|  PREDICTED: indole-3-acetic acid-induced prot...    105   2e-25   
ref|XP_004163654.1|  PREDICTED: auxin-induced protein 15A-like          105   2e-25   
ref|XP_008237030.1|  PREDICTED: auxin-induced protein X10A-like         105   2e-25   
ref|XP_008348904.1|  PREDICTED: indole-3-acetic acid-induced prot...    105   2e-25   
ref|XP_011088531.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    108   2e-25   
gb|EYU35301.1|  hypothetical protein MIMGU_mgv1a023166mg                105   2e-25   
gb|EYU35299.1|  hypothetical protein MIMGU_mgv1a019900mg                105   2e-25   
ref|XP_009347332.1|  PREDICTED: auxin-induced protein 15A-like          105   2e-25   
gb|EYU37896.1|  hypothetical protein MIMGU_mgv1a017226mg                105   2e-25   
ref|XP_008457632.1|  PREDICTED: auxin-induced protein 15A-like          105   2e-25   
ref|XP_002276250.1|  PREDICTED: auxin-induced protein X15               105   2e-25   
gb|AES89366.2|  SAUR-like auxin-responsive family protein               105   2e-25   
ref|XP_009368376.1|  PREDICTED: auxin-induced protein 15A-like          105   2e-25   
ref|XP_004231005.1|  PREDICTED: auxin-induced protein 15A-like          105   2e-25   
emb|CBI17632.3|  unnamed protein product                                106   2e-25   
ref|XP_009131628.1|  PREDICTED: auxin-induced protein 15A-like          105   2e-25   
ref|XP_009592059.1|  PREDICTED: auxin-induced protein 15A-like          105   2e-25   
ref|XP_009618922.1|  PREDICTED: auxin-induced protein 15A-like          105   2e-25   
gb|EYU18549.1|  hypothetical protein MIMGU_mgv1a023719mg                105   2e-25   
gb|EYU35287.1|  hypothetical protein MIMGU_mgv1a017212mg                105   2e-25   
ref|XP_004166276.1|  PREDICTED: auxin-induced protein X10A-like         105   2e-25   
ref|XP_004501106.1|  PREDICTED: auxin-induced protein X10A-like         105   2e-25   
gb|EYU37894.1|  hypothetical protein MIMGU_mgv1a020073mg                105   2e-25   
gb|KHN11757.1|  Auxin-induced protein 15A                               105   2e-25   
ref|XP_009379591.1|  PREDICTED: auxin-induced protein 15A-like          105   2e-25   
gb|EYU35300.1|  hypothetical protein MIMGU_mgv1a018533mg                105   2e-25   
ref|XP_010108331.1|  hypothetical protein L484_000422                   105   2e-25   
ref|XP_004165219.1|  PREDICTED: indole-3-acetic acid-induced prot...    105   2e-25   
ref|NP_197303.1|  SAUR-like auxin-responsive protein                    105   2e-25   
ref|XP_002871795.1|  hypothetical protein ARALYDRAFT_488668             105   2e-25   
ref|XP_009379574.1|  PREDICTED: auxin-induced protein 15A-like          105   2e-25   
ref|XP_004300227.1|  PREDICTED: uncharacterized protein LOC101304289    108   2e-25   
ref|XP_009346461.1|  PREDICTED: indole-3-acetic acid-induced prot...    106   2e-25   
ref|XP_008338055.1|  PREDICTED: auxin-induced protein 15A-like          105   2e-25   
ref|XP_007041986.1|  Auxin-induced SAUR protein                         104   2e-25   
ref|XP_006359627.1|  PREDICTED: auxin-induced protein 15A-like          104   2e-25   
ref|XP_010030681.1|  PREDICTED: auxin-induced protein 15A-like          105   2e-25   
ref|XP_008237100.1|  PREDICTED: auxin-induced protein 15A-like          105   2e-25   
gb|KCW55449.1|  hypothetical protein EUGRSUZ_I01351                     105   2e-25   
ref|XP_010255165.1|  PREDICTED: auxin-induced protein 15A-like          105   2e-25   
emb|CDY02658.1|  BnaC02g07770D                                          105   3e-25   
ref|XP_007041987.1|  SAUR-like auxin-responsive protein family          105   3e-25   
ref|XP_009799453.1|  PREDICTED: auxin-induced protein 15A-like          105   3e-25   
ref|XP_006293412.1|  hypothetical protein CARUB_v10024901mg             106   3e-25   
ref|XP_008236176.1|  PREDICTED: auxin-induced protein 15A-like          104   3e-25   
ref|XP_007041973.1|  SAUR-like auxin-responsive protein family, p...    105   3e-25   
ref|XP_011004678.1|  PREDICTED: auxin-induced protein 15A-like          105   3e-25   
ref|XP_009131627.1|  PREDICTED: auxin-induced protein 15A-like          105   3e-25   
ref|XP_007041972.1|  SAUR-like auxin-responsive protein family          107   3e-25   
gb|AFK49405.1|  unknown                                                 105   3e-25   
ref|XP_007200158.1|  hypothetical protein PRUPE_ppa016758mg             104   3e-25   
gb|KGN43200.1|  hypothetical protein Csa_7G008960                       105   3e-25   
emb|CDY38478.1|  BnaA10g16800D                                          105   3e-25   
ref|XP_002306153.1|  hypothetical protein POPTR_0004s17280g             104   3e-25   
ref|XP_010112285.1|  hypothetical protein L484_014967                   105   3e-25   
emb|CDY25480.1|  BnaC09g39950D                                          105   3e-25   
ref|NP_001237933.1|  uncharacterized protein LOC100527820               105   3e-25   
gb|KGN61876.1|  hypothetical protein Csa_2G258720                       105   3e-25   
ref|XP_002873870.1|  hypothetical protein ARALYDRAFT_909807             104   3e-25   
gb|EYU35277.1|  hypothetical protein MIMGU_mgv1a023478mg                104   3e-25   
ref|XP_007200204.1|  hypothetical protein PRUPE_ppa015749mg             105   3e-25   
ref|XP_008237034.1|  PREDICTED: indole-3-acetic acid-induced prot...    105   3e-25   
ref|XP_010649241.1|  PREDICTED: auxin-induced protein 15A               104   3e-25   
ref|XP_009368375.1|  PREDICTED: auxin-induced protein 15A-like          105   3e-25   
ref|NP_001235363.1|  uncharacterized protein LOC100306459               104   3e-25   
ref|XP_006494590.1|  PREDICTED: auxin-induced protein X10A-like         104   3e-25   
ref|XP_009765341.1|  PREDICTED: auxin-induced protein 15A-like          105   3e-25   
gb|EYU35296.1|  hypothetical protein MIMGU_mgv1a019157mg                104   3e-25   
ref|XP_009121031.1|  PREDICTED: auxin-induced protein 15A-like          104   3e-25   
ref|XP_008236815.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    107   3e-25   
ref|XP_008448002.1|  PREDICTED: auxin-induced protein 15A-like          104   3e-25   
ref|XP_009121032.1|  PREDICTED: indole-3-acetic acid-induced prot...    106   3e-25   
ref|XP_007041961.1|  SAUR-like auxin-responsive protein family          107   4e-25   
ref|XP_011088519.1|  PREDICTED: auxin-induced protein 15A-like          104   4e-25   
ref|XP_004301669.1|  PREDICTED: uncharacterized protein LOC101298230    106   4e-25   
ref|XP_007135905.1|  hypothetical protein PHAVU_009G001700g             104   4e-25   
gb|KHN20021.1|  Indole-3-acetic acid-induced protein ARG7               104   4e-25   
ref|XP_004147010.1|  PREDICTED: auxin-induced protein X10A-like         104   4e-25   
gb|KCW55452.1|  hypothetical protein EUGRSUZ_I01354                     104   4e-25   
emb|CDP18415.1|  unnamed protein product                                106   4e-25   
ref|XP_009101928.1|  PREDICTED: auxin-induced protein X15-like          104   4e-25   
ref|XP_006400348.1|  hypothetical protein EUTSA_v10015121mg             104   4e-25   
ref|XP_007135898.1|  hypothetical protein PHAVU_009G001000g             104   4e-25   
ref|XP_010492795.1|  PREDICTED: auxin-induced protein X10A-like         104   4e-25   
ref|XP_010420540.1|  PREDICTED: auxin-induced protein 15A-like          104   4e-25   
ref|XP_006359713.1|  PREDICTED: auxin-induced protein 15A-like          104   4e-25   
ref|XP_008363801.1|  PREDICTED: indole-3-acetic acid-induced prot...    105   4e-25   
ref|XP_007201443.1|  hypothetical protein PRUPE_ppa013837mg             104   4e-25   
ref|XP_004165218.1|  PREDICTED: uncharacterized LOC101211923            107   4e-25   
ref|XP_007041985.1|  SAUR-like auxin-responsive protein family          105   4e-25   
emb|CBI17636.3|  unnamed protein product                                104   5e-25   
gb|EYU35275.1|  hypothetical protein MIMGU_mgv1a026646mg                103   5e-25   
ref|XP_010246416.1|  PREDICTED: auxin-induced protein 15A-like          104   5e-25   
gb|KCW55447.1|  hypothetical protein EUGRSUZ_I01349                     104   5e-25   
ref|XP_002271861.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    107   5e-25   
ref|XP_010092524.1|  hypothetical protein L484_010412                   104   5e-25   
ref|XP_007199408.1|  hypothetical protein PRUPE_ppa026231mg             104   5e-25   
ref|XP_003604019.1|  Auxin-induced protein 6B                           104   5e-25   
ref|XP_009126228.1|  PREDICTED: auxin-induced protein 15A-like          104   5e-25   
gb|KDP34551.1|  hypothetical protein JCGZ_11101                         104   5e-25   
gb|EYU37895.1|  hypothetical protein MIMGU_mgv11b017820mg               103   5e-25   
ref|XP_006592466.1|  PREDICTED: auxin-induced protein X10A-like         103   5e-25   
ref|XP_008448015.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    104   5e-25   
emb|CDX70789.1|  BnaC03g08730D                                          104   5e-25   
ref|NP_197302.1|  small auxin up RNA 19                                 103   6e-25   
ref|XP_010420542.1|  PREDICTED: auxin-induced protein 15A-like          103   6e-25   



>emb|CBI37963.3| unnamed protein product [Vitis vinifera]
Length=88

 Score =   116 bits (291),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGE++K+RFV+P+SYLKNPSFQ+LLSQ+EEEFGF+HP GGLTIPC E+ F+
Sbjct  20   VPKGYFAVYVGEAQKKRFVVPISYLKNPSFQNLLSQAEEEFGFNHPMGGLTIPCTEEAFI  79

Query  275  EVISSLRS  252
            +V S L S
Sbjct  80   DVTSGLNS  87



>ref|XP_006423551.1| hypothetical protein CICLE_v10029685mg [Citrus clementina]
 ref|XP_006494592.1| PREDICTED: auxin-induced protein 15A-like [Citrus sinensis]
 gb|ESR36791.1| hypothetical protein CICLE_v10029685mg [Citrus clementina]
 gb|KDO42787.1| hypothetical protein CISIN_1g034523mg [Citrus sinensis]
Length=92

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI  + I++A + LRR+   +   + VPKGH AVYVGE EK RFV+PVSYLK+PSFQ+L
Sbjct  1    MAIRFLRIVNAKQALRRALMVSEAST-VPKGHLAVYVGEIEKSRFVVPVSYLKHPSFQNL  59

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LSQ+EEEFGFDHP GGLTIPC E  F+++ S L
Sbjct  60   LSQAEEEFGFDHPMGGLTIPCSEKVFMDLTSRL  92



>ref|XP_006487294.1| PREDICTED: auxin-induced protein 10A5-like [Citrus sinensis]
Length=100

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 4/97 (4%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtn----resEVPKGHFAVYVGESEKRRFVIPVSYLKNPS  369
            MAI +  I+HA + LR++    +      + VPKGHFAVYVGE++K+RFVIPVS+L  PS
Sbjct  1    MAIHVPGIMHAKQILRQAKLIVSQGVSTSTVVPKGHFAVYVGENQKKRFVIPVSFLNQPS  60

Query  368  FQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            FQ+LLS++EEEFGFDHP GGLTIPC ED F+ V SSL
Sbjct  61   FQELLSKAEEEFGFDHPMGGLTIPCREDIFINVTSSL  97



>gb|KDO46704.1| hypothetical protein CISIN_1g036136mg [Citrus sinensis]
Length=100

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 73/97 (75%), Gaps = 4/97 (4%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtn----resEVPKGHFAVYVGESEKRRFVIPVSYLKNPS  369
            MAI +  I+HA + LR++    +        VPKGHFAVYVGE++K+RFVIPVS+L  PS
Sbjct  1    MAIHVPGIMHAKQILRQAKLIVSQGVSTSKVVPKGHFAVYVGENQKKRFVIPVSFLNQPS  60

Query  368  FQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            FQ+LLS++EEEFGFDHP GGLTIPC ED F+ V SSL
Sbjct  61   FQELLSKAEEEFGFDHPMGGLTIPCREDIFINVTSSL  97



>ref|XP_010647435.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
Length=88

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+ AVYVGE++K+RFV+P+SYL+NPSFQ LLSQ+EEEFGFDHP GGLTIPC E+ F+
Sbjct  20   VPKGYLAVYVGEAQKKRFVVPISYLRNPSFQQLLSQAEEEFGFDHPMGGLTIPCTEEAFI  79

Query  275  EVISSLRS  252
            ++ SSL S
Sbjct  80   DITSSLNS  87



>ref|XP_009799352.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=85

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 68/94 (72%), Gaps = 10/94 (11%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI M HI+  +              +VPKGHFAVYVG+++K+RFVIP+S+L  PSFQDL
Sbjct  1    MAIRMPHIIKKSS----------TSGDVPKGHFAVYVGDNQKKRFVIPISFLSQPSFQDL  50

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            LSQ+EEEFGFDHP GGLTIPC ED F+ + S LR
Sbjct  51   LSQAEEEFGFDHPMGGLTIPCSEDVFVVLTSRLR  84



>ref|XP_004300216.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Fragaria 
vesca subsp. vesca]
Length=99

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+FAVYVGES+K+RFVIP+SYL  PSF DLLSQ+EEEFG+DHP GG+TIPC EDTFL
Sbjct  32   IPKGYFAVYVGESQKKRFVIPISYLNQPSFMDLLSQAEEEFGYDHPMGGITIPCSEDTFL  91

Query  275  EVISSL  258
            ++ SSL
Sbjct  92   DLTSSL  97



>ref|XP_003523506.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Glycine 
max]
 gb|KHN33702.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=95

 Score =   115 bits (287),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI +  +L A K + R S+      +VPKGHFAVYVGE EK+RFVIPVSYL  PSFQ+L
Sbjct  1    MAIRLPCVLSA-KHIFRRSNAAATSLDVPKGHFAVYVGEGEKKRFVIPVSYLNQPSFQEL  59

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            LS +EEEFGF HP GGLTIPC ED FL + S+LR
Sbjct  60   LSIAEEEFGFSHPMGGLTIPCTEDIFLNITSALR  93



>ref|XP_010246393.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=102

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGE+EKRRFVIPVSYL +PSFQ+LL Q+EEEFGFDHP GGLTIPC EDTF+
Sbjct  34   VPKGHLAVYVGEAEKRRFVIPVSYLNHPSFQELLGQAEEEFGFDHPMGGLTIPCKEDTFI  93

Query  275  EVISSL  258
             ++++L
Sbjct  94   HLLNAL  99



>ref|XP_010246391.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=101

 Score =   115 bits (287),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGE+EKRRFVIPVSYL +PSFQDLL Q+EEEFGFDHP GGLTIPC EDTF+
Sbjct  34   VPKGHLAVYVGEAEKRRFVIPVSYLNHPSFQDLLGQAEEEFGFDHPMGGLTIPCKEDTFI  93

Query  275  EVISSL  258
             +++ +
Sbjct  94   HLLNGM  99



>ref|XP_007200097.1| hypothetical protein PRUPE_ppa019366mg [Prunus persica]
 gb|EMJ01296.1| hypothetical protein PRUPE_ppa019366mg [Prunus persica]
Length=99

 Score =   115 bits (287),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 4/95 (4%)
 Frame = -3

Query  536  MAISMIHILHANKGLr----rsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPS  369
            M   +  ILH  K L      S+   ++  +VPKG+FAVYVGES+K+RFVIPVSYL +PS
Sbjct  1    MGFRLRGILHVKKNLLQSLPTSNQVHSKALDVPKGYFAVYVGESQKKRFVIPVSYLNHPS  60

Query  368  FQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVIS  264
            FQDLLSQ+EEEFG+DHP GG+TIPC EDTFL++ S
Sbjct  61   FQDLLSQAEEEFGYDHPMGGITIPCNEDTFLDLTS  95



>emb|CBI37961.3| unnamed protein product [Vitis vinifera]
Length=88

 Score =   114 bits (286),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGE++K+RFV+P+SYLKNPSFQ+LLSQ+EEEFGF+HP G LTIPC E+ F+
Sbjct  20   VPKGYFAVYVGEAQKKRFVVPISYLKNPSFQNLLSQAEEEFGFNHPMGALTIPCTEEAFI  79

Query  275  EVISSLRS  252
            +V S L S
Sbjct  80   DVTSGLNS  87



>ref|XP_011088521.1| PREDICTED: auxin-induced protein 15A-like [Sesamum indicum]
Length=92

 Score =   114 bits (286),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGESEK+RFVIP+SYL +PSFQDLL Q+EEEFGF HP GGLTIPC ED F+
Sbjct  24   VPKGHFAVYVGESEKKRFVIPMSYLNHPSFQDLLCQAEEEFGFHHPMGGLTIPCSEDLFV  83

Query  275  EVISSL  258
            ++ SSL
Sbjct  84   DITSSL  89



>emb|CAN65271.1| hypothetical protein VITISV_040138 [Vitis vinifera]
Length=76

 Score =   114 bits (285),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGE++K+RFV+P+SYLKNPSFQ+LLSQ+EEEFGF+HP G LTIPC E+ F+
Sbjct  8    VPKGYFAVYVGEAQKKRFVVPISYLKNPSFQNLLSQAEEEFGFNHPMGALTIPCTEEAFI  67

Query  275  EVISSLRS  252
            +V S L S
Sbjct  68   DVTSGLNS  75



>gb|EYU18551.1| hypothetical protein MIMGU_mgv1a018365mg [Erythranthe guttata]
Length=88

 Score =   114 bits (285),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGESEK+RFVIP+SYL NPSFQ+LLSQ+EEEFGF HP GGLTIPC E+ F+
Sbjct  20   VPKGHFAVYVGESEKKRFVIPLSYLNNPSFQELLSQAEEEFGFHHPMGGLTIPCSEELFI  79

Query  275  EVISSLR  255
            ++ S +R
Sbjct  80   DLTSHMR  86



>ref|XP_006423553.1| hypothetical protein CICLE_v10029881mg [Citrus clementina]
 gb|ESR36793.1| hypothetical protein CICLE_v10029881mg [Citrus clementina]
 gb|KDO42789.1| hypothetical protein CISIN_1g042730mg [Citrus sinensis]
Length=88

 Score =   114 bits (285),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHF VYVGE+ K+RFV+P+SYLK+PSFQ+LLSQ+EEEFGFDHP GGLTIPC E+ F+
Sbjct  23   VPKGHFVVYVGETTKKRFVLPISYLKHPSFQNLLSQTEEEFGFDHPMGGLTIPCSEEVFM  82

Query  275  EVISSL  258
            ++ISSL
Sbjct  83   DLISSL  88



>ref|XP_008237080.1| PREDICTED: auxin-induced protein 15A-like [Prunus mume]
Length=99

 Score =   114 bits (286),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 4/95 (4%)
 Frame = -3

Query  536  MAISMIHILHANKGLr----rsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPS  369
            M   +  ILH  K L      S+   ++  +VPKG+FAVYVGES+K+RFVIPVSYL +PS
Sbjct  1    MGFRLPGILHVKKNLLQSLPTSNQVHSKALDVPKGYFAVYVGESQKKRFVIPVSYLNHPS  60

Query  368  FQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVIS  264
            FQDLLSQ+EEEFG+DHP GG+TIPC EDTFL++ S
Sbjct  61   FQDLLSQAEEEFGYDHPMGGITIPCNEDTFLDLTS  95



>ref|XP_010246396.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=102

 Score =   114 bits (285),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGE+EKRRFVIPVSYL +PSFQ+LL Q+EEEFGFDHP GGLTIPC EDTF+
Sbjct  34   VPKGHLAVYVGEAEKRRFVIPVSYLNHPSFQELLRQAEEEFGFDHPMGGLTIPCKEDTFI  93

Query  275  EVISSL  258
             +++ L
Sbjct  94   HLLNGL  99



>ref|XP_010246394.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=102

 Score =   114 bits (285),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGE+EKRRFVIPVSYL +PSFQ+LL Q+EEEFGFDHP GGLTIPC EDTF+
Sbjct  34   VPKGHLAVYVGEAEKRRFVIPVSYLNHPSFQELLGQAEEEFGFDHPMGGLTIPCKEDTFI  93

Query  275  EVISSL  258
             +++ L
Sbjct  94   HLLNGL  99



>ref|XP_002312998.1| hypothetical protein POPTR_0009s12930g [Populus trichocarpa]
 gb|EEE86953.1| hypothetical protein POPTR_0009s12930g [Populus trichocarpa]
Length=99

 Score =   114 bits (285),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG  AVYVGE+EK+RFV+PVSYL   SFQDLLS++EEEFGFDHP GGLTIPC EDTFL
Sbjct  31   VPKGFLAVYVGETEKKRFVVPVSYLNQASFQDLLSKAEEEFGFDHPMGGLTIPCAEDTFL  90

Query  275  EVISSL  258
            +V SSL
Sbjct  91   DVTSSL  96



>ref|XP_006423540.1| hypothetical protein CICLE_v10029650mg [Citrus clementina]
 gb|ESR36780.1| hypothetical protein CICLE_v10029650mg [Citrus clementina]
Length=100

 Score =   114 bits (285),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE++K+RFVIPVS+L  PSFQ+LLS++EEEFGFDHP GGLTIPC ED F+
Sbjct  32   VPKGHFAVYVGENQKKRFVIPVSFLNQPSFQELLSKAEEEFGFDHPMGGLTIPCREDIFI  91

Query  275  EVISSL  258
             V SSL
Sbjct  92   NVTSSL  97



>ref|XP_009368370.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=101

 Score =   114 bits (285),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+F VYVGESEK+RFV+P+S+L  P+FQDLLS +EEEFGFDHP GGLTIPC +D FL
Sbjct  33   VPKGYFPVYVGESEKQRFVVPISFLNQPAFQDLLSAAEEEFGFDHPMGGLTIPCRQDAFL  92

Query  275  EVISSLRS  252
            ++ISSL++
Sbjct  93   DLISSLKA  100



>ref|XP_004301667.1| PREDICTED: uncharacterized protein LOC101297356 [Fragaria vesca 
subsp. vesca]
Length=197

 Score =   117 bits (292),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+FAVYVGES+K+RFVIP+SYL  PSF DLLSQ+EEEFG+DHP GG+TIPC EDTFL
Sbjct  130  IPKGYFAVYVGESQKKRFVIPISYLNQPSFMDLLSQAEEEFGYDHPMGGITIPCSEDTFL  189

Query  275  EVISSL  258
            E+ SSL
Sbjct  190  ELTSSL  195


 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+FAVYVGES+K+RFVIP++YL  PSF DLLSQ+EEEFG+DHP GG+TIPC E TFL
Sbjct  27   IPKGYFAVYVGESQKKRFVIPIAYLNQPSFMDLLSQAEEEFGYDHPMGGITIPCSEHTFL  86

Query  275  EVISSL  258
            ++ SSL
Sbjct  87   DLTSSL  92



>ref|XP_008236177.1| PREDICTED: auxin-induced protein 15A [Prunus mume]
Length=103

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 5/98 (5%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssr-----tnresEVPKGHFAVYVGESEKRRFVIPVSYLKNP  372
            M I ++ I HA + L+R+ S       +  +EVPKGHFAVYVGE +K+RFVIP+SYL +P
Sbjct  1    MGIKLMGIAHAKEKLQRTLSARYGSAADTNAEVPKGHFAVYVGEGKKKRFVIPISYLNHP  60

Query  371  SFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
             FQDLL+++EEEFG+DHPTGGLTIPC ED FL V S L
Sbjct  61   LFQDLLTKAEEEFGYDHPTGGLTIPCSEDYFLSVTSVL  98



>ref|XP_007201545.1| hypothetical protein PRUPE_ppa017462mg [Prunus persica]
 gb|EMJ02744.1| hypothetical protein PRUPE_ppa017462mg [Prunus persica]
Length=101

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 5/98 (5%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssr-----tnresEVPKGHFAVYVGESEKRRFVIPVSYLKNP  372
            M I ++ I HA + L+R+ S       +  +EVPKGHFAVYVGE +K+RFVIP+SYL +P
Sbjct  1    MGIKLMGIAHAKEKLQRTLSARYGSAADTNAEVPKGHFAVYVGEGKKKRFVIPISYLNHP  60

Query  371  SFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
             FQDLL+++EEEFG+DHPTGGLTIPC ED FL V S L
Sbjct  61   LFQDLLTKAEEEFGYDHPTGGLTIPCSEDYFLSVTSVL  98



>ref|XP_011088527.1| PREDICTED: auxin-induced protein 15A-like [Sesamum indicum]
Length=91

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGESEK+RFVIPVSYL +PSFQDLL Q+EEEFGF HP GGLTIPC ED F+
Sbjct  23   VPKGHFAVYVGESEKKRFVIPVSYLNHPSFQDLLCQAEEEFGFHHPMGGLTIPCSEDLFI  82

Query  275  EVISSL  258
            ++ S L
Sbjct  83   DITSHL  88



>ref|XP_011047001.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Populus 
euphratica]
Length=98

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG  AVYVGE+EK+RFV+PVSYL  PSFQDLLS++EEEFGFDHP GGLTIPC E+TFL
Sbjct  30   VPKGFLAVYVGETEKKRFVVPVSYLNQPSFQDLLSKAEEEFGFDHPMGGLTIPCAEETFL  89

Query  275  EVISSL  258
             V SSL
Sbjct  90   HVTSSL  95



>ref|XP_009358224.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=102

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 75/100 (75%), Gaps = 6/100 (6%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrs------ssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKN  375
            M I ++ I HA + L+R+      S+  +  +EVPKGHFAVYVGE EK+RFVIP+SYL +
Sbjct  1    MGIKLMGIAHAKQKLQRTLSARYGSAADSTSTEVPKGHFAVYVGEDEKKRFVIPISYLNH  60

Query  374  PSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            P FQDLL+++EEEFG+DHPTGGLTIPC ED F+ + S L 
Sbjct  61   PLFQDLLNKAEEEFGYDHPTGGLTIPCSEDYFISLTSCLN  100



>emb|CAN70456.1| hypothetical protein VITISV_035060 [Vitis vinifera]
Length=77

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE+EK+RFV+P+SYL NPSFQ LLS +EEEFGF+HP GG+TIPC ED F+
Sbjct  9    VPKGHFAVYVGEAEKKRFVVPISYLNNPSFQKLLSHAEEEFGFNHPMGGVTIPCNEDAFI  68

Query  275  EVISSLRS  252
            ++ S L S
Sbjct  69   DLTSRLHS  76



>ref|XP_002306150.1| hypothetical protein POPTR_0004s17180g [Populus trichocarpa]
 gb|EEE86661.1| hypothetical protein POPTR_0004s17180g [Populus trichocarpa]
Length=96

 Score =   113 bits (283),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI +  I++A + LRRS+   N+ +EVPKG+FAVYVGES+K+RF +P+S+L  PSFQ+L
Sbjct  1    MAILLKGIMNAKQILRRSNLLANQATEVPKGYFAVYVGESQKKRFTVPISFLNQPSFQEL  60

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            L ++EEEFG+ HP GGLT+PC EDTF+++IS L
Sbjct  61   LRKAEEEFGYSHPMGGLTLPCREDTFIDIISGL  93



>emb|CDP15258.1| unnamed protein product [Coffea canephora]
Length=145

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 74/101 (73%), Gaps = 7/101 (7%)
 Frame = -3

Query  557  FKKKHSR-MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYL  381
            + K  SR MAI +  IL A + LR+SS        V KG+ AVYVGESEK+RFVIP+SYL
Sbjct  50   YNKASSRVMAIRLPRILQAKQILRQSSKD------VSKGYVAVYVGESEKKRFVIPISYL  103

Query  380  KNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
              P+F++LLSQ+EEEFGFDHP GGLTIPC ED F++V S L
Sbjct  104  NQPTFRELLSQAEEEFGFDHPMGGLTIPCREDKFIDVTSCL  144



>ref|XP_010649236.1| PREDICTED: auxin-induced protein 15A-like [Vitis vinifera]
Length=103

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE+EK+RFV+P+SYL NPSFQ LLS +EEEFGF+HP GG+TIPC ED F+
Sbjct  35   VPKGHFAVYVGEAEKKRFVVPISYLNNPSFQKLLSHAEEEFGFNHPMGGVTIPCNEDAFI  94

Query  275  EVISSLRS  252
            ++ S L S
Sbjct  95   DLTSRLHS  102



>ref|XP_009368374.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=101

 Score =   113 bits (283),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+F VYVGESEK+RFV+P+S+L  P+FQDLLS +EEEFGFDHP GGLTIPC +DTFL
Sbjct  33   VPKGYFPVYVGESEKQRFVVPISFLNQPAFQDLLSAAEEEFGFDHPMGGLTIPCRQDTFL  92

Query  275  EVISSLRS  252
            ++IS L++
Sbjct  93   DLISCLKA  100



>ref|XP_009347322.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=91

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 5/93 (5%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M   +  ILHA K        +++  +VPKG+ A+YVGES+K+RF+IPVSYL  PSFQDL
Sbjct  1    MGFRLPGILHAKKS-----QVSSKSLDVPKGYLAIYVGESQKKRFIIPVSYLNQPSFQDL  55

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LS SE+EFG+DHP GG+TIPC EDTFL++ S+L
Sbjct  56   LSLSEDEFGYDHPMGGITIPCSEDTFLDLTSAL  88



>ref|XP_006360733.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=92

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 4/94 (4%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M I +I  + AN+ LRRSS+       VPKGH AVYVGES+++RFV+PVSYL  P FQDL
Sbjct  1    MGIKVIRFIQANRFLRRSSTPGG----VPKGHCAVYVGESQQKRFVVPVSYLSQPLFQDL  56

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            L++SEEEFGFDHP GGLTIPC ED F+ + S LR
Sbjct  57   LAKSEEEFGFDHPMGGLTIPCKEDVFVHLTSRLR  90



>ref|XP_009764192.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=85

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKGHFAVYVGE +K+RFVIP+S+L  P FQDLLSQ+EEEFGFDHP GG+TIPC ED FL
Sbjct  18   IPKGHFAVYVGEKQKKRFVIPISFLSQPLFQDLLSQAEEEFGFDHPMGGVTIPCSEDVFL  77

Query  275  EVISSLR  255
            ++ S LR
Sbjct  78   DLTSRLR  84



>ref|XP_010246392.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=102

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGE+EKRRFVIPVSYL +PSFQ+LL Q EEEFGFDHP GGLTIPC EDTF+
Sbjct  34   VPKGHLAVYVGEAEKRRFVIPVSYLNHPSFQELLGQVEEEFGFDHPMGGLTIPCKEDTFI  93

Query  275  EVISSL  258
             +++ L
Sbjct  94   HLLNGL  99



>ref|XP_004250226.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=92

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RF++P+SYL  PSFQDLL+Q+EE+FGFDHP GGLTIPC ED F+
Sbjct  25   VPKGHCAVYVGESQKKRFIVPISYLSQPSFQDLLTQAEEQFGFDHPMGGLTIPCKEDVFV  84

Query  275  EVISSLR  255
            ++ S LR
Sbjct  85   DLTSRLR  91



>ref|XP_004290377.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Fragaria 
vesca subsp. vesca]
Length=94

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+FAVYVGES+K+RFV+P+SYL +PSFQDLL Q+EEEFGFDHP GG+TIPC E TF+
Sbjct  27   IPKGYFAVYVGESQKKRFVVPISYLNHPSFQDLLRQAEEEFGFDHPMGGITIPCSEHTFV  86

Query  275  EVISSL  258
            E+ SSL
Sbjct  87   ELTSSL  92



>ref|XP_010108330.1| hypothetical protein L484_000421 [Morus notabilis]
 ref|XP_010112282.1| hypothetical protein L484_014964 [Morus notabilis]
 ref|XP_010112284.1| hypothetical protein L484_014966 [Morus notabilis]
 gb|EXC33085.1| hypothetical protein L484_014964 [Morus notabilis]
 gb|EXC33087.1| hypothetical protein L484_014966 [Morus notabilis]
 gb|EXC54957.1| hypothetical protein L484_000421 [Morus notabilis]
Length=102

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE EK+R+V+P+S L  PSFQDLL Q+EEE+GFDHPTGGLTIPC ED F+
Sbjct  32   VPKGHFAVYVGEHEKKRYVVPLSLLNQPSFQDLLIQAEEEYGFDHPTGGLTIPCREDAFV  91

Query  275  EVISSLRS  252
            +++SSL +
Sbjct  92   DLVSSLNA  99



>ref|XP_010312906.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=86

 Score =   112 bits (280),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH  VYVGES+KRRFV+P+SYL  P FQDLLSQ+EE+FGFDHP GGLTIPC ED F+
Sbjct  19   VPKGHCVVYVGESQKRRFVVPISYLSEPLFQDLLSQAEEQFGFDHPMGGLTIPCKEDVFV  78

Query  275  EVISSLRS  252
            ++ S LRS
Sbjct  79   DLTSRLRS  86



>ref|XP_004293889.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Fragaria 
vesca subsp. vesca]
Length=99

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+FAVYVGES+K+RFVIP+SYL  PSF DLLSQ+EEEFG+DHP GG+TIPC E+TFL
Sbjct  32   IPKGYFAVYVGESQKKRFVIPISYLNQPSFMDLLSQAEEEFGYDHPMGGITIPCSEETFL  91

Query  275  EVISSL  258
            ++ SSL
Sbjct  92   DLTSSL  97



>ref|XP_006362801.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Solanum 
tuberosum]
Length=102

 Score =   113 bits (282),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RFV+P+SYL+ P FQDLL+Q+EE+FGFDHP GGLTIPC ED F+
Sbjct  24   VPKGHCAVYVGESQKKRFVVPISYLRQPLFQDLLTQAEEQFGFDHPMGGLTIPCKEDVFV  83

Query  275  EVISSLRS  252
             + S LRS
Sbjct  84   HLTSRLRS  91



>ref|XP_008360591.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
 ref|XP_008367340.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=102

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 75/100 (75%), Gaps = 6/100 (6%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrs------ssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKN  375
            M I ++ I HA + L+R+      S+  N  +EVPKGHFAVYVGE EK+RFVIP+SYL +
Sbjct  1    MGIKLMGIAHAKQKLQRTLSARYGSAADNTSTEVPKGHFAVYVGEDEKKRFVIPISYLNH  60

Query  374  PSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            P FQDLL+++EEEFG+DHPTGGLTIPC ED F+ + S L 
Sbjct  61   PLFQDLLNKAEEEFGYDHPTGGLTIPCSEDYFVSLSSCLN  100



>gb|KDP34544.1| hypothetical protein JCGZ_11094 [Jatropha curcas]
Length=100

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG  AVY+G  EK+RFV+P+SYLK PSFQDLLS++EEEFGFDHP GGLTIPC EDTFL
Sbjct  31   IPKGFLAVYIGGLEKKRFVVPISYLKEPSFQDLLSKAEEEFGFDHPMGGLTIPCKEDTFL  90

Query  275  EVISSLRS  252
             V S+L+S
Sbjct  91   HVTSNLKS  98



>gb|KDP27620.1| hypothetical protein JCGZ_19625 [Jatropha curcas]
Length=96

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG  AVY+GE+EK+RF++PVSYL   SFQDLLS++EEE+GFDHP GGLTIPC EDTF+
Sbjct  28   VPKGFLAVYIGETEKKRFLVPVSYLNESSFQDLLSRAEEEYGFDHPMGGLTIPCREDTFI  87

Query  275  EVISSL  258
            +VISSL
Sbjct  88   DVISSL  93



>ref|XP_002312996.1| hypothetical protein POPTR_0009s12950g [Populus trichocarpa]
 gb|EEE86951.1| hypothetical protein POPTR_0009s12950g [Populus trichocarpa]
Length=98

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG  AVYVGE+EK+RFV+PVSYL  PSFQDLLS++E+EFGFDHP GGLTIPC E+TFL
Sbjct  30   VPKGFLAVYVGETEKKRFVVPVSYLNQPSFQDLLSKAEDEFGFDHPMGGLTIPCAEETFL  89

Query  275  EVISSL  258
             V SSL
Sbjct  90   HVTSSL  95



>ref|XP_009620278.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
 ref|XP_009620279.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=86

 Score =   112 bits (280),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE +K+RFVIP+S+L  P FQDLLSQ+EEEFGFDHP GGLTIPC ED F+
Sbjct  18   VPKGHFAVYVGEKQKKRFVIPISFLSQPLFQDLLSQAEEEFGFDHPMGGLTIPCDEDVFI  77

Query  275  EVISSL  258
            ++IS L
Sbjct  78   DLISHL  83



>ref|XP_008369486.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
 ref|XP_008345358.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=101

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+F VYVGESEK+RFV+P+S L  P+FQDLLS +EEEFGFDHP GGLTIPC +D FL
Sbjct  33   VPKGYFPVYVGESEKQRFVVPISILNQPAFQDLLSAAEEEFGFDHPMGGLTIPCRQDAFL  92

Query  275  EVISSLRS  252
            ++ISSL++
Sbjct  93   DLISSLKA  100



>ref|XP_009368351.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=91

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 70/93 (75%), Gaps = 5/93 (5%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M   +  ILHA K        +++  +VPKG+ A+YVGES+K+RF+IPVSYL  PSFQDL
Sbjct  1    MGFRLPGILHAKKN-----QVSSKSLDVPKGYLAIYVGESQKKRFIIPVSYLNQPSFQDL  55

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LS +E+EFG+DHP GG+TIPC EDTFL++ S+L
Sbjct  56   LSLAEDEFGYDHPMGGITIPCSEDTFLDLTSAL  88



>ref|XP_006360736.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Solanum 
tuberosum]
Length=107

 Score =   112 bits (281),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI M   + AN+ L RSS+       VP+GH AVYVGES+++RFV+PVSYL  P FQDL
Sbjct  1    MAIKMSPFIQANRFLWRSSTSRG----VPEGHCAVYVGESQQKRFVVPVSYLSQPLFQDL  56

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            L++SEEEFGFDHP GGLTIPC ED F+ + S LR
Sbjct  57   LAKSEEEFGFDHPMGGLTIPCKEDVFVHLTSRLR  90



>ref|XP_011088529.1| PREDICTED: auxin-induced protein 15A-like [Sesamum indicum]
Length=92

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGESEK+RFVIPVSYL + SFQDLL Q+EEEFGF HP GGLTIPC ED F+
Sbjct  24   VPKGHFAVYVGESEKKRFVIPVSYLNHSSFQDLLCQAEEEFGFHHPMGGLTIPCSEDLFI  83

Query  275  EVISSL  258
            +V S L
Sbjct  84   DVTSCL  89



>ref|XP_006352409.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=91

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RFV+P+SYL  P FQDLL+Q+EE+FGFDHP GGLTIPC ED F+
Sbjct  24   VPKGHCAVYVGESQKKRFVVPISYLSQPLFQDLLTQAEEQFGFDHPMGGLTIPCKEDVFV  83

Query  275  EVISSLRS  252
            ++ S LRS
Sbjct  84   DLTSRLRS  91



>ref|XP_004231003.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=83

 Score =   112 bits (279),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKGHFAVYVGE +K+RFVIP+S+L  P FQDLLSQ+EEEFGFDHP GG+TIPC ED F+
Sbjct  16   IPKGHFAVYVGEMQKKRFVIPISFLSEPLFQDLLSQAEEEFGFDHPMGGVTIPCSEDLFI  75

Query  275  EVISSLR  255
            +V S LR
Sbjct  76   DVTSRLR  82



>ref|XP_010312723.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=91

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RFV+P+SYL  P FQDLL+Q+EE+FGFDHP GGLTIPC ED F+
Sbjct  24   VPKGHCAVYVGESQKKRFVVPISYLSKPLFQDLLTQAEEQFGFDHPMGGLTIPCKEDVFV  83

Query  275  EVISSLRS  252
            ++ S LRS
Sbjct  84   DLTSRLRS  91



>emb|CAN70455.1| hypothetical protein VITISV_035059 [Vitis vinifera]
 emb|CBI17629.3| unnamed protein product [Vitis vinifera]
Length=103

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 72/102 (71%), Gaps = 7/102 (7%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrss-------srtnresEVPKGHFAVYVGESEKRRFVIPVSYLK  378
            M   M  ILHA + L+  S       S +   + VPKGHFAVYVGE+EK+RFV+P+SYL 
Sbjct  1    MGFRMPSILHAKQILKLQSLLTRSQLSISATTAVVPKGHFAVYVGEAEKKRFVVPISYLN  60

Query  377  NPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLRS  252
            NPSFQ  LS SEEEFGF+HP GG+TIPC E++F+++ S L S
Sbjct  61   NPSFQKFLSHSEEEFGFNHPMGGVTIPCKEESFIDLTSRLSS  102



>ref|XP_004250224.1| PREDICTED: auxin-induced protein X15-like [Solanum lycopersicum]
Length=91

 Score =   112 bits (279),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RF++P+SYL  P FQDLL+Q+EE+FGFDHP GGLTIPC ED F+
Sbjct  24   VPKGHCAVYVGESQKKRFIVPISYLSQPLFQDLLTQAEEQFGFDHPMGGLTIPCKEDVFV  83

Query  275  EVISSLRS  252
            ++ S LRS
Sbjct  84   DLTSRLRS  91



>ref|XP_010647509.1| PREDICTED: auxin-induced protein X15 [Vitis vinifera]
 emb|CBI37964.3| unnamed protein product [Vitis vinifera]
Length=94

 Score =   112 bits (279),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGE +K+RF++PVSYLK+PSFQ+LLSQ+EEEFGFDHP GGLTIPC E+ F+
Sbjct  27   VPKGYFAVYVGEDQKKRFLVPVSYLKDPSFQNLLSQAEEEFGFDHPRGGLTIPCTEEAFI  86

Query  275  EVISSL  258
            +V  SL
Sbjct  87   DVTCSL  92



>gb|KDP27617.1| hypothetical protein JCGZ_19622 [Jatropha curcas]
Length=95

 Score =   112 bits (279),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI +  IL     L    + +    EVPKG  AVYVGE+EK+R+V+P+SYL +PSFQDL
Sbjct  1    MAIRLPSILR-TPTLASKKAASRYLFEVPKGFIAVYVGETEKKRYVVPISYLNHPSFQDL  59

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LS++EEE+GFDHP GGLTIPC EDTF+ V SSL
Sbjct  60   LSRAEEEYGFDHPMGGLTIPCREDTFIYVTSSL  92



>ref|XP_009368354.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=91

 Score =   111 bits (278),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 5/93 (5%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M   +  ILHA K     S  +++  +VPKG+ A+YVGES+K+RF+IPVSYL  PSFQDL
Sbjct  1    MGFRLPGILHAKK-----SQVSSKSLDVPKGYLAIYVGESQKKRFIIPVSYLNQPSFQDL  55

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LS SE+EFG+DHP GG+TIPC EDTFL + S+L
Sbjct  56   LSLSEDEFGYDHPMGGITIPCSEDTFLGLTSAL  88



>ref|XP_006352413.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=91

 Score =   111 bits (278),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RFV+P+SYL  P FQDLL+Q+EE+FGFDHP GGLTIPC ED F+
Sbjct  24   VPKGHCAVYVGESQKKRFVMPISYLSQPLFQDLLTQAEEQFGFDHPMGGLTIPCKEDVFV  83

Query  275  EVISSLRS  252
            ++ S LRS
Sbjct  84   DLTSRLRS  91



>ref|XP_011088523.1| PREDICTED: uncharacterized protein LOC105169727 [Sesamum indicum]
Length=172

 Score =   114 bits (284),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGES+K+RFVIP+SYL +P+FQDLL Q+EEEFGF HPTGGLTIPC ED F+
Sbjct  104  VPKGHFAVYVGESKKKRFVIPISYLNHPAFQDLLCQAEEEFGFSHPTGGLTIPCSEDLFV  163

Query  275  EVISSL  258
            ++ S L
Sbjct  164  DITSRL  169



>ref|XP_002276271.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CBI37955.3| unnamed protein product [Vitis vinifera]
Length=95

 Score =   111 bits (278),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGE +K+RFV+P+SYLKNPSFQ+LLSQ+EEEFG DHP GGLTIPC E+ F+
Sbjct  27   VPKGYFAVYVGEVQKKRFVVPISYLKNPSFQNLLSQAEEEFGLDHPMGGLTIPCTEEAFI  86

Query  275  EVISSLR  255
            ++ SS  
Sbjct  87   DLTSSWN  93



>ref|XP_009592061.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=92

 Score =   111 bits (278),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RFV+P+SYL  P FQDLL+Q+EEEFGFDHP GGLTIPC ED F+
Sbjct  24   VPKGHCAVYVGESQKKRFVMPISYLSQPLFQDLLAQAEEEFGFDHPMGGLTIPCKEDVFI  83

Query  275  EVISSLR  255
            ++ S LR
Sbjct  84   DLTSRLR  90



>ref|XP_009793415.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=92

 Score =   111 bits (278),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RF++P+SYL  P FQDLL+Q+EEEFGFDHP GGLTIPC ED F+
Sbjct  24   VPKGHCAVYVGESQKKRFIVPISYLSQPLFQDLLAQAEEEFGFDHPMGGLTIPCKEDVFV  83

Query  275  EVISSLR  255
            ++ S LR
Sbjct  84   DLTSRLR  90



>gb|KDP27603.1| hypothetical protein JCGZ_19608 [Jatropha curcas]
Length=99

 Score =   112 bits (279),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VP+GH AVYVGE +K+RFV+P+SYL++PSFQDLL ++EEEFGFDHP GGLTIPC ED FL
Sbjct  30   VPRGHLAVYVGEQQKKRFVVPISYLRHPSFQDLLKRAEEEFGFDHPMGGLTIPCKEDAFL  89

Query  275  EVISSL  258
            ++ S+L
Sbjct  90   DLTSNL  95



>emb|CAN79758.1| hypothetical protein VITISV_009898 [Vitis vinifera]
Length=80

 Score =   111 bits (277),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VP+GHFAVYVG+++K+RFV+P+SYL +PSFQDLL Q+EEEFGFDHP GGLTIPC E+TF+
Sbjct  12   VPRGHFAVYVGDTQKKRFVVPISYLNHPSFQDLLQQAEEEFGFDHPMGGLTIPCKEETFV  71

Query  275  EVISSL  258
            ++ S L
Sbjct  72   DLASRL  77



>ref|XP_006359618.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=85

 Score =   111 bits (277),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHF VYVGE +++RFVIP+SYL  PSFQDLLSQ+EEEFGFDHP GG+TIPC ED F+
Sbjct  18   VPKGHFVVYVGEKQRKRFVIPISYLSQPSFQDLLSQAEEEFGFDHPMGGVTIPCSEDIFI  77

Query  275  EVISSLR  255
             + S  R
Sbjct  78   HITSHFR  84



>ref|XP_009601953.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=85

 Score =   111 bits (277),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGE +K+RFVIP+S+L  P FQDLLSQ+EEEFGFDHP GGL IPC ED F+
Sbjct  18   VPKGYFAVYVGEEQKKRFVIPISFLNQPLFQDLLSQAEEEFGFDHPMGGLAIPCSEDVFI  77

Query  275  EVISSLRS  252
            E+ S LR+
Sbjct  78   ELTSRLRN  85



>ref|XP_010315344.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=83

 Score =   111 bits (277),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKGHFAVYVGE +K+RF+IP+S+L  P FQDLLSQ+EEEFGFDHP GG+TIPC ED F+
Sbjct  16   IPKGHFAVYVGEMQKKRFMIPISFLSEPLFQDLLSQAEEEFGFDHPMGGVTIPCSEDLFI  75

Query  275  EVISSLR  255
            +V S LR
Sbjct  76   DVTSRLR  82



>gb|EYU35271.1| hypothetical protein MIMGU_mgv1a020811mg [Erythranthe guttata]
Length=88

 Score =   111 bits (277),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVY+GE+EK+RFVIP+SYL +PSFQDLL Q+EEEFG+ HP GGLTIPC ED F+
Sbjct  20   VPKGHLAVYIGENEKKRFVIPLSYLNHPSFQDLLCQAEEEFGYHHPMGGLTIPCREDLFV  79

Query  275  EVISSLR  255
            +V S LR
Sbjct  80   DVTSRLR  86



>ref|XP_002276391.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CBI37952.3| unnamed protein product [Vitis vinifera]
Length=89

 Score =   111 bits (277),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+ AVYVGE++K+RFV+P+SYLKNPSFQ LLSQ+EEEFGFDHP GG+TIPC E+ F+
Sbjct  20   VPKGYLAVYVGEAQKQRFVVPISYLKNPSFQKLLSQAEEEFGFDHPMGGITIPCTEEAFI  79

Query  275  EVISS  261
            + I+S
Sbjct  80   DAITS  84



>ref|XP_009592053.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=92

 Score =   111 bits (277),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M I +   + AN+ LRRSS+       VPKGH  VYVGES+K+RFV+P+SYL  P FQDL
Sbjct  1    MGIKVTPFIQANRILRRSSTTGG----VPKGHCTVYVGESQKKRFVVPISYLSQPLFQDL  56

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            L+Q+EEEFGFDHP GGLTIPC ED F+++ S LR
Sbjct  57   LAQAEEEFGFDHPMGGLTIPCKEDVFIDLTSRLR  90



>ref|XP_002276347.1| PREDICTED: auxin-induced protein 15A-like [Vitis vinifera]
Length=95

 Score =   111 bits (278),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+F+VYVGE +K+RFV+P+SYLKNPSFQ+LLSQ+EEEFGFDHP GGLTIPC E+ F+
Sbjct  27   VPKGYFSVYVGEVQKKRFVVPLSYLKNPSFQNLLSQAEEEFGFDHPMGGLTIPCTEEAFI  86

Query  275  EVISS  261
            ++ SS
Sbjct  87   DLTSS  91



>emb|CDO96966.1| unnamed protein product [Coffea canephora]
Length=98

 Score =   111 bits (278),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE EK+RFV+P+SYL +P+FQDLL ++EEEFG+DHP GGLTIPC ED F+
Sbjct  30   VPKGHFAVYVGEMEKKRFVLPISYLNHPTFQDLLRKAEEEFGYDHPMGGLTIPCNEDAFV  89

Query  275  EVISSLRS  252
            ++ S L S
Sbjct  90   DLTSRLNS  97



>ref|XP_010647407.1| PREDICTED: auxin-induced protein X15-like [Vitis vinifera]
Length=95

 Score =   111 bits (278),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI    I+ A K   R    +   ++VPKGHF VYVGE++K+RFVIP+SYLK+PSFQ L
Sbjct  1    MAIRFQRIIRA-KQFPRCILPSLETTDVPKGHFPVYVGETQKKRFVIPISYLKHPSFQKL  59

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LSQ+EEEFGFDHP GGLTIPC E+ F+ +  SL
Sbjct  60   LSQAEEEFGFDHPQGGLTIPCREEVFINLTCSL  92



>ref|XP_002306152.1| hypothetical protein POPTR_0004s17230g [Populus trichocarpa]
 gb|EEE86663.1| hypothetical protein POPTR_0004s17230g [Populus trichocarpa]
Length=99

 Score =   111 bits (278),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG  AVYVGE +K+RFV+PVSYL  PSFQDLLS++EEEFGF+HP GGLTIPC EDTF+
Sbjct  31   VPKGFLAVYVGEMDKKRFVVPVSYLNEPSFQDLLSKAEEEFGFNHPMGGLTIPCREDTFI  90

Query  275  EVISSL  258
            +++SSL
Sbjct  91   DILSSL  96



>ref|XP_006359712.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=83

 Score =   111 bits (277),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKGHFAVYVGE +K+RFVIP+S+L  P FQDLLSQ+EEEFGFDHP GG+TIPC ED F+
Sbjct  16   IPKGHFAVYVGEMQKKRFVIPISFLSEPLFQDLLSQAEEEFGFDHPMGGVTIPCSEDLFI  75

Query  275  EVISSLR  255
            ++ S LR
Sbjct  76   DLTSRLR  82



>emb|CDO96969.1| unnamed protein product [Coffea canephora]
Length=105

 Score =   111 bits (278),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGE+E++RFVIP++YL  PSF+DLL+++EEEFGFDHP GGLTIPC EDTF+
Sbjct  35   VPKGYFAVYVGENERKRFVIPIAYLNEPSFRDLLNRAEEEFGFDHPIGGLTIPCREDTFI  94

Query  275  EVISSL  258
            ++ + L
Sbjct  95   DITARL  100



>gb|AAM12778.1| auxin-induced SAUR-like protein [Capsicum annuum]
Length=85

 Score =   111 bits (277),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE +K RFVIP+SYL  PSFQDLLS++EEEFGFDHP GG+TIPC ED F+
Sbjct  18   VPKGHFAVYVGEKQKNRFVIPISYLSQPSFQDLLSRAEEEFGFDHPMGGVTIPCSEDIFI  77

Query  275  EVISSLR  255
             + S  R
Sbjct  78   GITSKFR  84



>ref|XP_002271395.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CBI17625.3| unnamed protein product [Vitis vinifera]
Length=97

 Score =   111 bits (277),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VP+GHFAVYVG+++K+RFV+P+SYL +PSFQDLL Q+EEEFGFDHP GGLTIPC E+TF+
Sbjct  29   VPRGHFAVYVGDTQKKRFVVPISYLNHPSFQDLLQQAEEEFGFDHPMGGLTIPCKEETFV  88

Query  275  EVISSL  258
            ++ S L
Sbjct  89   DLASRL  94



>emb|CBI17630.3| unnamed protein product [Vitis vinifera]
Length=75

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE+EK+RFV+P+SYL NPSFQ LLS +EEEFGF+HP GG+TIPC ED F+
Sbjct  7    VPKGHFAVYVGEAEKKRFVVPISYLNNPSFQKLLSHAEEEFGFNHPMGGVTIPCKEDAFI  66

Query  275  EVISSLRS  252
             + S   S
Sbjct  67   NLTSRFNS  74



>ref|XP_004301666.1| PREDICTED: uncharacterized protein LOC101297064 [Fragaria vesca 
subsp. vesca]
Length=206

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+FAVYVGES+K+R+VIP+SYL  PSF DLLSQ+EEE+G+DHP GG+TIPC EDTFL
Sbjct  32   IPKGYFAVYVGESQKKRYVIPISYLNQPSFMDLLSQAEEEYGYDHPMGGITIPCSEDTFL  91

Query  275  EVISSL  258
            E+ SSL
Sbjct  92   ELTSSL  97


 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+FAVYVG+S+K+RFV+P+SYL  P FQ LLSQ+EEEFG+ HP GG+TIPC EDTF 
Sbjct  139  IPKGYFAVYVGKSQKKRFVVPISYLNQPLFQHLLSQAEEEFGYHHPMGGITIPCSEDTFT  198

Query  275  EVISSL  258
            ++ S L
Sbjct  199  DLTSRL  204



>ref|XP_009347320.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=98

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+ AVYVGE+E++RFVIP+SYL  PSFQDLLS++E+EFGFDHP GGLTIPC +DTF+
Sbjct  33   VPKGYLAVYVGENERKRFVIPISYLNQPSFQDLLSEAEQEFGFDHPMGGLTIPCRQDTFI  92

Query  275  EVISSL  258
            ++IS  
Sbjct  93   DIISQF  98



>ref|XP_002276058.2| PREDICTED: auxin-induced protein X15 [Vitis vinifera]
 emb|CAN65270.1| hypothetical protein VITISV_040137 [Vitis vinifera]
Length=95

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI    I+ A K + R    +   + VPKGH  VYVGE+EK+RFVIP+SYLK+PSFQ+L
Sbjct  1    MAIRFQRIIPA-KQILRRILPSPESTNVPKGHVPVYVGETEKKRFVIPISYLKHPSFQNL  59

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LSQ+EEEFGFDHP GGLTIPC E+ F+++  SL
Sbjct  60   LSQAEEEFGFDHPLGGLTIPCREEAFIDLTCSL  92



>ref|XP_004230990.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=83

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKGHFAVYVGE +K+RFVIP+S+L  P FQDLLSQSEEEFGFDHP GG+TIPC ED F+
Sbjct  16   IPKGHFAVYVGEMQKKRFVIPISFLSEPLFQDLLSQSEEEFGFDHPMGGVTIPCSEDLFI  75

Query  275  EVISSLR  255
             + S LR
Sbjct  76   NLTSILR  82



>ref|XP_010315356.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=84

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE +K+RFVIP+SYL   SFQDLLSQ+EEEFGFDHP GG+TIPC ED F+
Sbjct  18   VPKGHFAVYVGEKQKKRFVIPISYLSQSSFQDLLSQAEEEFGFDHPMGGVTIPCPEDIFI  77

Query  275  EVISSL  258
             + S L
Sbjct  78   AITSQL  83



>ref|XP_006359717.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=85

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGE +K+RFVIP+S+L  P FQDLLSQ+EEEFGFDHP GGLTIPC ED F+
Sbjct  18   VPKGHCAVYVGEEQKKRFVIPISFLNQPLFQDLLSQAEEEFGFDHPMGGLTIPCKEDVFI  77

Query  275  EVISSLRS  252
             + S LR+
Sbjct  78   NLTSRLRN  85



>ref|XP_008448012.1| PREDICTED: auxin-induced protein 15A-like [Cucumis melo]
Length=84

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG  AVYVGE++KRR VIP+SYLK+PSFQDLLS++EEEFGFDHP GGLTIPC ED FL
Sbjct  16   VPKGFLAVYVGETQKRRHVIPISYLKHPSFQDLLSKAEEEFGFDHPMGGLTIPCNEDVFL  75

Query  275  EVISSL  258
            +V S L
Sbjct  76   KVTSRL  81



>ref|XP_006349639.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=84

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RFV+PVSYL  P FQDLL+++EEEFGFDHP GGLTIPC ED F+
Sbjct  15   VPKGHCAVYVGESQKKRFVVPVSYLSQPLFQDLLAKAEEEFGFDHPMGGLTIPCKEDVFV  74

Query  275  EVISSLR  255
            ++ S LR
Sbjct  75   DLTSRLR  81



>ref|XP_007135904.1| hypothetical protein PHAVU_009G001600g [Phaseolus vulgaris]
 gb|ESW07898.1| hypothetical protein PHAVU_009G001600g [Phaseolus vulgaris]
Length=100

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE EK+RFVIP+SYL +PSFQ LLS +EEEFGF+HP G LTIPC +D FL
Sbjct  32   VPKGHFAVYVGEGEKKRFVIPISYLNHPSFQQLLSIAEEEFGFNHPMGALTIPCTQDIFL  91

Query  275  EVISSLRS  252
             + S+L +
Sbjct  92   NITSALHT  99



>ref|XP_010271569.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=103

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M +    IL  ++ L R         +VPKGH AVYVGE++K+RFVIPVSYLK+P FQDL
Sbjct  8    MVLPAKQILKVHRLLARDEFPAGAIRDVPKGHLAVYVGETQKKRFVIPVSYLKHPLFQDL  67

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLRS  252
            LSQ+EEEFGFDHP GGLTIPC E  F+ + S + +
Sbjct  68   LSQAEEEFGFDHPMGGLTIPCKEAAFINLTSRMTA  102



>ref|XP_010244080.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=101

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGE+EKRRFVIPVSYL + SFQ+LL Q+EEEFGFDHP GGLTIPC EDTF+
Sbjct  34   VPKGHLAVYVGEAEKRRFVIPVSYLNHSSFQELLGQAEEEFGFDHPMGGLTIPCKEDTFI  93

Query  275  EVISSL  258
             +++ +
Sbjct  94   HLLNGM  99



>ref|XP_002312994.1| auxin-responsive family protein [Populus trichocarpa]
 gb|EEE86949.1| auxin-responsive family protein [Populus trichocarpa]
Length=93

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 69/94 (73%), Gaps = 3/94 (3%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI +  IL   + + R SS       V KG+ AVYVGE EK+RFVIPVSYL  PSFQDL
Sbjct  2    MAIRLPRILQVKQNILRGSSAAKD---VRKGYIAVYVGEEEKKRFVIPVSYLNQPSFQDL  58

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            LS++EEEFGF+HP GGLTIPC ED F+++ SSL+
Sbjct  59   LSKAEEEFGFEHPMGGLTIPCREDIFIDLTSSLK  92



>ref|XP_002271464.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
Length=103

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE++K+RFV+P+SYL NPSFQ LLS +EEEFGF+HP GG+TIPC ED F+
Sbjct  35   VPKGHFAVYVGEAQKKRFVLPISYLNNPSFQKLLSCAEEEFGFNHPMGGVTIPCKEDAFI  94

Query  275  EVISSLRS  252
             + S L S
Sbjct  95   HLTSQLHS  102



>gb|EYU37890.1| hypothetical protein MIMGU_mgv1a022439mg [Erythranthe guttata]
Length=88

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHF VYVGESEK+RFVIP+SYL NP FQ+LL Q+EEEFGF HPTGGLTIPC E+ F+
Sbjct  20   VPKGHFVVYVGESEKKRFVIPLSYLNNPLFQELLCQAEEEFGFYHPTGGLTIPCTEELFI  79

Query  275  EVISSLR  255
            ++ + LR
Sbjct  80   DITAHLR  86



>ref|XP_009620280.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=82

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE +K+RF+IPVS+L  P FQDLLSQ EEEFGFDHP GG+TIPC ED F+
Sbjct  15   VPKGHFAVYVGEKQKKRFLIPVSFLSQPLFQDLLSQDEEEFGFDHPMGGVTIPCSEDVFV  74

Query  275  EVISSLR  255
            ++ S LR
Sbjct  75   DLTSRLR  81



>ref|XP_011088530.1| PREDICTED: auxin-induced protein 15A-like [Sesamum indicum]
Length=92

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGES+K+RFVIP+SYL +P+FQDLL Q+EEEFGF HP GGLTIPC ED F 
Sbjct  24   VPKGHFAVYVGESKKKRFVIPLSYLNHPTFQDLLCQAEEEFGFHHPMGGLTIPCSEDLFF  83

Query  275  EVISSL  258
            +V S L
Sbjct  84   DVTSRL  89



>emb|CDY02656.1| BnaC02g07790D [Brassica napus]
Length=92

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -3

Query  530  ISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLS  351
            ++++  L   K +  +++     S  PKG  AVYVGES+K+R+V+P+SYL  PSFQ LLS
Sbjct  1    MALVRSLLGAKKMLGAATSKRATSAAPKGFLAVYVGESQKKRYVVPISYLSQPSFQALLS  60

Query  350  QSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            +SEEEFGFDHP GGLTIPC EDTF+ V S L+
Sbjct  61   KSEEEFGFDHPMGGLTIPCPEDTFINVTSRLQ  92



>emb|CDY38475.1| BnaA10g16830D [Brassica napus]
Length=93

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -3

Query  515  ILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEE  336
            +L A K L RS++  +  S  PKG  AVYVGES+K+R+V+PVSYL  PSFQ LLS+SEEE
Sbjct  7    LLGAKKILGRSATSKSATSAAPKGFLAVYVGESQKKRYVVPVSYLSQPSFQALLSKSEEE  66

Query  335  FGFDHPTGGLTIPCMEDTFLEVISSLR  255
            FGF+HP GGLTIPC EDTF++V S L+
Sbjct  67   FGFNHPMGGLTIPCPEDTFIDVTSRLQ  93



>ref|XP_009770357.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=83

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE +K RFVIP+S+L  P+FQDLLSQ+EEE GFDHP GGLTIPC ED F+
Sbjct  16   VPKGHFAVYVGEKQKNRFVIPISFLSQPAFQDLLSQAEEEVGFDHPMGGLTIPCSEDFFV  75

Query  275  EVISSLR  255
            ++ S LR
Sbjct  76   DLTSRLR  82



>gb|KDP27614.1| hypothetical protein JCGZ_19619 [Jatropha curcas]
Length=95

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 68/94 (72%), Gaps = 10/94 (11%)
 Frame = -3

Query  533  AISMIHILH--ANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQD  360
            AI    ILH  ANK         + +  +PKG  AVYVGE+EK+RF++PVSYL  PSFQD
Sbjct  7    AILAKQILHRSANKA--------SSKYSLPKGFLAVYVGETEKKRFLVPVSYLNEPSFQD  58

Query  359  LLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LLS++EEE+GFDHP GGLTIPC EDTF++V  SL
Sbjct  59   LLSKAEEEYGFDHPMGGLTIPCREDTFIDVTCSL  92



>ref|XP_002276204.1| PREDICTED: auxin-induced protein X15 [Vitis vinifera]
Length=95

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M   +  I++A K L++       ++ VPKG+FAVYVGE +K+RFV+P+SYLKNP FQ+L
Sbjct  1    MGFRLPGIVNAKKTLQQERKGAEAKN-VPKGYFAVYVGEVQKKRFVVPISYLKNPLFQNL  59

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LSQ+EEEFGFDHP GGLTIPC E+ F+ +  SL
Sbjct  60   LSQAEEEFGFDHPMGGLTIPCTEEAFINLTCSL  92



>emb|CDX94145.1| BnaC07g37790D [Brassica napus]
Length=93

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -3

Query  515  ILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEE  336
            +L A K L RS++  +  S  PKG  AVYVGE +K+R+V+PVSYL  PSFQ LLS+SEEE
Sbjct  7    LLGAKKILGRSATSKSATSAAPKGFLAVYVGEGQKKRYVVPVSYLSQPSFQALLSKSEEE  66

Query  335  FGFDHPTGGLTIPCMEDTFLEVISSLR  255
            FGFDHP GGLTIPC EDTF++V S L+
Sbjct  67   FGFDHPMGGLTIPCPEDTFIDVTSRLQ  93



>ref|XP_007201447.1| hypothetical protein PRUPE_ppa013863mg [Prunus persica]
 gb|EMJ02646.1| hypothetical protein PRUPE_ppa013863mg [Prunus persica]
Length=99

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+FAVYVGES+K+RFVIPVSYL  P F DLLSQ+EEEFG+DHP GG+TIPC E+TFL
Sbjct  32   IPKGYFAVYVGESQKKRFVIPVSYLNEPLFLDLLSQAEEEFGYDHPMGGITIPCSENTFL  91

Query  275  EVISSLR  255
            ++ S LR
Sbjct  92   DLTSRLR  98



>ref|XP_002306151.1| hypothetical protein POPTR_0004s17190g [Populus trichocarpa]
 gb|EEE86662.1| hypothetical protein POPTR_0004s17190g [Populus trichocarpa]
Length=99

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG  AVY+GE EK+RFV+PVSYL  PSFQDLL+++EEEFGF+HP GGLTIPC ED F+
Sbjct  31   VPKGFLAVYIGEREKKRFVVPVSYLNEPSFQDLLTKAEEEFGFNHPMGGLTIPCREDKFI  90

Query  275  EVISSL  258
            +V+SSL
Sbjct  91   DVLSSL  96



>emb|CDO96970.1| unnamed protein product [Coffea canephora]
Length=102

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 71/97 (73%), Gaps = 4/97 (4%)
 Frame = -3

Query  536  MAISMIHILHAN----KGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPS  369
            MAI +  I+ A     + L  S++  +   +VP+G+ AVYVGES+K+RFVIPV+YL  P 
Sbjct  1    MAIRLPRIIQAKQILKRSLLTSNAAISASVDVPRGYLAVYVGESKKKRFVIPVAYLNEPE  60

Query  368  FQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            FQ+LL+Q+EEEFGFDHP GGLTIPC ED F+++ S L
Sbjct  61   FQELLTQAEEEFGFDHPMGGLTIPCREDIFIDLTSRL  97



>ref|XP_004300228.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Fragaria 
vesca subsp. vesca]
Length=99

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+ AVYVGES+K+RFVIP+SYL  PSF DLLSQ+EEEFG+DH  GG+TIPC EDTF+
Sbjct  32   IPKGYLAVYVGESQKKRFVIPISYLNQPSFMDLLSQAEEEFGYDHSMGGITIPCSEDTFI  91

Query  275  EVISSL  258
            E+ SSL
Sbjct  92   ELTSSL  97



>ref|XP_009766736.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=92

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 69/94 (73%), Gaps = 4/94 (4%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M I M   + AN+ LRRSS        VPKGH AVYVGES+K+RFV+P+SYL  P FQDL
Sbjct  1    MGIKMTPFIQANRILRRSSISGG----VPKGHCAVYVGESQKKRFVVPISYLSQPLFQDL  56

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            L+Q+EEEFGFDHP GGLTIP  ED F+++ S LR
Sbjct  57   LAQAEEEFGFDHPMGGLTIPIKEDVFVDLTSRLR  90



>ref|XP_010086682.1| hypothetical protein L484_000889 [Morus notabilis]
 gb|EXB22714.1| hypothetical protein L484_000889 [Morus notabilis]
Length=103

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE+EK+RFVIP+SYL +P FQDLL+++EEEFGFDHPTGGL+IPC ED F 
Sbjct  35   VPKGHFAVYVGEAEKKRFVIPISYLNHPLFQDLLNRAEEEFGFDHPTGGLSIPCSEDYFS  94

Query  275  EVISSL  258
             + S+L
Sbjct  95   SLTSAL  100



>ref|XP_008365898.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=98

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+ AVYVGESE++RFVIPVSYL   SFQDLLS++E+EFGFDHP GGLTIPC +DTF+
Sbjct  33   VPKGYLAVYVGESERQRFVIPVSYLNQLSFQDLLSEAEQEFGFDHPMGGLTIPCRQDTFI  92

Query  275  EVISSL  258
            ++IS L
Sbjct  93   DIISQL  98



>ref|XP_010315343.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=86

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 66/93 (71%), Gaps = 10/93 (11%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI M  I+  +  +            VPKGHFAVYVGE++K+RFVIP+S+L  P FQDL
Sbjct  1    MAIRMPRIIKKSSTVAD----------VPKGHFAVYVGENQKKRFVIPISFLSQPLFQDL  50

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LSQ+EEEFGFDHP GG+TIPC ED F+++ S L
Sbjct  51   LSQAEEEFGFDHPMGGVTIPCSEDVFVDLTSRL  83



>ref|XP_004230984.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=86

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 65/93 (70%), Gaps = 10/93 (11%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI M  I+  +  +            VPKGHFAVYVGE +K+RFVIP+S+L  P FQDL
Sbjct  1    MAIRMPRIIKKSSTVAD----------VPKGHFAVYVGEKQKKRFVIPISFLSQPLFQDL  50

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LSQ+EEEFGFDHP GG+TIPC ED F+++ S L
Sbjct  51   LSQAEEEFGFDHPMGGVTIPCSEDVFVDLTSRL  83



>emb|CAN79759.1| hypothetical protein VITISV_009899 [Vitis vinifera]
Length=83

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE++K+RFV+P+SYL NPSFQ LLS +EEEFGF+HP GG+TIPC ED F+
Sbjct  15   VPKGHFAVYVGEAQKKRFVLPISYLNNPSFQKLLSCAEEEFGFNHPMGGVTIPCKEDAFI  74

Query  275  EVISSLRS  252
             + S L S
Sbjct  75   HLTSQLHS  82



>ref|XP_009126229.1| PREDICTED: auxin-induced protein 15A-like [Brassica rapa]
Length=92

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -3

Query  530  ISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLS  351
            ++++  L   K +  +++     S VPKG  AVYVGES+K R+V+P+SYL  PSFQ LLS
Sbjct  1    MALVRSLLGAKKILGAATSKRATSAVPKGFLAVYVGESQKMRYVVPISYLSQPSFQALLS  60

Query  350  QSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            +SEEEFGFDHP GGLTIPC EDTF+ V S L+
Sbjct  61   KSEEEFGFDHPMGGLTIPCHEDTFITVTSRLQ  92



>gb|KGN43197.1| hypothetical protein Csa_7G008440 [Cucumis sativus]
Length=84

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG  AVYVGE++KRR VIP+SYLK+PSFQDLLS++EEEFGFDHP GGLTIPC ED F 
Sbjct  16   VPKGFLAVYVGETQKRRHVIPISYLKHPSFQDLLSKAEEEFGFDHPMGGLTIPCNEDVFF  75

Query  275  EVISSL  258
            EV S L
Sbjct  76   EVTSRL  81



>ref|XP_004301662.1| PREDICTED: uncharacterized protein LOC101295922 [Fragaria vesca 
subsp. vesca]
Length=187

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+FAVYVGES+K+RFVIP+SYL  PSF DLLSQ+EEEFG+DHP GG+TIPC E+TFL
Sbjct  32   IPKGYFAVYVGESQKKRFVIPISYLNQPSFMDLLSQAEEEFGYDHPMGGITIPCSEETFL  91

Query  275  EVISSL  258
            ++ SSL
Sbjct  92   DLTSSL  97


 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+FAVYVGES+K+RFV+P+SYL  P F DLLSQ+EEEFG+ HP GG+TIPC +DTF+
Sbjct  120  IPKGYFAVYVGESQKKRFVVPISYLNQPLFLDLLSQAEEEFGYHHPMGGITIPCSQDTFI  179

Query  275  EVISSL  258
            ++ S L
Sbjct  180  DLTSRL  185



>gb|KDP27613.1| hypothetical protein JCGZ_19618 [Jatropha curcas]
Length=96

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG  AVY+GE EK+R+++P+SYL  PSFQDLLS++EEE+GFDHP GGLTIPC EDTF+
Sbjct  28   VPKGFLAVYIGEKEKKRYLVPISYLNEPSFQDLLSKAEEEYGFDHPMGGLTIPCREDTFI  87

Query  275  EVISSL  258
            +V SSL
Sbjct  88   DVTSSL  93



>gb|EYU35291.1| hypothetical protein MIMGU_mgv1a017210mg [Erythranthe guttata]
Length=88

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVY+GESEK+RFVIP+SYL +PSFQ+LL Q+EEEFGF HP GGLTIPC ED F+
Sbjct  20   VPKGHLAVYIGESEKKRFVIPLSYLNHPSFQELLCQAEEEFGFHHPMGGLTIPCSEDLFV  79

Query  275  EVISSLR  255
            ++ S LR
Sbjct  80   DLTSRLR  86



>ref|XP_009126235.1| PREDICTED: auxin-induced protein 15A-like [Brassica rapa]
Length=99

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -3

Query  452  PKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLE  273
            PKG  AVYVGES+K+R+V+P+SYL  PSFQ LLS+SEEEFGFDHPTGGLTIPC EDTF+ 
Sbjct  34   PKGFLAVYVGESQKKRYVVPISYLSQPSFQALLSRSEEEFGFDHPTGGLTIPCPEDTFIN  93

Query  272  VISSL  258
            V S L
Sbjct  94   VTSRL  98



>ref|XP_003631553.1| PREDICTED: auxin-induced protein X15-like [Vitis vinifera]
Length=95

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI    I+ A K + R    +   + VPKGH  VYVGE++K+RFVIP+SYLK+PSFQ+L
Sbjct  1    MAIRFQRIIPA-KQILRRILPSLESTNVPKGHVPVYVGETQKKRFVIPISYLKHPSFQNL  59

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LSQ+EEEFGFDHP GGLTIPC E+ F+++  SL
Sbjct  60   LSQAEEEFGFDHPLGGLTIPCREEAFIDLTCSL  92



>ref|XP_010315351.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=86

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE +K+RFVIP+S+L  P FQDLLSQ+EEEFGFDHP GG+TIPC ED F+
Sbjct  18   VPKGHFAVYVGEKQKKRFVIPISFLSQPLFQDLLSQAEEEFGFDHPMGGVTIPCSEDVFI  77

Query  275  EVISSL  258
            ++ S L
Sbjct  78   DLTSRL  83



>ref|XP_009620276.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=85

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 66/94 (70%), Gaps = 10/94 (11%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI M+ I+  +              +VPKG+FAVYVGE +K+RFVIP+S+L  P+FQDL
Sbjct  1    MAIRMLRIIKKSS----------TTGDVPKGYFAVYVGEKQKKRFVIPISFLSQPTFQDL  50

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            LSQ+EEEFGFDHP GG+TIPC +D F+ + S  R
Sbjct  51   LSQAEEEFGFDHPMGGVTIPCSDDIFIGITSQFR  84



>ref|XP_008372889.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=94

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGE +++RFVIP+SYL +PSFQDLLSQ+EEEFG+DHP GG+TIPC ED FL
Sbjct  26   VPKGYFAVYVGEXQRKRFVIPISYLNDPSFQDLLSQAEEEFGYDHPMGGITIPCSEDRFL  85

Query  275  EVISS  261
             +I++
Sbjct  86   HLITN  90



>emb|CBI17627.3| unnamed protein product [Vitis vinifera]
Length=151

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE+EK+RFV+P+SYL NPSFQ LLS +EEEFGF+HP GG+TIPC E++F+
Sbjct  83   VPKGHFAVYVGETEKKRFVVPISYLNNPSFQKLLSHAEEEFGFNHPMGGVTIPCKEESFI  142

Query  275  EVISSLRS  252
            ++ S L S
Sbjct  143  DLTSHLNS  150



>ref|XP_009592041.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=92

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M I +I  + AN+ LRR+S+       VPKGH AVYVGE +K+RFV+P+SYL  P FQDL
Sbjct  1    MGIKVIPFIQANRFLRRTSTSEG----VPKGHCAVYVGERQKKRFVVPISYLSQPLFQDL  56

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            L+Q+EEEFGFDHP GGLTIP  ED F+++ S LR
Sbjct  57   LAQAEEEFGFDHPMGGLTIPIKEDVFIDLTSRLR  90



>ref|XP_002272231.1| PREDICTED: auxin-induced protein X15-like [Vitis vinifera]
 ref|XP_003631552.1| PREDICTED: auxin-induced protein X15-like [Vitis vinifera]
 emb|CAN62608.1| hypothetical protein VITISV_016869 [Vitis vinifera]
Length=95

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI    I+ A K + R    +   + VPKGH  VYVGE++K+RFVIP+SYLK+PSFQ+L
Sbjct  1    MAIRFQRIIPA-KQILRRILPSPESTNVPKGHVPVYVGETQKKRFVIPISYLKHPSFQNL  59

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LSQ+EEEFGFDHP GGLTIPC E+ F+++  SL
Sbjct  60   LSQAEEEFGFDHPLGGLTIPCREEAFIDLTCSL  92



>ref|XP_010263886.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=96

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE++K+RF++P SYL +PSFQDLL Q+EEEFGF HP GGLTIPC ED FL
Sbjct  29   VPKGHFAVYVGETQKKRFIVPTSYLNHPSFQDLLGQAEEEFGFKHPMGGLTIPCNEDRFL  88

Query  275  EVISSL  258
            ++ S L
Sbjct  89   DLTSRL  94



>ref|XP_007199585.1| hypothetical protein PRUPE_ppb023607mg [Prunus persica]
 gb|EMJ00784.1| hypothetical protein PRUPE_ppb023607mg [Prunus persica]
Length=91

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+FAVYVGES+K+RFVIP+SYL  P F DLL+Q+EEEFG+DHP GG+TIPC EDTFL
Sbjct  24   LPKGYFAVYVGESQKKRFVIPISYLNEPLFLDLLNQAEEEFGYDHPMGGITIPCSEDTFL  83

Query  275  EVISSLR  255
            ++ S LR
Sbjct  84   DLTSHLR  90



>emb|CDY53265.1| BnaA02g03890D [Brassica napus]
Length=92

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -3

Query  530  ISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLS  351
            ++++  L   K +  +++     S  PKG  AVYVGES+K+RFV+P+SYL  PSFQ LLS
Sbjct  1    MALVRSLLGAKKMLGAATSKRATSAAPKGFLAVYVGESQKKRFVVPISYLSQPSFQALLS  60

Query  350  QSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            +SEEEFGF+HP GGLTIPC EDTF+ V S L+
Sbjct  61   KSEEEFGFNHPMGGLTIPCPEDTFINVTSRLQ  92



>ref|XP_002271501.1| PREDICTED: auxin-induced protein X15 [Vitis vinifera]
Length=95

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI    I+ A K + R    +   + VPKGH  VYVGE++K+RFVIP+SYLK+PSFQ+L
Sbjct  1    MAIRFQRIIPA-KQILRRILPSPESTNVPKGHVPVYVGEAQKKRFVIPISYLKHPSFQNL  59

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LSQ+EEEFGFDHP GGLTIPC E+ F+++  SL
Sbjct  60   LSQAEEEFGFDHPLGGLTIPCREEAFIDLTCSL  92



>ref|XP_010649235.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100246251 
[Vitis vinifera]
Length=208

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 76/103 (74%), Gaps = 7/103 (7%)
 Frame = -3

Query  539  RMAISMIHILHANKGLrrss-------srtnresEVPKGHFAVYVGESEKRRFVIPVSYL  381
            R  + M  ILHA + L+  S       S ++  +EVPKGHFAVYVGE+EK+RFV+P+SYL
Sbjct  105  RRWVCMPSILHAKQILKLQSLLTRSQLSVSSTTAEVPKGHFAVYVGETEKKRFVVPISYL  164

Query  380  KNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLRS  252
             NPSFQ LLS +EEEFGF+HP GG+TIPC E++F+++ S L S
Sbjct  165  NNPSFQKLLSHAEEEFGFNHPMGGVTIPCKEESFIDLTSHLNS  207


 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHF VYVGE++++RFV+P+SY  NPSF   LS +EEEFGF HP GG+TI C E  F+
Sbjct  35   VPKGHFVVYVGEAQRKRFVVPISYRNNPSFLKXLSHAEEEFGFKHPMGGVTILCNEGAFI  94

Query  275  EVIS  264
            ++ S
Sbjct  95   DITS  98



>ref|XP_002272387.1| PREDICTED: auxin-induced protein 15A-like [Vitis vinifera]
 ref|XP_010647418.1| PREDICTED: auxin-induced protein 15A-like [Vitis vinifera]
Length=100

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGES+K+RFVIP+SYL +P FQDLL ++EEEFGFDHP GGLTIPC ED F+
Sbjct  32   VPKGHFAVYVGESQKKRFVIPISYLNHPLFQDLLHRAEEEFGFDHPMGGLTIPCSEDYFI  91

Query  275  EVISSL  258
             + S L
Sbjct  92   SLTSHL  97



>emb|CBI17628.3| unnamed protein product [Vitis vinifera]
Length=84

 Score =   109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -3

Query  515  ILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEE  336
            ++HA + L+  S  T + SEVPKGHFAVYVGE +++RFV+P+SYL NPSFQ LLS +EEE
Sbjct  1    MVHARQILKLQSLLTRKASEVPKGHFAVYVGEGQRKRFVVPLSYLNNPSFQKLLSHAEEE  60

Query  335  FGFDHPTGGLTIPCMEDTFLEVIS  264
            FGF+HP GG+TIPC ED F+++ S
Sbjct  61   FGFNHPMGGVTIPCNEDAFIDITS  84



>ref|XP_009620275.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=83

 Score =   109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE +K+R VIP+S+L  P+FQ+LLSQ+EEEFGFDHP GGLTIPC ED F+
Sbjct  16   VPKGHFAVYVGEKQKKRVVIPISFLSQPAFQNLLSQAEEEFGFDHPMGGLTIPCSEDFFV  75

Query  275  EVISSLR  255
            ++ S LR
Sbjct  76   DLTSRLR  82



>gb|KDP34545.1| hypothetical protein JCGZ_11095 [Jatropha curcas]
Length=100

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG  AVY+GE EK+RFV+P+SYLK PSFQDLL+++EEEFGFDHP GGLTIPC E+ FL
Sbjct  31   VPKGFLAVYIGELEKKRFVVPISYLKEPSFQDLLNKAEEEFGFDHPMGGLTIPCREEAFL  90

Query  275  EVISSLRS  252
             V S+L++
Sbjct  91   HVTSNLKT  98



>ref|XP_009770355.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=86

 Score =   109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE +K+RFVIP+S+L  P FQDLLSQ+EEEFGFD P GGLTIPC ED F+
Sbjct  18   VPKGHFAVYVGEKQKKRFVIPISFLSQPLFQDLLSQAEEEFGFDQPMGGLTIPCGEDVFI  77

Query  275  EVISSL  258
            ++IS L
Sbjct  78   DLISHL  83



>ref|XP_008225927.1| PREDICTED: auxin-induced protein 15A-like [Prunus mume]
Length=90

 Score =   109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGES+K+RFVIPVS+L  PSFQ+LLSQ+E+EFG+DHP GG+TIPC EDTFL
Sbjct  23   VPKGYFAVYVGESQKKRFVIPVSFLNQPSFQNLLSQAEDEFGYDHPMGGITIPCSEDTFL  82

Query  275  EVIS  264
             +IS
Sbjct  83   HLIS  86



>ref|XP_008382353.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=91

 Score =   109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 5/93 (5%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M   +  ILHA K     S  +++  +VPKG+ A+YVGES+K+RF+IPVSY   PSFQDL
Sbjct  1    MGFRLPGILHAKK-----SQVSSKSLDVPKGYLAIYVGESQKKRFIIPVSYFNQPSFQDL  55

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LS SE+EFG+DHP GG+TIPC EDTFL + S+L
Sbjct  56   LSLSEDEFGYDHPMGGVTIPCSEDTFLGLTSAL  88



>ref|XP_010315355.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=78

 Score =   109 bits (272),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+ AVYVGE +K+RFVIP+S+L  P FQDLLSQ+E+EFGFDHP GGLTIPC ED F+
Sbjct  11   VPKGYLAVYVGEEQKKRFVIPISFLSQPLFQDLLSQAEDEFGFDHPMGGLTIPCREDIFI  70

Query  275  EVISSLRS  252
            ++IS LR+
Sbjct  71   DLISHLRN  78



>ref|XP_010536042.1| PREDICTED: auxin-induced protein 15A-like [Tarenaya hassleriana]
Length=95

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGES K+RF++PVS+L  PSFQDLL ++EEEFGFDHPTGGLTIPC E+ F 
Sbjct  26   VPKGHFAVYVGESRKKRFLVPVSFLSEPSFQDLLRKAEEEFGFDHPTGGLTIPCSEEVFA  85

Query  275  EVISSLRS  252
            ++ S L S
Sbjct  86   DLTSRLSS  93



>ref|XP_009772683.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=85

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHF VYVGE +K++FVIP+S+L  P FQDLLSQ+EEEFGFDHP GG+TIPC ED F+
Sbjct  18   VPKGHFTVYVGEKQKKKFVIPISFLSQPLFQDLLSQAEEEFGFDHPMGGVTIPCTEDVFI  77

Query  275  EVISSLRS  252
             + S LR+
Sbjct  78   NLTSRLRN  85



>gb|KFK26026.1| hypothetical protein AALP_AA8G193900 [Arabis alpina]
Length=97

 Score =   110 bits (274),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
             PKG  AVYVGES+K+R+V+P+SYL  PSFQ LLS+SEEEFGFDHP GGLTIPC EDTF+
Sbjct  31   APKGFLAVYVGESQKKRYVVPISYLSQPSFQALLSKSEEEFGFDHPMGGLTIPCREDTFI  90

Query  275  EVISSLR  255
             V S L+
Sbjct  91   NVTSRLQ  97



>ref|XP_007041971.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
 gb|EOX97802.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
Length=95

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M   +  I++A + L+R+ S +     VPKGHFAVY+GE+EK+RFV+P+S+LK+ SFQ+L
Sbjct  1    MGFRLPRIVNAKRSLKRALSSSETTV-VPKGHFAVYIGEAEKKRFVVPISFLKHASFQNL  59

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLRS  252
            LSQ+EEE+GF+HP G LTIPC E+ FL++I  L+S
Sbjct  60   LSQAEEEYGFNHPMGALTIPCCEEAFLDLICGLQS  94



>gb|KDP34553.1| hypothetical protein JCGZ_11103 [Jatropha curcas]
Length=100

 Score =   110 bits (274),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG  AVY+GE E++RFV+P+SYL+ PSFQDLLS++EEEFGFDHP GGLTIPC E+ FL
Sbjct  31   VPKGFLAVYIGELEEKRFVVPISYLREPSFQDLLSKAEEEFGFDHPMGGLTIPCREEAFL  90

Query  275  EVISSLRS  252
             V S+L+S
Sbjct  91   HVTSNLKS  98



>ref|XP_006352414.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=91

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGE +K+RFV+P+SYL  P +QDLL+Q+EE+FGFDHP GGLTIPC ED F+
Sbjct  24   VPKGHCAVYVGERQKKRFVVPISYLSQPLYQDLLTQAEEQFGFDHPMGGLTIPCKEDVFV  83

Query  275  EVISSLRS  252
            ++ S LRS
Sbjct  84   DLTSRLRS  91



>ref|XP_002276227.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
Length=95

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI    I+ A K + R    +   + VPKGH  VYVGE++K+RFVIP+SYLK+PSFQ+L
Sbjct  1    MAIRFQRIIPA-KQILRRILPSLESTNVPKGHVPVYVGETQKKRFVIPISYLKHPSFQNL  59

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LSQ+EEEFGFDHP GGLTIPC E+ F+++  SL
Sbjct  60   LSQAEEEFGFDHPLGGLTIPCREEAFIDLTYSL  92



>gb|AAM12777.1| putative auxin-induced SAUR-like protein [Capsicum annuum]
Length=83

 Score =   109 bits (272),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE++KRRFV+P+S+L  P FQDLLSQ+EEEFGFDHP GG+TIPC ED F 
Sbjct  16   VPKGHFAVYVGETQKRRFVVPISFLSEPLFQDLLSQAEEEFGFDHPMGGVTIPCSEDLFT  75

Query  275  EVISSLR  255
            ++   LR
Sbjct  76   DLTFRLR  82



>ref|XP_010248232.1| PREDICTED: auxin-induced protein X10A-like [Nelumbo nucifera]
Length=103

 Score =   110 bits (274),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = -3

Query  455  VPKGHFAVYVGES-EKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTF  279
            VPKGH AVYVGE+ +K+RFV+P+S+L +PSFQDLLSQ+EEE+GFDHP G LTIPC ED F
Sbjct  34   VPKGHLAVYVGEAHQKKRFVVPISHLNHPSFQDLLSQAEEEYGFDHPMGALTIPCKEDAF  93

Query  278  LEVISSLRS  252
            L + SSL S
Sbjct  94   LHLTSSLNS  102



>ref|XP_008369425.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
 ref|XP_008369426.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
 ref|XP_008338053.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=91

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+ A+YVGES+K+RF+IPVSYL  PSFQDLLS SE+EFG+DHP GG+TIPC EDTFL
Sbjct  23   VPKGYLAIYVGESQKKRFIIPVSYLNQPSFQDLLSLSEDEFGYDHPMGGITIPCSEDTFL  82

Query  275  EVISSL  258
             + S+L
Sbjct  83   GLTSAL  88



>ref|XP_002313000.1| hypothetical protein POPTR_0009s12910g [Populus trichocarpa]
 gb|EEE86955.1| hypothetical protein POPTR_0009s12910g [Populus trichocarpa]
Length=91

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG  AVYVGE+EK+RFV+PVSYL  P FQDLL ++EEEFGFDHP GGLTIPC EDTF+
Sbjct  23   VPKGFVAVYVGETEKKRFVVPVSYLNQPIFQDLLCKAEEEFGFDHPMGGLTIPCREDTFI  82

Query  275  EVISSL  258
             V SSL
Sbjct  83   HVTSSL  88



>ref|XP_009766735.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=92

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M I M   + A++ LRR+S+       VPKGH AVYVGES+K+RFV+P+SYL  P FQD+
Sbjct  1    MGIKMTPFIQASRILRRTSTTGG----VPKGHCAVYVGESQKKRFVVPISYLSQPLFQDM  56

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            L+Q+EEEFGFDH  GGLTIPC ED F+++ S LR
Sbjct  57   LAQAEEEFGFDHSMGGLTIPCKEDVFIDLTSRLR  90



>ref|XP_004250217.1| PREDICTED: auxin-induced protein X15-like [Solanum lycopersicum]
Length=91

 Score =   109 bits (272),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RFV+P+SYL  P FQDLL+Q+E++FGF+HP GGLTIPC ED F+
Sbjct  24   VPKGHCAVYVGESQKKRFVVPISYLSQPLFQDLLTQAEDQFGFNHPMGGLTIPCKEDVFV  83

Query  275  EVISSLRS  252
            ++ S LRS
Sbjct  84   DLTSRLRS  91



>ref|XP_010649243.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CBI17631.3| unnamed protein product [Vitis vinifera]
Length=96

 Score =   109 bits (273),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M I +  ++ A + L+  S  +   +EVPKGHFAVYVGE EK+R+V+P+SYL +PSF+ L
Sbjct  1    MGIRLPSVVQAKQILKLQSLLSRNRAEVPKGHFAVYVGEIEKKRYVVPISYLNHPSFRSL  60

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLRS  252
            L Q+EEEFGF+HP GGLTIPC E  FL++ S L++
Sbjct  61   LCQAEEEFGFNHPMGGLTIPCEEHAFLDLTSQLQA  95



>emb|CDY71214.1| BnaAnng36540D [Brassica napus]
Length=92

 Score =   109 bits (272),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = -3

Query  530  ISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLS  351
            +S++  L   + +  +++     S  PKG  AVYVGES+K+R+V+P+SYL  PSFQ LLS
Sbjct  1    MSLVRSLLGARKILGAATSKRATSAAPKGFLAVYVGESQKKRYVVPISYLSQPSFQALLS  60

Query  350  QSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            +SEEEFGFDHP GGLTIPC EDTF+ V S L
Sbjct  61   KSEEEFGFDHPMGGLTIPCPEDTFITVTSRL  91



>ref|XP_006352406.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=92

 Score =   109 bits (272),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RFV+P+SYL  P FQDLL+Q+E++FGFDHP GGLTIPC ED F+
Sbjct  24   VPKGHCAVYVGESQKKRFVVPISYLTQPLFQDLLTQAEKQFGFDHPMGGLTIPCKEDVFV  83

Query  275  EVISSLR  255
            ++ S LR
Sbjct  84   DLTSRLR  90



>emb|CDY25466.1| BnaC09g39810D [Brassica napus]
Length=93

 Score =   109 bits (272),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -3

Query  518  HILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEE  339
            ++L A K L RS++  +  S  PKG  AVYVGE +K+R+V+PVSYL  PSFQ LLS+SEE
Sbjct  6    NLLGAKKILGRSATSKSATSAAPKGFLAVYVGEGQKKRYVVPVSYLSQPSFQALLSKSEE  65

Query  338  EFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            EFGF+HP GGLTIPC EDTF++V S L+
Sbjct  66   EFGFNHPMGGLTIPCPEDTFIDVTSRLQ  93



>ref|XP_010664793.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CBI19838.3| unnamed protein product [Vitis vinifera]
Length=104

 Score =   109 bits (273),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGE++K+RFV+P+SYL +PSFQDLLSQ+EEEFGFDHP GGLTIPC    F+
Sbjct  34   VPKGYFAVYVGENQKQRFVVPISYLNHPSFQDLLSQAEEEFGFDHPMGGLTIPCKIANFI  93

Query  275  EVISSLR  255
            E+ S L+
Sbjct  94   ELTSRLQ  100



>ref|XP_009770668.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=86

 Score =   109 bits (272),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VP G+FAVYVGE +K+RFVIP+S+L  P+FQDLLSQ+EEEFGFDHP GGLTIPC ED F+
Sbjct  18   VPNGYFAVYVGEKQKKRFVIPLSFLSQPAFQDLLSQAEEEFGFDHPMGGLTIPCSEDMFV  77

Query  275  EVISSL  258
            ++ SSL
Sbjct  78   DLTSSL  83



>ref|XP_009379590.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=101

 Score =   109 bits (273),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+F VYVGESEK+RFV+P+S+L +P+FQDLLS +EEEFGFDHP GGLTIPC +D FL
Sbjct  33   VPKGYFPVYVGESEKQRFVVPISFLNHPAFQDLLSDAEEEFGFDHPMGGLTIPCRQDAFL  92

Query  275  EVISSLRS  252
            ++I  L++
Sbjct  93   DLICRLKA  100



>gb|KCW55457.1| hypothetical protein EUGRSUZ_I01359 [Eucalyptus grandis]
Length=100

 Score =   109 bits (273),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVG+S+KRR+V+P+SYL  PSFQDLLSQ+EEEFGF+HP GGLTIPC E+ FL
Sbjct  32   VPKGYFAVYVGDSQKRRYVVPISYLSQPSFQDLLSQAEEEFGFNHPMGGLTIPCEEEVFL  91

Query  275  EVISSL  258
             + S L
Sbjct  92   NLTSHL  97



>ref|XP_006359634.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=82

 Score =   108 bits (271),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKGHFAVYVGE +K+RFVIP+S+L  P FQDLL+Q+EEEFGFDHP GG+TIPC ED F+
Sbjct  15   IPKGHFAVYVGEEQKKRFVIPISFLSEPLFQDLLNQAEEEFGFDHPMGGVTIPCTEDLFV  74

Query  275  EVISSLRS  252
             + S LR 
Sbjct  75   NLTSRLRK  82



>ref|XP_011088528.1| PREDICTED: auxin-induced protein X15-like [Sesamum indicum]
Length=92

 Score =   109 bits (272),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGESE++RFVIPVSYL +PSFQDLL Q+EEEFGFDHP GG+TIPC E+ F+
Sbjct  24   VPKGHLAVYVGESERKRFVIPVSYLNHPSFQDLLFQAEEEFGFDHPMGGITIPCSEELFI  83

Query  275  EVISSL  258
            ++ S L
Sbjct  84   DLTSQL  89



>ref|XP_010271400.1| PREDICTED: auxin-induced protein 6B-like [Nelumbo nucifera]
Length=100

 Score =   109 bits (272),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH  VYVGE+ K+RFV+P+SYL +PSFQDLL+Q+EEEFGF HP GGLTIPC ED F 
Sbjct  32   VPKGHLVVYVGETLKKRFVVPISYLNHPSFQDLLTQAEEEFGFHHPMGGLTIPCKEDAFT  91

Query  275  EVISSLRS  252
            ++ SSL S
Sbjct  92   DLTSSLNS  99



>ref|XP_007041977.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
 gb|EOX97808.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
Length=95

 Score =   109 bits (272),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE+EK+RFV+P+S+LK+PSFQ+LLSQ+EEE+GF HP G LTIPC E+ F+
Sbjct  27   VPKGHFAVYVGEAEKKRFVVPISFLKDPSFQNLLSQAEEEYGFYHPRGALTIPCSEEAFI  86

Query  275  EVISSLRS  252
            ++  SL+S
Sbjct  87   DLTCSLQS  94



>ref|XP_006286674.1| hypothetical protein CARUB_v10002645mg [Capsella rubella]
 gb|EOA19572.1| hypothetical protein CARUB_v10002645mg [Capsella rubella]
Length=87

 Score =   108 bits (271),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
             PKG  AVYVGES+K+RFV+P+SYL  PSFQ LLS+SEEEFGFDHP GGLTIPC EDTF+
Sbjct  21   APKGFLAVYVGESQKKRFVVPISYLNQPSFQALLSKSEEEFGFDHPMGGLTIPCPEDTFI  80

Query  275  EVISSLR  255
             V S L+
Sbjct  81   TVTSRLQ  87



>gb|EYU37903.1| hypothetical protein MIMGU_mgv1a022749mg [Erythranthe guttata]
Length=88

 Score =   108 bits (271),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHF VYVGESEK+RFVIP+SYL NPSFQ+LL Q+EEEFGF HP  GLTIPC E+ F+
Sbjct  20   VPKGHFVVYVGESEKKRFVIPLSYLNNPSFQELLCQAEEEFGFHHPASGLTIPCSEELFV  79

Query  275  EVISSL  258
            E+ S L
Sbjct  80   ELTSRL  85



>ref|XP_009760902.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=92

 Score =   108 bits (271),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RFV+P+SYL  P FQDLL+Q+EEEFGFDH  GGLTIPC ED F+
Sbjct  24   VPKGHCAVYVGESQKKRFVMPISYLSQPLFQDLLAQAEEEFGFDHSMGGLTIPCKEDVFI  83

Query  275  EVISSLR  255
            ++ S LR
Sbjct  84   DLTSRLR  90



>ref|XP_006400352.1| hypothetical protein EUTSA_v10015118mg [Eutrema salsugineum]
 gb|ESQ41805.1| hypothetical protein EUTSA_v10015118mg [Eutrema salsugineum]
Length=97

 Score =   109 bits (272),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
             PKG  AVYVGES+K+R+++P+SYL  PSFQ LLS+SEEEFGFDHP GGLTIPC EDTF+
Sbjct  31   APKGFLAVYVGESQKKRYIVPISYLSQPSFQALLSKSEEEFGFDHPMGGLTIPCPEDTFI  90

Query  275  EVISSLR  255
             V S L+
Sbjct  91   TVTSQLQ  97



>gb|EYU23191.1| hypothetical protein MIMGU_mgv1a020984mg [Erythranthe guttata]
Length=88

 Score =   108 bits (271),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH  VYVGESEK+RFVIP+SYL +PSFQ+LLSQ+EEEFGF HP GGLTIPC E++F+
Sbjct  20   VPKGHLVVYVGESEKKRFVIPLSYLNHPSFQELLSQAEEEFGFRHPMGGLTIPCSEESFI  79

Query  275  EVISSLR  255
             + S LR
Sbjct  80   GLTSHLR  86



>ref|XP_006400344.1| hypothetical protein EUTSA_v10015117mg [Eutrema salsugineum]
 gb|ESQ41797.1| hypothetical protein EUTSA_v10015117mg [Eutrema salsugineum]
Length=97

 Score =   108 bits (271),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
             PKG  AVYVGES+K+R+++P+SYL  PSFQ LLS+SEEEFGFDHP GGLTIPC EDTF+
Sbjct  31   APKGFLAVYVGESQKKRYIVPISYLSQPSFQALLSKSEEEFGFDHPMGGLTIPCPEDTFI  90

Query  275  EVISSLR  255
             V S L+
Sbjct  91   TVTSQLQ  97



>ref|XP_010255167.1| PREDICTED: auxin-induced protein X10A-like [Nelumbo nucifera]
Length=103

 Score =   109 bits (272),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = -3

Query  455  VPKGHFAVYVGES-EKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTF  279
            VPKGH AVYVGE+ +K+RFV+P+SYL +PSFQDLLSQ+EE+FGFDHP G LTIPC ED F
Sbjct  34   VPKGHLAVYVGEAHQKKRFVVPISYLNHPSFQDLLSQAEEDFGFDHPMGALTIPCKEDAF  93

Query  278  LEVISSLRS  252
            L + S L S
Sbjct  94   LHLTSYLNS  102



>ref|XP_004166275.1| PREDICTED: auxin-induced protein 10A5-like [Cucumis sativus]
 gb|KGN61886.1| hypothetical protein Csa_2G258820 [Cucumis sativus]
Length=97

 Score =   108 bits (271),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -3

Query  515  ILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEE  336
            +L+A + L+  +     +S+VPKGH AVYVGE +++RFV+P+SYLKNPSF DLL++SEEE
Sbjct  9    LLNAKQILKMQAMSARNQSDVPKGHIAVYVGEIQRKRFVVPISYLKNPSFVDLLNRSEEE  68

Query  335  FGFDHPTGGLTIPCMEDTFLEVISSLRS  252
            FGF HP GGLTIPC ED F+ + + L +
Sbjct  69   FGFCHPMGGLTIPCREDAFINLTARLHT  96



>emb|CBI17626.3| unnamed protein product [Vitis vinifera]
Length=90

 Score =   108 bits (271),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE +K+RFV+P+SYL +PSFQDLL Q+EEEFGF+H  GGLTIPC E+TF+
Sbjct  22   VPKGHFAVYVGEIQKKRFVVPISYLNHPSFQDLLQQAEEEFGFNHSMGGLTIPCKEETFI  81

Query  275  EVISSLRS  252
            ++ S L +
Sbjct  82   DLASQLSA  89



>ref|XP_008392043.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=101

 Score =   108 bits (271),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+F VYVGESEK+RFV+P+S+L +P+FQDLLS +EEEFGFDHP GGLT+PC +D FL
Sbjct  33   VPKGYFPVYVGESEKQRFVVPISFLNHPAFQDLLSDAEEEFGFDHPMGGLTVPCRQDAFL  92

Query  275  EVISSLRS  252
            ++I  L++
Sbjct  93   DLICRLKA  100



>emb|CAN62606.1| hypothetical protein VITISV_016867 [Vitis vinifera]
Length=75

 Score =   108 bits (269),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGES+K+RFVIP+SYL +P FQDLL ++EEEFGFDHP GGLTIPC ED F+
Sbjct  7    VPKGHFAVYVGESQKKRFVIPISYLNHPLFQDLLHRAEEEFGFDHPMGGLTIPCSEDYFI  66

Query  275  EVISSL  258
             + S L
Sbjct  67   SLTSHL  72



>ref|XP_010271401.1| PREDICTED: uncharacterized protein LOC104607462 [Nelumbo nucifera]
Length=203

 Score =   112 bits (279),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnr-esEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQD  360
            M I +  I+HA   LRRS    +   + VPKGHFAVYVGE++K+RF++P+SYL +PSFQD
Sbjct  1    MGIRLPGIVHAKAILRRSLISPSAPTANVPKGHFAVYVGEAQKKRFIVPISYLSHPSFQD  60

Query  359  LLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LL Q+EEEFGF HP GGLTIPC ED FL++ S L
Sbjct  61   LLGQAEEEFGFHHPMGGLTIPCKEDQFLDLTSRL  94


 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVG +EK+RF++P+SYL +PSFQDLL+++EEEFGF HPTGGLTIPC E+TF+
Sbjct  136  VPKGHFAVYVGVNEKKRFIVPISYLNHPSFQDLLNKAEEEFGFKHPTGGLTIPCKEETFI  195

Query  275  EVISSL  258
             + S L
Sbjct  196  GLASQL  201



>ref|XP_002271427.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
Length=97

 Score =   108 bits (271),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE +K+RFV+P+SYL +PSFQDLL Q+EEEFGF+H  GGLTIPC E+TF+
Sbjct  29   VPKGHFAVYVGEIQKKRFVVPISYLNHPSFQDLLQQAEEEFGFNHSMGGLTIPCKEETFI  88

Query  275  EVISSLRS  252
            ++ S L +
Sbjct  89   DLASQLSA  96



>ref|XP_008237039.1| PREDICTED: auxin-induced protein 15A-like [Prunus mume]
Length=93

 Score =   108 bits (271),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG FAVYVGES+K+RFVIP+SYL  P FQDLL+Q+EEEFG+DHP GG+TIPC ED+FL
Sbjct  26   IPKGCFAVYVGESQKKRFVIPISYLNEPLFQDLLNQAEEEFGYDHPMGGITIPCSEDSFL  85

Query  275  EVISSL  258
            ++ S L
Sbjct  86   DITSRL  91



>emb|CDY25469.1| BnaC09g39840D [Brassica napus]
Length=93

 Score =   108 bits (271),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -3

Query  515  ILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEE  336
            +L A K L RS++  +  S  PKG  AVYVGE +K+R+V+PVSYL  PSFQ LLS+SEEE
Sbjct  7    LLGAKKILGRSATSKSATSAAPKGFLAVYVGEGQKKRYVVPVSYLSQPSFQALLSKSEEE  66

Query  335  FGFDHPTGGLTIPCMEDTFLEVISSLR  255
            FGF+HP GGLTIPC EDTF++V S L+
Sbjct  67   FGFNHPMGGLTIPCPEDTFIDVTSRLQ  93



>ref|XP_009368355.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=134

 Score =   110 bits (274),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 4/103 (4%)
 Frame = -3

Query  572  HKYLCFKKKHSRMAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIP  393
            HK + F+   +  AI ++    +N         +   ++VPKG+ AVYVGE+E++RFVIP
Sbjct  34   HKTMGFRCPSASHAIKVLQRSFSNPS----QGGSYSLADVPKGYLAVYVGENERQRFVIP  89

Query  392  VSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVIS  264
            VSYL  PSFQDLLS +E+EFGFDHP GGLTIPC +DTF+++IS
Sbjct  90   VSYLNQPSFQDLLSVAEQEFGFDHPMGGLTIPCRQDTFIDIIS  132



>ref|XP_006359632.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=85

 Score =   108 bits (270),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHF VYVGE++K+R+VIP+S+L  P FQDLL Q+E+EFGFDHP GGLTIPC ED F+
Sbjct  18   VPKGHFVVYVGENQKKRYVIPISFLSQPLFQDLLGQAEDEFGFDHPMGGLTIPCREDIFI  77

Query  275  EVISSLRS  252
            ++ S LR+
Sbjct  78   DLTSRLRN  85



>ref|XP_006359630.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=86

 Score =   108 bits (270),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE +K+RFVIP+S+L  P FQDLLSQ+EEEFGF+HP GG+TIPC ED F+
Sbjct  18   VPKGHFAVYVGEKQKKRFVIPISFLSQPLFQDLLSQAEEEFGFNHPMGGVTIPCSEDVFI  77

Query  275  EVISSL  258
            ++ S L
Sbjct  78   DLTSRL  83



>ref|XP_008391973.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=101

 Score =   108 bits (271),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGE+EK+R+VIPVS+L  P FQDL+SQ+EEEFGFDHP GGLTIPC +D FL
Sbjct  33   VPKGYFAVYVGENEKQRYVIPVSFLNEPEFQDLVSQAEEEFGFDHPMGGLTIPCRQDAFL  92

Query  275  EVISSLRS  252
             + S L +
Sbjct  93   HLTSRLNT  100



>emb|CBI37953.3| unnamed protein product [Vitis vinifera]
Length=108

 Score =   109 bits (272),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH  VYVGE++K+RFVIP+SYLK+PSFQ+LLSQ+EEEFGFDHP GGLTIPC E+ F+
Sbjct  40   VPKGHVPVYVGETQKKRFVIPISYLKHPSFQNLLSQAEEEFGFDHPLGGLTIPCREEAFI  99

Query  275  EVISSL  258
            ++  SL
Sbjct  100  DLTCSL  105



>ref|XP_006359633.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=82

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+ AVYVGE  K+RFVIP+S+L  P FQDLLSQ+EEEFGFDHP GGLTIPC ED F+
Sbjct  15   VPKGYLAVYVGEEHKKRFVIPISFLSQPLFQDLLSQAEEEFGFDHPMGGLTIPCREDIFI  74

Query  275  EVISSLRS  252
            ++ S LR+
Sbjct  75   DLTSRLRN  82



>gb|KDP27610.1| hypothetical protein JCGZ_19615 [Jatropha curcas]
Length=94

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG  AVYVGE+EK+R+++P+SYL +PSFQDLLS++EEE+GFDHP GG TIPC EDTF+
Sbjct  26   VPKGFIAVYVGETEKKRYIVPISYLNHPSFQDLLSRAEEEYGFDHPMGGSTIPCREDTFI  85

Query  275  EVISSL  258
             V SSL
Sbjct  86   YVTSSL  91



>ref|XP_009591874.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=85

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGE +K+RFVIP+S+L  P+FQDLLSQ+EEEFGFDHP GG+TIPC +D F+
Sbjct  18   VPKGYFAVYVGEKQKKRFVIPISFLSQPTFQDLLSQAEEEFGFDHPMGGVTIPCSDDIFI  77

Query  275  EVISSLR  255
             + S  R
Sbjct  78   GIASQFR  84



>emb|CDY02652.1| BnaC02g07830D [Brassica napus]
Length=92

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = -3

Query  530  ISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLS  351
            ++++  L   K +  +++     S  PKG  AVYVGES+K+R+V+P+SYL  PSFQ LLS
Sbjct  1    MALVRSLLGAKKILGAATSKRATSAAPKGFLAVYVGESQKKRYVVPISYLSQPSFQALLS  60

Query  350  QSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            ++EEEFGFDHP GGLTIPC EDTF+ V S L
Sbjct  61   KAEEEFGFDHPMGGLTIPCPEDTFITVTSGL  91



>ref|XP_002271660.2| PREDICTED: uncharacterized protein LOC100252964 [Vitis vinifera]
Length=214

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE+EK+RFV+P+SYL NPSFQ LLS +EEEFGF+HP GG+TIPC ED F+
Sbjct  146  VPKGHFAVYVGEAEKKRFVVPISYLNNPSFQKLLSHAEEEFGFNHPMGGVTIPCKEDAFI  205

Query  275  EVISSLRS  252
             + S   S
Sbjct  206  NLTSRFNS  213


 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 7/100 (7%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrss-------srtnresEVPKGHFAVYVGESEKRRFVIPVSYLK  378
            M   M  ILHA + L+  S       S +   + VPKGHFAVYVGE+EK+RFV+P+SYL 
Sbjct  1    MGFRMPSILHAKQILKLQSLLTRSQLSISATTAVVPKGHFAVYVGEAEKKRFVVPISYLN  60

Query  377  NPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            NPSFQ  LS SEEEFGF+HP GG+TIPC E++F+++ S L
Sbjct  61   NPSFQKFLSHSEEEFGFNHPMGGVTIPCKEESFIDLTSRL  100



>ref|XP_006359629.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=85

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHF VY+GE +K+RFVIP+S+L  P FQDLLSQ+EEEFGFDHP GG+TIPC ED F+
Sbjct  18   VPKGHFVVYIGEKQKKRFVIPISFLSQPLFQDLLSQAEEEFGFDHPMGGVTIPCSEDFFV  77

Query  275  EVISSLR  255
            ++ S LR
Sbjct  78   DLTSCLR  84



>gb|EYU40409.1| hypothetical protein MIMGU_mgv1a017192mg [Erythranthe guttata]
Length=89

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVG+S+ +RFV+P+S+L NP FQDLLS++EEEFGF+HP GG+TIPC ED F+
Sbjct  21   VPKGHFAVYVGQSQMKRFVVPLSFLNNPLFQDLLSRAEEEFGFNHPMGGITIPCSEDAFV  80

Query  275  EVISSL  258
            +++S L
Sbjct  81   DLVSRL  86



>ref|XP_009615593.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=85

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE  KRRFVIPV++L  P FQDLLSQ EEEFGFDHP GGLTIP  ED F+
Sbjct  18   VPKGHFAVYVGEKRKRRFVIPVAFLNQPLFQDLLSQVEEEFGFDHPMGGLTIPFSEDVFV  77

Query  275  EVISSLRS  252
            ++ S LR 
Sbjct  78   DLTSRLRK  85



>gb|AFK35784.1| unknown [Lotus japonicus]
Length=101

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGESEK+RFVIPVS L  PSFQ+LLS +EEEFGF HP GGL IPC ED F+
Sbjct  33   VPKGHFAVYVGESEKKRFVIPVSLLIQPSFQELLSIAEEEFGFSHPMGGLIIPCTEDIFV  92

Query  275  EVISSL  258
            EV S L
Sbjct  93   EVTSGL  98



>ref|XP_008237035.1| PREDICTED: auxin-induced protein 15A-like [Prunus mume]
Length=100

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+FAVYVGES+K+RFVIP+SYL  P F DLLSQ EEEFG+DHP GG+TIPC E+TFL
Sbjct  33   IPKGYFAVYVGESQKKRFVIPISYLNEPLFLDLLSQVEEEFGYDHPMGGITIPCSENTFL  92

Query  275  EVISSL  258
            ++IS L
Sbjct  93   DLISRL  98



>ref|XP_009615596.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=85

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGE +K+RFVIP+S+L  P+FQDLLSQ+EEEFGFDHP GG+TIPC +D F+
Sbjct  18   VPKGYFAVYVGEKQKKRFVIPISFLSQPTFQDLLSQAEEEFGFDHPMGGVTIPCSDDIFI  77

Query  275  EVISSLR  255
             + S  R
Sbjct  78   GIASQFR  84



>gb|AFK33527.1| unknown [Lotus japonicus]
Length=100

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGESEK+RFVIPVS L  PSFQ+LLS +EEEFGF HP GGL IPC ED F+
Sbjct  32   VPKGYFAVYVGESEKKRFVIPVSLLNQPSFQELLSAAEEEFGFSHPMGGLIIPCTEDIFV  91

Query  275  EVISSL  258
            EV S L
Sbjct  92   EVASGL  97



>ref|XP_008448001.1| PREDICTED: auxin-induced protein 15A [Cucumis melo]
Length=102

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE++K+RFVIP+ YL +P F+DLL+ +EEEFGFDHPTGGLTIPC ED F+
Sbjct  34   VPKGHFAVYVGETQKKRFVIPIWYLNHPLFKDLLNLAEEEFGFDHPTGGLTIPCTEDYFI  93

Query  275  EVISSLR  255
             + S+L 
Sbjct  94   SLTSALN  100



>ref|XP_010028670.1| PREDICTED: auxin-induced protein 15A-like [Eucalyptus grandis]
 gb|KCW55439.1| hypothetical protein EUGRSUZ_I01341 [Eucalyptus grandis]
Length=96

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI +  I+HA + LR+S         VPKG+ AVYVGE +K+R+ +P+S+L  P FQDL
Sbjct  1    MAIHLSSIMHAKQILRQSLLIGREAVSVPKGYVAVYVGERQKKRYAVPISFLNQPLFQDL  60

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            L ++EEEFGF+HP GGLTIPC EDTF+ + + L
Sbjct  61   LRKAEEEFGFNHPMGGLTIPCTEDTFIALTARL  93



>ref|XP_009619474.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=92

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 69/94 (73%), Gaps = 4/94 (4%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M I M   + AN+ LRRSS+       VPKGH AVYVGES+K+RFV+P+SYL  P FQDL
Sbjct  1    MGIKMTPFIQANRILRRSSTCGG----VPKGHCAVYVGESQKKRFVVPISYLSQPLFQDL  56

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            L+Q+EEEFGFDHP G LTIP  ED F+++ S LR
Sbjct  57   LAQAEEEFGFDHPMGSLTIPIKEDVFVDLTSRLR  90



>ref|XP_008391974.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=101

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGESE++RFVIPVS+L  PSFQ LLS++EEEFGFDHP GGLTIPC +D FL
Sbjct  33   VPKGYFAVYVGESERQRFVIPVSFLNEPSFQKLLSEAEEEFGFDHPMGGLTIPCRQDAFL  92

Query  275  EVISSLRS  252
             + S L +
Sbjct  93   HLTSHLNA  100



>ref|XP_010527467.1| PREDICTED: auxin-induced protein 15A-like [Tarenaya hassleriana]
Length=89

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGE++++RFV+P+S+L  P FQDLL +SEEEFGFDHP GGLTIPC E+TF+
Sbjct  21   VPKGHLAVYVGETQRKRFVVPISFLSQPLFQDLLKKSEEEFGFDHPMGGLTIPCSEETFV  80

Query  275  EVISSLRS  252
            ++ S L S
Sbjct  81   DLTSRLNS  88



>ref|XP_006423537.1| hypothetical protein CICLE_v10029871mg [Citrus clementina]
 gb|ESR36777.1| hypothetical protein CICLE_v10029871mg [Citrus clementina]
Length=100

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 76/97 (78%), Gaps = 4/97 (4%)
 Frame = -3

Query  536  MAISMIHILHANKGLrr----sssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPS  369
            MAI +  I+HA + LR+    +S  T++  +VPKG+ AVYVGE +K+RF+IPVS+L  PS
Sbjct  1    MAIRVPGIMHAKQILRQSKLCASQATSKSVDVPKGYLAVYVGERQKKRFIIPVSFLNQPS  60

Query  368  FQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            FQ+LLS++EEEFGF+HP GGLTIPC E+ F+++ SSL
Sbjct  61   FQELLSKAEEEFGFNHPMGGLTIPCKEEIFIDITSSL  97



>ref|XP_009126238.1| PREDICTED: auxin-induced protein 15A-like [Brassica rapa]
Length=99

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -3

Query  452  PKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLE  273
            PKG  AVYVGES+K+R+V+PVSYL  PSFQ LLS++EEEFGFDHP GGLTIPC EDTF+ 
Sbjct  34   PKGFLAVYVGESQKKRYVVPVSYLSQPSFQALLSKAEEEFGFDHPMGGLTIPCPEDTFIT  93

Query  272  VISSLR  255
            V S L+
Sbjct  94   VTSRLQ  99



>emb|CDY02650.1| BnaC02g07850D [Brassica napus]
Length=99

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -3

Query  452  PKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLE  273
            PKG  AVYVGES+K+R+V+P+SYL  PSFQ LLS+SEEEFGFDHP GGLTIPC EDTF+ 
Sbjct  34   PKGFLAVYVGESQKKRYVVPISYLSQPSFQALLSRSEEEFGFDHPMGGLTIPCPEDTFIS  93

Query  272  VISSLR  255
            + S L+
Sbjct  94   ITSRLQ  99



>dbj|BAA25434.1| SAUR [Raphanus sativus]
Length=95

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  452  PKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLE  273
            PKG  AVYVGES+K+R+V+P+SYL  PSFQ LLS+SEEEFGFDHP GGLTIPC EDTF+ 
Sbjct  31   PKGFLAVYVGESQKKRYVVPISYLSQPSFQALLSKSEEEFGFDHPMGGLTIPCPEDTFIN  90

Query  272  VISSL  258
            V S L
Sbjct  91   VTSRL  95



>gb|KDP27609.1| hypothetical protein JCGZ_19614 [Jatropha curcas]
Length=96

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG  AVY+GE+EK+R+++P+SYL  PSFQDLLS++EEE+GFDHP GGLTIPC EDTF+
Sbjct  28   VPKGFLAVYIGETEKKRYLVPISYLNEPSFQDLLSKAEEEYGFDHPMGGLTIPCGEDTFI  87

Query  275  EVISSL  258
            +V S L
Sbjct  88   DVTSRL  93



>emb|CDP20901.1| unnamed protein product [Coffea canephora]
Length=88

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 6/93 (6%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            MAI +  I+ A + LRRSS        V KG+ AVYVG SEK+RFV+P+SYL  P+FQ+L
Sbjct  1    MAIRLPRIIQAKQILRRSSKD------VLKGYIAVYVGVSEKKRFVVPISYLNQPAFQEL  54

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            LSQ+EEEFGFDHP GGLTIPC ED F++V S L
Sbjct  55   LSQAEEEFGFDHPMGGLTIPCREDKFIDVTSCL  87



>ref|XP_006352412.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=91

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH  VYVGES+K+RFV+P++YL  P F+DLL+Q+EE+FGFDHP GGLTIPC ED F+
Sbjct  24   VPKGHCVVYVGESQKKRFVVPIAYLSQPLFRDLLTQAEEQFGFDHPMGGLTIPCKEDVFV  83

Query  275  EVISSLRS  252
            ++ S LRS
Sbjct  84   DLTSRLRS  91



>ref|XP_007041975.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
 gb|EOX97806.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
Length=94

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE EK+RFV+P+S+LK+ SFQ+LLS++EEE+GF+HP G LTIPC E+ FL
Sbjct  27   VPKGHFAVYVGEVEKKRFVVPISFLKHHSFQNLLSEAEEEYGFNHPMGALTIPCSEEAFL  86

Query  275  EVISSLRS  252
            ++I SL+S
Sbjct  87   DIIGSLQS  94



>ref|XP_010420537.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=92

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  452  PKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLE  273
            PKG  AVYVGES+K+R+++P+SYLK PSFQ LLS+SEEEFGFDHP GGLTIPC EDTF+ 
Sbjct  27   PKGFLAVYVGESQKKRYLVPISYLKQPSFQALLSKSEEEFGFDHPMGGLTIPCPEDTFIN  86

Query  272  VISSLR  255
            V S L+
Sbjct  87   VTSRLQ  92



>ref|XP_007199079.1| hypothetical protein PRUPE_ppa019112mg [Prunus persica]
 gb|EMJ00278.1| hypothetical protein PRUPE_ppa019112mg [Prunus persica]
Length=90

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 68/93 (73%), Gaps = 5/93 (5%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M   +  I+HA K         ++  +VPKG+FAVYVGE EK+RFVIPVSYL  PSFQDL
Sbjct  1    MGFRLPGIVHAKKN-----KVPSKSLDVPKGYFAVYVGEGEKKRFVIPVSYLNQPSFQDL  55

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            L+++E+EFG+DHP G +TIPC E+TFL++ SS 
Sbjct  56   LTRAEDEFGYDHPMGAITIPCSENTFLDLTSSF  88



>ref|XP_010248164.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=97

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVG--ESEKRRFVIPVSYLKNPSFQ  363
            M I +  I+HA   LRRS   +   + VPKGH AVYVG  +++K+RFV+P+SYL +PSFQ
Sbjct  1    MGIRLPGIVHAKALLRRSLLPSTSTANVPKGHVAVYVGDLQTQKKRFVVPISYLSHPSFQ  60

Query  362  DLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            DLL Q+EEEFGF HP GGLTIPC ED FL + S L
Sbjct  61   DLLGQAEEEFGFHHPMGGLTIPCKEDQFLHLTSRL  95



>ref|XP_009615595.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=82

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE +K+RF+IPVS+L  P FQDLLSQ+EEEFGFDHP GG+TIPC  D F 
Sbjct  15   VPKGHFAVYVGEKQKKRFLIPVSFLSQPLFQDLLSQAEEEFGFDHPMGGVTIPCSVDVFT  74

Query  275  EVISSLR  255
            ++ S LR
Sbjct  75   DLTSRLR  81



>ref|XP_008392045.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=101

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+F VYVG+SEK+RFV+P+S L  PSFQDLLS++EEEFG+DHP GG+TIPC +DTFL
Sbjct  33   VPKGYFPVYVGKSEKQRFVVPISILNQPSFQDLLSEAEEEFGYDHPMGGVTIPCRQDTFL  92

Query  275  EVISSLRS  252
            ++IS L +
Sbjct  93   DLISRLSA  100



>gb|ABL97983.1| auxin-induced protein-like [Brassica rapa]
Length=99

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  452  PKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLE  273
            PKG  AVYVGES+K+R+V+P+SYL  PSFQ LLS+SEEEFGFDHP GGLTIPC EDTF+ 
Sbjct  34   PKGFLAVYVGESQKKRYVVPISYLSQPSFQALLSRSEEEFGFDHPMGGLTIPCPEDTFIN  93

Query  272  VISSL  258
            V S L
Sbjct  94   VTSRL  98



>gb|EYU37893.1| hypothetical protein MIMGU_mgv1a023686mg [Erythranthe guttata]
Length=89

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHF VYVGESEK+RFVIP+SYL +P FQ+LL Q+EEEFGF HP GGLTIPC E+ F+
Sbjct  21   VPKGHFVVYVGESEKKRFVIPLSYLNHPLFQELLCQAEEEFGFYHPMGGLTIPCTEELFI  80

Query  275  EVISSLR  255
            +V S LR
Sbjct  81   DVTSHLR  87



>emb|CDY02654.1| BnaC02g07810D [Brassica napus]
Length=98

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
             PKG  AVYVGES+K+R+V+P+SYL  PSFQ LLS+SEEEFGFDHP GGLTIPC EDTF+
Sbjct  32   TPKGFLAVYVGESQKKRYVVPISYLSQPSFQALLSKSEEEFGFDHPMGGLTIPCPEDTFI  91

Query  275  EVISSL  258
             V S L
Sbjct  92   NVTSRL  97



>ref|XP_009770356.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=85

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+FAVYVGE +K+RFVIP+S+L  P+FQDLLSQ+EEEFGF+HP GG+TIPC ED F+
Sbjct  18   VPKGYFAVYVGEKQKKRFVIPISFLSQPTFQDLLSQAEEEFGFEHPMGGVTIPCSEDIFI  77

Query  275  EVISSLR  255
             + S  R
Sbjct  78   GITSQFR  84



>ref|XP_007131725.1| hypothetical protein PHAVU_011G036500g [Phaseolus vulgaris]
 gb|ESW03719.1| hypothetical protein PHAVU_011G036500g [Phaseolus vulgaris]
Length=90

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVG+ EK+RFV+P+SYLK+P F DLL+Q+EEEFGF+HP GGLTIPC ED F+
Sbjct  22   VPKGHVAVYVGDVEKKRFVVPISYLKHPLFLDLLNQAEEEFGFNHPMGGLTIPCKEDAFI  81

Query  275  EVISSLRS  252
             + S +R+
Sbjct  82   NLTSRMRA  89



>gb|EYU37902.1| hypothetical protein MIMGU_mgv1a026564mg [Erythranthe guttata]
Length=88

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVG++EK+RFVIP+SYL +PSFQ+LLS +EEEFGF HPTGGLTIPC ED F+
Sbjct  20   VPKGHLAVYVGQNEKKRFVIPLSYLNHPSFQELLSHAEEEFGFHHPTGGLTIPCSEDVFV  79

Query  275  EVISSL  258
            ++ S L
Sbjct  80   DLTSRL  85



>gb|KGN61887.1| hypothetical protein Csa_2G258830 [Cucumis sativus]
Length=97

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = -3

Query  515  ILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEE  336
            +L+A + L+  +     + +VPKGH AVYVGE +++RFV+P+SYLKNPSF DLL++SEEE
Sbjct  9    LLNAKQILKMQAMSARNQFDVPKGHIAVYVGEIQRKRFVVPISYLKNPSFVDLLNRSEEE  68

Query  335  FGFDHPTGGLTIPCMEDTFLEVISSLRS  252
            FGF HP GGLTIPC ED F+ + + L +
Sbjct  69   FGFCHPMGGLTIPCREDAFINLTARLHT  96



>emb|CDY71365.1| BnaAnng37150D [Brassica napus]
 emb|CDY53263.1| BnaA02g03910D [Brassica napus]
Length=99

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  452  PKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLE  273
            PKG  AVYVGES+K+R+V+P+SYL  PSFQ LLS+SEEEFGFDHP GGLTIPC EDTF+ 
Sbjct  34   PKGFLAVYVGESQKKRYVVPISYLSQPSFQALLSRSEEEFGFDHPMGGLTIPCPEDTFIN  93

Query  272  VISSL  258
            V S L
Sbjct  94   VTSRL  98



>ref|XP_010315346.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
 ref|XP_010315347.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=97

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKGHFAVYVGE +K+RFVIP+S+L  P FQDLLSQ+E+EFGF+HP GG+TIPC ED F+
Sbjct  30   IPKGHFAVYVGEMQKKRFVIPISFLSEPLFQDLLSQAEDEFGFEHPMGGVTIPCSEDLFM  89

Query  275  EVISSLR  255
            ++ S LR
Sbjct  90   DLTSRLR  96



>gb|EYU37886.1| hypothetical protein MIMGU_mgv11b016999mg [Erythranthe guttata]
Length=88

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGESEK+RFVIP+SYL NP FQ+LL Q+E+EFGF HP GGLTIPC E+ F+
Sbjct  20   VPKGHLAVYVGESEKKRFVIPLSYLNNPLFQELLCQAEQEFGFHHPMGGLTIPCSEELFI  79

Query  275  EVISSLR  255
            ++ S LR
Sbjct  80   DLTSHLR  86



>emb|CDY53266.1| BnaA02g03880D [Brassica napus]
Length=98

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -3

Query  452  PKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLE  273
            PKG  AVYVGES+K+R+V+P+SYL  PSFQ LLS+SEEEFGFDHP GGLTIPC EDTF+ 
Sbjct  33   PKGFLAVYVGESQKKRYVVPISYLSQPSFQALLSKSEEEFGFDHPMGGLTIPCPEDTFIN  92

Query  272  VISSLR  255
            V S ++
Sbjct  93   VTSRIQ  98



>emb|CDY02660.1| BnaC02g07750D [Brassica napus]
Length=92

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -3

Query  530  ISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLS  351
            ++++  L   K +  +++     S  PKG  AVY+GES+K+R+V+P+SYL  PSFQ LLS
Sbjct  1    MALVRSLLGAKKILGAATSKRATSASPKGFLAVYIGESQKKRYVVPISYLSQPSFQALLS  60

Query  350  QSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            ++EEEFGFDHP GGLTIPC EDTF+ V S L+
Sbjct  61   KAEEEFGFDHPMGGLTIPCPEDTFITVTSRLQ  92



>ref|XP_002276185.1| PREDICTED: auxin-induced protein X15 [Vitis vinifera]
 emb|CAN65264.1| hypothetical protein VITISV_040131 [Vitis vinifera]
 emb|CBI37959.3| unnamed protein product [Vitis vinifera]
Length=95

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+F+VYVGE +K+RFV+P+SYLKNP+FQ LLSQ+EEEFGFDHP GGLTIPC E+ F+
Sbjct  27   VPKGYFSVYVGEIQKKRFVVPISYLKNPAFQTLLSQAEEEFGFDHPMGGLTIPCTEEAFI  86

Query  275  EVISSLRS  252
             +   L S
Sbjct  87   NLSCYLNS  94



>ref|XP_009799442.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
 ref|XP_009799443.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=145

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RFV+P+SYL  P FQDLL+Q+EEEFGFDH  GGLTIPC ED F+
Sbjct  77   VPKGHCAVYVGESQKKRFVVPISYLSQPLFQDLLAQAEEEFGFDHSMGGLTIPCKEDMFV  136

Query  275  EVISSLR  255
            ++ S LR
Sbjct  137  DLTSRLR  143



>ref|XP_008237099.1| PREDICTED: auxin-induced protein 15A-like [Prunus mume]
Length=128

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+FAVYVGES+K+RFVIPVSYL  P F DLLSQ+EEEFG+DHP GG+TIPC E+TFL
Sbjct  32   IPKGYFAVYVGESQKKRFVIPVSYLNEPLFLDLLSQAEEEFGYDHPMGGITIPCSENTFL  91

Query  275  EVISSL  258
            ++ S L
Sbjct  92   DLTSRL  97



>ref|XP_007041974.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
 gb|EOX97805.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
Length=95

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDL  357
            M   ++ I+ A +GL+R+ S +     VPKGHF VY+GE+EK+RFV+P+S LK+PSFQ+L
Sbjct  1    MGFRLLRIVSAKQGLKRTLSFSETTP-VPKGHFTVYIGEAEKKRFVVPISLLKDPSFQNL  59

Query  356  LSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLR  255
            L Q+EEE+GF+HP G LTIPC E+ F+++  SL+
Sbjct  60   LRQAEEEYGFNHPMGALTIPCSEEAFIDLTCSLQ  93



>ref|XP_004172954.1| PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]
Length=100

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+F VYVGE +K+RFVIP+SYL  PSFQDLLSQSEEEFG++HP GG+TIPC ED FL
Sbjct  32   VPKGYFTVYVGEEQKKRFVIPLSYLNQPSFQDLLSQSEEEFGYNHPMGGITIPCSEDCFL  91

Query  275  EVISSL  258
            +V   L
Sbjct  92   DVTERL  97



>gb|EYU40728.1| hypothetical protein MIMGU_mgv1a022834mg, partial [Erythranthe 
guttata]
Length=75

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGESEK+RFVIP+SYL +PSFQDLL ++EEEFGF HP GGLTIPC ED F+
Sbjct  7    VPKGHLAVYVGESEKKRFVIPLSYLNHPSFQDLLCRAEEEFGFHHPMGGLTIPCSEDLFV  66

Query  275  EVISSL  258
            ++ S L
Sbjct  67   DLTSHL  72



>ref|XP_006494594.1| PREDICTED: auxin-induced protein 10A5-like [Citrus sinensis]
Length=100

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+ AVYVGES+K+RFVIP S L  PSFQ+LLS++EEEFGF+HP GGLTIPC EDTF+
Sbjct  32   VPKGYLAVYVGESQKKRFVIPASLLSQPSFQELLSKAEEEFGFNHPMGGLTIPCREDTFI  91

Query  275  EVISSLRS  252
             + SSL +
Sbjct  92   NLTSSLSA  99



>ref|XP_010315354.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=82

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKGHF VYVGE +K+RFVIP+S+L  P FQDLL+Q+EEEFGFDHP GG+TIPC ED F+
Sbjct  15   IPKGHFVVYVGEKQKKRFVIPISFLSEPLFQDLLNQAEEEFGFDHPMGGVTIPCTEDLFV  74

Query  275  EVISSLRS  252
             + S LR 
Sbjct  75   NLTSRLRK  82



>ref|XP_006352411.1| PREDICTED: auxin-induced protein X15-like [Solanum tuberosum]
Length=91

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RF +P+SYL  P FQDLL+Q+EE+FGFDH  GGLTIPC ED F+
Sbjct  24   VPKGHCAVYVGESQKKRFFVPISYLSQPLFQDLLTQAEEQFGFDHQMGGLTIPCKEDVFV  83

Query  275  EVISSLRS  252
             +IS LRS
Sbjct  84   YLISRLRS  91



>ref|XP_006362802.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=91

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGES+K+RFV+P+SYL  P FQDLL+Q+EE+FGFDH  GGLTIPC ED F+
Sbjct  24   VPKGHCAVYVGESQKKRFVVPISYLSQPLFQDLLTQAEEQFGFDHQMGGLTIPCKEDVFV  83

Query  275  EVISSLR  255
            ++ S LR
Sbjct  84   DLTSRLR  90



>emb|CDP18416.1| unnamed protein product [Coffea canephora]
Length=102

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 71/97 (73%), Gaps = 4/97 (4%)
 Frame = -3

Query  536  MAISMIHILHA----NKGLrrsssrtnresEVPKGHFAVYVGESEKRRFVIPVSYLKNPS  369
            MAI +  I+ A     + +  S++  +   +VP+G+ AVYVGE+EK+RFVIPV+YL   +
Sbjct  1    MAIRLPLIIQAKQILRRSILTSNAAISASVDVPRGYLAVYVGENEKKRFVIPVAYLNESA  60

Query  368  FQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSL  258
            FQ+LLSQ+EEEFGFDHP GGLTIPC ED F+++ S L
Sbjct  61   FQELLSQAEEEFGFDHPMGGLTIPCREDMFIDLTSRL  97



>gb|KGN43203.1| hypothetical protein Csa_7G008990 [Cucumis sativus]
Length=100

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKG+F VYVGE +K+RFVIP+SYL  PSFQDLLSQSEEEFG++HP GG+TIPC ED FL
Sbjct  32   VPKGYFTVYVGEEQKKRFVIPLSYLNQPSFQDLLSQSEEEFGYNHPMGGITIPCSEDCFL  91

Query  275  EVISSL  258
            +V   L
Sbjct  92   DVTERL  97



>ref|XP_006289998.1| hypothetical protein CARUB_v10003628mg [Capsella rubella]
 gb|EOA22896.1| hypothetical protein CARUB_v10003628mg [Capsella rubella]
Length=90

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
             PKG  AVYVGES+K+R+++PVSYL  PSFQ LLS+SEEEFGFDHP GGLTIPC EDTF+
Sbjct  24   APKGFLAVYVGESQKKRYLVPVSYLNQPSFQALLSKSEEEFGFDHPMGGLTIPCPEDTFI  83

Query  275  EVISSLR  255
             V S L+
Sbjct  84   NVTSRLQ  90



>ref|XP_004289828.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Fragaria 
vesca subsp. vesca]
Length=102

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 71/101 (70%), Gaps = 6/101 (6%)
 Frame = -3

Query  536  MAISMIHILHANKGLrrsssrtnresE------VPKGHFAVYVGESEKRRFVIPVSYLKN  375
            M I ++ I HA + L+R+ S             VPKGHFAVYVGE +K+RFVIP+SYL +
Sbjct  1    MGIKLMGIAHAKQKLQRTLSARLGAITDTNGIDVPKGHFAVYVGEGKKKRFVIPISYLNH  60

Query  374  PSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLEVISSLRS  252
            P F DLL++++EEFG+DHPTGGL IPC ED F+ + S+L S
Sbjct  61   PLFLDLLNKAQEEFGYDHPTGGLIIPCSEDYFITLTSALNS  101



>gb|EYU40724.1| hypothetical protein MIMGU_mgv1a024905mg, partial [Erythranthe 
guttata]
Length=70

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGH AVYVGESEK+RFVIP+SYL +PSFQDLL ++EEEFGF HP GGLTIPC ED F+
Sbjct  2    VPKGHLAVYVGESEKKRFVIPLSYLNHPSFQDLLCRAEEEFGFHHPMGGLTIPCSEDLFV  61

Query  275  EVISSL  258
            ++ S L
Sbjct  62   DLTSHL  67



>ref|XP_009764193.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=83

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGE +K R VIP+S+L  P+FQDLLSQ+EEE GFDHP GGLTIPC ED F+
Sbjct  16   VPKGHFAVYVGEKQKNRCVIPISFLSQPAFQDLLSQAEEEVGFDHPMGGLTIPCSEDFFV  75

Query  275  EVISSLR  255
            ++ S LR
Sbjct  76   DLTSRLR  82



>ref|XP_006286648.1| hypothetical protein CARUB_v10002518mg [Capsella rubella]
 gb|EOA19546.1| hypothetical protein CARUB_v10002518mg [Capsella rubella]
Length=90

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
             PKG  AVYVGES+K+R+++PVSYL  PSFQ LLS+SEEEFGFDHP GGLTIPC EDTF+
Sbjct  24   APKGFLAVYVGESQKKRYLVPVSYLNQPSFQALLSKSEEEFGFDHPMGGLTIPCPEDTFI  83

Query  275  EVISSLR  255
             V S L+
Sbjct  84   NVTSRLQ  90



>ref|XP_009368357.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus 
x bretschneideri]
 ref|XP_009347326.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus 
x bretschneideri]
Length=99

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +PKG+FAVYVGE +K+RFVIP+SYL +P FQDLLSQ+EEEFG+DHP GG+TIPC E TFL
Sbjct  32   IPKGYFAVYVGERQKKRFVIPISYLNDPLFQDLLSQAEEEFGYDHPMGGITIPCSEYTFL  91

Query  275  EVISSL  258
             + S L
Sbjct  92   HLTSRL  97



>ref|XP_008237032.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Prunus 
mume]
Length=100

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            +P+G+FAVYVGES+K+RFVIPVSYL  P F DLLSQ+EEEFG+DHP GG+TIPC EDTFL
Sbjct  33   IPRGYFAVYVGESQKKRFVIPVSYLNEPLFLDLLSQAEEEFGYDHPMGGITIPCSEDTFL  92

Query  275  EVISSL  258
             + S L
Sbjct  93   HLTSCL  98



>gb|EYU37898.1| hypothetical protein MIMGU_mgv1a019710mg, partial [Erythranthe 
guttata]
Length=68

 Score =   107 bits (266),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  452  PKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFLE  273
            PKGHF VYVGESEK+RFVIP+SYL NP FQ+LL Q+EEEFGF HP GGLTIPC E+ F++
Sbjct  1    PKGHFTVYVGESEKKRFVIPLSYLNNPLFQELLCQAEEEFGFYHPMGGLTIPCTEELFID  60

Query  272  VISSLRS  252
            V S LR 
Sbjct  61   VTSHLRK  67



>ref|XP_010492794.1| PREDICTED: auxin-induced protein X10A-like [Camelina sativa]
Length=86

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
             PKG  AVYVGES+K+R+++PVSYL  PSFQ LLS+SEEEFGFDHP GGLTIPC EDTF+
Sbjct  20   APKGFLAVYVGESQKKRYLVPVSYLNQPSFQALLSKSEEEFGFDHPMGGLTIPCPEDTFI  79

Query  275  EVISSLR  255
             V S L+
Sbjct  80   NVTSRLQ  86



>ref|XP_010028671.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Eucalyptus 
grandis]
 gb|KCW55441.1| hypothetical protein EUGRSUZ_I01343 [Eucalyptus grandis]
Length=91

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHF VYVGE++K+RF++P+SYL  PSFQDLLSQ+EEEFGFDHP GGLTIPC E+ FL
Sbjct  27   VPKGHFPVYVGENQKKRFIVPLSYLSRPSFQDLLSQAEEEFGFDHPMGGLTIPCNEEVFL  86

Query  275  EVI  267
             +I
Sbjct  87   SLI  89



>gb|EYU37888.1| hypothetical protein MIMGU_mgv1a023157mg [Erythranthe guttata]
Length=83

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -3

Query  455  VPKGHFAVYVGESEKRRFVIPVSYLKNPSFQDLLSQSEEEFGFDHPTGGLTIPCMEDTFL  276
            VPKGHFAVYVGESEK+RFVIP+SYL NPSFQ+LL Q+EEEFGF H  GGLTIPC E+ F+
Sbjct  15   VPKGHFAVYVGESEKKRFVIPLSYLNNPSFQELLCQTEEEFGFHHSMGGLTIPCTEELFI  74

Query  275  EVISSL  258
            ++ + L
Sbjct  75   DLTAYL  80



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 717231537738