BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25402_g4_i2 len=1019 path=[1201:0-510 1712:511-571 1773:572-595
1797:596-622 1824:623-657 1859:658-658 1860:659-685 10986:686-706
1908:707-733 1935:734-754 11020:755-759 11025:760-766 11032:767-768
11034:769-770 11036:771-782 11048:783-788 11054:789-796
11062:797-798 11064:799-819 11085:820-822 11088:823-837
11103:838-838 2040:839-839 1061:840-873 7477:874-887 11182:888-895
11190:896-906 11201:907-919 8987:920-1018]

Length=1019
                                                                      Score     E

ref|XP_002306150.1|  hypothetical protein POPTR_0004s17180g             130   1e-33   Populus trichocarpa [western balsam poplar]
ref|XP_008448014.1|  PREDICTED: auxin-induced protein 15A-like          129   6e-33   
ref|XP_004172954.1|  PREDICTED: auxin-induced protein X10A-like         128   1e-32   
ref|XP_004300216.1|  PREDICTED: indole-3-acetic acid-induced prot...    127   1e-32   
ref|XP_008448016.1|  PREDICTED: auxin-induced protein 15A-like          127   2e-32   
ref|XP_008448015.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    127   3e-32   
gb|KGN43203.1|  hypothetical protein Csa_7G008990                       127   3e-32   
ref|XP_004173149.1|  PREDICTED: auxin-induced protein X10A-like         126   4e-32   
ref|XP_004162911.1|  PREDICTED: auxin-induced protein X10A-like         126   4e-32   
ref|XP_006423551.1|  hypothetical protein CICLE_v10029685mg             126   6e-32   
emb|CDO96970.1|  unnamed protein product                                125   1e-31   
ref|XP_008237080.1|  PREDICTED: auxin-induced protein 15A-like          125   1e-31   
ref|XP_008448013.1|  PREDICTED: auxin-induced protein 15A-like          125   2e-31   
ref|XP_004309347.1|  PREDICTED: indole-3-acetic acid-induced prot...    125   2e-31   
ref|XP_007200097.1|  hypothetical protein PRUPE_ppa019366mg             125   2e-31   
ref|XP_003523506.1|  PREDICTED: indole-3-acetic acid-induced prot...    124   2e-31   
emb|CDP15258.1|  unnamed protein product                                126   2e-31   
ref|XP_004301662.1|  PREDICTED: uncharacterized protein LOC101295922    127   2e-31   
gb|KDP27614.1|  hypothetical protein JCGZ_19619                         124   3e-31   
gb|EYU18551.1|  hypothetical protein MIMGU_mgv1a018365mg                123   4e-31   
ref|XP_002276058.2|  PREDICTED: auxin-induced protein X15               124   4e-31   Vitis vinifera
gb|EYU35299.1|  hypothetical protein MIMGU_mgv1a019900mg                123   4e-31   
emb|CDP20901.1|  unnamed protein product                                123   5e-31   
emb|CDO96969.1|  unnamed protein product                                124   6e-31   
gb|EYU37887.1|  hypothetical protein MIMGU_mgv1a022037mg                123   6e-31   
emb|CBI37960.3|  unnamed protein product                                123   6e-31   
emb|CDP18416.1|  unnamed protein product                                123   7e-31   
ref|XP_002306153.1|  hypothetical protein POPTR_0004s17280g             122   8e-31   Populus trichocarpa [western balsam poplar]
ref|XP_011088527.1|  PREDICTED: auxin-induced protein 15A-like          122   9e-31   
ref|XP_004293889.1|  PREDICTED: indole-3-acetic acid-induced prot...    123   9e-31   
ref|XP_007041989.1|  SAUR family protein                                123   9e-31   
ref|XP_002271501.1|  PREDICTED: auxin-induced protein X15               122   9e-31   Vitis vinifera
ref|XP_002272231.1|  PREDICTED: auxin-induced protein X15-like          122   1e-30   Vitis vinifera
ref|XP_007135904.1|  hypothetical protein PHAVU_009G001600g             122   1e-30   
ref|XP_011047001.1|  PREDICTED: indole-3-acetic acid-induced prot...    122   1e-30   
ref|XP_003527610.1|  PREDICTED: auxin-induced protein 10A5-like         122   1e-30   
ref|XP_007041971.1|  SAUR-like auxin-responsive protein family, p...    122   1e-30   
gb|EYU37897.1|  hypothetical protein MIMGU_mgv11b017186mg               122   1e-30   
ref|XP_009347325.1|  PREDICTED: indole-3-acetic acid-induced prot...    122   1e-30   
ref|XP_009760902.1|  PREDICTED: auxin-induced protein 15A-like          122   1e-30   
ref|XP_009766735.1|  PREDICTED: auxin-induced protein 15A-like          122   2e-30   
ref|XP_002276227.1|  PREDICTED: auxin-induced protein 15A               122   2e-30   Vitis vinifera
ref|XP_003631553.1|  PREDICTED: auxin-induced protein X15-like          122   2e-30   
ref|XP_006384539.1|  hypothetical protein POPTR_0004s17250g             122   2e-30   
ref|XP_004170628.1|  PREDICTED: auxin-induced protein 6B-like           122   2e-30   
emb|CBI37962.3|  unnamed protein product                                123   2e-30   
ref|XP_004301667.1|  PREDICTED: uncharacterized protein LOC101297356    125   2e-30   
ref|XP_006423541.1|  hypothetical protein CICLE_v10030014mg             122   2e-30   
ref|XP_004301666.1|  PREDICTED: uncharacterized protein LOC101297064    125   2e-30   
ref|XP_007041974.1|  SAUR-like auxin-responsive protein family, p...    121   3e-30   
ref|XP_009799442.1|  PREDICTED: auxin-induced protein 15A-like          123   3e-30   
ref|XP_006487294.1|  PREDICTED: auxin-induced protein 10A5-like         121   3e-30   
ref|XP_003631579.1|  PREDICTED: auxin-induced protein X15               121   3e-30   
ref|XP_004144906.1|  PREDICTED: auxin-induced protein X10A-like         121   3e-30   
ref|XP_007135905.1|  hypothetical protein PHAVU_009G001700g             121   3e-30   
ref|XP_002312994.1|  auxin-responsive family protein                    121   3e-30   Populus trichocarpa [western balsam poplar]
gb|EYU37894.1|  hypothetical protein MIMGU_mgv1a020073mg                121   3e-30   
ref|XP_002312996.1|  hypothetical protein POPTR_0009s12950g             121   4e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008237099.1|  PREDICTED: auxin-induced protein 15A-like          122   4e-30   
ref|XP_006423537.1|  hypothetical protein CICLE_v10029871mg             121   4e-30   
ref|XP_002271427.1|  PREDICTED: auxin-induced protein 15A               121   4e-30   Vitis vinifera
ref|XP_010246391.1|  PREDICTED: auxin-induced protein 15A-like          121   4e-30   
ref|XP_010649243.1|  PREDICTED: auxin-induced protein 15A               121   4e-30   
gb|KDO46704.1|  hypothetical protein CISIN_1g036136mg                   121   5e-30   
ref|XP_002312998.1|  hypothetical protein POPTR_0009s12930g             120   5e-30   Populus trichocarpa [western balsam poplar]
ref|XP_007201447.1|  hypothetical protein PRUPE_ppa013863mg             120   5e-30   
ref|XP_006362802.1|  PREDICTED: auxin-induced protein 15A-like          120   6e-30   
ref|XP_008360591.1|  PREDICTED: auxin-induced protein 15A-like          120   6e-30   
ref|XP_009592061.1|  PREDICTED: auxin-induced protein 15A-like          120   6e-30   
ref|XP_007041977.1|  SAUR-like auxin-responsive protein family, p...    120   7e-30   
ref|XP_006487310.1|  PREDICTED: auxin-induced protein X10A-like         120   7e-30   
ref|XP_002271620.1|  PREDICTED: auxin-induced protein 15A               120   7e-30   Vitis vinifera
ref|XP_009368350.1|  PREDICTED: auxin-induced protein 15A-like          120   7e-30   
ref|XP_011088521.1|  PREDICTED: auxin-induced protein 15A-like          120   7e-30   
gb|EYU37888.1|  hypothetical protein MIMGU_mgv1a023157mg                120   8e-30   
ref|XP_007041975.1|  SAUR-like auxin-responsive protein family, p...    120   8e-30   
ref|XP_010315356.1|  PREDICTED: auxin-induced protein 15A-like          120   8e-30   
ref|XP_010095660.1|  hypothetical protein L484_012231                   120   8e-30   
ref|XP_006423540.1|  hypothetical protein CICLE_v10029650mg             120   8e-30   
ref|XP_004151832.1|  PREDICTED: auxin-induced protein X10A-like         120   8e-30   
ref|XP_010246392.1|  PREDICTED: auxin-induced protein 15A-like          120   8e-30   
gb|EYU18549.1|  hypothetical protein MIMGU_mgv1a023719mg                120   9e-30   
ref|XP_008391973.1|  PREDICTED: auxin-induced protein 15A-like          120   9e-30   
ref|XP_009368374.1|  PREDICTED: auxin-induced protein 15A-like          120   9e-30   
ref|XP_006423549.1|  hypothetical protein CICLE_v10030017mg             120   9e-30   
gb|EYU35291.1|  hypothetical protein MIMGU_mgv1a017210mg                119   1e-29   
ref|XP_009620278.1|  PREDICTED: auxin-induced protein 15A-like          119   1e-29   
ref|XP_004144905.1|  PREDICTED: indole-3-acetic acid-induced prot...    120   1e-29   
ref|XP_009592053.1|  PREDICTED: auxin-induced protein 15A-like          120   1e-29   
ref|XP_008372889.1|  PREDICTED: auxin-induced protein 15A-like          119   1e-29   
ref|XP_004290376.1|  PREDICTED: indole-3-acetic acid-induced prot...    119   1e-29   
ref|XP_009368370.1|  PREDICTED: auxin-induced protein 15A-like          120   1e-29   
ref|XP_010649235.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    123   1e-29   
ref|XP_009347320.1|  PREDICTED: auxin-induced protein 15A-like          119   1e-29   
ref|XP_010271400.1|  PREDICTED: auxin-induced protein 6B-like           119   1e-29   
ref|XP_004290377.1|  PREDICTED: indole-3-acetic acid-induced prot...    119   1e-29   
ref|XP_003631580.1|  PREDICTED: auxin-induced protein 15A               119   1e-29   
ref|XP_009368356.1|  PREDICTED: indole-3-acetic acid-induced prot...    119   1e-29   
ref|XP_003522807.1|  PREDICTED: auxin-induced protein 10A5-like         120   1e-29   
ref|XP_008392045.1|  PREDICTED: auxin-induced protein 15A-like          119   1e-29   
ref|XP_002306151.1|  hypothetical protein POPTR_0004s17190g             119   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_004173148.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    119   2e-29   
ref|XP_002271594.1|  PREDICTED: auxin-induced protein 15A-like          119   2e-29   Vitis vinifera
ref|XP_010647407.1|  PREDICTED: auxin-induced protein X15-like          119   2e-29   
gb|KGN43205.1|  hypothetical protein Csa_7G009010                       119   2e-29   
gb|KDP27620.1|  hypothetical protein JCGZ_19625                         119   2e-29   
gb|EYU40725.1|  hypothetical protein MIMGU_mgv1a017774mg                119   3e-29   
ref|XP_010271401.1|  PREDICTED: uncharacterized protein LOC104607462    122   3e-29   
ref|XP_010108330.1|  hypothetical protein L484_000421                   119   3e-29   
ref|XP_010649236.1|  PREDICTED: auxin-induced protein 15A-like          119   3e-29   
emb|CBI17628.3|  unnamed protein product                                118   3e-29   
gb|EYU35280.1|  hypothetical protein MIMGU_mgv1a023363mg                118   3e-29   
ref|XP_002276250.1|  PREDICTED: auxin-induced protein X15               118   3e-29   Vitis vinifera
ref|XP_002306157.1|  hypothetical protein POPTR_0004s17300g             118   3e-29   Populus trichocarpa [western balsam poplar]
ref|XP_009793415.1|  PREDICTED: auxin-induced protein 15A-like          118   3e-29   
gb|EYU35301.1|  hypothetical protein MIMGU_mgv1a023166mg                118   3e-29   
ref|XP_002271891.1|  PREDICTED: auxin-induced protein 15A               118   4e-29   Vitis vinifera
ref|XP_009358224.1|  PREDICTED: auxin-induced protein 15A-like          119   4e-29   
gb|EYU35277.1|  hypothetical protein MIMGU_mgv1a023478mg                118   4e-29   
ref|XP_009368357.1|  PREDICTED: indole-3-acetic acid-induced prot...    118   4e-29   
ref|XP_002272387.1|  PREDICTED: auxin-induced protein 15A-like          118   4e-29   Vitis vinifera
gb|KDP27603.1|  hypothetical protein JCGZ_19608                         118   5e-29   
gb|EYU35281.1|  hypothetical protein MIMGU_mgv11b014396mg               118   5e-29   
ref|XP_008237039.1|  PREDICTED: auxin-induced protein 15A-like          118   5e-29   
ref|XP_007201545.1|  hypothetical protein PRUPE_ppa017462mg             118   5e-29   
ref|XP_004300228.1|  PREDICTED: indole-3-acetic acid-induced prot...    118   5e-29   
gb|EYU35271.1|  hypothetical protein MIMGU_mgv1a020811mg                117   5e-29   
gb|EYU35300.1|  hypothetical protein MIMGU_mgv1a018533mg                118   5e-29   
ref|XP_008236177.1|  PREDICTED: auxin-induced protein 15A               118   6e-29   
gb|EYU40730.1|  hypothetical protein MIMGU_mgv1a023017mg                118   6e-29   
emb|CAN70455.1|  hypothetical protein VITISV_035059                     118   6e-29   Vitis vinifera
ref|XP_009379575.1|  PREDICTED: auxin-induced protein 15A-like          118   6e-29   
gb|AFK33527.1|  unknown                                                 118   6e-29   
gb|KFK41731.1|  hypothetical protein AALP_AA2G165400                    117   6e-29   
ref|XP_011037241.1|  PREDICTED: uncharacterized protein LOC105134501    120   7e-29   
ref|XP_008363801.1|  PREDICTED: indole-3-acetic acid-induced prot...    118   7e-29   
ref|XP_004144907.1|  PREDICTED: auxin-induced protein X10A-like         117   7e-29   
ref|XP_002306152.1|  hypothetical protein POPTR_0004s17230g             117   7e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010108331.1|  hypothetical protein L484_000422                   117   8e-29   
ref|XP_010647509.1|  PREDICTED: auxin-induced protein X15               117   8e-29   
gb|KHN20021.1|  Indole-3-acetic acid-induced protein ARG7               117   8e-29   
ref|XP_010315343.1|  PREDICTED: auxin-induced protein 15A-like          117   8e-29   
gb|EYU35287.1|  hypothetical protein MIMGU_mgv1a017212mg                117   8e-29   
gb|EYU37892.1|  hypothetical protein MIMGU_mgv1a019362mg                117   8e-29   
ref|XP_010244080.1|  PREDICTED: auxin-induced protein 15A-like          117   8e-29   
ref|XP_008369486.1|  PREDICTED: auxin-induced protein 15A-like          117   8e-29   
ref|XP_010112285.1|  hypothetical protein L484_014967                   117   8e-29   
ref|NP_001235363.1|  uncharacterized protein LOC100306459               117   9e-29   
ref|XP_009766736.1|  PREDICTED: auxin-induced protein 15A-like          117   9e-29   
gb|EYU37891.1|  hypothetical protein MIMGU_mgv1a023887mg                117   9e-29   
gb|KDP27616.1|  hypothetical protein JCGZ_19621                         117   9e-29   
ref|XP_009379588.1|  PREDICTED: auxin-induced protein 15A-like          117   9e-29   
ref|XP_010271572.1|  PREDICTED: auxin-induced protein 15A-like          117   1e-28   
ref|XP_011088523.1|  PREDICTED: uncharacterized protein LOC105169727    119   1e-28   
ref|XP_007199401.1|  hypothetical protein PRUPE_ppa026172mg             117   1e-28   
gb|EYU23191.1|  hypothetical protein MIMGU_mgv1a020984mg                117   1e-28   
ref|XP_011088529.1|  PREDICTED: auxin-induced protein 15A-like          117   1e-28   
ref|XP_009764192.1|  PREDICTED: auxin-induced protein 15A-like          117   1e-28   
ref|XP_004230984.1|  PREDICTED: auxin-induced protein 15A-like          117   1e-28   
ref|XP_004250224.1|  PREDICTED: auxin-induced protein X15-like          117   1e-28   
ref|XP_009770355.1|  PREDICTED: auxin-induced protein 15A-like          117   1e-28   
emb|CDY38475.1|  BnaA10g16830D                                          117   1e-28   
ref|XP_002306156.1|  hypothetical protein POPTR_0004s17290g             117   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006352409.1|  PREDICTED: auxin-induced protein 15A-like          117   1e-28   
ref|XP_009793414.1|  PREDICTED: auxin-induced protein 15A-like          117   1e-28   
gb|AFK35784.1|  unknown                                                 117   1e-28   
ref|XP_008237037.1|  PREDICTED: indole-3-acetic acid-induced prot...    117   1e-28   
gb|EYU35303.1|  hypothetical protein MIMGU_mgv1a018888mg                116   1e-28   
gb|EYU35297.1|  hypothetical protein MIMGU_mgv1a021816mg                116   1e-28   
ref|XP_002271793.1|  PREDICTED: auxin-induced protein X15               117   1e-28   Vitis vinifera
ref|XP_010271402.1|  PREDICTED: auxin-induced protein X10A-like         117   2e-28   
ref|XP_008365898.1|  PREDICTED: auxin-induced protein 15A-like          117   2e-28   
gb|EYU37893.1|  hypothetical protein MIMGU_mgv1a023686mg                116   2e-28   
ref|XP_006359630.1|  PREDICTED: auxin-induced protein 15A-like          116   2e-28   
ref|XP_010312723.1|  PREDICTED: auxin-induced protein 15A-like          116   2e-28   
ref|XP_008236815.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    120   2e-28   
ref|XP_004290370.1|  PREDICTED: uncharacterized protein LOC101293834    120   2e-28   
ref|XP_002271395.1|  PREDICTED: auxin-induced protein 15A               117   2e-28   Vitis vinifera
gb|EYU37886.1|  hypothetical protein MIMGU_mgv11b016999mg               116   2e-28   
emb|CDX94145.1|  BnaC07g37790D                                          116   2e-28   
ref|XP_010315351.1|  PREDICTED: auxin-induced protein 15A-like          116   2e-28   
ref|XP_006487311.1|  PREDICTED: auxin-induced protein X15-like          116   2e-28   
ref|XP_010271569.1|  PREDICTED: auxin-induced protein 15A-like          117   2e-28   
ref|XP_008358419.1|  PREDICTED: indole-3-acetic acid-induced prot...    116   2e-28   
ref|XP_002306149.1|  hypothetical protein POPTR_0004s17170g             116   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_008448010.1|  PREDICTED: auxin-induced protein 15A-like          116   2e-28   
gb|EYU37895.1|  hypothetical protein MIMGU_mgv11b017820mg               116   2e-28   
gb|EYU37903.1|  hypothetical protein MIMGU_mgv1a022749mg                116   2e-28   
ref|XP_010246393.1|  PREDICTED: auxin-induced protein 15A-like          116   2e-28   
ref|XP_006359618.1|  PREDICTED: auxin-induced protein 15A-like          116   2e-28   
ref|XP_011088530.1|  PREDICTED: auxin-induced protein 15A-like          116   2e-28   
ref|XP_006352413.1|  PREDICTED: auxin-induced protein 15A-like          116   2e-28   
ref|XP_009379590.1|  PREDICTED: auxin-induced protein 15A-like          116   2e-28   
ref|XP_007200204.1|  hypothetical protein PRUPE_ppa015749mg             116   2e-28   
ref|XP_006352411.1|  PREDICTED: auxin-induced protein X15-like          116   3e-28   
ref|XP_002313000.1|  hypothetical protein POPTR_0009s12910g             116   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006487295.1|  PREDICTED: auxin-induced protein 10A5-like         116   3e-28   
ref|XP_008348904.1|  PREDICTED: indole-3-acetic acid-induced prot...    116   3e-28   
gb|KGN61876.1|  hypothetical protein Csa_2G258720                       116   3e-28   
ref|XP_007041973.1|  SAUR-like auxin-responsive protein family, p...    115   3e-28   
gb|KDP34544.1|  hypothetical protein JCGZ_11094                         116   3e-28   
ref|XP_009619474.1|  PREDICTED: auxin-induced protein 15A-like          115   3e-28   
ref|XP_008237036.1|  PREDICTED: indole-3-acetic acid-induced prot...    115   3e-28   
ref|XP_010246416.1|  PREDICTED: auxin-induced protein 15A-like          116   3e-28   
ref|XP_010255168.1|  PREDICTED: uncharacterized protein LOC104595902    119   3e-28   
ref|XP_010028670.1|  PREDICTED: auxin-induced protein 15A-like          115   3e-28   
emb|CDO96966.1|  unnamed protein product                                115   3e-28   
emb|CBI17626.3|  unnamed protein product                                115   3e-28   
ref|XP_002271660.2|  PREDICTED: uncharacterized protein LOC100252964    119   3e-28   Vitis vinifera
ref|XP_008457635.1|  PREDICTED: auxin-induced protein 15A-like          115   4e-28   
ref|XP_002276412.1|  PREDICTED: auxin-induced protein 15A               115   4e-28   Vitis vinifera
ref|XP_010526566.1|  PREDICTED: auxin-induced protein X15               115   4e-28   
ref|XP_007200851.1|  hypothetical protein PRUPE_ppa026539mg             115   4e-28   
ref|XP_007135906.1|  hypothetical protein PHAVU_009G001800g             115   4e-28   
gb|EYU37890.1|  hypothetical protein MIMGU_mgv1a022439mg                115   4e-28   
gb|AAM12778.1|  auxin-induced SAUR-like protein                         115   4e-28   Capsicum annuum
ref|XP_010536039.1|  PREDICTED: auxin-induced protein 15A-like          115   4e-28   
ref|XP_010649241.1|  PREDICTED: auxin-induced protein 15A               115   4e-28   
ref|XP_006352406.1|  PREDICTED: auxin-induced protein 15A-like          115   4e-28   
gb|EYU35286.1|  hypothetical protein MIMGU_mgv1a024807mg                115   4e-28   
ref|XP_009368351.1|  PREDICTED: auxin-induced protein 15A-like          115   4e-28   
ref|XP_004250217.1|  PREDICTED: auxin-induced protein X15-like          115   5e-28   
gb|KGN43199.1|  hypothetical protein Csa_7G008460                       115   5e-28   
ref|XP_007041987.1|  SAUR-like auxin-responsive protein family          115   5e-28   
ref|XP_007041976.1|  SAUR-like auxin-responsive protein family, p...    115   5e-28   
gb|EYU35272.1|  hypothetical protein MIMGU_mgv1a023235mg                115   5e-28   
ref|XP_009379573.1|  PREDICTED: indole-3-acetic acid-induced prot...    115   5e-28   
ref|XP_009347322.1|  PREDICTED: auxin-induced protein 15A-like          115   5e-28   
ref|XP_010246394.1|  PREDICTED: auxin-induced protein 15A-like          115   5e-28   
ref|XP_002276271.1|  PREDICTED: auxin-induced protein 15A               115   5e-28   Vitis vinifera
gb|KGN43200.1|  hypothetical protein Csa_7G008960                       115   5e-28   
ref|XP_009379591.1|  PREDICTED: auxin-induced protein 15A-like          115   5e-28   
gb|EYU40409.1|  hypothetical protein MIMGU_mgv1a017192mg                115   5e-28   
emb|CBI17636.3|  unnamed protein product                                115   6e-28   
gb|KDP34553.1|  hypothetical protein JCGZ_11103                         115   6e-28   
ref|XP_006423553.1|  hypothetical protein CICLE_v10029881mg             115   6e-28   
ref|XP_010246396.1|  PREDICTED: auxin-induced protein 15A-like          115   6e-28   
emb|CDY25469.1|  BnaC09g39840D                                          115   6e-28   
emb|CDY25466.1|  BnaC09g39810D                                          115   6e-28   
emb|CAN79758.1|  hypothetical protein VITISV_009898                     114   6e-28   Vitis vinifera
ref|XP_002271464.1|  PREDICTED: auxin-induced protein 15A               115   6e-28   Vitis vinifera
gb|EYU40723.1|  hypothetical protein MIMGU_mgv1a024510mg                114   6e-28   
ref|XP_008391976.1|  PREDICTED: auxin-induced protein 15A-like          115   6e-28   
ref|XP_009368378.1|  PREDICTED: auxin-induced protein 15A-like          115   6e-28   
emb|CBI37951.3|  unnamed protein product                                115   6e-28   
ref|XP_004163654.1|  PREDICTED: auxin-induced protein 15A-like          115   7e-28   
ref|XP_007200158.1|  hypothetical protein PRUPE_ppa016758mg             115   7e-28   
ref|XP_009799437.1|  PREDICTED: auxin-induced protein 15A-like          115   7e-28   
ref|XP_002276321.1|  PREDICTED: auxin-induced protein 15A               115   7e-28   Vitis vinifera
gb|KDP27610.1|  hypothetical protein JCGZ_19615                         115   7e-28   
ref|XP_008448009.1|  PREDICTED: auxin-induced protein 15A-like          115   8e-28   
ref|XP_010248164.1|  PREDICTED: auxin-induced protein 15A-like          115   8e-28   
gb|EYU35296.1|  hypothetical protein MIMGU_mgv1a019157mg                114   8e-28   
ref|XP_007201460.1|  hypothetical protein PRUPE_ppa013981mg             114   9e-28   
ref|XP_009799352.1|  PREDICTED: auxin-induced protein 15A-like          114   9e-28   
ref|XP_006362801.1|  PREDICTED: indole-3-acetic acid-induced prot...    115   9e-28   
ref|NP_179717.1|  SAUR-like auxin-responsive protein                    114   9e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KDP27619.1|  hypothetical protein JCGZ_19624                         115   9e-28   
ref|XP_008392044.1|  PREDICTED: auxin-induced protein 15A-like          115   9e-28   
gb|KDP27609.1|  hypothetical protein JCGZ_19614                         114   1e-27   
ref|XP_010263886.1|  PREDICTED: auxin-induced protein 15A-like          114   1e-27   
ref|XP_002306154.1|  hypothetical protein POPTR_0004s17260g             114   1e-27   Populus trichocarpa [western balsam poplar]
gb|KGN61878.1|  hypothetical protein Csa_2G258740                       114   1e-27   
ref|XP_003522810.1|  PREDICTED: indole-3-acetic acid-induced prot...    114   1e-27   
gb|KDP27608.1|  hypothetical protein JCGZ_19613                         114   1e-27   
emb|CBI37963.3|  unnamed protein product                                114   1e-27   
gb|KDP27617.1|  hypothetical protein JCGZ_19622                         114   1e-27   
ref|XP_007200892.1|  hypothetical protein PRUPE_ppb015877mg             114   1e-27   
gb|KGN61881.1|  hypothetical protein Csa_2G258770                       114   1e-27   
ref|XP_002276347.1|  PREDICTED: auxin-induced protein 15A-like          114   1e-27   Vitis vinifera
ref|XP_009615596.1|  PREDICTED: auxin-induced protein 15A-like          114   1e-27   
ref|XP_008392043.1|  PREDICTED: auxin-induced protein 15A-like          114   1e-27   
emb|CAN62609.1|  hypothetical protein VITISV_016870                     118   1e-27   Vitis vinifera
ref|XP_008237100.1|  PREDICTED: auxin-induced protein 15A-like          114   1e-27   
ref|XP_006360733.1|  PREDICTED: auxin-induced protein 15A-like          114   1e-27   
ref|XP_004250226.1|  PREDICTED: auxin-induced protein 15A-like          114   1e-27   
ref|XP_010647435.1|  PREDICTED: auxin-induced protein 15A               114   1e-27   
emb|CDX70790.1|  BnaC03g08740D                                          114   1e-27   
emb|CBI37953.3|  unnamed protein product                                114   1e-27   
gb|KDP27613.1|  hypothetical protein JCGZ_19618                         114   1e-27   
ref|XP_007199338.1|  hypothetical protein PRUPE_ppa024057mg             114   1e-27   
emb|CDY53266.1|  BnaA02g03880D                                          114   2e-27   
emb|CBI37958.3|  unnamed protein product                                114   2e-27   
ref|XP_008369481.1|  PREDICTED: auxin-induced protein 15A-like          114   2e-27   
gb|EYU35290.1|  hypothetical protein MIMGU_mgv11b020256mg               114   2e-27   
dbj|BAA25434.1|  SAUR                                                   114   2e-27   
ref|XP_009770668.1|  PREDICTED: auxin-induced protein 15A-like          114   2e-27   
ref|XP_010101890.1|  hypothetical protein L484_015480                   114   2e-27   
ref|XP_006352414.1|  PREDICTED: auxin-induced protein 15A-like          114   2e-27   
emb|CDY02654.1|  BnaC02g07810D                                          114   2e-27   
ref|XP_002276185.1|  PREDICTED: auxin-induced protein X15               114   2e-27   
ref|XP_006494591.1|  PREDICTED: auxin-induced protein 6B-like           114   2e-27   
ref|XP_010647476.1|  PREDICTED: auxin-induced protein X15               114   2e-27   
ref|XP_009347332.1|  PREDICTED: auxin-induced protein 15A-like          114   2e-27   
ref|XP_008457632.1|  PREDICTED: auxin-induced protein 15A-like          114   2e-27   
ref|XP_009770356.1|  PREDICTED: auxin-induced protein 15A-like          113   2e-27   
gb|EYU35308.1|  hypothetical protein MIMGU_mgv1a026507mg                113   2e-27   
ref|XP_006290038.1|  hypothetical protein CARUB_v10003672mg             114   2e-27   
ref|XP_009129147.1|  PREDICTED: auxin-induced protein 15A-like          114   2e-27   
gb|KCW55457.1|  hypothetical protein EUGRSUZ_I01359                     113   3e-27   
ref|XP_009368371.1|  PREDICTED: auxin-induced protein 15A-like          114   3e-27   
ref|XP_009620276.1|  PREDICTED: auxin-induced protein 15A-like          113   3e-27   
ref|XP_007201445.1|  hypothetical protein PRUPE_ppa013846mg             113   3e-27   
ref|XP_010101888.1|  hypothetical protein L484_015478                   113   3e-27   
gb|KGN43204.1|  hypothetical protein Csa_7G009000                       116   3e-27   
emb|CAN70456.1|  hypothetical protein VITISV_035060                     112   3e-27   
emb|CDY02661.1|  BnaC02g07740D                                          113   3e-27   
ref|XP_008237030.1|  PREDICTED: auxin-induced protein X10A-like         113   3e-27   
gb|EYU35275.1|  hypothetical protein MIMGU_mgv1a026646mg                113   3e-27   
ref|XP_006286674.1|  hypothetical protein CARUB_v10002645mg             113   3e-27   
ref|XP_010536046.1|  PREDICTED: auxin-induced protein 15A-like          114   3e-27   
ref|XP_006359717.1|  PREDICTED: auxin-induced protein 15A-like          113   3e-27   
ref|XP_008391974.1|  PREDICTED: auxin-induced protein 15A-like          113   3e-27   
ref|XP_006487292.1|  PREDICTED: auxin-induced protein X10A-like         113   3e-27   
ref|XP_010246399.1|  PREDICTED: auxin-induced protein 15A-like          113   3e-27   
ref|XP_009591874.1|  PREDICTED: auxin-induced protein 15A-like          113   3e-27   
ref|XP_006423536.1|  hypothetical protein CICLE_v10029654mg             113   3e-27   
ref|XP_008225927.1|  PREDICTED: auxin-induced protein 15A-like          113   3e-27   
ref|XP_009379576.1|  PREDICTED: auxin-induced protein 15A-like          113   3e-27   
ref|XP_007041979.1|  SAUR-like auxin-responsive protein family          117   3e-27   
ref|XP_008448001.1|  PREDICTED: auxin-induced protein 15A               113   3e-27   
ref|XP_006289917.1|  hypothetical protein CARUB_v10003533mg             113   3e-27   
ref|XP_007014781.1|  SAUR-like auxin-responsive protein family          113   3e-27   
ref|XP_004144912.1|  PREDICTED: indole-3-acetic acid-induced prot...    114   3e-27   
emb|CDY02652.1|  BnaC02g07830D                                          113   3e-27   
ref|XP_004230981.1|  PREDICTED: auxin-induced protein 15A-like          112   3e-27   
ref|XP_009368375.1|  PREDICTED: auxin-induced protein 15A-like          113   4e-27   
ref|NP_197303.1|  SAUR-like auxin-responsive protein                    113   4e-27   
ref|XP_004248873.1|  PREDICTED: auxin-induced protein 15A-like          113   4e-27   
ref|XP_009131627.1|  PREDICTED: auxin-induced protein 15A-like          113   4e-27   
ref|XP_008457636.1|  PREDICTED: auxin-induced protein 15A-like          113   4e-27   
ref|XP_011004678.1|  PREDICTED: auxin-induced protein 15A-like          113   4e-27   
ref|XP_007199585.1|  hypothetical protein PRUPE_ppb023607mg             112   4e-27   
emb|CBI17630.3|  unnamed protein product                                112   4e-27   
ref|XP_006289130.1|  hypothetical protein CARUB_v10002553mg             112   4e-27   
ref|XP_007200918.1|  hypothetical protein PRUPE_ppb021863mg             113   4e-27   
ref|XP_010255166.1|  PREDICTED: indole-3-acetic acid-induced prot...    113   4e-27   
ref|XP_008236176.1|  PREDICTED: auxin-induced protein 15A-like          112   4e-27   
ref|XP_007201638.1|  hypothetical protein PRUPE_ppa021647mg             113   4e-27   
ref|XP_010536042.1|  PREDICTED: auxin-induced protein 15A-like          112   4e-27   
ref|XP_006359712.1|  PREDICTED: auxin-induced protein 15A-like          112   5e-27   
emb|CAN65271.1|  hypothetical protein VITISV_040138                     112   5e-27   
ref|XP_002871799.1|  hypothetical protein ARALYDRAFT_909816             112   5e-27   
ref|XP_009368376.1|  PREDICTED: auxin-induced protein 15A-like          113   5e-27   
ref|XP_006423552.1|  hypothetical protein CICLE_v10029653mg             112   5e-27   
ref|XP_008338055.1|  PREDICTED: auxin-induced protein 15A-like          113   5e-27   
ref|XP_009368354.1|  PREDICTED: auxin-induced protein 15A-like          112   5e-27   
gb|EYU40726.1|  hypothetical protein MIMGU_mgv1a023467mg                112   5e-27   
ref|XP_009592041.1|  PREDICTED: auxin-induced protein 15A-like          112   5e-27   
gb|EYU37899.1|  hypothetical protein MIMGU_mgv1a019099mg                112   5e-27   
ref|XP_004501106.1|  PREDICTED: auxin-induced protein X10A-like         113   5e-27   
ref|XP_004147060.1|  PREDICTED: uncharacterized protein LOC101203413    115   5e-27   
ref|XP_008345408.1|  PREDICTED: auxin-induced protein 15A-like          112   5e-27   
gb|KDP34545.1|  hypothetical protein JCGZ_11095                         112   5e-27   
ref|XP_007200676.1|  hypothetical protein PRUPE_ppa016329mg             112   5e-27   
gb|KGN61887.1|  hypothetical protein Csa_2G258830                       112   5e-27   
gb|KCW55450.1|  hypothetical protein EUGRSUZ_I01352                     112   6e-27   
emb|CDY02656.1|  BnaC02g07790D                                          112   6e-27   
ref|XP_006352412.1|  PREDICTED: auxin-induced protein 15A-like          112   6e-27   
ref|XP_002312989.1|  hypothetical protein POPTR_0009s13020g             113   6e-27   
ref|XP_010246401.1|  PREDICTED: auxin-induced protein 15A-like          112   6e-27   
gb|EYU40728.1|  hypothetical protein MIMGU_mgv1a022834mg                112   6e-27   
ref|XP_004292442.1|  PREDICTED: uncharacterized protein LOC101308743    115   6e-27   
ref|XP_009121024.1|  PREDICTED: auxin-induced protein 15A-like          112   6e-27   
ref|XP_006365925.1|  PREDICTED: auxin-induced protein 10A5-like         112   6e-27   
emb|CDY53265.1|  BnaA02g03890D                                          112   6e-27   
gb|EYU35269.1|  hypothetical protein MIMGU_mgv1a017198mg                112   6e-27   
ref|XP_002276204.1|  PREDICTED: auxin-induced protein X15               112   6e-27   
ref|XP_002271861.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    115   6e-27   
gb|KCW55456.1|  hypothetical protein EUGRSUZ_I01358                     112   6e-27   
emb|CBI37961.3|  unnamed protein product                                112   7e-27   
ref|XP_009366349.1|  PREDICTED: auxin-induced protein 15A-like          112   7e-27   
ref|XP_006360736.1|  PREDICTED: indole-3-acetic acid-induced prot...    112   7e-27   
ref|XP_009101928.1|  PREDICTED: auxin-induced protein X15-like          112   7e-27   
ref|XP_006359629.1|  PREDICTED: auxin-induced protein 15A-like          112   7e-27   
ref|XP_006289998.1|  hypothetical protein CARUB_v10003628mg             112   7e-27   
ref|XP_009126238.1|  PREDICTED: auxin-induced protein 15A-like          112   7e-27   
ref|XP_009772683.1|  PREDICTED: auxin-induced protein 15A-like          112   7e-27   
ref|XP_010420540.1|  PREDICTED: auxin-induced protein 15A-like          112   7e-27   
ref|XP_008382354.1|  PREDICTED: auxin-induced protein 15A-like          112   7e-27   
ref|XP_010028671.1|  PREDICTED: indole-3-acetic acid-induced prot...    112   7e-27   
ref|XP_004231003.1|  PREDICTED: auxin-induced protein 15A-like          112   8e-27   
ref|XP_006293412.1|  hypothetical protein CARUB_v10024901mg             114   8e-27   
ref|XP_002271994.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    115   8e-27   
ref|XP_011088524.1|  PREDICTED: auxin-induced protein 15A-like          112   8e-27   
ref|XP_006359634.1|  PREDICTED: auxin-induced protein 15A-like          111   8e-27   
gb|KCW55445.1|  hypothetical protein EUGRSUZ_I01347                     112   8e-27   
ref|XP_010315344.1|  PREDICTED: auxin-induced protein 15A-like          111   8e-27   
ref|XP_006349639.1|  PREDICTED: auxin-induced protein 15A-like          111   9e-27   
ref|XP_007201446.1|  hypothetical protein PRUPE_ppa013847mg             112   9e-27   
ref|XP_006286648.1|  hypothetical protein CARUB_v10002518mg             112   9e-27   
ref|XP_004166275.1|  PREDICTED: auxin-induced protein 10A5-like         112   9e-27   
emb|CDY15832.1|  BnaC02g34510D                                          113   9e-27   
ref|XP_010472101.1|  PREDICTED: auxin-induced protein X15               112   9e-27   
ref|XP_009627044.1|  PREDICTED: auxin-induced protein X10A-like         114   9e-27   
ref|XP_002276391.1|  PREDICTED: auxin-induced protein 15A               111   1e-26   
gb|EYU37904.1|  hypothetical protein MIMGU_mgv1a020634mg                111   1e-26   
ref|NP_197307.1|  SAUR-like auxin-responsive protein                    112   1e-26   
ref|XP_010246398.1|  PREDICTED: auxin-induced protein 15A-like          112   1e-26   
ref|XP_007041969.1|  SAUR-like auxin-responsive protein family          112   1e-26   
ref|XP_010086682.1|  hypothetical protein L484_000889                   112   1e-26   
ref|XP_011088531.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    114   1e-26   
ref|XP_009379574.1|  PREDICTED: auxin-induced protein 15A-like          111   1e-26   
ref|XP_008369425.1|  PREDICTED: auxin-induced protein 15A-like          111   1e-26   
gb|KCW55443.1|  hypothetical protein EUGRSUZ_I01345                     111   1e-26   
emb|CBI17627.3|  unnamed protein product                                113   1e-26   
gb|EYU35273.1|  hypothetical protein MIMGU_mgv1a019887mg                111   1e-26   
ref|XP_010315346.1|  PREDICTED: auxin-induced protein 15A-like          112   1e-26   
ref|XP_008237035.1|  PREDICTED: auxin-induced protein 15A-like          112   1e-26   
ref|XP_007201444.1|  hypothetical protein PRUPE_ppa013844mg             112   1e-26   
ref|XP_009760922.1|  PREDICTED: auxin-induced protein 15A-like          111   1e-26   
emb|CDY71214.1|  BnaAnng36540D                                          111   1e-26   
gb|EYU40724.1|  hypothetical protein MIMGU_mgv1a024905mg                110   1e-26   
gb|ABL97983.1|  auxin-induced protein-like                              112   1e-26   
ref|XP_008457943.1|  PREDICTED: auxin-induced protein 15A-like          111   1e-26   
ref|XP_009133442.1|  PREDICTED: auxin-induced protein X15-like          111   1e-26   
ref|XP_004300217.1|  PREDICTED: indole-3-acetic acid-induced prot...    111   1e-26   
ref|XP_009131624.1|  PREDICTED: auxin-induced protein 15A-like          111   1e-26   
gb|KCW55452.1|  hypothetical protein EUGRSUZ_I01354                     111   1e-26   
emb|CDY71365.1|  BnaAnng37150D                                          111   1e-26   
emb|CDY02660.1|  BnaC02g07750D                                          111   1e-26   
emb|CDY02650.1|  BnaC02g07850D                                          111   1e-26   
ref|XP_006285108.1|  hypothetical protein CARUB_v10006441mg             111   1e-26   
ref|NP_197309.1|  small auxin up RNA 24                                 111   1e-26   
ref|XP_009592059.1|  PREDICTED: auxin-induced protein 15A-like          111   1e-26   
ref|XP_009379578.1|  PREDICTED: auxin-induced protein 15A-like          111   1e-26   
ref|NP_197304.1|  SAUR-like auxin-responsive protein                    111   1e-26   
ref|XP_004165218.1|  PREDICTED: uncharacterized LOC101211923            114   1e-26   
ref|XP_004144829.1|  PREDICTED: auxin-induced protein X15-like          111   1e-26   
ref|XP_009601953.1|  PREDICTED: auxin-induced protein 15A-like          111   1e-26   
emb|CBI17635.3|  unnamed protein product                                111   1e-26   
ref|XP_010101892.1|  hypothetical protein L484_015482                   111   2e-26   
ref|XP_004147011.1|  PREDICTED: uncharacterized protein LOC101211923    114   2e-26   
ref|XP_009368355.1|  PREDICTED: auxin-induced protein 15A-like          112   2e-26   
ref|XP_007199079.1|  hypothetical protein PRUPE_ppa019112mg             111   2e-26   
emb|CDX78776.1|  BnaA03g06880D                                          111   2e-26   
gb|AAM12777.1|  putative auxin-induced SAUR-like protein                110   2e-26   
gb|EYU35292.1|  hypothetical protein MIMGU_mgv1a017204mg                111   2e-26   
ref|XP_009760935.1|  PREDICTED: auxin-induced protein 15A-like          111   2e-26   
gb|EYU37883.1|  hypothetical protein MIMGU_mgv1a020884mg                111   2e-26   
emb|CDX70794.1|  BnaC03g08780D                                          111   2e-26   
ref|XP_004505827.1|  PREDICTED: auxin-induced protein X10A-like         111   2e-26   
ref|XP_009615592.1|  PREDICTED: auxin-induced protein 15A-like          110   2e-26   
ref|XP_010101886.1|  hypothetical protein L484_015476                   111   2e-26   
ref|XP_006423538.1|  hypothetical protein CICLE_v10029885mg             111   2e-26   
ref|XP_010492794.1|  PREDICTED: auxin-induced protein X10A-like         110   2e-26   
emb|CDO96972.1|  unnamed protein product                                111   2e-26   
ref|XP_009787694.1|  PREDICTED: auxin-induced protein 15A-like          111   2e-26   
ref|XP_011088528.1|  PREDICTED: auxin-induced protein X15-like          111   2e-26   
emb|CDY25470.1|  BnaC09g39850D                                          111   2e-26   
ref|XP_006400352.1|  hypothetical protein EUTSA_v10015118mg             111   2e-26   
ref|XP_009121020.1|  PREDICTED: auxin-induced protein 15A-like          111   2e-26   
ref|XP_007199408.1|  hypothetical protein PRUPE_ppa026231mg             110   2e-26   
ref|XP_006494594.1|  PREDICTED: auxin-induced protein 10A5-like         111   2e-26   
emb|CAN79759.1|  hypothetical protein VITISV_009899                     110   2e-26   
ref|XP_009121032.1|  PREDICTED: indole-3-acetic acid-induced prot...    112   2e-26   
ref|XP_002271794.1|  PREDICTED: auxin-induced protein 15A-like          110   2e-26   
gb|KFK26043.1|  hypothetical protein AALP_AA8G195900                    110   2e-26   
ref|XP_004290375.1|  PREDICTED: auxin-induced protein X10A-like         111   2e-26   
ref|XP_008382353.1|  PREDICTED: auxin-induced protein 15A-like          110   2e-26   
ref|XP_010255167.1|  PREDICTED: auxin-induced protein X10A-like         111   2e-26   
ref|XP_009121026.1|  PREDICTED: auxin-induced protein 15A-like          110   2e-26   
ref|XP_009131625.1|  PREDICTED: auxin-induced protein 15A-like          110   2e-26   
gb|EYU18550.1|  hypothetical protein MIMGU_mgv1a019908mg                110   2e-26   
ref|XP_004166277.1|  PREDICTED: auxin-induced protein X10A-like         110   2e-26   
gb|EYU37896.1|  hypothetical protein MIMGU_mgv1a017226mg                110   2e-26   
gb|KCW55447.1|  hypothetical protein EUGRSUZ_I01349                     110   2e-26   
ref|XP_007200638.1|  hypothetical protein PRUPE_ppa013834mg             110   2e-26   
ref|XP_006400344.1|  hypothetical protein EUTSA_v10015117mg             110   3e-26   
ref|XP_009619470.1|  PREDICTED: auxin-induced protein 15A-like          110   3e-26   
ref|XP_010315354.1|  PREDICTED: auxin-induced protein 15A-like          110   3e-26   
ref|XP_009620275.1|  PREDICTED: auxin-induced protein 15A-like          110   3e-26   
emb|CDX70787.1|  BnaC03g08710D                                          110   3e-26   
ref|XP_007041970.1|  SAUR-like auxin-responsive protein family, p...    110   3e-26   
emb|CDX70786.1|  BnaC03g08700D                                          110   3e-26   
ref|XP_006400350.1|  hypothetical protein EUTSA_v10015720mg             110   3e-26   
gb|KDP34550.1|  hypothetical protein JCGZ_11100                         110   3e-26   
ref|XP_010492795.1|  PREDICTED: auxin-induced protein X10A-like         110   3e-26   
ref|XP_006359632.1|  PREDICTED: auxin-induced protein 15A-like          110   3e-26   
ref|XP_007131725.1|  hypothetical protein PHAVU_011G036500g             110   3e-26   
ref|XP_009770357.1|  PREDICTED: auxin-induced protein 15A-like          110   3e-26   
ref|XP_004165222.1|  PREDICTED: auxin-induced protein 10A5-like         114   3e-26   
ref|XP_009347321.1|  PREDICTED: auxin-induced protein 15A-like          110   3e-26   
ref|XP_004300227.1|  PREDICTED: uncharacterized protein LOC101304289    114   4e-26   
ref|XP_008237032.1|  PREDICTED: indole-3-acetic acid-induced prot...    110   4e-26   
ref|XP_004231005.1|  PREDICTED: auxin-induced protein 15A-like          110   4e-26   
ref|XP_007200640.1|  hypothetical protein PRUPE_ppa013865mg             110   4e-26   
ref|XP_006359633.1|  PREDICTED: auxin-induced protein 15A-like          109   4e-26   
gb|EYU23193.1|  hypothetical protein MIMGU_mgv11b024059mg               110   4e-26   
ref|XP_010649242.1|  PREDICTED: auxin-induced protein 15A               110   4e-26   
emb|CDY02658.1|  BnaC02g07770D                                          110   4e-26   
ref|XP_004230990.1|  PREDICTED: auxin-induced protein 15A-like          109   4e-26   
ref|XP_007201437.1|  hypothetical protein PRUPE_ppa013765mg             110   4e-26   
emb|CDP18415.1|  unnamed protein product                                112   4e-26   
ref|XP_009618922.1|  PREDICTED: auxin-induced protein 15A-like          110   4e-26   
ref|XP_008358421.1|  PREDICTED: auxin-induced protein 15A-like          110   5e-26   
ref|XP_008237033.1|  PREDICTED: auxin-induced protein 15A-like          110   5e-26   
ref|XP_010271405.1|  PREDICTED: auxin-induced protein 15A-like          110   5e-26   
ref|XP_006423555.1|  hypothetical protein CICLE_v10030043mg             110   5e-26   
ref|XP_009606929.1|  PREDICTED: auxin-induced protein 15A-like          110   5e-26   



>ref|XP_002306150.1| hypothetical protein POPTR_0004s17180g [Populus trichocarpa]
 gb|EEE86661.1| hypothetical protein POPTR_0004s17180g [Populus trichocarpa]
Length=96

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI +  I+ AKQ LRRS+   N+  EVPKG+FAVYVGES+KKRF +PIS+L  PSFQ+L
Sbjct  1    MAILLKGIMNAKQILRRSNLLANQATEVPKGYFAVYVGESQKKRFTVPISFLNQPSFQEL  60

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            L +AEEEFG+ H MGGLT+PC EDTF+DII
Sbjct  61   LRKAEEEFGYSHPMGGLTLPCREDTFIDII  90



>ref|XP_008448014.1| PREDICTED: auxin-induced protein 15A-like [Cucumis melo]
Length=100

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI+ AKQ L+RSSS  N    + I+VPKG+FAVY+GE +KKRFVIP+SYL  PS
Sbjct  1    MGFRLPRIVTAKQSLQRSSSTGNGASPKAIDVPKGYFAVYIGEEQKKRFVIPLSYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQAEE+FG++H MGG+TIPC ED FLD+
Sbjct  61   FQDLLSQAEEKFGYNHPMGGITIPCSEDYFLDV  93



>ref|XP_004172954.1| PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]
Length=100

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE----IEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI+ AKQ L+RSSS  N E    ++VPKG+F VYVGE +KKRFVIP+SYL  PS
Sbjct  1    MGFRLPRIVTAKQSLQRSSSTGNGESPKAVDVPKGYFTVYVGEEQKKRFVIPLSYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQ+EEEFG++H MGG+TIPC ED FLD+
Sbjct  61   FQDLLSQSEEEFGYNHPMGGITIPCSEDCFLDV  93



>ref|XP_004300216.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Fragaria 
vesca subsp. vesca]
Length=99

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI   K+ L RSSS  N    + +++PKG+FAVYVGES+KKRFVIPISYL  PS
Sbjct  1    MGFRLPRISNTKRILTRSSSNGNQTASKTLDIPKGYFAVYVGESQKKRFVIPISYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            F DLLSQAEEEFG+DH MGG+TIPC EDTFLD+
Sbjct  61   FMDLLSQAEEEFGYDHPMGGITIPCSEDTFLDL  93



>ref|XP_008448016.1| PREDICTED: auxin-induced protein 15A-like [Cucumis melo]
Length=100

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI+ AKQ L+RSSS+ N    + ++VPKG+F+VYVGE  KKRFVIP+SYL  PS
Sbjct  1    MGFRLPRIVTAKQSLQRSSSKENGTSPKIVDVPKGYFSVYVGEEHKKRFVIPLSYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQAEEEFG++H MGG+TIPC ED FLD+
Sbjct  61   FQDLLSQAEEEFGYNHPMGGITIPCHEDEFLDL  93



>ref|XP_008448015.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein X10A-like 
[Cucumis melo]
Length=100

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE----IEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI+ AKQ L+RSSS  NRE    ++VPKG+F VYVGE +KKRFVIP+SYL   S
Sbjct  1    MGFRLPRIVTAKQSLQRSSSTGNRESPKAVDVPKGYFTVYVGEEQKKRFVIPLSYLNQTS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLL+QAEEEFG++H MGG+TIPC ED FLD+
Sbjct  61   FQDLLNQAEEEFGYNHPMGGITIPCREDXFLDL  93



>gb|KGN43203.1| hypothetical protein Csa_7G008990 [Cucumis sativus]
Length=100

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 73/93 (78%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE----IEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI+ +KQ L+RSSS  N E    ++VPKG+F VYVGE +KKRFVIP+SYL  PS
Sbjct  1    MGFRLPRIVTSKQSLQRSSSTGNGESPKAVDVPKGYFTVYVGEEQKKRFVIPLSYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQ+EEEFG++H MGG+TIPC ED FLD+
Sbjct  61   FQDLLSQSEEEFGYNHPMGGITIPCSEDCFLDV  93



>ref|XP_004173149.1| PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]
 gb|KGN43202.1| hypothetical protein Csa_7G008980 [Cucumis sativus]
Length=100

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 73/93 (78%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI+ AKQ L+RSSS  N    + ++VPKG+FAVY+GE +KKRFVIP+SYL  PS
Sbjct  1    MGFRLPRIVTAKQSLQRSSSTGNGASPKAVDVPKGYFAVYIGEEQKKRFVIPLSYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQAEEEFG++H MGG+TIPC E  FLD+
Sbjct  61   FQDLLSQAEEEFGYNHPMGGITIPCNEAYFLDL  93



>ref|XP_004162911.1| PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]
 gb|KGN43206.1| hypothetical protein Csa_7G009020 [Cucumis sativus]
Length=100

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI+ AKQ L+RSSS  N    + ++VPKG+F VYVGE  KKRFVIP+SYL  PS
Sbjct  1    MGFRLPRIVTAKQSLQRSSSTGNGASPKVVDVPKGYFTVYVGEEHKKRFVIPLSYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQAEEEFG++H MGG+TIPC ED FLD+
Sbjct  61   FQDLLSQAEEEFGYNHPMGGITIPCHEDEFLDL  93



>ref|XP_006423551.1| hypothetical protein CICLE_v10029685mg [Citrus clementina]
 ref|XP_006494592.1| PREDICTED: auxin-induced protein 15A-like [Citrus sinensis]
 gb|ESR36791.1| hypothetical protein CICLE_v10029685mg [Citrus clementina]
 gb|KDO42787.1| hypothetical protein CISIN_1g034523mg [Citrus sinensis]
Length=92

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI   RI+ AKQ LRR+    +    VPKGH AVYVGE EK RFV+P+SYLK PSFQ+L
Sbjct  1    MAIRFLRIVNAKQALRRAL-MVSEASTVPKGHLAVYVGEIEKSRFVVPVSYLKHPSFQNL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGFDH MGGLTIPC E  F+D+
Sbjct  60   LSQAEEEFGFDHPMGGLTIPCSEKVFMDL  88



>emb|CDO96970.1| unnamed protein product [Coffea canephora]
Length=102

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 75/93 (81%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREI----EVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI + RI++AKQ L+RS   +N  I    +VP+G+ AVYVGES+KKRFVIP++YL +P 
Sbjct  1    MAIRLPRIIQAKQILKRSLLTSNAAISASVDVPRGYLAVYVGESKKKRFVIPVAYLNEPE  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ+LL+QAEEEFGFDH MGGLTIPC ED F+D+
Sbjct  61   FQELLTQAEEEFGFDHPMGGLTIPCREDIFIDL  93



>ref|XP_008237080.1| PREDICTED: auxin-induced protein 15A-like [Prunus mume]
Length=99

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   +  IL  K+ L +S   +N    + ++VPKG+FAVYVGES+KKRFVIP+SYL  PS
Sbjct  1    MGFRLPGILHVKKNLLQSLPTSNQVHSKALDVPKGYFAVYVGESQKKRFVIPVSYLNHPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQAEEEFG+DH MGG+TIPC EDTFLD+
Sbjct  61   FQDLLSQAEEEFGYDHPMGGITIPCNEDTFLDL  93



>ref|XP_008448013.1| PREDICTED: auxin-induced protein 15A-like [Cucumis melo]
Length=100

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE----IEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI+ AKQ L+RSSS  NRE    ++VPKG+F VYVGE +KKRFVIP+SYL  PS
Sbjct  1    MGFRLPRIVTAKQSLQRSSSTENRESPKAVDVPKGYFTVYVGEEQKKRFVIPLSYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQA+EEFG++H MGG+TIPC E+ F ++
Sbjct  61   FQDLLSQAKEEFGYNHPMGGITIPCSEEIFQNL  93



>ref|XP_004309347.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Fragaria 
vesca subsp. vesca]
Length=99

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE----IEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   +  I+  K+ L RSSS  N+     +++PKG+FAVYVG+S+KKRFVIPISYL  PS
Sbjct  1    MGFKLPAIVSPKKSLTRSSSNANKTASKILDIPKGYFAVYVGKSQKKRFVIPISYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            F DLLSQAE+EFG+DH MGG+TIPC E+TFLD+
Sbjct  61   FMDLLSQAEDEFGYDHFMGGITIPCSENTFLDL  93



>ref|XP_007200097.1| hypothetical protein PRUPE_ppa019366mg [Prunus persica]
 gb|EMJ01296.1| hypothetical protein PRUPE_ppa019366mg [Prunus persica]
Length=99

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   +  IL  K+ L +S   +N    + ++VPKG+FAVYVGES+KKRFVIP+SYL  PS
Sbjct  1    MGFRLRGILHVKKNLLQSLPTSNQVHSKALDVPKGYFAVYVGESQKKRFVIPVSYLNHPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQAEEEFG+DH MGG+TIPC EDTFLD+
Sbjct  61   FQDLLSQAEEEFGYDHPMGGITIPCNEDTFLDL  93



>ref|XP_003523506.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Glycine 
max]
 gb|KHN33702.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=95

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI +  +L AK   RRS++     ++VPKGHFAVYVGE EKKRFVIP+SYL  PSFQ+L
Sbjct  1    MAIRLPCVLSAKHIFRRSNAAAT-SLDVPKGHFAVYVGEGEKKRFVIPVSYLNQPSFQEL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LS AEEEFGF H MGGLTIPC ED FL+I
Sbjct  60   LSIAEEEFGFSHPMGGLTIPCTEDIFLNI  88



>emb|CDP15258.1| unnamed protein product [Coffea canephora]
Length=145

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 72/89 (81%), Gaps = 6/89 (7%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI + RIL+AKQ LR+SS       +V KG+ AVYVGESEKKRFVIPISYL  P+F++L
Sbjct  58   MAIRLPRILQAKQILRQSSK------DVSKGYVAVYVGESEKKRFVIPISYLNQPTFREL  111

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGFDH MGGLTIPC ED F+D+
Sbjct  112  LSQAEEEFGFDHPMGGLTIPCREDKFIDV  140



>ref|XP_004301662.1| PREDICTED: uncharacterized protein LOC101295922 [Fragaria vesca 
subsp. vesca]
Length=187

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNR----EIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI   K+ L RSSS  N+     +++PKG+FAVYVGES+KKRFVIPISYL  PS
Sbjct  1    MGFRLPRISNTKRSLTRSSSNGNKTAPKSLDIPKGYFAVYVGESQKKRFVIPISYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            F DLLSQAEEEFG+DH MGG+TIPC E+TFLD+
Sbjct  61   FMDLLSQAEEEFGYDHPMGGITIPCSEETFLDL  93


 Score =   109 bits (272),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -2

Query  889  RAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFG  710
            +   G R       +  ++PKG+FAVYVGES+KKRFV+PISYL  P F DLLSQAEEEFG
Sbjct  102  KLTMGFRLPRIANTKTSDIPKGYFAVYVGESQKKRFVVPISYLNQPLFLDLLSQAEEEFG  161

Query  709  FDHQMGGLTIPCPEDTFLDI  650
            + H MGG+TIPC +DTF+D+
Sbjct  162  YHHPMGGITIPCSQDTFIDL  181



>gb|KDP27614.1| hypothetical protein JCGZ_19619 [Jatropha curcas]
Length=95

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 74/89 (83%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MA  ++ IL AKQ L RS+++ + +  +PKG  AVYVGE+EKKRF++P+SYL +PSFQDL
Sbjct  1    MARHLSAIL-AKQILHRSANKASSKYSLPKGFLAVYVGETEKKRFLVPVSYLNEPSFQDL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LS+AEEE+GFDH MGGLTIPC EDTF+D+
Sbjct  60   LSKAEEEYGFDHPMGGLTIPCREDTFIDV  88



>gb|EYU18551.1| hypothetical protein MIMGU_mgv1a018365mg [Erythranthe guttata]
Length=88

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R  EVPKGHFAVYVGESEKKRFVIP+SYL +PSFQ+LLSQAEEEFGF H M
Sbjct  7    LRRSLSSEKRSNEVPKGHFAVYVGESEKKRFVIPLSYLNNPSFQELLSQAEEEFGFHHPM  66

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC E+ F+D+
Sbjct  67   GGLTIPCSEELFIDL  81



>ref|XP_002276058.2| PREDICTED: auxin-induced protein X15 [Vitis vinifera]
 emb|CAN65270.1| hypothetical protein VITISV_040137 [Vitis vinifera]
Length=95

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 71/92 (77%), Gaps = 7/92 (8%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRR---SSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
            MAI   RI+ AKQ LRR   S   TN    VPKGH  VYVGE+EKKRFVIPISYLK PSF
Sbjct  1    MAIRFQRIIPAKQILRRILPSPESTN----VPKGHVPVYVGETEKKRFVIPISYLKHPSF  56

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            Q+LLSQAEEEFGFDH +GGLTIPC E+ F+D+
Sbjct  57   QNLLSQAEEEFGFDHPLGGLTIPCREEAFIDL  88



>gb|EYU35299.1| hypothetical protein MIMGU_mgv1a019900mg [Erythranthe guttata]
Length=83

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R  EVPKGHFAVYVGESEKKRFVIP+SYL +P FQ+LL QAEEEFGF HQM
Sbjct  2    LRRSLSAEKRSNEVPKGHFAVYVGESEKKRFVIPLSYLNNPLFQELLCQAEEEFGFHHQM  61

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC E+ F+DI
Sbjct  62   GGLTIPCSEELFIDI  76



>emb|CDP20901.1| unnamed protein product [Coffea canephora]
Length=88

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 71/89 (80%), Gaps = 6/89 (7%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI + RI++AKQ LRRSS       +V KG+ AVYVG SEKKRFV+PISYL  P+FQ+L
Sbjct  1    MAIRLPRIIQAKQILRRSSK------DVLKGYIAVYVGVSEKKRFVVPISYLNQPAFQEL  54

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGFDH MGGLTIPC ED F+D+
Sbjct  55   LSQAEEEFGFDHPMGGLTIPCREDKFIDV  83



>emb|CDO96969.1| unnamed protein product [Coffea canephora]
Length=105

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 78/96 (81%), Gaps = 7/96 (7%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSS-SRTNRE------IEVPKGHFAVYVGESEKKRFVIPISYLK  758
            MAI + RI++AKQ  R+ S ++ N        ++VPKG+FAVYVGE+E+KRFVIPI+YL 
Sbjct  1    MAIRLPRIVQAKQLFRQYSFTKCNAAASATACLDVPKGYFAVYVGENERKRFVIPIAYLN  60

Query  757  DPSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            +PSF+DLL++AEEEFGFDH +GGLTIPC EDTF+DI
Sbjct  61   EPSFRDLLNRAEEEFGFDHPIGGLTIPCREDTFIDI  96



>gb|EYU37887.1| hypothetical protein MIMGU_mgv1a022037mg [Erythranthe guttata]
Length=88

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -2

Query  892  LRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEF  713
            +  +Q LRRS S   R +EVPKGHFAVYVG++EKKRFV+P+SYL  PSFQ+LL QAEEEF
Sbjct  1    MAIRQILRRSLSNERRSVEVPKGHFAVYVGQNEKKRFVVPLSYLNHPSFQELLCQAEEEF  60

Query  712  GFDHQMGGLTIPCPEDTFLDI  650
            GF H MGGLTIPC ED F+D+
Sbjct  61   GFHHPMGGLTIPCSEDLFVDL  81



>emb|CBI37960.3| unnamed protein product [Vitis vinifera]
Length=107

 Score =   123 bits (309),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 71/92 (77%), Gaps = 7/92 (8%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRR---SSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
            MAI   RI+ AKQ LRR   S   TN    VPKGH  VYVGE+EKKRFVIPISYLK PSF
Sbjct  1    MAIRFQRIIPAKQILRRILPSPESTN----VPKGHVPVYVGETEKKRFVIPISYLKHPSF  56

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            Q+LLSQAEEEFGFDH +GGLTIPC E+ F+D+
Sbjct  57   QNLLSQAEEEFGFDHPLGGLTIPCREEAFIDL  88



>emb|CDP18416.1| unnamed protein product [Coffea canephora]
Length=102

 Score =   123 bits (309),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 74/93 (80%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREI----EVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +  I++AKQ LRRS   +N  I    +VP+G+ AVYVGE+EKKRFVIP++YL + +
Sbjct  1    MAIRLPLIIQAKQILRRSILTSNAAISASVDVPRGYLAVYVGENEKKRFVIPVAYLNESA  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ+LLSQAEEEFGFDH MGGLTIPC ED F+D+
Sbjct  61   FQELLSQAEEEFGFDHPMGGLTIPCREDMFIDL  93



>ref|XP_002306153.1| hypothetical protein POPTR_0004s17280g [Populus trichocarpa]
 ref|XP_006384538.1| hypothetical protein POPTR_0004s17240g [Populus trichocarpa]
 gb|EEE86664.1| hypothetical protein POPTR_0004s17280g [Populus trichocarpa]
 gb|ERP62335.1| hypothetical protein POPTR_0004s17240g [Populus trichocarpa]
Length=94

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 71/89 (80%), Gaps = 3/89 (3%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI + RIL+AKQ L R SS      +V KG+ AVYVGE EKKRFVIP+S+L  PSFQ+L
Sbjct  2    MAIRLPRILQAKQNLLRGSSPAR---DVRKGYIAVYVGEEEKKRFVIPVSHLNQPSFQEL  58

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LS+AEEE+GFDHQMGGLTIPC ED F+D+
Sbjct  59   LSKAEEEYGFDHQMGGLTIPCREDIFIDL  87



>ref|XP_011088527.1| PREDICTED: auxin-induced protein 15A-like [Sesamum indicum]
Length=91

 Score =   122 bits (307),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 71/90 (79%), Gaps = 7/90 (8%)
 Frame = -2

Query  916  MAISMTRILR-AKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQD  740
            MAIS  RILR +    +RS+S T    EVPKGHFAVYVGESEKKRFVIP+SYL  PSFQD
Sbjct  1    MAIS--RILRRSLSAEKRSTSGT----EVPKGHFAVYVGESEKKRFVIPVSYLNHPSFQD  54

Query  739  LLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LL QAEEEFGF H MGGLTIPC ED F+DI
Sbjct  55   LLCQAEEEFGFHHPMGGLTIPCSEDLFIDI  84



>ref|XP_004293889.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Fragaria 
vesca subsp. vesca]
Length=99

 Score =   123 bits (308),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI   K+ L RS S  N    + +++PKG+FAVYVGES+KKRFVIPISYL  PS
Sbjct  1    MGFRLPRISSPKRSLIRSLSNGNQTAPKTLDIPKGYFAVYVGESQKKRFVIPISYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            F DLLSQAEEEFG+DH MGG+TIPC E+TFLD+
Sbjct  61   FMDLLSQAEEEFGYDHPMGGITIPCSEETFLDL  93



>ref|XP_007041989.1| SAUR family protein [Theobroma cacao]
 gb|EOX97820.1| SAUR family protein [Theobroma cacao]
Length=100

 Score =   123 bits (308),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNR----EIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +  ++ AKQ LRRS+  +N+     ++VPKG FAVYVGESEKKRFV+P+S+L  P 
Sbjct  1    MAIRLPGVVAAKQILRRSALTSNKRASTSLDVPKGFFAVYVGESEKKRFVVPLSFLSQPL  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLS AEEEFGF+H MGGLTIPC ED F+DI
Sbjct  61   FQDLLSIAEEEFGFNHPMGGLTIPCHEDMFIDI  93



>ref|XP_002271501.1| PREDICTED: auxin-induced protein X15 [Vitis vinifera]
Length=95

 Score =   122 bits (307),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 71/92 (77%), Gaps = 7/92 (8%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRR---SSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
            MAI   RI+ AKQ LRR   S   TN    VPKGH  VYVGE++KKRFVIPISYLK PSF
Sbjct  1    MAIRFQRIIPAKQILRRILPSPESTN----VPKGHVPVYVGEAQKKRFVIPISYLKHPSF  56

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            Q+LLSQAEEEFGFDH +GGLTIPC E+ F+D+
Sbjct  57   QNLLSQAEEEFGFDHPLGGLTIPCREEAFIDL  88



>ref|XP_002272231.1| PREDICTED: auxin-induced protein X15-like [Vitis vinifera]
 ref|XP_003631552.1| PREDICTED: auxin-induced protein X15-like [Vitis vinifera]
 emb|CAN62608.1| hypothetical protein VITISV_016869 [Vitis vinifera]
Length=95

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 71/92 (77%), Gaps = 7/92 (8%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRR---SSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
            MAI   RI+ AKQ LRR   S   TN    VPKGH  VYVGE++KKRFVIPISYLK PSF
Sbjct  1    MAIRFQRIIPAKQILRRILPSPESTN----VPKGHVPVYVGETQKKRFVIPISYLKHPSF  56

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            Q+LLSQAEEEFGFDH +GGLTIPC E+ F+D+
Sbjct  57   QNLLSQAEEEFGFDHPLGGLTIPCREEAFIDL  88



>ref|XP_007135904.1| hypothetical protein PHAVU_009G001600g [Phaseolus vulgaris]
 gb|ESW07898.1| hypothetical protein PHAVU_009G001600g [Phaseolus vulgaris]
Length=100

 Score =   122 bits (307),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 60/93 (65%), Positives = 69/93 (74%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNR----EIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +  +L AK  LRR++   N      ++VPKGHFAVYVGE EKKRFVIPISYL  PS
Sbjct  1    MAIRLASVLSAKHILRRTNIFANHAAATSLDVPKGHFAVYVGEGEKKRFVIPISYLNHPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ LLS AEEEFGF+H MG LTIPC +D FL+I
Sbjct  61   FQQLLSIAEEEFGFNHPMGALTIPCTQDIFLNI  93



>ref|XP_011047001.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Populus 
euphratica]
Length=98

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 72/93 (77%), Gaps = 6/93 (6%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE----IEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +  +  AKQ LRRS S  N+     ++VPKG  AVYVGE+EKKRFV+P+SYL  PS
Sbjct  1    MAIRLPGL--AKQSLRRSFSTANKASSKYLDVPKGFLAVYVGETEKKRFVVPVSYLNQPS  58

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLS+AEEEFGFDH MGGLTIPC E+TFL +
Sbjct  59   FQDLLSKAEEEFGFDHPMGGLTIPCAEETFLHV  91



>ref|XP_003527610.1| PREDICTED: auxin-induced protein 10A5-like [Glycine max]
 gb|KHN20020.1| Auxin-induced protein 10A5 [Glycine soja]
Length=100

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 69/93 (74%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNR----EIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +  IL AK  LRRS+   N      ++VPKGHFAVYVGE EKKRFVIP+SYL  PS
Sbjct  1    MAIRLPSILSAKYILRRSNLFANHAATTSLDVPKGHFAVYVGEGEKKRFVIPVSYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ+LLS AEEEFGF H MGGL IPC E+ FL+I
Sbjct  61   FQELLSIAEEEFGFSHPMGGLIIPCTEEIFLNI  93



>ref|XP_007041971.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
 gb|EOX97802.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
Length=95

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   + RI+ AK+ L+R+ S +   + VPKGHFAVY+GE+EKKRFV+PIS+LK  SFQ+L
Sbjct  1    MGFRLPRIVNAKRSLKRALSSSETTV-VPKGHFAVYIGEAEKKRFVVPISFLKHASFQNL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            LSQAEEE+GF+H MG LTIPC E+ FLD+I
Sbjct  60   LSQAEEEYGFNHPMGALTIPCCEEAFLDLI  89



>gb|EYU37897.1| hypothetical protein MIMGU_mgv11b017186mg [Erythranthe guttata]
Length=83

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R  EVPKGHFAVYVGESEKKRFVIP++YL +PSFQ+LL QAEEEFGF H M
Sbjct  2    LRRSLSAEKRSNEVPKGHFAVYVGESEKKRFVIPLTYLNNPSFQELLCQAEEEFGFHHSM  61

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC E+ F+D+
Sbjct  62   GGLTIPCTEELFIDL  76



>ref|XP_009347325.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus 
x bretschneideri]
Length=100

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 5/94 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN-----REIEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M   + RI+ AK+ L RS S +N     + +++PKG+FAVYVGES+KKRFVIPISYL +P
Sbjct  1    MGFLLPRIVTAKRTLIRSLSSSNQTADSKTMDIPKGYFAVYVGESQKKRFVIPISYLNEP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
             F DLLSQAEEEFG+DH MGG+TIPC EDTFL +
Sbjct  61   LFLDLLSQAEEEFGYDHPMGGITIPCSEDTFLHL  94



>ref|XP_009760902.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=92

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (78%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I +T  ++A + LRRSS+       VPKGH AVYVGES+KKRFV+PISYL  P FQDL
Sbjct  1    MGIKVTPFIQATRTLRRSSTTGG----VPKGHCAVYVGESQKKRFVMPISYLSQPLFQDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEEEFGFDH MGGLTIPC ED F+D+
Sbjct  57   LAQAEEEFGFDHSMGGLTIPCKEDVFIDL  85



>ref|XP_009766735.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=92

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 69/89 (78%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I MT  ++A + LRR+S+       VPKGH AVYVGES+KKRFV+PISYL  P FQD+
Sbjct  1    MGIKMTPFIQASRILRRTSTTGG----VPKGHCAVYVGESQKKRFVVPISYLSQPLFQDM  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEEEFGFDH MGGLTIPC ED F+D+
Sbjct  57   LAQAEEEFGFDHSMGGLTIPCKEDVFIDL  85



>ref|XP_002276227.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
Length=95

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 71/92 (77%), Gaps = 7/92 (8%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRR---SSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
            MAI   RI+ AKQ LRR   S   TN    VPKGH  VYVGE++KKRFVIPISYLK PSF
Sbjct  1    MAIRFQRIIPAKQILRRILPSLESTN----VPKGHVPVYVGETQKKRFVIPISYLKHPSF  56

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            Q+LLSQAEEEFGFDH +GGLTIPC E+ F+D+
Sbjct  57   QNLLSQAEEEFGFDHPLGGLTIPCREEAFIDL  88



>ref|XP_003631553.1| PREDICTED: auxin-induced protein X15-like [Vitis vinifera]
Length=95

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 71/92 (77%), Gaps = 7/92 (8%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRR---SSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
            MAI   RI+ AKQ LRR   S   TN    VPKGH  VYVGE++KKRFVIPISYLK PSF
Sbjct  1    MAIRFQRIIPAKQILRRILPSLESTN----VPKGHVPVYVGETQKKRFVIPISYLKHPSF  56

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            Q+LLSQAEEEFGFDH +GGLTIPC E+ F+D+
Sbjct  57   QNLLSQAEEEFGFDHPLGGLTIPCREEAFIDL  88



>ref|XP_006384539.1| hypothetical protein POPTR_0004s17250g [Populus trichocarpa]
 gb|ERP62336.1| hypothetical protein POPTR_0004s17250g [Populus trichocarpa]
Length=94

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 71/89 (80%), Gaps = 3/89 (3%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI + RIL+AKQ L R SS      +V KG+ AVYVGE EKKRFVIP+S+L  PSFQ+L
Sbjct  2    MAIRLPRILQAKQHLLRGSSPAR---DVRKGYIAVYVGEEEKKRFVIPVSHLNQPSFQEL  58

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LS+AEEE+GFDHQMGGLTIPC ED F+D+
Sbjct  59   LSKAEEEYGFDHQMGGLTIPCREDIFIDL  87



>ref|XP_004170628.1| PREDICTED: auxin-induced protein 6B-like [Cucumis sativus]
Length=100

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE----IEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI+ +KQ L+RSSS  N E    ++VPKG+F VYVGE +KKRFVIP+SYL  PS
Sbjct  1    MGFRLPRIVTSKQSLQRSSSTGNGESPKAVDVPKGYFTVYVGEEQKKRFVIPLSYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQAEEEFG++H MGG+TIPC E+ F ++
Sbjct  61   FQDLLSQAEEEFGYNHPMGGITIPCSEEIFQNL  93



>emb|CBI37962.3| unnamed protein product [Vitis vinifera]
Length=136

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 71/92 (77%), Gaps = 7/92 (8%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRR---SSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
            MAI   RI+ AKQ LRR   S   TN    VPKGH  VYVGE++KKRFVIPISYLK PSF
Sbjct  1    MAIRFQRIIPAKQILRRILPSPESTN----VPKGHVPVYVGEAQKKRFVIPISYLKHPSF  56

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            Q+LLSQAEEEFGFDH +GGLTIPC E+ F+D+
Sbjct  57   QNLLSQAEEEFGFDHPLGGLTIPCREEAFIDL  88



>ref|XP_004301667.1| PREDICTED: uncharacterized protein LOC101297356 [Fragaria vesca 
subsp. vesca]
Length=197

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   +  I   K+ L RSSS  N    + +++PKG+FAVYVGES+KKRFVIPISYL  PS
Sbjct  99   MGFRLPGISNTKRSLTRSSSNGNQTASKTLDIPKGYFAVYVGESQKKRFVIPISYLNQPS  158

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            F DLLSQAEEEFG+DH MGG+TIPC EDTFL++
Sbjct  159  FMDLLSQAEEEFGYDHPMGGITIPCSEDTFLEL  191


 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 5/91 (5%)
 Frame = -2

Query  916  MAISMTR--ILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQ  743
            M IS T+  ++R+    ++++S+T   +E+PKG+FAVYVGES+KKRFVIPI+YL  PSF 
Sbjct  1    MGISNTKRSLIRSLSNGKQTASKT---LEIPKGYFAVYVGESQKKRFVIPIAYLNQPSFM  57

Query  742  DLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            DLLSQAEEEFG+DH MGG+TIPC E TFLD+
Sbjct  58   DLLSQAEEEFGYDHPMGGITIPCSEHTFLDL  88



>ref|XP_006423541.1| hypothetical protein CICLE_v10030014mg [Citrus clementina]
 gb|ESR36781.1| hypothetical protein CICLE_v10030014mg [Citrus clementina]
Length=98

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 2/91 (2%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREI--EVPKGHFAVYVGESEKKRFVIPISYLKDPSFQ  743
            MAI + RIL AKQ  RRS+   N+ I  +VPKG+ AVYVG+ EKKRFVIPIS+L +P FQ
Sbjct  1    MAIRLPRILHAKQVFRRSNFFPNQSIFIDVPKGNLAVYVGQCEKKRFVIPISFLNEPLFQ  60

Query  742  DLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            +LL +AEEEFGF+H MGGLTIPC E+ FLD+
Sbjct  61   ELLYKAEEEFGFNHPMGGLTIPCAEEMFLDL  91



>ref|XP_004301666.1| PREDICTED: uncharacterized protein LOC101297064 [Fragaria vesca 
subsp. vesca]
Length=206

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI   K+ L RSSS  N    + +++PKG+FAVYVGES+KKR+VIPISYL  PS
Sbjct  1    MGFRLPRISNTKRSLTRSSSNGNQTASKTLDIPKGYFAVYVGESQKKRYVIPISYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            F DLLSQAEEE+G+DH MGG+TIPC EDTFL++
Sbjct  61   FMDLLSQAEEEYGYDHPMGGITIPCSEDTFLEL  93


 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  877  GLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQ  698
            G R       +  ++PKG+FAVYVG+S+KKRFV+PISYL  P FQ LLSQAEEEFG+ H 
Sbjct  125  GFRLPRIANTKTSDIPKGYFAVYVGKSQKKRFVVPISYLNQPLFQHLLSQAEEEFGYHHP  184

Query  697  MGGLTIPCPEDTFLDI  650
            MGG+TIPC EDTF D+
Sbjct  185  MGGITIPCSEDTFTDL  200



>ref|XP_007041974.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
 gb|EOX97805.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
Length=95

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   + RI+ AKQGL+R+ S  +    VPKGHF VY+GE+EKKRFV+PIS LKDPSFQ+L
Sbjct  1    MGFRLLRIVSAKQGLKRTLS-FSETTPVPKGHFTVYIGEAEKKRFVVPISLLKDPSFQNL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L QAEEE+GF+H MG LTIPC E+ F+D+
Sbjct  60   LRQAEEEYGFNHPMGALTIPCSEEAFIDL  88



>ref|XP_009799442.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
 ref|XP_009799443.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=145

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (78%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I +T  ++A + LRRSS+       VPKGH AVYVGES+KKRFV+PISYL  P FQDL
Sbjct  54   MGIKVTPFIQATRTLRRSSTTGG----VPKGHCAVYVGESQKKRFVVPISYLSQPLFQDL  109

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEEEFGFDH MGGLTIPC ED F+D+
Sbjct  110  LAQAEEEFGFDHSMGGLTIPCKEDMFVDL  138



>ref|XP_006487294.1| PREDICTED: auxin-induced protein 10A5-like [Citrus sinensis]
Length=100

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS----SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +  I+ AKQ LR++    S   +    VPKGHFAVYVGE++KKRFVIP+S+L  PS
Sbjct  1    MAIHVPGIMHAKQILRQAKLIVSQGVSTSTVVPKGHFAVYVGENQKKRFVIPVSFLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ+LLS+AEEEFGFDH MGGLTIPC ED F+++
Sbjct  61   FQELLSKAEEEFGFDHPMGGLTIPCREDIFINV  93



>ref|XP_003631579.1| PREDICTED: auxin-induced protein X15 [Vitis vinifera]
Length=95

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 71/92 (77%), Gaps = 7/92 (8%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRR---SSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
            MAI   RI+ AKQ LRR   S+  TN    VPKGH  VYVGE++KKRFVIPISYLK PSF
Sbjct  1    MAIHFQRIIPAKQILRRILPSAESTN----VPKGHVPVYVGETQKKRFVIPISYLKHPSF  56

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            Q+LLSQA EEFGFDH +GGLTIPC E+ F+D+
Sbjct  57   QNLLSQAAEEFGFDHPLGGLTIPCREEAFIDL  88



>ref|XP_004144906.1| PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]
 ref|XP_004162917.1| PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]
 gb|KGN43207.1| hypothetical protein Csa_7G009030 [Cucumis sativus]
Length=98

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 2/91 (2%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN--REIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQ  743
            M   + RI++AKQ LRRSSS  N    ++VPKG+F VYVG+ +KKRFVIP+SYL +P+FQ
Sbjct  1    MGFRLPRIVQAKQSLRRSSSTGNGTTAVDVPKGYFTVYVGDVQKKRFVIPLSYLNEPTFQ  60

Query  742  DLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            DLL+QAEEEFG+DH MGG+TI C E+ FL +
Sbjct  61   DLLNQAEEEFGYDHPMGGITISCSEELFLGL  91



>ref|XP_007135905.1| hypothetical protein PHAVU_009G001700g [Phaseolus vulgaris]
 gb|ESW07899.1| hypothetical protein PHAVU_009G001700g [Phaseolus vulgaris]
Length=98

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 69/93 (74%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNR----EIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +  +L AK  LRRSS   N      ++VPKGHFAVYVGE EKKRFVIP+SYL  PS
Sbjct  1    MAIRLPSVLSAKHILRRSSLFPNHAAATSLDVPKGHFAVYVGEGEKKRFVIPVSYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ+LLS AEEEFGF H MGGL IPC ++ FL+I
Sbjct  61   FQELLSIAEEEFGFSHPMGGLIIPCSQEFFLNI  93



>ref|XP_002312994.1| auxin-responsive family protein [Populus trichocarpa]
 gb|EEE86949.1| auxin-responsive family protein [Populus trichocarpa]
Length=93

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (78%), Gaps = 3/89 (3%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI + RIL+ KQ + R SS      +V KG+ AVYVGE EKKRFVIP+SYL  PSFQDL
Sbjct  2    MAIRLPRILQVKQNILRGSSAAK---DVRKGYIAVYVGEEEKKRFVIPVSYLNQPSFQDL  58

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LS+AEEEFGF+H MGGLTIPC ED F+D+
Sbjct  59   LSKAEEEFGFEHPMGGLTIPCREDIFIDL  87



>gb|EYU37894.1| hypothetical protein MIMGU_mgv1a020073mg [Erythranthe guttata]
Length=88

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -2

Query  883  KQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFD  704
            +Q LRRS S   R IEVPKGHFAV VGESEKKRFVIP+SYL  P FQDLL +AEEEFGF 
Sbjct  4    RQMLRRSLSNERRSIEVPKGHFAVNVGESEKKRFVIPLSYLNHPLFQDLLCRAEEEFGFH  63

Query  703  HQMGGLTIPCPEDTFLDI  650
            H MGGLTIPC ED F+D+
Sbjct  64   HPMGGLTIPCSEDRFVDL  81



>ref|XP_002312996.1| hypothetical protein POPTR_0009s12950g [Populus trichocarpa]
 gb|EEE86951.1| hypothetical protein POPTR_0009s12950g [Populus trichocarpa]
Length=98

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 6/93 (6%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE----IEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +  +  AKQ LRRS S  N+     ++VPKG  AVYVGE+EKKRFV+P+SYL  PS
Sbjct  1    MAIRLPGL--AKQSLRRSFSTANKASSKYLDVPKGFLAVYVGETEKKRFVVPVSYLNQPS  58

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLS+AE+EFGFDH MGGLTIPC E+TFL +
Sbjct  59   FQDLLSKAEDEFGFDHPMGGLTIPCAEETFLHV  91



>ref|XP_008237099.1| PREDICTED: auxin-induced protein 15A-like [Prunus mume]
Length=128

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIE----VPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   +  I+ AK+ L RS S +N+  E    +PKG+FAVYVGES+KKRFVIP+SYL +P 
Sbjct  1    MGFRLPGIVNAKRSLIRSRSTSNQTAESKTDIPKGYFAVYVGESQKKRFVIPVSYLNEPL  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            F DLLSQAEEEFG+DH MGG+TIPC E+TFLD+
Sbjct  61   FLDLLSQAEEEFGYDHPMGGITIPCSENTFLDL  93



>ref|XP_006423537.1| hypothetical protein CICLE_v10029871mg [Citrus clementina]
 gb|ESR36777.1| hypothetical protein CICLE_v10029871mg [Citrus clementina]
Length=100

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS----SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +  I+ AKQ LR+S    S  T++ ++VPKG+ AVYVGE +KKRF+IP+S+L  PS
Sbjct  1    MAIRVPGIMHAKQILRQSKLCASQATSKSVDVPKGYLAVYVGERQKKRFIIPVSFLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ+LLS+AEEEFGF+H MGGLTIPC E+ F+DI
Sbjct  61   FQELLSKAEEEFGFNHPMGGLTIPCKEEIFIDI  93



>ref|XP_002271427.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
Length=97

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = -2

Query  916  MAISMTRIL-RAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQD  740
            M I +  ++  AKQ L+  S     + +VPKGHFAVYVGE +KKRFV+PISYL  PSFQD
Sbjct  1    MGIRLPSVISNAKQILKLQSVHIRSQSDVPKGHFAVYVGEIQKKRFVVPISYLNHPSFQD  60

Query  739  LLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LL QAEEEFGF+H MGGLTIPC E+TF+D+
Sbjct  61   LLQQAEEEFGFNHSMGGLTIPCKEETFIDL  90



>ref|XP_010246391.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=101

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 69/96 (72%), Gaps = 6/96 (6%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS------SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKD  755
            M   + R+L  K+ LRRS       S  +    VPKGH AVYVGE+EK+RFVIP+SYL  
Sbjct  1    MGFRLPRLLPTKEILRRSLSGGRNQSLCSTTANVPKGHLAVYVGEAEKRRFVIPVSYLNH  60

Query  754  PSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            PSFQDLL QAEEEFGFDH MGGLTIPC EDTF+ ++
Sbjct  61   PSFQDLLGQAEEEFGFDHPMGGLTIPCKEDTFIHLL  96



>ref|XP_010649243.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CBI17631.3| unnamed protein product [Vitis vinifera]
Length=96

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I +  +++AKQ L+  S  +    EVPKGHFAVYVGE EKKR+V+PISYL  PSF+ L
Sbjct  1    MGIRLPSVVQAKQILKLQSLLSRNRAEVPKGHFAVYVGEIEKKRYVVPISYLNHPSFRSL  60

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L QAEEEFGF+H MGGLTIPC E  FLD+
Sbjct  61   LCQAEEEFGFNHPMGGLTIPCEEHAFLDL  89



>gb|KDO46704.1| hypothetical protein CISIN_1g036136mg [Citrus sinensis]
Length=100

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 73/93 (78%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIE----VPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +  I+ AKQ LR++    ++ +     VPKGHFAVYVGE++KKRFVIP+S+L  PS
Sbjct  1    MAIHVPGIMHAKQILRQAKLIVSQGVSTSKVVPKGHFAVYVGENQKKRFVIPVSFLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ+LLS+AEEEFGFDH MGGLTIPC ED F+++
Sbjct  61   FQELLSKAEEEFGFDHPMGGLTIPCREDIFINV  93



>ref|XP_002312998.1| hypothetical protein POPTR_0009s12930g [Populus trichocarpa]
 gb|EEE86953.1| hypothetical protein POPTR_0009s12930g [Populus trichocarpa]
Length=99

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 70/93 (75%), Gaps = 5/93 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSS----RTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +   L AKQ LRR  S      ++  +VPKG  AVYVGE+EKKRFV+P+SYL   S
Sbjct  1    MAIRLLGFL-AKQSLRRPVSCAHKAASKSSDVPKGFLAVYVGETEKKRFVVPVSYLNQAS  59

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLS+AEEEFGFDH MGGLTIPC EDTFLD+
Sbjct  60   FQDLLSKAEEEFGFDHPMGGLTIPCAEDTFLDV  92



>ref|XP_007201447.1| hypothetical protein PRUPE_ppa013863mg [Prunus persica]
 gb|EMJ02646.1| hypothetical protein PRUPE_ppa013863mg [Prunus persica]
Length=99

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 71/93 (76%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIE----VPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   +  I+ AK+ L RS S + R  E    +PKG+FAVYVGES+KKRFVIP+SYL +P 
Sbjct  1    MGFRLPGIVNAKRSLIRSRSTSKRTAESKTDIPKGYFAVYVGESQKKRFVIPVSYLNEPL  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            F DLLSQAEEEFG+DH MGG+TIPC E+TFLD+
Sbjct  61   FLDLLSQAEEEFGYDHPMGGITIPCSENTFLDL  93



>ref|XP_006362802.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=91

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 69/89 (78%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I M+ I++  + LRR S+       VPKGH AVYVGES+KKRFV+PISYL  P FQDL
Sbjct  1    MGIKMSPIIQGTRILRRFSNSGG----VPKGHCAVYVGESQKKRFVVPISYLSQPLFQDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEE+FGFDHQMGGLTIPC ED F+D+
Sbjct  57   LTQAEEQFGFDHQMGGLTIPCKEDVFVDL  85



>ref|XP_008360591.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
 ref|XP_008367340.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=102

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 68/95 (72%), Gaps = 6/95 (6%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS------SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKD  755
            M I +  I  AKQ L+R+      S+  N   EVPKGHFAVYVGE EKKRFVIPISYL  
Sbjct  1    MGIKLMGIAHAKQKLQRTLSARYGSAADNTSTEVPKGHFAVYVGEDEKKRFVIPISYLNH  60

Query  754  PSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            P FQDLL++AEEEFG+DH  GGLTIPC ED F+ +
Sbjct  61   PLFQDLLNKAEEEFGYDHPTGGLTIPCSEDYFVSL  95



>ref|XP_009592061.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=92

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (78%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I +T  ++A + LRRSS+       VPKGH AVYVGES+KKRFV+PISYL  P FQDL
Sbjct  1    MGIKVTPFIQASRILRRSSTTGG----VPKGHCAVYVGESQKKRFVMPISYLSQPLFQDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEEEFGFDH MGGLTIPC ED F+D+
Sbjct  57   LAQAEEEFGFDHPMGGLTIPCKEDVFIDL  85



>ref|XP_007041977.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
 gb|EOX97808.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
Length=95

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   + RI+ AKQ L+R+ S  +    VPKGHFAVYVGE+EKKRFV+PIS+LKDPSFQ+L
Sbjct  1    MGFRLPRIVSAKQSLKRTLS-FSETTPVPKGHFAVYVGEAEKKRFVVPISFLKDPSFQNL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEE+GF H  G LTIPC E+ F+D+
Sbjct  60   LSQAEEEYGFYHPRGALTIPCSEEAFIDL  88



>ref|XP_006487310.1| PREDICTED: auxin-induced protein X10A-like [Citrus sinensis]
 gb|KDO46702.1| hypothetical protein CISIN_1g039975mg [Citrus sinensis]
Length=100

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 73/93 (78%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS----SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +  I+ AKQ LR+S    S  T++ ++VPKG+ AVYVGE +KKRF+IP+S+L  PS
Sbjct  1    MAIRVPGIMHAKQILRQSKLCASQATSKSVDVPKGYLAVYVGERQKKRFIIPVSFLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ+LLS+AEEEFGF+H MGGLTIPC E  F+DI
Sbjct  61   FQELLSKAEEEFGFNHPMGGLTIPCKEKLFIDI  93



>ref|XP_002271620.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CAN65269.1| hypothetical protein VITISV_040136 [Vitis vinifera]
Length=95

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 69/92 (75%), Gaps = 7/92 (8%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRR---SSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
            MAI   RI+  KQ LRR   S   TN    VPKGH  VYVGE+EKKRFVIPISYLK PSF
Sbjct  1    MAIRFQRIIPTKQILRRILPSPESTN----VPKGHVPVYVGETEKKRFVIPISYLKHPSF  56

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            Q+LLSQAEEEFGFDH +G LTIPC E+ F+D+
Sbjct  57   QNLLSQAEEEFGFDHPLGALTIPCREEAFIDL  88



>ref|XP_009368350.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=99

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRT----NREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   +  I+ AK+ L RS S +    ++ +++PKG+FAVYVGE +KKRFVIPISYL DP 
Sbjct  1    MGFRLPGIVSAKRSLVRSLSNSKQTASKTLDIPKGYFAVYVGERQKKRFVIPISYLNDPL  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ+LLSQAEEEFG+DH MGG+TIPC EDTFL +
Sbjct  61   FQNLLSQAEEEFGYDHPMGGITIPCSEDTFLHL  93



>ref|XP_011088521.1| PREDICTED: auxin-induced protein 15A-like [Sesamum indicum]
Length=92

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 65/85 (76%), Gaps = 4/85 (5%)
 Frame = -2

Query  892  LRAKQGLRRSSSRTNRE----IEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQA  725
            +  +Q LRRS S   R      +VPKGHFAVYVGESEKKRFVIP+SYL  PSFQDLL QA
Sbjct  1    MAIRQMLRRSLSTERRSSSSGTQVPKGHFAVYVGESEKKRFVIPMSYLNHPSFQDLLCQA  60

Query  724  EEEFGFDHQMGGLTIPCPEDTFLDI  650
            EEEFGF H MGGLTIPC ED F+DI
Sbjct  61   EEEFGFHHPMGGLTIPCSEDLFVDI  85



>gb|EYU37888.1| hypothetical protein MIMGU_mgv1a023157mg [Erythranthe guttata]
Length=83

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R  +VPKGHFAVYVGESEKKRFVIP+SYL +PSFQ+LL Q EEEFGF H M
Sbjct  2    LRRSLSAEKRSNQVPKGHFAVYVGESEKKRFVIPLSYLNNPSFQELLCQTEEEFGFHHSM  61

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC E+ F+D+
Sbjct  62   GGLTIPCTEELFIDL  76



>ref|XP_007041975.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
 gb|EOX97806.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
Length=94

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   + RI+ AK+ L+R+ S +   + VPKGHFAVYVGE EKKRFV+PIS+LK  SFQ+L
Sbjct  1    MGFRLPRIVNAKRSLKRTLSFSETTV-VPKGHFAVYVGEVEKKRFVVPISFLKHHSFQNL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            LS+AEEE+GF+H MG LTIPC E+ FLDII
Sbjct  60   LSEAEEEYGFNHPMGALTIPCSEEAFLDII  89



>ref|XP_010315356.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=84

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 10/89 (11%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI + RI++          +++  ++VPKGHFAVYVGE +KKRFVIPISYL   SFQDL
Sbjct  1    MAIRVPRIIK----------KSSTSLQVPKGHFAVYVGEKQKKRFVIPISYLSQSSFQDL  50

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGFDH MGG+TIPCPED F+ I
Sbjct  51   LSQAEEEFGFDHPMGGVTIPCPEDIFIAI  79



>ref|XP_010095660.1| hypothetical protein L484_012231 [Morus notabilis]
 gb|EXB61799.1| hypothetical protein L484_012231 [Morus notabilis]
Length=93

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI +  +  AKQ LRRSSS +   ++VPKG+FAVYVGES+KKR V+PIS L +PSFQ+L
Sbjct  1    MAIRLPGLSNAKQILRRSSSAST-PVDVPKGYFAVYVGESKKKRHVVPISLLNEPSFQEL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LS+AEEEFG++H MGGLTIPC ED F+D+
Sbjct  60   LSRAEEEFGYNHPMGGLTIPCREDIFIDL  88



>ref|XP_006423540.1| hypothetical protein CICLE_v10029650mg [Citrus clementina]
 gb|ESR36780.1| hypothetical protein CICLE_v10029650mg [Citrus clementina]
Length=100

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 73/93 (78%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIE----VPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +  I+ AKQ LR++    ++ +     VPKGHFAVYVGE++KKRFVIP+S+L  PS
Sbjct  1    MAIHVPGIMYAKQILRQAKLIVSQGVSTSKVVPKGHFAVYVGENQKKRFVIPVSFLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ+LLS+AEEEFGFDH MGGLTIPC ED F+++
Sbjct  61   FQELLSKAEEEFGFDHPMGGLTIPCREDIFINV  93



>ref|XP_004151832.1| PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]
Length=100

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 4/91 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI+ AK  L+RSSS  N    + I+VPKG+F VYVGE EKKRFVIP+SYL   S
Sbjct  1    MGFRLPRIVTAKPSLQRSSSTGNGASPKSIDVPKGYFTVYVGEVEKKRFVIPLSYLNQSS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFL  656
            FQDLLSQAEEEFG++H MGG+TIPC ED FL
Sbjct  61   FQDLLSQAEEEFGYNHPMGGITIPCSEDFFL  91



>ref|XP_010246392.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=102

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 69/96 (72%), Gaps = 6/96 (6%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE------IEVPKGHFAVYVGESEKKRFVIPISYLKD  755
            M   + R+L  K+ LRRS S    +      + VPKGH AVYVGE+EK+RFVIP+SYL  
Sbjct  1    MGFRLPRLLHTKEILRRSLSGGRNQSLWSTTVNVPKGHLAVYVGEAEKRRFVIPVSYLNH  60

Query  754  PSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            PSFQ+LL Q EEEFGFDH MGGLTIPC EDTF+ ++
Sbjct  61   PSFQELLGQVEEEFGFDHPMGGLTIPCKEDTFIHLL  96



>gb|EYU18549.1| hypothetical protein MIMGU_mgv1a023719mg [Erythranthe guttata]
Length=88

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -2

Query  880  QGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDH  701
            Q LRRS S   +  EVPKGH AVYVGESEKKRFVIP+SYL  PSFQDLL +AEEEFGF H
Sbjct  5    QILRRSLSSERKSTEVPKGHLAVYVGESEKKRFVIPLSYLNHPSFQDLLCRAEEEFGFHH  64

Query  700  QMGGLTIPCPEDTFLDI  650
             MGGLTIPC ED F+D+
Sbjct  65   PMGGLTIPCNEDLFVDL  81



>ref|XP_008391973.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=101

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE-----IEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M   +  +L AK+ LRRS S T R      ++VPKG+FAVYVGE+EK+R+VIP+S+L +P
Sbjct  1    MGFRLPAVLPAKKLLRRSFSNTTRGASTNLVDVPKGYFAVYVGENEKQRYVIPVSFLNEP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
             FQDL+SQAEEEFGFDH MGGLTIPC +D FL +
Sbjct  61   EFQDLVSQAEEEFGFDHPMGGLTIPCRQDAFLHL  94



>ref|XP_009368374.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=101

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 5/95 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRT-----NREIEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M   +  ++ AK+ L+RS S +     N   +VPKG+F VYVGESEK+RFV+PIS+L  P
Sbjct  1    MGFRLPVVIPAKKLLQRSLSNSSQGASNNLADVPKGYFPVYVGESEKQRFVVPISFLNQP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            +FQDLLS AEEEFGFDH MGGLTIPC +DTFLD+I
Sbjct  61   AFQDLLSAAEEEFGFDHPMGGLTIPCRQDTFLDLI  95



>ref|XP_006423549.1| hypothetical protein CICLE_v10030017mg [Citrus clementina]
 gb|ESR36789.1| hypothetical protein CICLE_v10030017mg [Citrus clementina]
 gb|KDO42784.1| hypothetical protein CISIN_1g047875mg [Citrus sinensis]
Length=92

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI   +I+ AKQ LRR+    +    VPKGHFAVY+GE EKKRFV+PIS+LK PSFQ+L
Sbjct  1    MAIRFPKIVNAKQALRRAF-MASEAATVPKGHFAVYIGEFEKKRFVVPISHLKHPSFQNL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQA EEFGFDH MG LTIPC E  F D+
Sbjct  60   LSQAGEEFGFDHPMGVLTIPCSEQVFFDL  88



>gb|EYU35291.1| hypothetical protein MIMGU_mgv1a017210mg [Erythranthe guttata]
Length=88

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R  EVPKGH AVY+GESEKKRFVIP+SYL  PSFQ+LL QAEEEFGF H M
Sbjct  7    LRRSLSGEKRSTEVPKGHLAVYIGESEKKRFVIPLSYLNHPSFQELLCQAEEEFGFHHPM  66

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC ED F+D+
Sbjct  67   GGLTIPCSEDLFVDL  81



>ref|XP_009620278.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
 ref|XP_009620279.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=86

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 69/90 (77%), Gaps = 10/90 (11%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI M RI++          ++++  +VPKGHFAVYVGE +KKRFVIPIS+L  P FQDL
Sbjct  1    MAIRMPRIIK----------KSSKAGDVPKGHFAVYVGEKQKKRFVIPISFLSQPLFQDL  50

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            LSQAEEEFGFDH MGGLTIPC ED F+D+I
Sbjct  51   LSQAEEEFGFDHPMGGLTIPCDEDVFIDLI  80



>ref|XP_004144905.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Cucumis 
sativus]
Length=100

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI+ +KQ L+RSSS  N    + ++VPKG+F VYVGE  KKRFVIP+SYL  PS
Sbjct  1    MGFRLPRIVTSKQSLQRSSSTGNGASPKVVDVPKGYFTVYVGEEHKKRFVIPLSYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQAEEEFG++H MGG+TIPC E+ F ++
Sbjct  61   FQDLLSQAEEEFGYNHPMGGITIPCSEEIFQNL  93



>ref|XP_009592053.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=92

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 68/89 (76%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I +T  ++A + LRRSS+       VPKGH  VYVGES+KKRFV+PISYL  P FQDL
Sbjct  1    MGIKVTPFIQANRILRRSSTTGG----VPKGHCTVYVGESQKKRFVVPISYLSQPLFQDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEEEFGFDH MGGLTIPC ED F+D+
Sbjct  57   LAQAEEEFGFDHPMGGLTIPCKEDVFIDL  85



>ref|XP_008372889.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=94

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = -2

Query  892  LRAKQGLRRSSSR--TNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEE  719
            L  K+  R S+S    +R + VPKG+FAVYVGE ++KRFVIPISYL DPSFQDLLSQAEE
Sbjct  5    LPGKKNHRHSTSNQAASRAVNVPKGYFAVYVGEXQRKRFVIPISYLNDPSFQDLLSQAEE  64

Query  718  EFGFDHQMGGLTIPCPEDTFLDII  647
            EFG+DH MGG+TIPC ED FL +I
Sbjct  65   EFGYDHPMGGITIPCSEDRFLHLI  88



>ref|XP_004290376.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Fragaria 
vesca subsp. vesca]
Length=94

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   +  I  AK+ L RS S + + +++PKG+FAVYVGES+KKRFVIPISYL  PSFQDL
Sbjct  1    MGFRLPAIANAKKILTRSLSGS-KTLDIPKGYFAVYVGESQKKRFVIPISYLNHPSFQDL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEE+G+DH MGG+T PC E TFLD+
Sbjct  60   LSQAEEEYGYDHPMGGITFPCNEHTFLDL  88



>ref|XP_009368370.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=101

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 5/95 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRT-----NREIEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M   +  ++ AK+ L+RS S +     N   +VPKG+F VYVGESEK+RFV+PIS+L  P
Sbjct  1    MGFRLPSVISAKKLLQRSLSNSSQGASNNLADVPKGYFPVYVGESEKQRFVVPISFLNQP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            +FQDLLS AEEEFGFDH MGGLTIPC +D FLD+I
Sbjct  61   AFQDLLSAAEEEFGFDHPMGGLTIPCRQDAFLDLI  95



>ref|XP_010649235.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100246251 
[Vitis vinifera]
Length=208

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 72/97 (74%), Gaps = 7/97 (7%)
 Frame = -2

Query  919  RMAISMTRILRAKQGLRRSSSRTNREI-------EVPKGHFAVYVGESEKKRFVIPISYL  761
            R  + M  IL AKQ L+  S  T  ++       EVPKGHFAVYVGE+EKKRFV+PISYL
Sbjct  105  RRWVCMPSILHAKQILKLQSLLTRSQLSVSSTTAEVPKGHFAVYVGETEKKRFVVPISYL  164

Query  760  KDPSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
             +PSFQ LLS AEEEFGF+H MGG+TIPC E++F+D+
Sbjct  165  NNPSFQKLLSHAEEEFGFNHPMGGVTIPCKEESFIDL  201


 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 64/96 (67%), Gaps = 7/96 (7%)
 Frame = -2

Query  916  MAISMTRILRAKQGL-------RRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLK  758
            M I +  I++AKQ L       R   S + +  EVPKGHF VYVGE+++KRFV+PISY  
Sbjct  1    MGIHLPSIVQAKQILKVDPLLTRSQLSISTKASEVPKGHFVVYVGEAQRKRFVVPISYRN  60

Query  757  DPSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            +PSF   LS AEEEFGF H MGG+TI C E  F+DI
Sbjct  61   NPSFLKXLSHAEEEFGFKHPMGGVTILCNEGAFIDI  96



>ref|XP_009347320.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=98

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 5/95 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE-----IEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M      +  AK+ LRRS S +++       +VPKG+ AVYVGE+E+KRFVIPISYL  P
Sbjct  1    MGFRRPSVTHAKKILRRSFSNSSQGGSYNLADVPKGYLAVYVGENERKRFVIPISYLNQP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            SFQDLLS+AE+EFGFDH MGGLTIPC +DTF+DII
Sbjct  61   SFQDLLSEAEQEFGFDHPMGGLTIPCRQDTFIDII  95



>ref|XP_010271400.1| PREDICTED: auxin-induced protein 6B-like [Nelumbo nucifera]
Length=100

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 67/93 (72%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS----SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M I +  +  AK  LRRS    +  T+  ++VPKGH  VYVGE+ KKRFV+PISYL  PS
Sbjct  1    MGIRLPALFHAKMILRRSFLTANHSTSAALDVPKGHLVVYVGETLKKRFVVPISYLNHPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLL+QAEEEFGF H MGGLTIPC ED F D+
Sbjct  61   FQDLLTQAEEEFGFHHPMGGLTIPCKEDAFTDL  93



>ref|XP_004290377.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Fragaria 
vesca subsp. vesca]
Length=94

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   +  I  AK+ L RS S  ++ +++PKG+FAVYVGES+KKRFV+PISYL  PSFQDL
Sbjct  1    MGFRLPAITSAKKSLSRSLS-GSKTLDIPKGYFAVYVGESQKKRFVVPISYLNHPSFQDL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L QAEEEFGFDH MGG+TIPC E TF+++
Sbjct  60   LRQAEEEFGFDHPMGGITIPCSEHTFVEL  88



>ref|XP_003631580.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
Length=95

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI   RI+ AKQ LRR  S +     VPKGH  +YVGE +KKRFVIPISYLK PSFQ+L
Sbjct  1    MAIRFQRIIPAKQILRRILS-SPESTNVPKGHVPIYVGEYQKKRFVIPISYLKHPSFQNL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGFDH +G LTIPC E+ F+D+
Sbjct  60   LSQAEEEFGFDHPLGALTIPCREEAFIDL  88



>ref|XP_009368356.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus 
x bretschneideri]
Length=100

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN-----REIEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M   + RI+ AK+ L RS S +N     +  ++PKG+FAVYVGE +KKRFVIPISYL +P
Sbjct  1    MGFLLPRIVTAKRTLIRSLSSSNQTADSKTTDIPKGYFAVYVGERQKKRFVIPISYLNEP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
             F DLLSQAEEEFG+DH MGG+TIPC EDTFL +
Sbjct  61   LFLDLLSQAEEEFGYDHPMGGITIPCSEDTFLHL  94



>ref|XP_003522807.1| PREDICTED: auxin-induced protein 10A5-like [Glycine max]
 gb|KHN33703.1| Auxin-induced protein 10A5 [Glycine soja]
Length=106

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 69/93 (74%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNR----EIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +  +L AK  LRRS+   N      ++VPKGHFAVYVGE EK+R+VIP+SYL  PS
Sbjct  1    MAIRLPSVLSAKYILRRSNLFANHAATTSLDVPKGHFAVYVGEGEKRRYVIPVSYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ+LLS AEEEFGF H MGGL IPC E+ FL+I
Sbjct  61   FQELLSIAEEEFGFSHPMGGLIIPCTEENFLNI  93



>ref|XP_008392045.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=101

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 75/95 (79%), Gaps = 5/95 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREI-----EVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M   +  ++ AK+ LRRS S +++++     +VPKG+F VYVG+SEK+RFV+PIS L  P
Sbjct  1    MGFRLPSVIPAKKLLRRSFSNSSQQVSYNLADVPKGYFPVYVGKSEKQRFVVPISILNQP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            SFQDLLS+AEEEFG+DH MGG+TIPC +DTFLD+I
Sbjct  61   SFQDLLSEAEEEFGYDHPMGGVTIPCRQDTFLDLI  95



>ref|XP_002306151.1| hypothetical protein POPTR_0004s17190g [Populus trichocarpa]
 gb|EEE86662.1| hypothetical protein POPTR_0004s17190g [Populus trichocarpa]
Length=99

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 7/93 (8%)
 Frame = -2

Query  904  MTRILRA---KQGLRRS----SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
            MTR L A   KQ LRRS    S   +R ++VPKG  AVY+GE EKKRFV+P+SYL +PSF
Sbjct  1    MTRHLAAALAKQILRRSVWNASKPASRSLDVPKGFLAVYIGEREKKRFVVPVSYLNEPSF  60

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            QDLL++AEEEFGF+H MGGLTIPC ED F+D++
Sbjct  61   QDLLTKAEEEFGFNHPMGGLTIPCREDKFIDVL  93



>ref|XP_004173148.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein X10A-like 
[Cucumis sativus]
Length=100

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 68/91 (75%), Gaps = 4/91 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI+ AK  L+RSSS  N    + I+VPKG+F VYVGE EKKRFV PISYL   S
Sbjct  1    MGFRLPRIVTAKPSLQRSSSTGNGASPKSIDVPKGYFTVYVGEVEKKRFVXPISYLNQSS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFL  656
            FQDLLSQAEEEFG++H MGG+TIPC ED FL
Sbjct  61   FQDLLSQAEEEFGYNHPMGGITIPCSEDFFL  91



>ref|XP_002271594.1| PREDICTED: auxin-induced protein 15A-like [Vitis vinifera]
Length=98

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 69/96 (72%), Gaps = 7/96 (7%)
 Frame = -2

Query  916  MAISMTRILRAKQGL-------RRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLK  758
            M I    I++AKQ L       R  SS +    EVPKGHFAVYVGE ++KRFV+P+SYL 
Sbjct  1    MGIRFPSIVQAKQILKLHSPFTRSQSSISTEASEVPKGHFAVYVGEGQRKRFVVPLSYLN  60

Query  757  DPSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            +PSFQ LLS AEEEFGF+H MGG+TIPC ED F+DI
Sbjct  61   NPSFQKLLSHAEEEFGFNHPMGGVTIPCNEDAFIDI  96



>ref|XP_010647407.1| PREDICTED: auxin-induced protein X15-like [Vitis vinifera]
Length=95

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI   RI+RAKQ   R    +    +VPKGHF VYVGE++KKRFVIPISYLK PSFQ L
Sbjct  1    MAIRFQRIIRAKQ-FPRCILPSLETTDVPKGHFPVYVGETQKKRFVIPISYLKHPSFQKL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGFDH  GGLTIPC E+ F+++
Sbjct  60   LSQAEEEFGFDHPQGGLTIPCREEVFINL  88



>gb|KGN43205.1| hypothetical protein Csa_7G009010 [Cucumis sativus]
Length=100

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 69/91 (76%), Gaps = 4/91 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + RI+ AK  L+RSSS  N    + I+VPKG+F VYVGE EKKRFVIP+SYL   S
Sbjct  1    MGFRLPRIVTAKPSLQRSSSTGNGASPKSIDVPKGYFTVYVGEVEKKRFVIPLSYLNQSS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFL  656
            FQDLLSQ+EEEFG++H MGG+TIPC ED FL
Sbjct  61   FQDLLSQSEEEFGYNHPMGGITIPCSEDFFL  91



>gb|KDP27620.1| hypothetical protein JCGZ_19625 [Jatropha curcas]
Length=96

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 75/91 (82%), Gaps = 2/91 (2%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSR-TNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQD  740
            MA  ++ +L AKQ LR S+++ ++R   VPKG  AVY+GE+EKKRF++P+SYL + SFQD
Sbjct  1    MARYLSAVL-AKQILRGSANKASSRYSNVPKGFLAVYIGETEKKRFLVPVSYLNESSFQD  59

Query  739  LLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            LLS+AEEE+GFDH MGGLTIPC EDTF+D+I
Sbjct  60   LLSRAEEEYGFDHPMGGLTIPCREDTFIDVI  90



>gb|EYU40725.1| hypothetical protein MIMGU_mgv1a017774mg [Erythranthe guttata]
Length=88

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R  EVPKGH AVYVGE+EKKRFVIP+SYL  P FQ+LL QAEEEFGF H M
Sbjct  7    LRRSLSAEKRSTEVPKGHLAVYVGENEKKRFVIPVSYLNHPLFQELLCQAEEEFGFHHPM  66

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC ED F+D+
Sbjct  67   GGLTIPCTEDLFIDL  81



>ref|XP_010271401.1| PREDICTED: uncharacterized protein LOC104607462 [Nelumbo nucifera]
Length=203

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSS-SRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQD  740
            M I +  I+ AK  LRRS  S +     VPKGHFAVYVGE++KKRF++PISYL  PSFQD
Sbjct  1    MGIRLPGIVHAKAILRRSLISPSAPTANVPKGHFAVYVGEAQKKRFIVPISYLSHPSFQD  60

Query  739  LLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LL QAEEEFGF H MGGLTIPC ED FLD+
Sbjct  61   LLGQAEEEFGFHHPMGGLTIPCKEDQFLDL  90


 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 73/103 (71%), Gaps = 5/103 (5%)
 Frame = -2

Query  943  HWFKKKHPRMAISMTRILRAKQGLRRSSSRTN-----REIEVPKGHFAVYVGESEKKRFV  779
            +W  +K   MA+ +  ++ AK+  +RS  R N        +VPKGHFAVYVG +EKKRF+
Sbjct  95   NWNSRKLQLMAVRVPGMVHAKEIFKRSLLRRNLLPSATMTDVPKGHFAVYVGVNEKKRFI  154

Query  778  IPISYLKDPSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            +PISYL  PSFQDLL++AEEEFGF H  GGLTIPC E+TF+ +
Sbjct  155  VPISYLNHPSFQDLLNKAEEEFGFKHPTGGLTIPCKEETFIGL  197



>ref|XP_010108330.1| hypothetical protein L484_000421 [Morus notabilis]
 ref|XP_010112282.1| hypothetical protein L484_014964 [Morus notabilis]
 ref|XP_010112284.1| hypothetical protein L484_014966 [Morus notabilis]
 gb|EXC33085.1| hypothetical protein L484_014964 [Morus notabilis]
 gb|EXC33087.1| hypothetical protein L484_014966 [Morus notabilis]
 gb|EXC54957.1| hypothetical protein L484_000421 [Morus notabilis]
Length=102

 Score =   119 bits (298),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 4/94 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE----IEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + R++ AK+ L+RS S +N+     ++VPKGHFAVYVGE EKKR+V+P+S L  PS
Sbjct  1    MGFRLPRVVPAKKFLQRSFSNSNKAASMAVDVPKGHFAVYVGEHEKKRYVVPLSLLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            FQDLL QAEEE+GFDH  GGLTIPC ED F+D++
Sbjct  61   FQDLLIQAEEEYGFDHPTGGLTIPCREDAFVDLV  94



>ref|XP_010649236.1| PREDICTED: auxin-induced protein 15A-like [Vitis vinifera]
Length=103

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -2

Query  898  RILRAKQGLRRS-SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAE  722
            +IL+ +  L RS SS      EVPKGHFAVYVGE+EKKRFV+PISYL +PSFQ LLS AE
Sbjct  13   QILKLQSLLTRSQSSILATTAEVPKGHFAVYVGEAEKKRFVVPISYLNNPSFQKLLSHAE  72

Query  721  EEFGFDHQMGGLTIPCPEDTFLDI  650
            EEFGF+H MGG+TIPC ED F+D+
Sbjct  73   EEFGFNHPMGGVTIPCNEDAFIDL  96



>emb|CBI17628.3| unnamed protein product [Vitis vinifera]
Length=84

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  895  ILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEE  716
            ++ A+Q L+  S  T +  EVPKGHFAVYVGE ++KRFV+P+SYL +PSFQ LLS AEEE
Sbjct  1    MVHARQILKLQSLLTRKASEVPKGHFAVYVGEGQRKRFVVPLSYLNNPSFQKLLSHAEEE  60

Query  715  FGFDHQMGGLTIPCPEDTFLDI  650
            FGF+H MGG+TIPC ED F+DI
Sbjct  61   FGFNHPMGGVTIPCNEDAFIDI  82



>gb|EYU35280.1| hypothetical protein MIMGU_mgv1a023363mg [Erythranthe guttata]
Length=88

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -2

Query  883  KQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFD  704
            +Q L+RS S   R  EVPKGH AVYVGE+EKKRFVIP+SYL  PSFQDLL QAEEEF + 
Sbjct  4    RQILKRSLSNERRSNEVPKGHLAVYVGENEKKRFVIPLSYLNHPSFQDLLCQAEEEFRYH  63

Query  703  HQMGGLTIPCPEDTFLDI  650
            H MGGLTIPC ED FLD+
Sbjct  64   HPMGGLTIPCSEDLFLDL  81



>ref|XP_002276250.1| PREDICTED: auxin-induced protein X15 [Vitis vinifera]
 emb|CAN62610.1| hypothetical protein VITISV_016871 [Vitis vinifera]
Length=95

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 71/92 (77%), Gaps = 7/92 (8%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRR---SSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
            MAI   RI+ AKQ LRR   S   TN    VPKG+  VYVGE++KKRFVIPISYLK PSF
Sbjct  1    MAIRFQRIIPAKQILRRILPSPEPTN----VPKGYVPVYVGETQKKRFVIPISYLKHPSF  56

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            Q+LLSQAEEEFGFDH +GGLTIPC E+ F+++
Sbjct  57   QNLLSQAEEEFGFDHPLGGLTIPCREEAFINL  88



>ref|XP_002306157.1| hypothetical protein POPTR_0004s17300g [Populus trichocarpa]
 gb|EEE86668.1| hypothetical protein POPTR_0004s17300g [Populus trichocarpa]
Length=92

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 69/93 (74%), Gaps = 7/93 (8%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRR---SSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
            M I +  I+ AKQ L+R   S   +N    VPKGH AVYVGE++KKRF +PISYLK PSF
Sbjct  1    MGIRLPGIVNAKQILKRILLSEDTSN----VPKGHLAVYVGEAQKKRFTVPISYLKHPSF  56

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            Q+LLSQAEEEFGFDH MGGLTIPC E+ F  +I
Sbjct  57   QNLLSQAEEEFGFDHSMGGLTIPCSEEVFTGLI  89



>ref|XP_009793415.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=92

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I +T  ++A + LR SS+  +    VPKGH AVYVGES+KKRF++PISYL  P FQDL
Sbjct  1    MGIKVTPFIQASRILRMSSTTGS----VPKGHCAVYVGESQKKRFIVPISYLSQPLFQDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEEEFGFDH MGGLTIPC ED F+D+
Sbjct  57   LAQAEEEFGFDHPMGGLTIPCKEDVFVDL  85



>gb|EYU35301.1| hypothetical protein MIMGU_mgv1a023166mg [Erythranthe guttata]
Length=88

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R  EVPKGH AVYVGESE KRFVIP+SYL  PSFQ+LL QAEEEFG+ H M
Sbjct  7    LRRSLSAGKRSTEVPKGHLAVYVGESEMKRFVIPLSYLNHPSFQELLCQAEEEFGYHHPM  66

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC ED F+D+
Sbjct  67   GGLTIPCSEDLFIDL  81



>ref|XP_002271891.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CAN70450.1| hypothetical protein VITISV_035053 [Vitis vinifera]
Length=96

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I +  + +AKQ L+  S  +  + EVPKGHFA+YVGE +KKR+V+PISYL  PSF+ L
Sbjct  1    MGIRLPSMGQAKQILKLQSLLSRNQAEVPKGHFAIYVGEVKKKRYVVPISYLDHPSFRSL  60

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGF+H MGGLTIPC E  FLD+
Sbjct  61   LSQAEEEFGFNHPMGGLTIPCKEHAFLDL  89



>ref|XP_009358224.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=102

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 68/95 (72%), Gaps = 6/95 (6%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS------SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKD  755
            M I +  I  AKQ L+R+      S+  +   EVPKGHFAVYVGE EKKRFVIPISYL  
Sbjct  1    MGIKLMGIAHAKQKLQRTLSARYGSAADSTSTEVPKGHFAVYVGEDEKKRFVIPISYLNH  60

Query  754  PSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            P FQDLL++AEEEFG+DH  GGLTIPC ED F+ +
Sbjct  61   PLFQDLLNKAEEEFGYDHPTGGLTIPCSEDYFISL  95



>gb|EYU35277.1| hypothetical protein MIMGU_mgv1a023478mg [Erythranthe guttata]
Length=88

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -2

Query  883  KQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFD  704
            +Q L+RS S   R  EVPKGH AVYVGE+EKKRFVIP+SYL  PSFQDLL QAEEEFGF 
Sbjct  4    RQILKRSLSNERRSTEVPKGHLAVYVGENEKKRFVIPLSYLSHPSFQDLLCQAEEEFGFH  63

Query  703  HQMGGLTIPCPEDTFLDI  650
            H MGGLTIPC +D F+ +
Sbjct  64   HPMGGLTIPCSQDLFVHL  81



>ref|XP_009368357.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus 
x bretschneideri]
 ref|XP_009347326.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus 
x bretschneideri]
Length=99

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRT----NREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   +  I+ AK+ L RS S +    ++ +++PKG+FAVYVGE +KKRFVIPISYL DP 
Sbjct  1    MGFRLPGIVSAKRSLVRSLSNSKQTASKTLDIPKGYFAVYVGERQKKRFVIPISYLNDPL  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQAEEEFG+DH MGG+TIPC E TFL +
Sbjct  61   FQDLLSQAEEEFGYDHPMGGITIPCSEYTFLHL  93



>ref|XP_002272387.1| PREDICTED: auxin-induced protein 15A-like [Vitis vinifera]
 ref|XP_010647418.1| PREDICTED: auxin-induced protein 15A-like [Vitis vinifera]
Length=100

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 67/90 (74%), Gaps = 5/90 (6%)
 Frame = -2

Query  904  MTRILRAKQGLRRS-SSRTNREI----EVPKGHFAVYVGESEKKRFVIPISYLKDPSFQD  740
            M  I  AKQ L+R+ SSR    I     VPKGHFAVYVGES+KKRFVIPISYL  P FQD
Sbjct  4    MMGITHAKQKLQRTLSSRITGAISATANVPKGHFAVYVGESQKKRFVIPISYLNHPLFQD  63

Query  739  LLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LL +AEEEFGFDH MGGLTIPC ED F+ +
Sbjct  64   LLHRAEEEFGFDHPMGGLTIPCSEDYFISL  93



>gb|KDP27603.1| hypothetical protein JCGZ_19608 [Jatropha curcas]
Length=99

 Score =   118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 68/89 (76%), Gaps = 5/89 (6%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M  S+ +IL+ K  L R     N + EVP+GH AVYVGE +KKRFV+PISYL+ PSFQDL
Sbjct  8    MFPSVKQILQGKYVLSR-----NDQSEVPRGHLAVYVGEQQKKRFVVPISYLRHPSFQDL  62

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L +AEEEFGFDH MGGLTIPC ED FLD+
Sbjct  63   LKRAEEEFGFDHPMGGLTIPCKEDAFLDL  91



>gb|EYU35281.1| hypothetical protein MIMGU_mgv11b014396mg [Erythranthe guttata]
Length=88

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R IEVPKGH AVYVGESEKKRFVIP++YL DP FQ+LL Q EEEFGF H M
Sbjct  7    LRRSLSAEKRTIEVPKGHLAVYVGESEKKRFVIPLTYLNDPLFQELLCQTEEEFGFHHPM  66

Query  694  GGLTIPCPEDTFLDI  650
            GGLTI C ED F+D+
Sbjct  67   GGLTISCSEDLFIDL  81



>ref|XP_008237039.1| PREDICTED: auxin-induced protein 15A-like [Prunus mume]
Length=93

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 2/89 (2%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   +  I+ AK+ L  S    ++ +++PKG FAVYVGES+KKRFVIPISYL +P FQDL
Sbjct  1    MGFRLPGIVNAKRSL--SHIAASKTLDIPKGCFAVYVGESQKKRFVIPISYLNEPLFQDL  58

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEEEFG+DH MGG+TIPC ED+FLDI
Sbjct  59   LNQAEEEFGYDHPMGGITIPCSEDSFLDI  87



>ref|XP_007201545.1| hypothetical protein PRUPE_ppa017462mg [Prunus persica]
 gb|EMJ02744.1| hypothetical protein PRUPE_ppa017462mg [Prunus persica]
Length=101

 Score =   118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 67/94 (71%), Gaps = 5/94 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS-----SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M I +  I  AK+ L+R+      S  +   EVPKGHFAVYVGE +KKRFVIPISYL  P
Sbjct  1    MGIKLMGIAHAKEKLQRTLSARYGSAADTNAEVPKGHFAVYVGEGKKKRFVIPISYLNHP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
             FQDLL++AEEEFG+DH  GGLTIPC ED FL +
Sbjct  61   LFQDLLTKAEEEFGYDHPTGGLTIPCSEDYFLSV  94



>ref|XP_004300228.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Fragaria 
vesca subsp. vesca]
Length=99

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + +I   K+ L RS S  N    + +++PKG+ AVYVGES+KKRFVIPISYL  PS
Sbjct  1    MGFRLPKISSPKRILIRSLSNGNQTASKTLDIPKGYLAVYVGESQKKRFVIPISYLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            F DLLSQAEEEFG+DH MGG+TIPC EDTF+++
Sbjct  61   FMDLLSQAEEEFGYDHSMGGITIPCSEDTFIEL  93



>gb|EYU35271.1| hypothetical protein MIMGU_mgv1a020811mg [Erythranthe guttata]
Length=88

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -2

Query  883  KQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFD  704
            +Q L+RS S   R  +VPKGH AVY+GE+EKKRFVIP+SYL  PSFQDLL QAEEEFG+ 
Sbjct  4    RQILKRSLSNERRSNDVPKGHLAVYIGENEKKRFVIPLSYLNHPSFQDLLCQAEEEFGYH  63

Query  703  HQMGGLTIPCPEDTFLDI  650
            H MGGLTIPC ED F+D+
Sbjct  64   HPMGGLTIPCREDLFVDV  81



>gb|EYU35300.1| hypothetical protein MIMGU_mgv1a018533mg [Erythranthe guttata]
Length=99

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -2

Query  883  KQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFD  704
            +Q LRRS S   +  EVPKGH AVYVG +EKKRFVIP+SYL +P FQDLL QAEEEFGF 
Sbjct  4    RQMLRRSLSNERKSTEVPKGHLAVYVGHNEKKRFVIPLSYLNNPLFQDLLFQAEEEFGFH  63

Query  703  HQMGGLTIPCPEDTFLDI  650
            H MGG+TIPC ED F+D+
Sbjct  64   HPMGGITIPCSEDLFVDL  81



>ref|XP_008236177.1| PREDICTED: auxin-induced protein 15A [Prunus mume]
Length=103

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 67/94 (71%), Gaps = 5/94 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS-----SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M I +  I  AK+ L+R+      S  +   EVPKGHFAVYVGE +KKRFVIPISYL  P
Sbjct  1    MGIKLMGIAHAKEKLQRTLSARYGSAADTNAEVPKGHFAVYVGEGKKKRFVIPISYLNHP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
             FQDLL++AEEEFG+DH  GGLTIPC ED FL +
Sbjct  61   LFQDLLTKAEEEFGYDHPTGGLTIPCSEDYFLSV  94



>gb|EYU40730.1| hypothetical protein MIMGU_mgv1a023017mg, partial [Erythranthe 
guttata]
Length=100

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  907  SMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQ  728
            S  + +  +Q  RRS S   +  EVPKGH AVYVGESEKKRF+IP+SYL  P FQDLL +
Sbjct  8    SFQKKMTIRQIFRRSLSNERKSAEVPKGHLAVYVGESEKKRFIIPLSYLNHPMFQDLLCR  67

Query  727  AEEEFGFDHQMGGLTIPCPEDTFLDI  650
            AEEEFGF H MGGLTIPC ED F+D+
Sbjct  68   AEEEFGFHHPMGGLTIPCSEDLFVDL  93



>emb|CAN70455.1| hypothetical protein VITISV_035059 [Vitis vinifera]
 emb|CBI17629.3| unnamed protein product [Vitis vinifera]
Length=103

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 69/96 (72%), Gaps = 7/96 (7%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIE-------VPKGHFAVYVGESEKKRFVIPISYLK  758
            M   M  IL AKQ L+  S  T  ++        VPKGHFAVYVGE+EKKRFV+PISYL 
Sbjct  1    MGFRMPSILHAKQILKLQSLLTRSQLSISATTAVVPKGHFAVYVGEAEKKRFVVPISYLN  60

Query  757  DPSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            +PSFQ  LS +EEEFGF+H MGG+TIPC E++F+D+
Sbjct  61   NPSFQKFLSHSEEEFGFNHPMGGVTIPCKEESFIDL  96



>ref|XP_009379575.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=98

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 5/95 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE-----IEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M      +  AK+ LRRS S ++R      ++VPKG  AVYVGE+E++RFVIP+SYL  P
Sbjct  1    MGFHRPSVTHAKKVLRRSFSNSSRGGSYNLVDVPKGFLAVYVGENERQRFVIPVSYLNQP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            S QDLLS+AE+EFGFDH MGGLTIPC +DTF+DII
Sbjct  61   SLQDLLSEAEQEFGFDHPMGGLTIPCRQDTFIDII  95



>gb|AFK33527.1| unknown [Lotus japonicus]
Length=100

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 70/93 (75%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNR----EIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI ++  L AK+ LR SS   N+     ++VPKG+FAVYVGESEKKRFVIP+S L  PS
Sbjct  1    MAIRLSSALSAKRILRGSSLFANQAAATSLDVPKGYFAVYVGESEKKRFVIPVSLLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ+LLS AEEEFGF H MGGL IPC ED F+++
Sbjct  61   FQELLSAAEEEFGFSHPMGGLIIPCTEDIFVEV  93



>gb|KFK41731.1| hypothetical protein AALP_AA2G165400 [Arabis alpina]
Length=96

 Score =   117 bits (294),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGES-EKKRFVIPISYLKDPSFQD  740
            MAIS+ R+L++ + L +S S ++  I+VPKGH AVY+GE  +KKRFV+P++YL + SFQ+
Sbjct  1    MAISIPRVLQSSKKLLKSFSHSSNNIDVPKGHLAVYIGEKLQKKRFVVPVTYLNNSSFQN  60

Query  739  LLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LL +AEEEFGF H MGGLTIPC E  F+D+
Sbjct  61   LLRKAEEEFGFHHSMGGLTIPCTEQIFIDL  90



>ref|XP_011037241.1| PREDICTED: uncharacterized protein LOC105134501 [Populus euphratica]
Length=194

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 3/89 (3%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            +AI + RIL+AKQ L R SS       V KG+ AVYVGE EKKRFVIP+S+L  PSFQ+L
Sbjct  2    IAIRLPRILQAKQNLLRGSSPAR---NVRKGYIAVYVGEEEKKRFVIPVSHLNQPSFQEL  58

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LS+AEEE+GFDHQMGGLTIPC ED F+D+
Sbjct  59   LSKAEEEYGFDHQMGGLTIPCREDIFIDL  87


 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 71/94 (76%), Gaps = 3/94 (3%)
 Frame = -2

Query  928  KHPRMAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            +HP  A++   + R+     + +SR+   ++VPKG  AVY+GE EKKRFV+P+SYL +PS
Sbjct  98   RHPAAALAKKILQRSVWNANKPASRS---LDVPKGFLAVYIGEREKKRFVVPVSYLNEPS  154

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            FQDLL++AEEEFGF+H MGGLTIPC ED F D++
Sbjct  155  FQDLLTKAEEEFGFNHPMGGLTIPCREDKFNDVL  188



>ref|XP_008363801.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
Length=118

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 4/89 (4%)
 Frame = -2

Query  913  AISMTRILRAKQGLRRSSSRT----NREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
              S+  I+ AK+ L RS S +    ++ +++PKG+FAVYVGE +KKRFVIPISYL DP F
Sbjct  21   GFSLPGIVSAKRSLVRSLSNSKQTASKTLDIPKGYFAVYVGERQKKRFVIPISYLNDPLF  80

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTF  659
            Q+LLSQAEEEFG+DH MGG+TIPC EDTF
Sbjct  81   QNLLSQAEEEFGYDHPMGGITIPCSEDTF  109



>ref|XP_004144907.1| PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]
 ref|XP_004162916.1| PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]
 gb|KGN43208.1| hypothetical protein Csa_7G009040 [Cucumis sativus]
Length=100

 Score =   117 bits (294),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNR----EIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   +  I+ AK  LRRS+S  NR     ++VPKG F VYVGE +KKRFVI +SYL  P 
Sbjct  1    MGFRLPSIVLAKPSLRRSTSSGNRATPKSLDVPKGCFTVYVGEEQKKRFVISLSYLNHPL  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            FQDLLSQAEEEFG+D+ MGG+TIPC EDTF+++I
Sbjct  61   FQDLLSQAEEEFGYDYAMGGITIPCNEDTFVNLI  94



>ref|XP_002306152.1| hypothetical protein POPTR_0004s17230g [Populus trichocarpa]
 gb|EEE86663.1| hypothetical protein POPTR_0004s17230g [Populus trichocarpa]
Length=99

 Score =   117 bits (294),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 4/84 (5%)
 Frame = -2

Query  886  AKQGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEE  719
            AKQ L RS   TN    R  +VPKG  AVYVGE +KKRFV+P+SYL +PSFQDLLS+AEE
Sbjct  10   AKQILCRSVWITNKSASRSSDVPKGFLAVYVGEMDKKRFVVPVSYLNEPSFQDLLSKAEE  69

Query  718  EFGFDHQMGGLTIPCPEDTFLDII  647
            EFGF+H MGGLTIPC EDTF+DI+
Sbjct  70   EFGFNHPMGGLTIPCREDTFIDIL  93



>ref|XP_010108331.1| hypothetical protein L484_000422 [Morus notabilis]
 gb|EXC54958.1| hypothetical protein L484_000422 [Morus notabilis]
Length=100

 Score =   117 bits (294),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 57/94 (61%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE----IEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   + R++ AK+ LRRS S +N+     ++VPKGHFAVYVGE EKKRFV+P+S L    
Sbjct  1    MGFRLPRVVPAKKFLRRSFSNSNKAASSALDVPKGHFAVYVGEDEKKRFVVPLSLLNQAF  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            FQDLL QAE+E+GFDH MG LTIPC ED FLD+I
Sbjct  61   FQDLLVQAEDEYGFDHPMGALTIPCREDVFLDLI  94



>ref|XP_010647509.1| PREDICTED: auxin-induced protein X15 [Vitis vinifera]
 emb|CBI37964.3| unnamed protein product [Vitis vinifera]
Length=94

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 71/90 (79%), Gaps = 3/90 (3%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIE-VPKGHFAVYVGESEKKRFVIPISYLKDPSFQD  740
            M   +  I+ AKQ L+R   R   EI+ VPKG+FAVYVGE +KKRF++P+SYLKDPSFQ+
Sbjct  1    MGFRLPGIVNAKQILQRV--RMGGEIKNVPKGYFAVYVGEDQKKRFLVPVSYLKDPSFQN  58

Query  739  LLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LLSQAEEEFGFDH  GGLTIPC E+ F+D+
Sbjct  59   LLSQAEEEFGFDHPRGGLTIPCTEEAFIDV  88



>gb|KHN20021.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=94

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI +   L A+  LRRS++     ++VPKG+FAVYVGE EKKRFVIP+S L  PSFQ+L
Sbjct  1    MAIRLPSALSARHILRRSNAAAT-SLDVPKGYFAVYVGEGEKKRFVIPVSLLNQPSFQEL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LS AEEEFGF H MGGLTIPC ED F++I
Sbjct  60   LSIAEEEFGFTHPMGGLTIPCTEDIFVNI  88



>ref|XP_010315343.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=86

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 10/89 (11%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI M RI++          +++   +VPKGHFAVYVGE++KKRFVIPIS+L  P FQDL
Sbjct  1    MAIRMPRIIK----------KSSTVADVPKGHFAVYVGENQKKRFVIPISFLSQPLFQDL  50

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGFDH MGG+TIPC ED F+D+
Sbjct  51   LSQAEEEFGFDHPMGGVTIPCSEDVFVDL  79



>gb|EYU35287.1| hypothetical protein MIMGU_mgv1a017212mg [Erythranthe guttata]
Length=88

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R  EVPKGH AVY+GESEKKRFVIP+SYL  PSFQ+LL QAEEEFGF H M
Sbjct  7    LRRSLSAEKRSAEVPKGHLAVYIGESEKKRFVIPLSYLNHPSFQELLCQAEEEFGFHHPM  66

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC E+ F+++
Sbjct  67   GGLTIPCSEELFVEL  81



>gb|EYU37892.1| hypothetical protein MIMGU_mgv1a019362mg, partial [Erythranthe 
guttata]
Length=94

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  907  SMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQ  728
            S+  ++  +  LRRS S   R  EVPKGH AVYVGESEKKRFVIP+SYL   SFQ+LL +
Sbjct  2    SLNTLMAIRGMLRRSLSSEKRSNEVPKGHLAVYVGESEKKRFVIPLSYLNHSSFQELLCR  61

Query  727  AEEEFGFDHQMGGLTIPCPEDTFLDI  650
            AEEEFGF H MGGLTIPC E++F+D+
Sbjct  62   AEEEFGFHHPMGGLTIPCSEESFIDL  87



>ref|XP_010244080.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=101

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 6/96 (6%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS-SSRTNREI-----EVPKGHFAVYVGESEKKRFVIPISYLKD  755
            M   +  +L  K+ LRRS S R N+ +      VPKGH AVYVGE+EK+RFVIP+SYL  
Sbjct  1    MGFRLPALLHTKEILRRSLSGRRNQSLWSTTANVPKGHLAVYVGEAEKRRFVIPVSYLNH  60

Query  754  PSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
             SFQ+LL QAEEEFGFDH MGGLTIPC EDTF+ ++
Sbjct  61   SSFQELLGQAEEEFGFDHPMGGLTIPCKEDTFIHLL  96



>ref|XP_008369486.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
 ref|XP_008345358.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=101

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 70/95 (74%), Gaps = 5/95 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRT-----NREIEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M   +  ++ AK+ L+RS S +     N   +VPKG+F VYVGESEK+RFV+PIS L  P
Sbjct  1    MGFRLPSVIPAKKLLQRSLSNSSQGASNNLADVPKGYFPVYVGESEKQRFVVPISILNQP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            +FQDLLS AEEEFGFDH MGGLTIPC +D FLD+I
Sbjct  61   AFQDLLSAAEEEFGFDHPMGGLTIPCRQDAFLDLI  95



>ref|XP_010112285.1| hypothetical protein L484_014967 [Morus notabilis]
 gb|EXC33088.1| hypothetical protein L484_014967 [Morus notabilis]
Length=98

 Score =   117 bits (294),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 57/92 (62%), Positives = 69/92 (75%), Gaps = 2/92 (2%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNR--EIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQ  743
            M   + R++ AK+ LRRS S +N+    +VPKGHFAVYVGE EKKRFV+P+S L    FQ
Sbjct  1    MGFRLPRVVPAKKFLRRSFSNSNKAASFDVPKGHFAVYVGEDEKKRFVVPLSLLNQAFFQ  60

Query  742  DLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            DLL QAE+E+GFDH MG LTIPC ED FLD+I
Sbjct  61   DLLVQAEDEYGFDHPMGALTIPCREDVFLDLI  92



>ref|NP_001235363.1| uncharacterized protein LOC100306459 [Glycine max]
 gb|ACU14649.1| unknown [Glycine max]
Length=95

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI +   L A+  LRRS++     ++VPKG+FAVYVGE EKKRFVIP+S L  PSFQ+L
Sbjct  2    MAIRLPSALSARHILRRSNAAAT-SLDVPKGYFAVYVGEGEKKRFVIPVSLLNQPSFQEL  60

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LS AEEEFGF H MGGLTIPC ED F++I
Sbjct  61   LSIAEEEFGFTHPMGGLTIPCTEDIFVNI  89



>ref|XP_009766736.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=92

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 67/89 (75%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I MT  ++A + LRRSS        VPKGH AVYVGES+KKRFV+PISYL  P FQDL
Sbjct  1    MGIKMTPFIQANRILRRSSISGG----VPKGHCAVYVGESQKKRFVVPISYLSQPLFQDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEEEFGFDH MGGLTIP  ED F+D+
Sbjct  57   LAQAEEEFGFDHPMGGLTIPIKEDVFVDL  85



>gb|EYU37891.1| hypothetical protein MIMGU_mgv1a023887mg [Erythranthe guttata]
Length=86

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R  EVPKGHFAVY+GESE KRFVIP+SYL +PSFQ+LL QAE++FGF H M
Sbjct  7    LRRSLSAEKRSNEVPKGHFAVYIGESETKRFVIPLSYLNNPSFQELLFQAEQKFGFHHPM  66

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC ED F+D+
Sbjct  67   GGLTIPCSEDLFVDL  81



>gb|KDP27616.1| hypothetical protein JCGZ_19621 [Jatropha curcas]
Length=96

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 73/90 (81%), Gaps = 2/90 (2%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN-REIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQD  740
            MA  ++ IL AKQ LRRS+++ +     VPKG  AVY+GE+EKKR+++PISYL +PSFQD
Sbjct  1    MARHLSTIL-AKQILRRSANKASPNSSNVPKGFLAVYIGENEKKRYLVPISYLNEPSFQD  59

Query  739  LLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LLS+AEE++GF H MGGLTIPC EDTF+D+
Sbjct  60   LLSKAEEKYGFHHPMGGLTIPCREDTFIDV  89



>ref|XP_009379588.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=101

 Score =   117 bits (294),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 74/95 (78%), Gaps = 5/95 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREI-----EVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M   +  ++ AK+ LRRS S +++E+     +VPKG+F VYVG+SEK+RFV+PIS L  P
Sbjct  1    MGFRLPSVIPAKKLLRRSFSNSSQEVSNNLADVPKGYFPVYVGKSEKQRFVVPISILNQP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            SFQDLLS+AEEEFG+DH MGG+TIPC +DTFL +I
Sbjct  61   SFQDLLSEAEEEFGYDHPMGGVTIPCRQDTFLVLI  95



>ref|XP_010271572.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=95

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI +  +++AKQ LRRS   T   + VPKGH AVY+GE++KKRFV+PISY+  P F+DL
Sbjct  1    MAIRLPGVVQAKQILRRSLP-TRAAVNVPKGHAAVYIGETQKKRFVVPISYINHPLFEDL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFL  656
            LS AEEEFGFDH MGGLTIPC E+ F+
Sbjct  60   LSHAEEEFGFDHPMGGLTIPCKEEAFI  86



>ref|XP_011088523.1| PREDICTED: uncharacterized protein LOC105169727 [Sesamum indicum]
Length=172

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 65/85 (76%), Gaps = 4/85 (5%)
 Frame = -2

Query  892  LRAKQGLRRSSSRTNREI----EVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQA  725
            +  +Q LRRS S   R I    EVPKGHFAVYVGES+KKRFVIPISYL  P+FQDLL QA
Sbjct  81   MAIRQILRRSLSAERRSISSGTEVPKGHFAVYVGESKKKRFVIPISYLNHPAFQDLLCQA  140

Query  724  EEEFGFDHQMGGLTIPCPEDTFLDI  650
            EEEFGF H  GGLTIPC ED F+DI
Sbjct  141  EEEFGFSHPTGGLTIPCSEDLFVDI  165



>ref|XP_007199401.1| hypothetical protein PRUPE_ppa026172mg [Prunus persica]
 gb|EMJ00600.1| hypothetical protein PRUPE_ppa026172mg [Prunus persica]
Length=93

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 73/89 (82%), Gaps = 2/89 (2%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   +  I+ +K+GL +++  T++ +++PKG+FAVYVGES+KKRFV+PISYL +P F DL
Sbjct  1    MGFRLPGIVNSKKGLNKAA--TSKTLDIPKGYFAVYVGESQKKRFVVPISYLNEPLFLDL  58

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFG+DH MGG+TIPC ++TF+ +
Sbjct  59   LSQAEEEFGYDHPMGGITIPCSDETFIHL  87



>gb|EYU23191.1| hypothetical protein MIMGU_mgv1a020984mg [Erythranthe guttata]
Length=88

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R  EVPKGH  VYVGESEKKRFVIP+SYL  PSFQ+LLSQAEEEFGF H M
Sbjct  7    LRRSLSAEKRSNEVPKGHLVVYVGESEKKRFVIPLSYLNHPSFQELLSQAEEEFGFRHPM  66

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC E++F+ +
Sbjct  67   GGLTIPCSEESFIGL  81



>ref|XP_011088529.1| PREDICTED: auxin-induced protein 15A-like [Sesamum indicum]
Length=92

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 61/79 (77%), Gaps = 4/79 (5%)
 Frame = -2

Query  874  LRRSSSRTNREI----EVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGF  707
            LRRS S   R      EVPKGHFAVYVGESEKKRFVIP+SYL   SFQDLL QAEEEFGF
Sbjct  7    LRRSLSAEKRSTSAGTEVPKGHFAVYVGESEKKRFVIPVSYLNHSSFQDLLCQAEEEFGF  66

Query  706  DHQMGGLTIPCPEDTFLDI  650
             H MGGLTIPC ED F+D+
Sbjct  67   HHPMGGLTIPCSEDLFIDV  85



>ref|XP_009764192.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=85

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 67/89 (75%), Gaps = 10/89 (11%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI M RI++          +++   ++PKGHFAVYVGE +KKRFVIPIS+L  P FQDL
Sbjct  1    MAIRMPRIIK----------KSSTSGDIPKGHFAVYVGEKQKKRFVIPISFLSQPLFQDL  50

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGFDH MGG+TIPC ED FLD+
Sbjct  51   LSQAEEEFGFDHPMGGVTIPCSEDVFLDL  79



>ref|XP_004230984.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=86

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 67/89 (75%), Gaps = 10/89 (11%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI M RI++          +++   +VPKGHFAVYVGE +KKRFVIPIS+L  P FQDL
Sbjct  1    MAIRMPRIIK----------KSSTVADVPKGHFAVYVGEKQKKRFVIPISFLSQPLFQDL  50

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGFDH MGG+TIPC ED F+D+
Sbjct  51   LSQAEEEFGFDHPMGGVTIPCSEDVFVDL  79



>ref|XP_004250224.1| PREDICTED: auxin-induced protein X15-like [Solanum lycopersicum]
Length=91

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 69/89 (78%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I M+ +++  + LRR S+     + VPKGH AVYVGES+KKRF++PISYL  P FQDL
Sbjct  1    MGIKMSPLIQGTRILRRFSN----SMGVPKGHCAVYVGESQKKRFIVPISYLSQPLFQDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEE+FGFDH MGGLTIPC ED F+D+
Sbjct  57   LTQAEEQFGFDHPMGGLTIPCKEDVFVDL  85



>ref|XP_009770355.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=86

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 10/90 (11%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI M RI++          ++++  +VPKGHFAVYVGE +KKRFVIPIS+L  P FQDL
Sbjct  1    MAIRMPRIIK----------KSSKAGDVPKGHFAVYVGEKQKKRFVIPISFLSQPLFQDL  50

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            LSQAEEEFGFD  MGGLTIPC ED F+D+I
Sbjct  51   LSQAEEEFGFDQPMGGLTIPCGEDVFIDLI  80



>emb|CDY38475.1| BnaA10g16830D [Brassica napus]
Length=93

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  895  ILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEE  716
            +L AK+ L RS++  +     PKG  AVYVGES+KKR+V+P+SYL  PSFQ LLS++EEE
Sbjct  7    LLGAKKILGRSATSKSATSAAPKGFLAVYVGESQKKRYVVPVSYLSQPSFQALLSKSEEE  66

Query  715  FGFDHQMGGLTIPCPEDTFLDI  650
            FGF+H MGGLTIPCPEDTF+D+
Sbjct  67   FGFNHPMGGLTIPCPEDTFIDV  88



>ref|XP_002306156.1| hypothetical protein POPTR_0004s17290g [Populus trichocarpa]
 gb|EEE86667.1| hypothetical protein POPTR_0004s17290g [Populus trichocarpa]
Length=97

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREI-EVPKGHFAVYVGESEKKRFVIPISYLKDPSFQD  740
            M   ++ I+RAKQ L+ S S T++    VPKG  AVYVGE +KKRFVIPISYL  P+FQ+
Sbjct  1    MGFRLSAIVRAKQVLQLSPSATSQAASNVPKGCLAVYVGEIQKKRFVIPISYLNQPNFQE  60

Query  739  LLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            LLSQAEEEFG+ H MGGLTIPC ED FL +I
Sbjct  61   LLSQAEEEFGYVHPMGGLTIPCREDIFLAVI  91



>ref|XP_006352409.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=91

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I M+ +++  + LRR S+       VPKGH AVYVGES+KKRFV+PISYL  P FQDL
Sbjct  1    MGIKMSPLIQGTRILRRFSNSGG----VPKGHCAVYVGESQKKRFVVPISYLSQPLFQDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEE+FGFDH MGGLTIPC ED F+D+
Sbjct  57   LTQAEEQFGFDHPMGGLTIPCKEDVFVDL  85



>ref|XP_009793414.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=92

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 67/89 (75%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I MT  ++A Q LRRS++       VPKGH AVYVGES+KKRF++PISYL  P F DL
Sbjct  1    MGIKMTPFIQANQILRRSTTCGG----VPKGHCAVYVGESQKKRFIVPISYLSQPLFHDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEEEFGFDH MGGLTIP  ED F+D+
Sbjct  57   LAQAEEEFGFDHPMGGLTIPIKEDVFIDL  85



>gb|AFK35784.1| unknown [Lotus japonicus]
Length=101

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNR-----EIEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            MAI ++  L AK+ LR  S  TN+      ++VPKGHFAVYVGESEKKRFVIP+S L  P
Sbjct  1    MAIRLSSALSAKRILRGFSLFTNQAAASTSLDVPKGHFAVYVGESEKKRFVIPVSLLIQP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            SFQ+LLS AEEEFGF H MGGL IPC ED F+++
Sbjct  61   SFQELLSIAEEEFGFSHPMGGLIIPCTEDIFVEV  94



>ref|XP_008237037.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Prunus 
mume]
Length=93

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 73/89 (82%), Gaps = 2/89 (2%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   +  I+ +K+GL +++  T++ +++PKG+FAVYVGES+KKRFV+PISYL +P F DL
Sbjct  1    MGFRLPGIVNSKKGLNKAA--TSKTLDIPKGYFAVYVGESQKKRFVVPISYLNEPLFLDL  58

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFG+DH MGG+TIPC ++TF+ +
Sbjct  59   LSQAEEEFGYDHPMGGITIPCGDETFIHL  87



>gb|EYU35303.1| hypothetical protein MIMGU_mgv1a018888mg [Erythranthe guttata]
Length=88

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R IEVPKGH AVYVGE+ KKRFVIP+SYL  P FQ+LL +AEEEFG+ H M
Sbjct  7    LRRSLSAEKRSIEVPKGHLAVYVGENNKKRFVIPLSYLNHPLFQELLCRAEEEFGYHHPM  66

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC ED FLD+
Sbjct  67   GGLTIPCTEDLFLDL  81



>gb|EYU35297.1| hypothetical protein MIMGU_mgv1a021816mg [Erythranthe guttata]
Length=88

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -2

Query  883  KQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFD  704
            +Q LRRS S   +  EVPKGH AVYVG++EKKRFVIP+SYL  P FQDLL QAEEEFGF 
Sbjct  4    RQMLRRSLSNERKSAEVPKGHLAVYVGDNEKKRFVIPLSYLNHPLFQDLLFQAEEEFGFH  63

Query  703  HQMGGLTIPCPEDTFLDI  650
            H MGG+TIPC ED F+D+
Sbjct  64   HPMGGITIPCSEDLFVDL  81



>ref|XP_002271793.1| PREDICTED: auxin-induced protein X15 [Vitis vinifera]
 emb|CAN65265.1| hypothetical protein VITISV_040132 [Vitis vinifera]
Length=95

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI   RI+ AKQ LRR    +     VPKG+  VYVGE++KKRFVIPISYLK PSFQ L
Sbjct  1    MAIRFQRIIPAKQILRRILP-SPESTSVPKGYVPVYVGETQKKRFVIPISYLKHPSFQSL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGFDH +GGLTIPC E+ F+++
Sbjct  60   LSQAEEEFGFDHPLGGLTIPCREEAFINL  88



>ref|XP_010271402.1| PREDICTED: auxin-induced protein X10A-like [Nelumbo nucifera]
Length=100

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 68/93 (73%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS----SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M I +  I  AK  LR S    +  T+  I+VPKGH AVYVG ++KKRFV+PISYL  PS
Sbjct  1    MGIRLPGITHAKMILRHSLLTANHTTSATIDVPKGHLAVYVGATQKKRFVVPISYLNHPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ LL++AEEEFGFDH MGGLTIPC E+ F+D+
Sbjct  61   FQKLLNRAEEEFGFDHPMGGLTIPCEEEAFIDL  93



>ref|XP_008365898.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=98

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 71/95 (75%), Gaps = 5/95 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE-----IEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M      +  AK+ LRRS S ++R       +VPKG+ AVYVGESE++RFVIP+SYL   
Sbjct  1    MGFRRPSVTHAKKILRRSFSNSSRGGSHNLADVPKGYLAVYVGESERQRFVIPVSYLNQL  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            SFQDLLS+AE+EFGFDH MGGLTIPC +DTF+DII
Sbjct  61   SFQDLLSEAEQEFGFDHPMGGLTIPCRQDTFIDII  95



>gb|EYU37893.1| hypothetical protein MIMGU_mgv1a023686mg [Erythranthe guttata]
Length=89

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R  EVPKGHF VYVGESEKKRFVIP+SYL  P FQ+LL QAEEEFGF H M
Sbjct  8    LRRSLSAEKRSNEVPKGHFVVYVGESEKKRFVIPLSYLNHPLFQELLCQAEEEFGFYHPM  67

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC E+ F+D+
Sbjct  68   GGLTIPCTEELFIDV  82



>ref|XP_006359630.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=86

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 10/89 (11%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI M RI++     + S++R     +VPKGHFAVYVGE +KKRFVIPIS+L  P FQDL
Sbjct  1    MAIRMPRIIK-----KSSTTR-----DVPKGHFAVYVGEKQKKRFVIPISFLSQPLFQDL  50

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGF+H MGG+TIPC ED F+D+
Sbjct  51   LSQAEEEFGFNHPMGGVTIPCSEDVFIDL  79



>ref|XP_010312723.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=91

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I M+ +++  + LRR S+       VPKGH AVYVGES+KKRFV+PISYL  P FQDL
Sbjct  1    MGIKMSPLIQGTRILRRFSNSRG----VPKGHCAVYVGESQKKRFVVPISYLSKPLFQDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEE+FGFDH MGGLTIPC ED F+D+
Sbjct  57   LTQAEEQFGFDHPMGGLTIPCKEDVFVDL  85



>ref|XP_008236815.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103335582 
[Prunus mume]
Length=208

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE-----IEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            MAI +  I+ AKQ LRR S   NR      I VPKG  AVYVGESEKKR+++PIS+L  P
Sbjct  1    MAIRLPSIMHAKQILRRGSLFANRAASRSAIGVPKGFLAVYVGESEKKRYMVPISFLSQP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            SFQ+LLS+AEEEFGFDH MGGLTIPC E+ F+++
Sbjct  61   SFQELLSKAEEEFGFDHPMGGLTIPCREEIFINL  94


 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  928  KHPRMAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            ++  MAI +++ILR    L  + + ++  + VPKG+  VYVGE EKKRFV+PIS+L  PS
Sbjct  111  RYLSMAIRLSQILRQSSLLFANKAASSSSVGVPKGYIVVYVGEFEKKRFVVPISFLNQPS  170

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ+LL +AEEEFG+++ MGGLTIPC ED F+D+
Sbjct  171  FQELLRKAEEEFGYNYPMGGLTIPCREDIFIDL  203



>ref|XP_004290370.1| PREDICTED: uncharacterized protein LOC101293834 [Fragaria vesca 
subsp. vesca]
Length=196

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   +  I  AK+ L RS S T + +++PKG+FAVYVG+S+KKRFVIPISYL +P F DL
Sbjct  103  MGFRLPGIANAKKSLTRSLSAT-KSLDIPKGYFAVYVGKSQKKRFVIPISYLNEPLFLDL  161

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEEEFGFDH MGG+TIPC E TFLD+
Sbjct  162  LNQAEEEFGFDHPMGGITIPCSEHTFLDL  190


 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  832  PKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLD  653
            PKG+F VYVGES+KKRFVIP+SYL +P FQDLLSQAEEEFG+DH MGG+TIPC E  FL+
Sbjct  31   PKGYFVVYVGESQKKRFVIPLSYLNEPMFQDLLSQAEEEFGYDHPMGGITIPCGEHNFLE  90

Query  652  I  650
            +
Sbjct  91   L  91



>ref|XP_002271395.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CBI17625.3| unnamed protein product [Vitis vinifera]
Length=97

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  895  ILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEE  716
            I  A Q L+        + +VP+GHFAVYVG+++KKRFV+PISYL  PSFQDLL QAEEE
Sbjct  9    ITNAMQILKLQPVHIRNQSDVPRGHFAVYVGDTQKKRFVVPISYLNHPSFQDLLQQAEEE  68

Query  715  FGFDHQMGGLTIPCPEDTFLDI  650
            FGFDH MGGLTIPC E+TF+D+
Sbjct  69   FGFDHPMGGLTIPCKEETFVDL  90



>gb|EYU37886.1| hypothetical protein MIMGU_mgv11b016999mg [Erythranthe guttata]
Length=88

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R  EVPKGH AVYVGESEKKRFVIP+SYL +P FQ+LL QAE+EFGF H M
Sbjct  7    LRRSLSSEKRSNEVPKGHLAVYVGESEKKRFVIPLSYLNNPLFQELLCQAEQEFGFHHPM  66

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC E+ F+D+
Sbjct  67   GGLTIPCSEELFIDL  81



>emb|CDX94145.1| BnaC07g37790D [Brassica napus]
Length=93

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  895  ILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEE  716
            +L AK+ L RS++  +     PKG  AVYVGE +KKR+V+P+SYL  PSFQ LLS++EEE
Sbjct  7    LLGAKKILGRSATSKSATSAAPKGFLAVYVGEGQKKRYVVPVSYLSQPSFQALLSKSEEE  66

Query  715  FGFDHQMGGLTIPCPEDTFLDI  650
            FGFDH MGGLTIPCPEDTF+D+
Sbjct  67   FGFDHPMGGLTIPCPEDTFIDV  88



>ref|XP_010315351.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=86

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 67/89 (75%), Gaps = 10/89 (11%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI M RI++          +++   +VPKGHFAVYVGE +KKRFVIPIS+L  P FQDL
Sbjct  1    MAIRMPRIIK----------KSSTSGDVPKGHFAVYVGEKQKKRFVIPISFLSQPLFQDL  50

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGFDH MGG+TIPC ED F+D+
Sbjct  51   LSQAEEEFGFDHPMGGVTIPCSEDVFIDL  79



>ref|XP_006487311.1| PREDICTED: auxin-induced protein X15-like [Citrus sinensis]
 gb|KDO46705.1| hypothetical protein CISIN_1g042279mg [Citrus sinensis]
Length=92

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI   RI+ +KQ LRR+         VPKGHFAVYVGE+E+ RFV+P+SY K PSFQ L
Sbjct  1    MAIRFLRIVNSKQALRRALMVPEAST-VPKGHFAVYVGETERSRFVVPVSYPKHPSFQKL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LS AEEEFGF H MGGLTIPC E+ F+D+
Sbjct  60   LSPAEEEFGFHHPMGGLTIPCSEELFMDL  88



>ref|XP_010271569.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=103

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = -2

Query  922  PRMAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQ  743
            P M +   +IL+  + L R         +VPKGH AVYVGE++KKRFVIP+SYLK P FQ
Sbjct  6    PSMVLPAKQILKVHRLLARDEFPAGAIRDVPKGHLAVYVGETQKKRFVIPVSYLKHPLFQ  65

Query  742  DLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            DLLSQAEEEFGFDH MGGLTIPC E  F+++
Sbjct  66   DLLSQAEEEFGFDHPMGGLTIPCKEAAFINL  96



>ref|XP_008358419.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
 emb|CAB07785.1| hypothetical protein [Malus domestica]
Length=99

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRT----NREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   +  I+ AK+ L RS S +    ++ +++PKG+FAVY GE +KKRFVIPISYL DP 
Sbjct  1    MGFRLPGIVSAKRSLIRSLSNSKQTASKTLDIPKGYFAVYAGERQKKRFVIPISYLNDPL  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQAEEEFG+DH MGG+TIPC E TFL +
Sbjct  61   FQDLLSQAEEEFGYDHPMGGITIPCSEYTFLHL  93



>ref|XP_002306149.1| hypothetical protein POPTR_0004s17170g [Populus trichocarpa]
 gb|EEE86660.1| hypothetical protein POPTR_0004s17170g [Populus trichocarpa]
Length=98

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 68/93 (73%), Gaps = 5/93 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSS----RTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +  I  AKQ L RS S      +R ++VPKG  AVYVGE EKKRFV+P SYLK PS
Sbjct  1    MAIRLP-IAPAKQSLPRSVSGAYKAASRSLDVPKGFLAVYVGEPEKKRFVVPTSYLKQPS  59

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLL  AEEEFGFDH MGGLTIP  EDTFLD+
Sbjct  60   FQDLLHGAEEEFGFDHPMGGLTIPRAEDTFLDV  92



>ref|XP_008448010.1| PREDICTED: auxin-induced protein 15A-like [Cucumis melo]
Length=98

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSS--RTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQ  743
            M   + RI++AKQ LRRSSS       ++VPKG+F VY+GE +KKRFVIP+SYL  P+FQ
Sbjct  1    MGFHLPRIVQAKQSLRRSSSTGHGTSAVDVPKGYFTVYIGEVQKKRFVIPLSYLNLPTFQ  60

Query  742  DLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            DLLSQ EEEFG+DH MGG+TI C E+ F  +
Sbjct  61   DLLSQGEEEFGYDHPMGGITISCSEELFFGL  91



>gb|EYU37895.1| hypothetical protein MIMGU_mgv11b017820mg [Erythranthe guttata]
Length=88

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -2

Query  892  LRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEF  713
            +  +Q LRRS S   +  EVPKGH AVYVGESEKK F+IP+SYL +PSFQ+LL QAEEE 
Sbjct  1    MAIRQMLRRSLSNERKSNEVPKGHLAVYVGESEKKHFIIPLSYLNNPSFQELLCQAEEEL  60

Query  712  GFDHQMGGLTIPCPEDTFLDI  650
            GF H MGGLTIPC E+ F DI
Sbjct  61   GFHHPMGGLTIPCNEELFTDI  81



>gb|EYU37903.1| hypothetical protein MIMGU_mgv1a022749mg [Erythranthe guttata]
Length=88

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -2

Query  883  KQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFD  704
            +Q LRRS S   R  EVPKGHF VYVGESEKKRFVIP+SYL +PSFQ+LL QAEEEFGF 
Sbjct  4    RQMLRRSLSNERRSNEVPKGHFVVYVGESEKKRFVIPLSYLNNPSFQELLCQAEEEFGFH  63

Query  703  HQMGGLTIPCPEDTFLDI  650
            H   GLTIPC E+ F+++
Sbjct  64   HPASGLTIPCSEELFVEL  81



>ref|XP_010246393.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=102

 Score =   116 bits (291),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 6/96 (6%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS-SSRTNREI-----EVPKGHFAVYVGESEKKRFVIPISYLKD  755
            M   +  +L  K+ LRRS S   N+ +      VPKGH AVYVGE+EK+RFVIP+SYL  
Sbjct  1    MGFRLPGLLHTKEILRRSLSGGRNQSLWSTTANVPKGHLAVYVGEAEKRRFVIPVSYLNH  60

Query  754  PSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            PSFQ+LL QAEEEFGFDH MGGLTIPC EDTF+ ++
Sbjct  61   PSFQELLGQAEEEFGFDHPMGGLTIPCKEDTFIHLL  96



>ref|XP_006359618.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=85

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 67/89 (75%), Gaps = 10/89 (11%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI + RI++          +++  ++VPKGHF VYVGE ++KRFVIPISYL  PSFQDL
Sbjct  1    MAIRVPRIIK----------KSSTSLDVPKGHFVVYVGEKQRKRFVIPISYLSQPSFQDL  50

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGFDH MGG+TIPC ED F+ I
Sbjct  51   LSQAEEEFGFDHPMGGVTIPCSEDIFIHI  79



>ref|XP_011088530.1| PREDICTED: auxin-induced protein 15A-like [Sesamum indicum]
Length=92

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 61/79 (77%), Gaps = 4/79 (5%)
 Frame = -2

Query  874  LRRSSSRTNREI----EVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGF  707
            LRRS S   R      EVPKGHFAVYVGES+KKRFVIP+SYL  P+FQDLL QAEEEFGF
Sbjct  7    LRRSLSAEKRSTSAGTEVPKGHFAVYVGESKKKRFVIPLSYLNHPTFQDLLCQAEEEFGF  66

Query  706  DHQMGGLTIPCPEDTFLDI  650
             H MGGLTIPC ED F D+
Sbjct  67   HHPMGGLTIPCSEDLFFDV  85



>ref|XP_006352413.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=91

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I M+ +++  + LRR S+       VPKGH AVYVGES+KKRFV+PISYL  P FQDL
Sbjct  1    MGIKMSPLIQGTRILRRFSNSGG----VPKGHCAVYVGESQKKRFVMPISYLSQPLFQDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEE+FGFDH MGGLTIPC ED F+D+
Sbjct  57   LTQAEEQFGFDHPMGGLTIPCKEDVFVDL  85



>ref|XP_009379590.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=101

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 5/95 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREI-----EVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M   +  ++ AK+  RRS S +++       +VPKG+F VYVGESEK+RFV+PIS+L  P
Sbjct  1    MGFRLPAVIPAKKLFRRSFSNSSQGASYNLSDVPKGYFPVYVGESEKQRFVVPISFLNHP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            +FQDLLS AEEEFGFDH MGGLTIPC +D FLD+I
Sbjct  61   AFQDLLSDAEEEFGFDHPMGGLTIPCRQDAFLDLI  95



>ref|XP_007200204.1| hypothetical protein PRUPE_ppa015749mg [Prunus persica]
 gb|EMJ01403.1| hypothetical protein PRUPE_ppa015749mg [Prunus persica]
Length=109

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 5/95 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREI-----EVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M   +  ++ AK+ LRRS S TNR       ++PKG+FAVYVGESEK+RFV+PIS+L   
Sbjct  1    MGFCLPAVIPAKKLLRRSFSNTNRGASINLADIPKGYFAVYVGESEKQRFVVPISFLNQS  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
             FQ+LLS+AEEEFG+DH MG LTIPC +D FLD+I
Sbjct  61   VFQELLSEAEEEFGYDHPMGDLTIPCIQDAFLDLI  95



>ref|XP_006352411.1| PREDICTED: auxin-induced protein X15-like [Solanum tuberosum]
Length=91

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 4/90 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I M+ +++  + LRR S+       VPKGH AVYVGES+KKRF +PISYL  P FQDL
Sbjct  1    MGIKMSPLIQGTRILRRFSNSGG----VPKGHCAVYVGESQKKRFFVPISYLSQPLFQDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            L+QAEE+FGFDHQMGGLTIPC ED F+ +I
Sbjct  57   LTQAEEQFGFDHQMGGLTIPCKEDVFVYLI  86



>ref|XP_002313000.1| hypothetical protein POPTR_0009s12910g [Populus trichocarpa]
 gb|EEE86955.1| hypothetical protein POPTR_0009s12910g [Populus trichocarpa]
Length=91

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 5/89 (6%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI +T  L AKQ  RRSS    +  +VPKG  AVYVGE+EKKRFV+P+SYL  P FQDL
Sbjct  1    MAIRLTGSL-AKQIFRRSS----KSFDVPKGFVAVYVGETEKKRFVVPVSYLNQPIFQDL  55

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L +AEEEFGFDH MGGLTIPC EDTF+ +
Sbjct  56   LCKAEEEFGFDHPMGGLTIPCREDTFIHV  84



>ref|XP_006487295.1| PREDICTED: auxin-induced protein 10A5-like [Citrus sinensis]
Length=98

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE--IEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQ  743
            MAI + RIL AKQ  RRS    N+   I+VPKG  AVYVG+ EKK FVIPIS+L +P FQ
Sbjct  1    MAIRLPRILHAKQVFRRSIFFPNQSTSIDVPKGCLAVYVGQCEKKIFVIPISFLNEPLFQ  60

Query  742  DLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            +LL +AEEEFGF+H MGGLTIPC E+ FLD+
Sbjct  61   ELLYKAEEEFGFNHPMGGLTIPCAEEMFLDL  91



>ref|XP_008348904.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus 
domestica]
Length=99

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRT----NREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   +  I+ AK+ L RS S +    ++ +++PKG+FAVY GE +KKRFVIPISYL DP 
Sbjct  1    MGFRLPGIVSAKRSLIRSLSNSKQTASKTLDIPKGYFAVYXGERQKKRFVIPISYLNDPL  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQAEEEFG+DH MGG+TIPC E TFL +
Sbjct  61   FQDLLSQAEEEFGYDHPMGGITIPCSEYTFLHL  93



>gb|KGN61876.1| hypothetical protein Csa_2G258720 [Cucumis sativus]
Length=97

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -2

Query  904  MTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQA  725
            ++ +  AKQ L+  S  T  ++ VPKGH AVYVGE ++KRFV+PISYL DPSFQ LLS A
Sbjct  6    LSLVPHAKQILKMQSGFTKNQLNVPKGHVAVYVGEIQRKRFVVPISYLNDPSFQQLLSHA  65

Query  724  EEEFGFDHQMGGLTIPCPEDTFLDI  650
            EEEFGF H  GGLTIPC ED F+D+
Sbjct  66   EEEFGFHHPHGGLTIPCKEDAFVDL  90



>ref|XP_007041973.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
 gb|EOX97804.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
Length=95

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   + RI+ AKQ L R+ S +     V KGHFAVYVGE++KKRF++PIS+LKDPSFQ+L
Sbjct  1    MGFRLPRIVCAKQRLTRTLSFS-ENTPVSKGHFAVYVGEAQKKRFIVPISFLKDPSFQNL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEE GF+H MG LTIPC E+ F+D+
Sbjct  60   LSQAEEECGFNHPMGALTIPCNEEAFIDL  88



>gb|KDP34544.1| hypothetical protein JCGZ_11094 [Jatropha curcas]
Length=100

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 5/93 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS----SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MA+ +   L +KQ LRRS    +   +R  ++PKG  AVY+G  EKKRFV+PISYLK+PS
Sbjct  1    MALRLAGNL-SKQILRRSVFSPNKAASRSSDIPKGFLAVYIGGLEKKRFVVPISYLKEPS  59

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLS+AEEEFGFDH MGGLTIPC EDTFL +
Sbjct  60   FQDLLSKAEEEFGFDHPMGGLTIPCKEDTFLHV  92



>ref|XP_009619474.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=92

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 67/89 (75%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I MT  ++A + LRRSS+       VPKGH AVYVGES+KKRFV+PISYL  P FQDL
Sbjct  1    MGIKMTPFIQANRILRRSSTCGG----VPKGHCAVYVGESQKKRFVVPISYLSQPLFQDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAEEEFGFDH MG LTIP  ED F+D+
Sbjct  57   LAQAEEEFGFDHPMGSLTIPIKEDVFVDL  85



>ref|XP_008237036.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Prunus 
mume]
Length=93

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 72/89 (81%), Gaps = 2/89 (2%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   +  I+ +K+GL +++  T++ I++PKG+FAVYVG S+KKRFV+PISYL +P F DL
Sbjct  1    MGFRLPGIVNSKKGLNKAA--TSKTIDIPKGYFAVYVGGSQKKRFVVPISYLNEPLFLDL  58

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFG+DH MGG+TIPC ++TF+ +
Sbjct  59   LSQAEEEFGYDHPMGGITIPCSDETFIHL  87



>ref|XP_010246416.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=103

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 67/92 (73%), Gaps = 3/92 (3%)
 Frame = -2

Query  916  MAISMTRILRAKQ---GLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
            M I +  ++ AKQ   GLRRS        +VPKGHF VYVGE EKKR+V+PISYLK PSF
Sbjct  1    MGIQLPGMVHAKQLLQGLRRSQFVEAIASDVPKGHFVVYVGEYEKKRYVVPISYLKHPSF  60

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            Q LLS AEEEFGFDHQMGGLTIPC E  F+ +
Sbjct  61   QYLLSLAEEEFGFDHQMGGLTIPCKEVDFIRL  92



>ref|XP_010255168.1| PREDICTED: uncharacterized protein LOC104595902 [Nelumbo nucifera]
Length=198

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVG-ESEKKRFVIPISYLKDPSFQD  740
            M I +  ++ AK  LRRS   +     VPKGHFAVYVG +++KKRF++PISYL +PSFQD
Sbjct  1    MGIRLPGMVLAKALLRRSLLPSAPTANVPKGHFAVYVGDQAQKKRFIVPISYLTNPSFQD  60

Query  739  LLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LL QAEEEFGF+H MGGLTIPC ED FLD+
Sbjct  61   LLGQAEEEFGFNHPMGGLTIPCKEDQFLDL  90


 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVG-ESEKKRFVIPISYLKDPSFQD  740
            M I +  ++ AK  LRRS   +     VPKGHFAVYVG +++KKRF++PISYL +PSFQD
Sbjct  103  MGIRLPGMVLAKALLRRSLLPSAPTANVPKGHFAVYVGDQAQKKRFIVPISYLTNPSFQD  162

Query  739  LLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LL QAEEEFGF+H MGGLTIPC ED FLD+
Sbjct  163  LLGQAEEEFGFNHPMGGLTIPCKEDQFLDL  192



>ref|XP_010028670.1| PREDICTED: auxin-induced protein 15A-like [Eucalyptus grandis]
 gb|KCW55439.1| hypothetical protein EUGRSUZ_I01341 [Eucalyptus grandis]
Length=96

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI ++ I+ AKQ LR+S       + VPKG+ AVYVGE +KKR+ +PIS+L  P FQDL
Sbjct  1    MAIHLSSIMHAKQILRQSLLIGREAVSVPKGYVAVYVGERQKKRYAVPISFLNQPLFQDL  60

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L +AEEEFGF+H MGGLTIPC EDTF+ +
Sbjct  61   LRKAEEEFGFNHPMGGLTIPCTEDTFIAL  89



>emb|CDO96966.1| unnamed protein product [Coffea canephora]
Length=98

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 5/91 (5%)
 Frame = -2

Query  922  PRMAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQ  743
            P M  +  +  + +  L+R     NR+ +VPKGHFAVYVGE EKKRFV+PISYL  P+FQ
Sbjct  6    PSMIANARQFYKLQSLLQR-----NRQSDVPKGHFAVYVGEMEKKRFVLPISYLNHPTFQ  60

Query  742  DLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            DLL +AEEEFG+DH MGGLTIPC ED F+D+
Sbjct  61   DLLRKAEEEFGYDHPMGGLTIPCNEDAFVDL  91



>emb|CBI17626.3| unnamed protein product [Vitis vinifera]
Length=90

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 8/90 (9%)
 Frame = -2

Query  916  MAISMTRIL-RAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQD  740
            M I +  ++  AKQ L+  S       +VPKGHFAVYVGE +KKRFV+PISYL  PSFQD
Sbjct  1    MGIRLPSVISNAKQILKLQS-------DVPKGHFAVYVGEIQKKRFVVPISYLNHPSFQD  53

Query  739  LLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LL QAEEEFGF+H MGGLTIPC E+TF+D+
Sbjct  54   LLQQAEEEFGFNHSMGGLTIPCKEETFIDL  83



>ref|XP_002271660.2| PREDICTED: uncharacterized protein LOC100252964 [Vitis vinifera]
Length=214

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 69/96 (72%), Gaps = 7/96 (7%)
 Frame = -2

Query  916  MAISMTRILRAKQGL-------RRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLK  758
            M      I++AKQ L       R  SS +    EVPKGHFAVYVGE+EKKRFV+PISYL 
Sbjct  112  MGFRFPSIIQAKQILKLHSLLSRGQSSISATAAEVPKGHFAVYVGEAEKKRFVVPISYLN  171

Query  757  DPSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            +PSFQ LLS AEEEFGF+H MGG+TIPC ED F+++
Sbjct  172  NPSFQKLLSHAEEEFGFNHPMGGVTIPCKEDAFINL  207


 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 69/96 (72%), Gaps = 7/96 (7%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIE-------VPKGHFAVYVGESEKKRFVIPISYLK  758
            M   M  IL AKQ L+  S  T  ++        VPKGHFAVYVGE+EKKRFV+PISYL 
Sbjct  1    MGFRMPSILHAKQILKLQSLLTRSQLSISATTAVVPKGHFAVYVGEAEKKRFVVPISYLN  60

Query  757  DPSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            +PSFQ  LS +EEEFGF+H MGG+TIPC E++F+D+
Sbjct  61   NPSFQKFLSHSEEEFGFNHPMGGVTIPCKEESFIDL  96



>ref|XP_008457635.1| PREDICTED: auxin-induced protein 15A-like [Cucumis melo]
Length=97

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -2

Query  904  MTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQA  725
            ++ +  AKQ L+  S  T  +++VPKGH AVYVGE + KRFV+PISYL  PSFQ LLS A
Sbjct  6    LSLVPHAKQLLKMQSGFTKNQLDVPKGHVAVYVGEIQSKRFVVPISYLNHPSFQQLLSYA  65

Query  724  EEEFGFDHQMGGLTIPCPEDTFLDI  650
            EEEFGF H  GGLTIPC EDTFLD+
Sbjct  66   EEEFGFHHPQGGLTIPCKEDTFLDL  90



>ref|XP_002276412.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CAN62605.1| hypothetical protein VITISV_016866 [Vitis vinifera]
Length=100

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -2

Query  901  TRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAE  722
            ++I  AKQ L+  S  +  +  VPKGH AVYVGE +KKRFV+PISYL  P+FQDLL  AE
Sbjct  7    SKIHNAKQILKLQSLLSRNQSSVPKGHCAVYVGEIQKKRFVVPISYLNHPAFQDLLHLAE  66

Query  721  EEFGFDHQMGGLTIPCPEDTFLDI  650
            EEFGFDH MGGLTIPC ED F+D+
Sbjct  67   EEFGFDHPMGGLTIPCEEDAFIDL  90



>ref|XP_010526566.1| PREDICTED: auxin-induced protein X15 [Tarenaya hassleriana]
Length=97

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 73/91 (80%), Gaps = 2/91 (2%)
 Frame = -2

Query  916  MAISMTRILRA-KQGLRRSSS-RTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQ  743
            MAI   R+L++ KQ LR++ +   +  ++VPKG FAVYVGE ++KRFV+P+S+L+ PSFQ
Sbjct  1    MAIRFPRVLQSSKQVLRQAKAFSASNSVDVPKGCFAVYVGERQRKRFVVPLSFLRQPSFQ  60

Query  742  DLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            DLL +AEEEFGFDH MGGLTIPC E+ F+D+
Sbjct  61   DLLRKAEEEFGFDHSMGGLTIPCSEEIFVDL  91



>ref|XP_007200851.1| hypothetical protein PRUPE_ppa026539mg [Prunus persica]
 gb|EMJ02050.1| hypothetical protein PRUPE_ppa026539mg [Prunus persica]
Length=91

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 66/90 (73%), Gaps = 4/90 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   +  I+ AKQ  R S S        PKG+FAVY+GES+KKRFVIPIS L  PSF+DL
Sbjct  1    MGFRLPGIIHAKQKFRHSPSNQ----AAPKGYFAVYIGESQKKRFVIPISCLNQPSFKDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            LSQAEEEFG++H MGG+TIPC ED FLD+I
Sbjct  57   LSQAEEEFGYNHPMGGITIPCSEDRFLDLI  86



>ref|XP_007135906.1| hypothetical protein PHAVU_009G001800g [Phaseolus vulgaris]
 gb|ESW07900.1| hypothetical protein PHAVU_009G001800g [Phaseolus vulgaris]
Length=101

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 66/93 (71%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNR----EIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI     L AK  LRRS+   N+     ++VPKG+FAVYVGE EKKRFVIP+S L  PS
Sbjct  2    MAIRFPTALSAKHILRRSNLFANQAAATSVDVPKGYFAVYVGEGEKKRFVIPVSLLNQPS  61

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ LLS AEEEFGF H MGGLTIPC +D F +I
Sbjct  62   FQQLLSIAEEEFGFTHPMGGLTIPCTQDIFFNI  94



>gb|EYU37890.1| hypothetical protein MIMGU_mgv1a022439mg [Erythranthe guttata]
Length=88

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R  +VPKGHF VYVGESEKKRFVIP+SYL +P FQ+LL QAEEEFGF H  
Sbjct  7    LRRSLSSEKRSTQVPKGHFVVYVGESEKKRFVIPLSYLNNPLFQELLCQAEEEFGFYHPT  66

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC E+ F+DI
Sbjct  67   GGLTIPCTEELFIDI  81



>gb|AAM12778.1| auxin-induced SAUR-like protein [Capsicum annuum]
Length=85

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 67/89 (75%), Gaps = 10/89 (11%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI + RI++          +++  ++VPKGHFAVYVGE +K RFVIPISYL  PSFQDL
Sbjct  1    MAIRVPRIIK----------KSSTSLDVPKGHFAVYVGEKQKNRFVIPISYLSQPSFQDL  50

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LS+AEEEFGFDH MGG+TIPC ED F+ I
Sbjct  51   LSRAEEEFGFDHPMGGVTIPCSEDIFIGI  79



>ref|XP_010536039.1| PREDICTED: auxin-induced protein 15A-like [Tarenaya hassleriana]
Length=98

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRT-NREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQD  740
            MA  + R L++KQ  R++ S T +    VPKGH AVYVGES KKRF++P+S+L +PSFQD
Sbjct  1    MAFRVLRSLQSKQIFRQAKSFTPSNSSGVPKGHLAVYVGESRKKRFLVPVSFLNEPSFQD  60

Query  739  LLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LL +AEEEFGFDH MGGLTIPC E+ F D+
Sbjct  61   LLRKAEEEFGFDHPMGGLTIPCSEEVFADL  90



>ref|XP_010649241.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CAN83559.1| hypothetical protein VITISV_024104 [Vitis vinifera]
Length=96

 Score =   115 bits (289),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 52/89 (58%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I +  +++AKQ L+  S  +    +VPKGHFAVYVGE +KKR+V+PISYL +PSF+ L
Sbjct  1    MGICLPSMVQAKQILKLQSLLSKNRAQVPKGHFAVYVGEVDKKRYVVPISYLNNPSFRSL  60

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L QAEEEFG++H MGGLTIPC E   LD+
Sbjct  61   LCQAEEEFGYNHTMGGLTIPCEEHALLDL  89



>ref|XP_006352406.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=92

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 68/89 (76%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I M+ +++  + LRR S+       VPKGH AVYVGES+KKRFV+PISYL  P FQDL
Sbjct  1    MGIKMSPLIQGTKILRRFSNSGG----VPKGHCAVYVGESQKKRFVVPISYLTQPLFQDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAE++FGFDH MGGLTIPC ED F+D+
Sbjct  57   LTQAEKQFGFDHPMGGLTIPCKEDVFVDL  85



>gb|EYU35286.1| hypothetical protein MIMGU_mgv1a024807mg [Erythranthe guttata]
Length=88

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -2

Query  883  KQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFD  704
            +Q LRRS S   R +EVPKGH AVYVGE EKKRFVIP+SYL    FQ+LL QAEEEFGF 
Sbjct  4    RQILRRSLSNERRSVEVPKGHLAVYVGEGEKKRFVIPLSYLNHHLFQELLFQAEEEFGFH  63

Query  703  HQMGGLTIPCPEDTFLDI  650
            H MGG+TIPC ED F+D+
Sbjct  64   HPMGGITIPCSEDLFIDL  81



>ref|XP_009368351.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=91

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 69/89 (78%), Gaps = 5/89 (6%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   +  IL AK+     +  +++ ++VPKG+ A+YVGES+KKRF+IP+SYL  PSFQDL
Sbjct  1    MGFRLPGILHAKK-----NQVSSKSLDVPKGYLAIYVGESQKKRFIIPVSYLNQPSFQDL  55

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LS AE+EFG+DH MGG+TIPC EDTFLD+
Sbjct  56   LSLAEDEFGYDHPMGGITIPCSEDTFLDL  84



>ref|XP_004250217.1| PREDICTED: auxin-induced protein X15-like [Solanum lycopersicum]
Length=91

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 69/89 (78%), Gaps = 4/89 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I M+ +++  + LRR S+     + VPKGH AVYVGES+KKRFV+PISYL  P FQDL
Sbjct  1    MGIKMSPLIQGTRLLRRFSN----SLGVPKGHCAVYVGESQKKRFVVPISYLSQPLFQDL  56

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L+QAE++FGF+H MGGLTIPC ED F+D+
Sbjct  57   LTQAEDQFGFNHPMGGLTIPCKEDVFVDL  85



>gb|KGN43199.1| hypothetical protein Csa_7G008460 [Cucumis sativus]
Length=96

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE----IEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M   +  I+ AKQ  +RSS+  N      ++VPKG+F VYVGE++K+RFVIP+S L  PS
Sbjct  1    MGFRLPSIVHAKQSFQRSSTMRNGASPTVVDVPKGYFTVYVGETQKRRFVIPLSCLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLSQAEEEFG+DH MGG+TIPC E  FL +
Sbjct  61   FQDLLSQAEEEFGYDHSMGGITIPCSEAIFLSL  93



>ref|XP_007041987.1| SAUR-like auxin-responsive protein family [Theobroma cacao]
 gb|EOX97818.1| SAUR-like auxin-responsive protein family [Theobroma cacao]
Length=98

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 4/93 (4%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNR----EIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            M I + RI+ A+Q LR+     N+      +VPKG+F+VYVGESEKKRFV+PIS L  PS
Sbjct  1    MGIRVPRIMHARQILRQPKLFANQAASTSTDVPKGYFSVYVGESEKKRFVVPISVLNQPS  60

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQ LLS AEEEFGFDH MGGLTIPC E+ F+D+
Sbjct  61   FQKLLSIAEEEFGFDHPMGGLTIPCREEVFIDL  93



>ref|XP_007041976.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
 gb|EOX97807.1| SAUR-like auxin-responsive protein family, putative [Theobroma 
cacao]
Length=95

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   + RI+  KQ L+R+ S +   + VPKGHFAVYVGE EKKRFV+PIS+LK  SF+ L
Sbjct  1    MGFRLPRIVNPKQSLKRTLSFSETTV-VPKGHFAVYVGEVEKKRFVVPISFLKHHSFKIL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            LS+AEEE+GF+H MG LTIPC E+ FLD+I
Sbjct  60   LSEAEEEYGFNHPMGALTIPCSEEAFLDLI  89



>gb|EYU35272.1| hypothetical protein MIMGU_mgv1a023235mg [Erythranthe guttata]
Length=88

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  874  LRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQM  695
            LRRS S   R  EVPKGH  VYVGESEKKRFVIP++YL DP FQ+LL Q EEEFGF H M
Sbjct  7    LRRSLSAEKRSTEVPKGHLTVYVGESEKKRFVIPLTYLNDPLFQELLFQTEEEFGFHHPM  66

Query  694  GGLTIPCPEDTFLDI  650
            GGLTIPC E++F+D+
Sbjct  67   GGLTIPCSEESFIDL  81



>ref|XP_009379573.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus 
x bretschneideri]
Length=100

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTN-----REIEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M   +  I  AK+ L RS S +N     + I++PKG+FAVYV ES KKRFVIPISYL  P
Sbjct  1    MGFRLPGIFTAKKSLIRSLSSSNQTADSKTIDIPKGYFAVYVEESWKKRFVIPISYLNKP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
             F DLL+QAEEEFG+DH MGG+TIPC EDTFL +
Sbjct  61   LFLDLLTQAEEEFGYDHPMGGITIPCSEDTFLHL  94



>ref|XP_009347322.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=91

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 69/89 (78%), Gaps = 5/89 (6%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   +  IL AK+     S  +++ ++VPKG+ A+YVGES+KKRF+IP+SYL  PSFQDL
Sbjct  1    MGFRLPGILHAKK-----SQVSSKSLDVPKGYLAIYVGESQKKRFIIPVSYLNQPSFQDL  55

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LS +E+EFG+DH MGG+TIPC EDTFLD+
Sbjct  56   LSLSEDEFGYDHPMGGITIPCSEDTFLDL  84



>ref|XP_010246394.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=102

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  895  ILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEE  716
            ILR      R+ S  +    VPKGH AVYVGE+EK+RFVIP+SYL  PSFQ+LL QAEEE
Sbjct  14   ILRHSLSGGRNQSLWSTTANVPKGHLAVYVGEAEKRRFVIPVSYLNHPSFQELLGQAEEE  73

Query  715  FGFDHQMGGLTIPCPEDTFLDII  647
            FGFDH MGGLTIPC EDTF+ ++
Sbjct  74   FGFDHPMGGLTIPCKEDTFIHLL  96



>ref|XP_002276271.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CBI37955.3| unnamed protein product [Vitis vinifera]
Length=95

 Score =   115 bits (288),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 54/89 (61%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   +  I+ AKQ +++       +  VPKG+FAVYVGE +KKRFV+PISYLK+PSFQ+L
Sbjct  1    MGFRLPGIVNAKQVVQQVCKGAEAK-NVPKGYFAVYVGEVQKKRFVVPISYLKNPSFQNL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFG DH MGGLTIPC E+ F+D+
Sbjct  60   LSQAEEEFGLDHPMGGLTIPCTEEAFIDL  88



>gb|KGN43200.1| hypothetical protein Csa_7G008960 [Cucumis sativus]
Length=102

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 6/95 (6%)
 Frame = -2

Query  916  MAISMTRILRAK--QGLRRSSSRTN----REIEVPKGHFAVYVGESEKKRFVIPISYLKD  755
            M   + RI+     Q L+RSSS  N    R  +VPKG+FAVY+GE +KKRFVIP+SYL  
Sbjct  1    MGFRLPRIVTGTVTQSLQRSSSTRNGASPRANDVPKGYFAVYIGEEQKKRFVIPLSYLNQ  60

Query  754  PSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            PSFQDLLSQAEEEFG++H MGG+TIPC E  FLD+
Sbjct  61   PSFQDLLSQAEEEFGYNHPMGGITIPCNEVYFLDL  95



>ref|XP_009379591.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=98

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 5/95 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE-----IEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M      +  AK+ LRRS S ++R      ++VPKG  AVYVGE+E++RFVIP+SYL  P
Sbjct  1    MGFRHPSVTHAKKVLRRSFSNSSRGGSCNLVDVPKGFLAVYVGENERQRFVIPVSYLNQP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            S QDLLS+AE+EFGFDH MGGLT PC +DTF+DII
Sbjct  61   SLQDLLSEAEQEFGFDHPMGGLTTPCRQDTFIDII  95



>gb|EYU40409.1| hypothetical protein MIMGU_mgv1a017192mg [Erythranthe guttata]
Length=89

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = -2

Query  883  KQGLRRSSSRTNR-EIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGF  707
            +Q LRRS S   R   +VPKGHFAVYVG+S+ KRFV+P+S+L +P FQDLLS+AEEEFGF
Sbjct  4    RQMLRRSLSSEKRLATDVPKGHFAVYVGQSQMKRFVVPLSFLNNPLFQDLLSRAEEEFGF  63

Query  706  DHQMGGLTIPCPEDTFLDII  647
            +H MGG+TIPC ED F+D++
Sbjct  64   NHPMGGITIPCSEDAFVDLV  83



>emb|CBI17636.3| unnamed protein product [Vitis vinifera]
Length=96

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M I +  +++AKQ  +  S  +  + EVPKG+FAVYVGE EK+R V+PISYL  PSF+ L
Sbjct  1    MGIRLPSMVQAKQIFKLQSYLSRNQAEVPKGYFAVYVGEVEKRRHVVPISYLNHPSFRSL  60

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L QAEEEFGF+H MGGLTIPC ED F D+
Sbjct  61   LCQAEEEFGFNHPMGGLTIPCNEDAFADL  89



>gb|KDP34553.1| hypothetical protein JCGZ_11103 [Jatropha curcas]
Length=100

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 5/93 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS----SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPS  749
            MAI +   L +KQ LRRS    +   +R  EVPKG  AVY+GE E+KRFV+PISYL++PS
Sbjct  1    MAIRLAGNL-SKQILRRSVFAPNKAASRSSEVPKGFLAVYIGELEEKRFVVPISYLREPS  59

Query  748  FQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            FQDLLS+AEEEFGFDH MGGLTIPC E+ FL +
Sbjct  60   FQDLLSKAEEEFGFDHPMGGLTIPCREEAFLHV  92



>ref|XP_006423553.1| hypothetical protein CICLE_v10029881mg [Citrus clementina]
 gb|ESR36793.1| hypothetical protein CICLE_v10029881mg [Citrus clementina]
 gb|KDO42789.1| hypothetical protein CISIN_1g042730mg [Citrus sinensis]
Length=88

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -2

Query  871  RRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQMG  692
             +++ + ++   VPKGHF VYVGE+ KKRFV+PISYLK PSFQ+LLSQ EEEFGFDH MG
Sbjct  11   NKNTEKCSQATIVPKGHFVVYVGETTKKRFVLPISYLKHPSFQNLLSQTEEEFGFDHPMG  70

Query  691  GLTIPCPEDTFLDII  647
            GLTIPC E+ F+D+I
Sbjct  71   GLTIPCSEEVFMDLI  85



>ref|XP_010246396.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=102

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 67/96 (70%), Gaps = 6/96 (6%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRS------SSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKD  755
            M      +L  K+ LRRS       S  +    VPKGH AVYVGE+EK+RFVIP+SYL  
Sbjct  1    MGFRXPGLLHTKEILRRSLSGGRNQSLWSTTANVPKGHLAVYVGEAEKRRFVIPVSYLNH  60

Query  754  PSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            PSFQ+LL QAEEEFGFDH MGGLTIPC EDTF+ ++
Sbjct  61   PSFQELLRQAEEEFGFDHPMGGLTIPCKEDTFIHLL  96



>emb|CDY25469.1| BnaC09g39840D [Brassica napus]
Length=93

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  895  ILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEE  716
            +L AK+ L RS++  +     PKG  AVYVGE +KKR+V+P+SYL  PSFQ LLS++EEE
Sbjct  7    LLGAKKILGRSATSKSATSAAPKGFLAVYVGEGQKKRYVVPVSYLSQPSFQALLSKSEEE  66

Query  715  FGFDHQMGGLTIPCPEDTFLDI  650
            FGF+H MGGLTIPCPEDTF+D+
Sbjct  67   FGFNHPMGGLTIPCPEDTFIDV  88



>emb|CDY25466.1| BnaC09g39810D [Brassica napus]
Length=93

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -2

Query  898  RILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEE  719
             +L AK+ L RS++  +     PKG  AVYVGE +KKR+V+P+SYL  PSFQ LLS++EE
Sbjct  6    NLLGAKKILGRSATSKSATSAAPKGFLAVYVGEGQKKRYVVPVSYLSQPSFQALLSKSEE  65

Query  718  EFGFDHQMGGLTIPCPEDTFLDI  650
            EFGF+H MGGLTIPCPEDTF+D+
Sbjct  66   EFGFNHPMGGLTIPCPEDTFIDV  88



>emb|CAN79758.1| hypothetical protein VITISV_009898 [Vitis vinifera]
Length=80

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -2

Query  865  SSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQMGGL  686
            S+ +  +E +VP+GHFAVYVG+++KKRFV+PISYL  PSFQDLL QAEEEFGFDH MGGL
Sbjct  2    STIQVLQESDVPRGHFAVYVGDTQKKRFVVPISYLNHPSFQDLLQQAEEEFGFDHPMGGL  61

Query  685  TIPCPEDTFLDI  650
            TIPC E+TF+D+
Sbjct  62   TIPCKEETFVDL  73



>ref|XP_002271464.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
Length=103

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (73%), Gaps = 7/96 (7%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREI-------EVPKGHFAVYVGESEKKRFVIPISYLK  758
            M   +  I++AK+ L+  S  T  ++       EVPKGHFAVYVGE++KKRFV+PISYL 
Sbjct  1    MGFRLPSIIQAKKILKLQSLLTRSQLSISATTAEVPKGHFAVYVGEAQKKRFVLPISYLN  60

Query  757  DPSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            +PSFQ LLS AEEEFGF+H MGG+TIPC ED F+ +
Sbjct  61   NPSFQKLLSCAEEEFGFNHPMGGVTIPCKEDAFIHL  96



>gb|EYU40723.1| hypothetical protein MIMGU_mgv1a024510mg, partial [Erythranthe 
guttata]
Length=80

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  868  RSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQMGG  689
            RS S   R  EVPKGHF VYVGESEKKRFVIP+SYL +P FQ+LL QAEEEFGF H MGG
Sbjct  1    RSLSSEKRSTEVPKGHFVVYVGESEKKRFVIPLSYLNNPLFQELLCQAEEEFGFHHPMGG  60

Query  688  LTIPCPEDTFLDI  650
            LTIPC E+ F+D+
Sbjct  61   LTIPCTEELFIDL  73



>ref|XP_008391976.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=92

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  868  RSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEEFGFDHQMGG  689
            + S  +++ ++VPKG+ A+YVGES+KKRFVIP+SYL  PSFQDLLS AE+EFG+DH MGG
Sbjct  14   KKSQVSSKSLDVPKGYLAIYVGESQKKRFVIPVSYLNQPSFQDLLSLAEDEFGYDHPMGG  73

Query  688  LTIPCPEDTFLDI  650
            LTIPC EDTFLD+
Sbjct  74   LTIPCSEDTFLDL  86



>ref|XP_009368378.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=101

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 72/95 (76%), Gaps = 5/95 (5%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNRE-----IEVPKGHFAVYVGESEKKRFVIPISYLKDP  752
            M   +  ++ AK+  RRS S +++      ++VPKG+F+VYVGESEK RFV+PIS+L  P
Sbjct  1    MGFRLPAVIPAKKLFRRSFSNSSQGASYNLVDVPKGYFSVYVGESEKHRFVVPISFLCQP  60

Query  751  SFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDII  647
            +FQ LLS+AEEEFGFDH MGGLTIPC +D FLD++
Sbjct  61   AFQHLLSKAEEEFGFDHPMGGLTIPCRQDAFLDLV  95



>emb|CBI37951.3| unnamed protein product [Vitis vinifera]
Length=91

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI   RI+RAKQ   R    +    +VPKGHF VYVGE++KKRFVIPISYLK PSFQ L
Sbjct  1    MAIRFQRIIRAKQ-FPRCILPSLETTDVPKGHFPVYVGETQKKRFVIPISYLKHPSFQKL  59

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFGFDH  GGLTIPC E++   I
Sbjct  60   LSQAEEEFGFDHPQGGLTIPCREESIKKI  88



>ref|XP_004163654.1| PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]
 gb|KGN43218.1| hypothetical protein Csa_7G009140 [Cucumis sativus]
Length=102

 Score =   115 bits (288),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 68/98 (69%), Gaps = 12/98 (12%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRR---------SSSRTNREIEVPKGHFAVYVGESEKKRFVIPISY  764
            M I +T I  AKQ L+R         S+  TN    VPKGHFAVYVGE++KKRFV+PI Y
Sbjct  1    MGIHLTGIANAKQKLQRTFSGKYGIGSAVTTN---NVPKGHFAVYVGETQKKRFVVPIWY  57

Query  763  LKDPSFQDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            L  P F+DLL+ AEEEFGFDH MGGLTIPC ED F+ +
Sbjct  58   LNHPLFKDLLNLAEEEFGFDHPMGGLTIPCTEDYFISL  95



>ref|XP_007200158.1| hypothetical protein PRUPE_ppa016758mg [Prunus persica]
 gb|EMJ01357.1| hypothetical protein PRUPE_ppa016758mg [Prunus persica]
Length=93

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            M   +  I+ +K+GL +++  T+  +++PKG+FAVYVG S+KKRFV+PISYL +P F DL
Sbjct  1    MGFRLPGIVNSKKGLNKAA--TSNTVDIPKGYFAVYVGGSQKKRFVVPISYLNEPLFLDL  58

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LSQAEEEFG+DH MGG+TIPC ++TF+ +
Sbjct  59   LSQAEEEFGYDHPMGGITIPCSDETFIHL  87



>ref|XP_009799437.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=90

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 4/82 (5%)
 Frame = -2

Query  895  ILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDLLSQAEEE  716
            I +A + LRRSS+       VPKGH AVYVGES+KKRFV+PISYL  P FQDLL+QAEEE
Sbjct  6    IFKANRILRRSSTTGG----VPKGHCAVYVGESQKKRFVMPISYLSQPLFQDLLAQAEEE  61

Query  715  FGFDHQMGGLTIPCPEDTFLDI  650
            FGFDH MGGLTI C ED F+D+
Sbjct  62   FGFDHSMGGLTISCKEDVFIDL  83



>ref|XP_002276321.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
Length=95

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 70/92 (76%), Gaps = 7/92 (8%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRR---SSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSF  746
            MAI   RI+ AKQ LRR   S   TN    VPKG+  VYVGE++KKRFVIPISYLK  SF
Sbjct  1    MAIRFQRIIPAKQILRRILPSPEPTN----VPKGYVPVYVGETQKKRFVIPISYLKHHSF  56

Query  745  QDLLSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            Q+LLSQAEEEFGFDH +GGLTIPC E+ F+++
Sbjct  57   QNLLSQAEEEFGFDHPLGGLTIPCREEAFINL  88



>gb|KDP27610.1| hypothetical protein JCGZ_19615 [Jatropha curcas]
Length=94

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = -2

Query  916  MAISMTRILRAKQGLRRSSSRTNREIEVPKGHFAVYVGESEKKRFVIPISYLKDPSFQDL  737
            MAI +  +LR      R S+  +R  +VPKG  AVYVGE+EKKR+++PISYL  PSFQDL
Sbjct  1    MAIRLPSVLRTSTVASRKSA--SRSFDVPKGFIAVYVGETEKKRYIVPISYLNHPSFQDL  58

Query  736  LSQAEEEFGFDHQMGGLTIPCPEDTFLDI  650
            LS+AEEE+GFDH MGG TIPC EDTF+ +
Sbjct  59   LSRAEEEYGFDHPMGGSTIPCREDTFIYV  87



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2302838196460