BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25395_g1_i1 len=1273 path=[1:0-44 46:45-88 90:89-112 114:113-321
323:322-355 357:356-394 396:395-419 4302:420-516 518:517-532
534:533-561 563:562-565 567:566-652 4407:653-676 678:677-752
3828:753-766 768:767-801 3902:802-808 810:809-930 3701:931-940
4532:941-947 3718:948-964 966:965-1008 1010:1009-1033 1035:1034-1082
2754:1083-1123 1112:1124-1149 3411:1150-1161 1162:1162-1272]

Length=1273
                                                                      Score     E

dbj|BAF46311.1|  cysteine proteinase precursor                          663   0.0      Ipomoea nil [qian niu]
gb|AAK27968.1|AF242372_1  cysteine protease                             625   0.0      Ipomoea batatas [batate]
gb|AAL14199.1|  cysteine proteinase precursor                           623   0.0      Ipomoea batatas [batate]
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g             509   2e-176   Populus trichocarpa [western balsam poplar]
ref|XP_007048796.1|  Senescence-associated gene 12                      508   4e-176   
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...    508   9e-176   
ref|XP_007048792.1|  Senescence-associated gene 12                      505   6e-175   
emb|CDP18641.1|  unnamed protein product                                502   5e-174   
emb|CAL64936.1|  putative cysteine protease 8                           498   3e-172   Trifolium pratense [peavine clover]
gb|AAP32196.1|  cysteine protease 8                                     498   4e-172   Trifolium repens [creeping white clover]
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1            498   5e-172   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...    497   5e-172   
ref|XP_006469012.1|  PREDICTED: vignain-like                            496   1e-171   
ref|XP_006469011.1|  PREDICTED: vignain-like                            495   3e-171   
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg                494   1e-170   
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg             494   2e-170   
ref|XP_002523447.1|  cysteine protease, putative                        494   2e-170   Ricinus communis
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...    493   2e-170   
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g             493   3e-170   Populus trichocarpa [western balsam poplar]
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...    493   3e-170   
dbj|BAF56428.1|  cysteine proteinase                                    493   3e-170   Lotus japonicus
ref|XP_003526232.1|  PREDICTED: vignain-like                            493   4e-170   
ref|XP_003612210.1|  Cysteine proteinase                                492   6e-170   
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g             492   7e-170   
ref|XP_002523448.1|  cysteine protease, putative                        492   7e-170   Ricinus communis
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg             492   8e-170   
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g             492   8e-170   Populus trichocarpa [western balsam poplar]
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g             492   1e-169   
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g             492   1e-169   
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...    491   2e-169   
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg             491   2e-169   
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...    491   2e-169   
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...    491   3e-169   Vitis vinifera
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg             490   3e-169   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...    490   3e-169   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g             490   5e-169   
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g             490   5e-169   
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                        489   7e-169   
gb|AAP32198.1|  cysteine protease 12                                    489   1e-168   Trifolium repens [creeping white clover]
gb|AAP32195.1|  cysteine protease 5                                     489   1e-168   Trifolium repens [creeping white clover]
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...    488   2e-168   Vitis vinifera
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...    489   2e-168   
ref|XP_006592465.1|  PREDICTED: vignain-like                            488   3e-168   
ref|XP_003557016.1|  PREDICTED: vignain-like                            488   3e-168   
ref|XP_006592467.1|  PREDICTED: vignain-like                            488   4e-168   
ref|XP_007132888.1|  hypothetical protein PHAVU_011G133300g             488   4e-168   
ref|XP_008340724.1|  PREDICTED: vignain-like                            487   4e-168   
ref|XP_002522559.1|  cysteine protease, putative                        488   4e-168   Ricinus communis
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...    487   6e-168   Vitis vinifera
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                        487   7e-168   
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...    487   9e-168   Vitis vinifera
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                        486   1e-167   
ref|XP_004505498.1|  PREDICTED: vignain-like                            486   2e-167   
emb|CAN64655.1|  hypothetical protein VITISV_005140                     486   2e-167   Vitis vinifera
ref|XP_006467666.1|  PREDICTED: vignain-like                            486   2e-167   
ref|XP_003609015.1|  Cysteine proteinase                                485   3e-167   
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g             485   3e-167   
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                        485   3e-167   
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg             485   4e-167   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1            486   4e-167   
ref|XP_004506025.1|  PREDICTED: vignain-like                            485   5e-167   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                         484   7e-167   
emb|CAN70559.1|  hypothetical protein VITISV_032465                     484   9e-167   Vitis vinifera
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...    484   1e-166   
ref|XP_007048674.1|  Senescence-associated gene 12                      484   2e-166   
ref|XP_009361500.1|  PREDICTED: vignain-like                            483   2e-166   
gb|KDP45578.1|  hypothetical protein JCGZ_17185                         483   2e-166   
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...    483   2e-166   
ref|XP_006360707.1|  PREDICTED: vignain-like                            483   2e-166   
dbj|BAD29955.1|  cysteine protease                                      484   2e-166   Daucus carota [carrots]
gb|KHN13721.1|  Vignain                                                 482   2e-166   
gb|KHN08187.1|  Thiol protease SEN102                                   482   3e-166   
ref|XP_004505502.1|  PREDICTED: vignain-like                            483   3e-166   
ref|XP_007132860.1|  hypothetical protein PHAVU_011G130800g             483   4e-166   
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                        482   4e-166   
ref|XP_009359967.1|  PREDICTED: vignain-like                            482   5e-166   
ref|XP_004290089.1|  PREDICTED: vignain-like                            482   5e-166   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...    482   5e-166   
ref|XP_006362426.1|  PREDICTED: vignain-like                            482   6e-166   
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                        481   1e-165   
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...    481   1e-165   
dbj|BAF56430.1|  cysteine proteinase                                    481   1e-165   Lotus japonicus
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg                481   1e-165   
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g             480   3e-165   
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                        480   3e-165   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                        479   5e-165   
ref|XP_008228922.1|  PREDICTED: vignain-like                            478   9e-165   
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg             479   1e-164   
gb|AAT34987.1|  putative cysteine protease                              479   1e-164   Gossypium hirsutum [American cotton]
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                        478   1e-164   
ref|XP_003607571.1|  Cysteine proteinase EP-B                           478   2e-164   
ref|XP_004505500.1|  PREDICTED: vignain-like                            478   3e-164   
ref|XP_004306851.1|  PREDICTED: vignain-like                            478   3e-164   
dbj|BAF56427.1|  cysteine proteinase                                    478   3e-164   Lotus japonicus
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg             478   3e-164   
dbj|BAB13759.1|  cysteine proteinase                                    477   5e-164   Astragalus sinicus
gb|AAA50755.1|  cysteine proteinase                                     477   7e-164   Alnus glutinosa
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                        477   8e-164   
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g             477   8e-164   
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                        477   8e-164   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...    476   8e-164   
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...    477   9e-164   
ref|XP_003538185.1|  PREDICTED: vignain-like                            476   1e-163   
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg             476   1e-163   
ref|XP_007025398.1|  Senescence-associated gene 12                      476   1e-163   
gb|KDP23984.1|  hypothetical protein JCGZ_25372                         476   1e-163   
gb|AFV30165.1|  cysteine proteinase                                     475   3e-163   
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...    475   4e-163   
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg                475   4e-163   
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g             474   6e-163   
gb|KHN32069.1|  Vignain                                                 474   6e-163   
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g             473   6e-163   Populus trichocarpa [western balsam poplar]
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...    474   8e-163   
ref|XP_004297571.1|  PREDICTED: vignain-like                            474   8e-163   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                         473   9e-163   
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1            474   1e-162   
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g             474   1e-162   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                        474   1e-162   
ref|XP_003605890.1|  Cysteine proteinase                                474   1e-162   
ref|XP_004303175.1|  PREDICTED: vignain-like                            473   1e-162   
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                        473   1e-162   
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                        473   2e-162   
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                        473   3e-162   
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg             473   3e-162   
ref|XP_004489011.1|  PREDICTED: vignain-like                            473   3e-162   
ref|XP_004297572.1|  PREDICTED: vignain-like                            472   4e-162   
ref|XP_009349242.1|  PREDICTED: vignain-like                            478   5e-162   
ref|XP_009365508.1|  PREDICTED: vignain-like                            479   5e-162   
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1             472   6e-162   
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                        473   6e-162   
ref|XP_003539970.1|  PREDICTED: vignain-like                            472   7e-162   
ref|XP_011037399.1|  PREDICTED: senescence-specific cysteine prot...    471   8e-162   
ref|XP_003539989.1|  PREDICTED: vignain-like                            472   8e-162   
ref|XP_003527349.1|  PREDICTED: vignain-like                            471   8e-162   
ref|XP_006360708.1|  PREDICTED: vignain-like                            471   9e-162   
ref|XP_006449486.1|  hypothetical protein CICLE_v10018236mg             470   1e-161   
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                        471   1e-161   
ref|XP_006469128.1|  PREDICTED: vignain-like                            470   3e-161   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    470   3e-161   
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...    470   3e-161   
ref|XP_003556992.1|  PREDICTED: vignain-like                            470   4e-161   
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                        469   5e-161   
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2             468   9e-161   
ref|XP_003607548.1|  Cysteine protease                                  469   9e-161   
ref|XP_006376351.1|  hypothetical protein POPTR_0013s12280g             469   1e-160   
ref|XP_003607574.1|  Cysteine protease                                  468   1e-160   
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                        468   1e-160   
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...    468   1e-160   Vitis vinifera
ref|XP_002531151.1|  cysteine protease, putative                        468   2e-160   Ricinus communis
gb|EYU43350.1|  hypothetical protein MIMGU_mgv1a021555mg                468   2e-160   
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                        467   5e-160   
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                        467   6e-160   
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                        466   8e-160   
ref|XP_002280263.1|  PREDICTED: senescence-specific cysteine prot...    466   1e-159   Vitis vinifera
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                        466   1e-159   
ref|XP_003527388.1|  PREDICTED: vignain-like                            466   1e-159   
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3             464   3e-159   
ref|XP_006362428.1|  PREDICTED: vignain-like                            464   5e-159   
ref|XP_002531152.1|  cysteine protease, putative                        464   6e-159   Ricinus communis
ref|XP_007132896.1|  hypothetical protein PHAVU_011G134100g             463   7e-159   
ref|XP_009354321.1|  PREDICTED: ervatamin-B-like                        466   1e-158   
ref|XP_004306836.1|  PREDICTED: vignain-like                            464   1e-158   
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                        463   1e-158   
ref|XP_009797968.1|  PREDICTED: vignain-like                            463   1e-158   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...    464   1e-158   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741    479   2e-158   
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg                462   2e-158   
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                   462   2e-158   
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                        462   3e-158   
ref|XP_004308524.1|  PREDICTED: vignain-like                            462   5e-158   
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                        461   5e-158   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                        461   7e-158   
emb|CDP18644.1|  unnamed protein product                                461   7e-158   
ref|XP_007050065.1|  Senescence-associated gene 12                      461   9e-158   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                        461   1e-157   
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                        461   2e-157   
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                        461   2e-157   
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    460   2e-157   
ref|XP_004306597.1|  PREDICTED: vignain-like                            460   2e-157   
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...    459   4e-157   
gb|KHN38752.1|  Vignain                                                 458   5e-157   
gb|KHN07749.1|  Vignain                                                 457   1e-156   
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg                457   2e-156   
ref|XP_004306813.1|  PREDICTED: vignain-like                            457   3e-156   
ref|XP_004294729.1|  PREDICTED: vignain-like                            457   3e-156   
emb|CDP18645.1|  unnamed protein product                                457   3e-156   
ref|XP_008800073.1|  PREDICTED: ervatamin-B-like                        456   1e-155   
gb|KHN07750.1|  KDEL-tailed cysteine endopeptidase CEP1                 454   3e-155   
gb|KHN33962.1|  Vignain                                                 454   3e-155   
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                        455   3e-155   
gb|KHN13720.1|  Vignain                                                 452   7e-155   
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                        454   8e-155   
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                        454   9e-155   
dbj|BAD29959.1|  cysteine protease                                      454   1e-154   Daucus carota [carrots]
ref|XP_008368631.1|  PREDICTED: ervatamin-B-like                        453   2e-154   
emb|CDP05747.1|  unnamed protein product                                452   3e-154   
ref|XP_003596314.1|  Cysteine proteinase                                450   2e-153   
ref|XP_006592475.1|  PREDICTED: vignain-like                            450   2e-153   
ref|XP_006380495.1|  hypothetical protein POPTR_0007s07290g             449   2e-153   
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg             450   3e-153   
ref|XP_003527350.1|  PREDICTED: vignain-like                            449   4e-153   
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                     447   1e-152   
emb|CBI21973.3|  unnamed protein product                                446   2e-152   
gb|KHN32068.1|  Vignain                                                 445   5e-152   
emb|CBI21976.3|  unnamed protein product                                445   7e-152   
ref|XP_007132814.1|  hypothetical protein PHAVU_011G126700g             444   3e-151   
ref|XP_006582264.1|  PREDICTED: vignain-like                            444   4e-151   
ref|XP_003526207.1|  PREDICTED: thiol protease SEN102-like              444   5e-151   
ref|XP_002525123.1|  cysteine protease, putative                        444   5e-151   Ricinus communis
gb|KHN08873.1|  Vignain                                                 444   6e-151   
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g             444   7e-151   
emb|CBI21972.3|  unnamed protein product                                442   8e-151   
dbj|BAF56429.1|  cysteine proteinase                                    443   1e-150   Lotus japonicus
ref|XP_006652104.1|  PREDICTED: vignain-like                            443   1e-150   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...    443   2e-150   
ref|XP_006582263.1|  PREDICTED: vignain-like                            442   2e-150   
gb|AAR92154.1|  putative cysteine protease 1                            442   2e-150   Iris x hollandica [Dutch iris]
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like              442   2e-150   
gb|KHN28095.1|  Thiol protease                                          442   2e-150   
ref|XP_009354265.1|  PREDICTED: ervatamin-B-like                        442   2e-150   
ref|XP_007132874.1|  hypothetical protein PHAVU_011G132000g             442   2e-150   
ref|XP_003540013.1|  PREDICTED: vignain-like                            441   6e-150   
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                        441   6e-150   
ref|XP_004973089.1|  PREDICTED: thiol protease SEN102-like              441   9e-150   
gb|KCW84689.1|  hypothetical protein EUGRSUZ_B01506                     439   1e-149   
ref|XP_004974538.1|  PREDICTED: thiol protease SEN102-like              440   2e-149   
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                    439   4e-149   
gb|KHN27797.1|  Thiol protease SEN102                                   439   4e-149   
gb|KHN27806.1|  Vignain                                                 438   5e-149   
ref|XP_004974539.1|  PREDICTED: thiol protease SEN102-like              439   6e-149   
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g             439   6e-149   
ref|XP_004974540.1|  PREDICTED: thiol protease SEN102-like              438   7e-149   
gb|KHN05669.1|  Vignain                                                 436   2e-148   
gb|KDP40484.1|  hypothetical protein JCGZ_24483                         437   4e-148   
ref|XP_004974541.1|  PREDICTED: thiol protease SEN102-like              437   4e-148   
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                    440   4e-148   
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...    436   6e-148   
emb|CBI21977.3|  unnamed protein product                                434   1e-147   
sp|Q7XWK5.2|SAG39_ORYSJ  RecName: Full=Senescence-specific cystei...    435   2e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...    435   2e-147   
sp|A2XQE8.1|SAG39_ORYSI  RecName: Full=Senescence-specific cystei...    434   3e-147   Oryza sativa Indica Group [Indian rice]
ref|XP_004975180.1|  PREDICTED: thiol protease SEN102-like              434   3e-147   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                        434   3e-147   
emb|CAH66275.1|  OSIGBa0147O06.5                                        434   5e-147   Oryza sativa [red rice]
ref|XP_003599736.1|  Cysteine proteinase                                434   5e-147   
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                        434   6e-147   
emb|CBI30671.3|  unnamed protein product                                433   6e-147   
ref|XP_010035848.1|  PREDICTED: zingipain-2-like                        433   1e-146   
gb|KDP45355.1|  hypothetical protein JCGZ_09604                         432   1e-146   
ref|XP_002446222.1|  hypothetical protein SORBIDRAFT_06g005410          432   2e-146   Sorghum bicolor [broomcorn]
gb|ADV74756.1|  cysteine protease                                       433   2e-146   
gb|AFK44139.1|  unknown                                                 432   2e-146   
ref|XP_002525124.1|  cysteine protease, putative                        432   2e-146   Ricinus communis
ref|XP_004975184.1|  PREDICTED: vignain-like                            432   2e-146   
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                        432   2e-146   
ref|XP_003607647.1|  Cysteine proteinase                                432   3e-146   
emb|CAD40112.2|  OSJNBa0035O13.5                                        430   2e-145   Oryza sativa Japonica Group [Japonica rice]
gb|AAP32194.1|  cysteine protease 1                                     428   2e-145   Trifolium repens [creeping white clover]
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400          430   2e-145   
gb|EMT12294.1|  Vignain                                                 428   8e-145   
gb|EAY93078.1|  hypothetical protein OsI_14879                          428   9e-145   Oryza sativa Indica Group [Indian rice]
emb|CAH66233.1|  H0825G02.10                                            428   1e-144   Oryza sativa [red rice]
gb|EMT33085.1|  Vignain                                                 428   1e-144   
gb|KHG19386.1|  KDEL-tailed cysteine endopeptidase CEP2 -like pro...    425   1e-144   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...    427   3e-144   
ref|XP_004975183.1|  PREDICTED: vignain-like                            427   3e-144   
ref|XP_010239696.1|  PREDICTED: senescence-specific cysteine prot...    427   3e-144   
ref|XP_004975182.1|  PREDICTED: vignain-like                            426   6e-144   
ref|XP_008225269.1|  PREDICTED: uncharacterized protein LOC103324934    440   1e-143   
ref|XP_004505458.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    425   1e-143   
gb|KCW47322.1|  hypothetical protein EUGRSUZ_K01110                     422   5e-143   
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...    423   1e-142   
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070          423   1e-142   
gb|ADP02218.1|  Peptidase_C1 domain-containing protein                  422   2e-142   
gb|EAY97106.1|  hypothetical protein OsI_19029                          422   2e-142   Oryza sativa Indica Group [Indian rice]
gb|EMT08022.1|  Vignain                                                 421   5e-142   
gb|AGT16936.1|  vignain-like protein                                    421   6e-142   
gb|KHN12137.1|  Thiol protease                                          421   8e-142   
ref|XP_008663073.1|  PREDICTED: ervatamin-B-like                        421   1e-141   
ref|XP_006582265.1|  PREDICTED: thiol protease SEN102-like              420   1e-141   
ref|XP_006857796.1|  hypothetical protein AMTR_s00061p00215230          420   1e-141   
ref|XP_004233054.1|  PREDICTED: senescence-specific cysteine prot...    420   1e-141   
ref|XP_003526209.1|  PREDICTED: thiol protease SEN102-like              419   2e-141   
ref|XP_003578807.1|  PREDICTED: senescence-specific cysteine prot...    419   3e-141   
ref|XP_003578808.1|  PREDICTED: senescence-specific cysteine prot...    419   3e-141   
gb|ABA97421.1|  Vignain precursor, putative                             419   3e-141   
ref|XP_006857794.1|  hypothetical protein AMTR_s00061p00214890          419   4e-141   
ref|XP_009759551.1|  PREDICTED: zingipain-2-like                        419   4e-141   
gb|EMT29822.1|  Vignain                                                 419   5e-141   
ref|XP_003578815.1|  PREDICTED: senescence-specific cysteine prot...    419   5e-141   
gb|AAW78661.2|  senescence-specific cysteine protease                   419   5e-141   
gb|ADV41672.1|  cysteine protease                                       419   6e-141   
ref|XP_009608954.1|  PREDICTED: zingipain-2-like                        419   7e-141   
ref|XP_002446132.1|  hypothetical protein SORBIDRAFT_06g002150          417   2e-140   
gb|EMT20796.1|  Vignain                                                 419   2e-140   
gb|EMT15489.1|  Thiol protease SEN102                                   416   5e-140   
ref|XP_003539770.1|  PREDICTED: vignain-like                            416   5e-140   
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                        416   5e-140   
ref|XP_002446133.1|  hypothetical protein SORBIDRAFT_06g002160          416   5e-140   
ref|XP_008244477.1|  PREDICTED: zingipain-2-like                        415   1e-139   
gb|EEC84514.1|  hypothetical protein OsI_31214                          415   1e-139   
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g             415   1e-139   
ref|XP_002446135.1|  hypothetical protein SORBIDRAFT_06g002170          415   1e-139   
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                        414   2e-139   
gb|EMS56453.1|  KDEL-tailed cysteine endopeptidase CEP1                 414   2e-139   
ref|XP_010052196.1|  PREDICTED: zingipain-2-like                        414   2e-139   
gb|EMT08019.1|  Vignain                                                 413   2e-139   
ref|XP_008669676.1|  PREDICTED: ervatamin-B-like                        414   3e-139   
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g             414   3e-139   
ref|XP_003526212.1|  PREDICTED: thiol protease SEN102-like              414   4e-139   
ref|XP_006362420.1|  PREDICTED: vignain-like                            414   4e-139   
ref|XP_003578813.1|  PREDICTED: senescence-specific cysteine prot...    414   4e-139   
gb|KCW76116.1|  hypothetical protein EUGRSUZ_D00493                     414   5e-139   
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like              413   8e-139   
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1             412   3e-138   
ref|XP_011008467.1|  PREDICTED: senescence-specific cysteine prot...    410   3e-138   
gb|AAP32197.1|  cysteine protease 10                                    409   3e-138   
ref|XP_009407029.1|  PREDICTED: ervatamin-B-like                        411   5e-138   
ref|XP_007048673.1|  Senescence-associated gene 12, putative            409   8e-138   
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2             410   8e-138   
gb|EMT20795.1|  Vignain                                                 410   1e-137   
gb|EMT29821.1|  Thiol protease SEN102                                   409   2e-137   
gb|AHA62780.1|  RCR3-like cysteine protease                             409   3e-137   
emb|CDP06286.1|  unnamed protein product                                407   4e-137   
ref|XP_006663940.1|  PREDICTED: thiol protease SEN102-like              409   4e-137   
gb|AHA62779.1|  RCR3-like cysteine protease                             409   4e-137   
ref|XP_002436841.1|  hypothetical protein SORBIDRAFT_10g009840          407   7e-137   
ref|XP_003581047.2|  PREDICTED: senescence-specific cysteine prot...    408   8e-137   
gb|AHA62781.1|  RCR3-like cysteine protease                             407   1e-136   
ref|XP_009397226.1|  PREDICTED: zingipain-2-like                        408   2e-136   
gb|AGT97048.1|  senescence-specific cysteine protease                   407   2e-136   
gb|EMT29823.1|  Vignain                                                 406   3e-136   
ref|XP_002436840.1|  hypothetical protein SORBIDRAFT_10g009830          405   4e-136   
gb|AHA62783.1|  RCR3-like cysteine protease                             406   5e-136   
ref|XP_008246197.1|  PREDICTED: vignain-like                            404   5e-136   
ref|XP_003558756.1|  PREDICTED: senescence-specific cysteine prot...    405   7e-136   
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...    405   1e-135   
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                        405   1e-135   
ref|XP_008669668.1|  PREDICTED: ervatamin-B-like                        405   2e-135   
gb|AHA62782.1|  RCR3-like cysteine protease                             404   2e-135   
gb|ABF70145.1|  cysteine protease, putative                             405   2e-135   
ref|XP_007214697.1|  hypothetical protein PRUPE_ppa026948mg             404   2e-135   
emb|CDP18639.1|  unnamed protein product                                403   5e-135   
ref|XP_010686289.1|  PREDICTED: senescence-specific cysteine prot...    403   5e-135   
ref|XP_010052203.1|  PREDICTED: ervatamin-B-like                        402   1e-134   
ref|XP_003578721.1|  PREDICTED: senescence-specific cysteine prot...    402   1e-134   
ref|XP_010054320.1|  PREDICTED: ervatamin-B-like                        400   6e-134   
ref|XP_008228971.1|  PREDICTED: zingipain-2-like                        400   7e-134   
emb|CDP18638.1|  unnamed protein product                                400   9e-134   
gb|AAX13273.1|  putative cysteine protease                              400   1e-133   
gb|EMT09279.1|  Thiol protease SEN102                                   398   1e-133   
ref|XP_010054319.1|  PREDICTED: zingipain-2-like                        399   2e-133   
ref|XP_010052199.1|  PREDICTED: ervatamin-B-like                        399   4e-133   
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                        397   6e-133   
gb|EAY93080.1|  hypothetical protein OsI_14881                          396   9e-133   
emb|CAD40110.2|  OSJNBa0035O13.9                                        396   1e-132   
gb|KCW76123.1|  hypothetical protein EUGRSUZ_D00500                     397   1e-132   
ref|NP_001052232.2|  Os04g0203500                                       396   3e-132   
gb|ADP02219.1|  Peptidase_C1 domain-containing protein                  398   6e-132   
ref|XP_003526229.1|  PREDICTED: vignain-like                            392   1e-131   
ref|XP_007214465.1|  hypothetical protein PRUPE_ppa023848mg             394   2e-131   
ref|XP_007132822.1|  hypothetical protein PHAVU_011G127400g             394   2e-131   
ref|XP_006652103.1|  PREDICTED: cysteine protease 1-like                394   2e-131   
ref|XP_010052201.1|  PREDICTED: ervatamin-B-like                        394   3e-131   
emb|CAE03344.2|  OSJNBb0005B05.11                                       392   4e-131   
emb|CAN62838.1|  hypothetical protein VITISV_003391                     391   5e-131   
ref|XP_010481519.1|  PREDICTED: senescence-specific cysteine prot...    393   5e-131   
ref|XP_006398274.1|  hypothetical protein EUTSA_v10000948mg             393   7e-131   
ref|XP_010494742.1|  PREDICTED: senescence-specific cysteine prot...    392   2e-130   
ref|XP_003540007.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    391   2e-130   
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                        391   3e-130   
gb|AFW57869.1|  hypothetical protein ZEAMMB73_830006                    394   4e-130   
ref|XP_010054322.1|  PREDICTED: ervatamin-B-like                        391   4e-130   
ref|XP_007025415.1|  Senescence-associated gene 12, putative            390   5e-130   
ref|XP_002446131.1|  hypothetical protein SORBIDRAFT_06g002140          390   5e-130   
ref|XP_008780645.1|  PREDICTED: vignain-like                            388   5e-130   
gb|KHN34255.1|  KDEL-tailed cysteine endopeptidase CEP1                 389   6e-130   
ref|XP_008669672.1|  PREDICTED: ervatamin-B-like                        389   7e-130   
ref|XP_003599735.1|  Cysteine proteinase                                390   8e-130   
ref|XP_010441658.1|  PREDICTED: senescence-specific cysteine prot...    390   9e-130   
ref|XP_010052198.1|  PREDICTED: ervatamin-B-like                        389   2e-129   
gb|KFK31512.1|  hypothetical protein AALP_AA6G122300                    389   2e-129   
ref|XP_002436842.1|  hypothetical protein SORBIDRAFT_10g009850          387   3e-129   
ref|XP_009366072.1|  PREDICTED: zingipain-2-like                        389   4e-129   
ref|XP_003526215.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    388   4e-129   
ref|XP_002865220.1|  senescence-associated gene 12                      388   5e-129   
ref|XP_007021896.1|  Cysteine proteinases superfamily protein, pu...    387   6e-129   
gb|KCW76128.1|  hypothetical protein EUGRSUZ_D00504                     387   6e-129   
ref|XP_003526208.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    387   7e-129   
ref|XP_006281607.1|  hypothetical protein CARUB_v10027725mg             388   7e-129   
ref|NP_568651.1|  cysteine protease SAG12                               387   1e-128   
ref|XP_003527330.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    387   1e-128   
ref|XP_007132818.1|  hypothetical protein PHAVU_011G127100g             387   1e-128   
gb|KHN27801.1|  Vignain                                                 385   3e-128   
gb|AAC49135.1|  SAG12 protein                                           386   4e-128   
ref|XP_008364019.1|  PREDICTED: zingipain-2-like                        386   4e-128   
ref|XP_007025397.1|  Senescence-associated gene 12, putative            384   6e-128   
ref|XP_003526217.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    385   7e-128   
gb|AFW86315.1|  hypothetical protein ZEAMMB73_539008                    383   1e-127   
ref|XP_004505461.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    384   2e-127   
gb|AAD53011.1|AF089848_1  senescence-specific cysteine protease         384   2e-127   
ref|XP_010518799.1|  PREDICTED: senescence-specific cysteine prot...    384   3e-127   
ref|XP_009128825.1|  PREDICTED: ervatamin-B                             383   4e-127   
ref|XP_007132871.1|  hypothetical protein PHAVU_011G131700g             379   1e-126   
ref|XP_008239373.1|  PREDICTED: vignain-like                            382   2e-126   
ref|XP_003540991.1|  PREDICTED: vignain-like                            382   2e-126   
gb|KHN05670.1|  Vignain                                                 380   2e-126   
ref|XP_007209277.1|  hypothetical protein PRUPE_ppa007566mg             382   2e-126   
gb|EYU28078.1|  hypothetical protein MIMGU_mgv1a009081mg                382   2e-126   
emb|CDX87758.1|  BnaC02g31910D                                          381   3e-126   
ref|XP_006852527.1|  hypothetical protein AMTR_s00021p00178980          379   2e-125   
ref|XP_003527331.1|  PREDICTED: vignain-like                            379   2e-125   
ref|XP_009774957.1|  PREDICTED: vignain-like                            379   3e-125   
ref|NP_001239703.1|  uncharacterized protein LOC100799247 precursor     378   3e-125   
gb|KHN33932.1|  KDEL-tailed cysteine endopeptidase CEP1                 377   6e-125   
ref|XP_009617207.1|  PREDICTED: vignain-like                            376   3e-124   
ref|XP_008811650.1|  PREDICTED: vignain-like                            374   3e-124   
gb|KHN33935.1|  KDEL-tailed cysteine endopeptidase CEP1                 374   6e-124   
ref|XP_010279091.1|  PREDICTED: ervatamin-B                             374   1e-123   
ref|XP_009101555.1|  PREDICTED: ervatamin-B-like                        374   1e-123   
ref|XP_007132821.1|  hypothetical protein PHAVU_011G127300g             373   3e-123   
ref|XP_006470294.1|  PREDICTED: xylem cysteine proteinase 1-like ...    373   4e-123   
ref|XP_004299172.1|  PREDICTED: vignain-like                            374   4e-123   
emb|CDP18637.1|  unnamed protein product                                369   5e-123   
gb|EYU22236.1|  hypothetical protein MIMGU_mgv1a008784mg                373   6e-123   
ref|XP_008364021.1|  PREDICTED: ervatamin-B-like                        373   8e-123   
ref|XP_009366071.1|  PREDICTED: ervatamin-B-like                        373   8e-123   
gb|KHN27802.1|  Vignain                                                 369   2e-122   
ref|XP_004487576.1|  PREDICTED: vignain-like                            371   2e-122   
gb|KDP30997.1|  hypothetical protein JCGZ_11373                         372   2e-122   
ref|XP_010245279.1|  PREDICTED: vignain-like                            372   2e-122   
ref|XP_008805113.1|  PREDICTED: vignain-like                            371   3e-122   
ref|XP_006446541.1|  hypothetical protein CICLE_v10015814mg             370   4e-122   
gb|AAW78660.1|  cysteine protease                                       371   5e-122   
ref|XP_004487579.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    370   5e-122   
ref|XP_008374352.1|  PREDICTED: vignain                                 371   5e-122   
ref|XP_004236298.1|  PREDICTED: vignain-like                            370   5e-122   
ref|XP_008392874.1|  PREDICTED: vignain-like                            370   7e-122   
gb|ABV22590.1|  KDEL-tailed cysteine endopeptidase                      370   7e-122   
ref|XP_011072006.1|  PREDICTED: vignain-like                            370   8e-122   
ref|XP_002321654.1|  Cys endopeptidase family protein                   370   8e-122   
ref|XP_006470293.1|  PREDICTED: xylem cysteine proteinase 1-like ...    370   9e-122   
ref|XP_009779832.1|  PREDICTED: vignain-like                            370   1e-121   
gb|KDO55227.1|  hypothetical protein CISIN_1g019112mg                   369   1e-121   
ref|XP_006470292.1|  PREDICTED: xylem cysteine proteinase 1-like ...    369   1e-121   
gb|KCW76139.1|  hypothetical protein EUGRSUZ_D00515                     368   2e-121   
ref|XP_008225268.1|  PREDICTED: zingipain-2-like                        368   2e-121   
emb|CAN62459.1|  hypothetical protein VITISV_015168                     364   4e-121   
ref|XP_006351440.1|  PREDICTED: vignain-like                            368   4e-121   
ref|XP_004305438.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    367   4e-121   
emb|CDY58055.1|  BnaA06g40240D                                          367   5e-121   
ref|XP_009333898.1|  PREDICTED: vignain                                 368   6e-121   
gb|AAM73806.1|AF448505_1  cysteine proteinase                           367   7e-121   
ref|XP_008345990.1|  PREDICTED: zingipain-2-like                        367   8e-121   
emb|CDP15086.1|  unnamed protein product                                368   9e-121   
ref|XP_006432601.1|  hypothetical protein CICLE_v10001718mg             366   2e-120   
ref|XP_006470291.1|  PREDICTED: xylem cysteine proteinase 1-like ...    366   3e-120   
ref|XP_011005600.1|  PREDICTED: vignain                                 366   3e-120   
gb|KHG06908.1|  Vignain                                                 366   4e-120   
ref|XP_006852216.1|  hypothetical protein AMTR_s00049p00133800          365   5e-120   
ref|XP_006490014.1|  PREDICTED: xylem cysteine proteinase 1-like        365   6e-120   
gb|KEH31736.1|  KDEL-tailed cysteine endopeptidase CEP1                 365   6e-120   
gb|EAY80530.1|  hypothetical protein OsI_35710                          366   7e-120   
ref|XP_010248729.1|  PREDICTED: vignain-like                            365   7e-120   
ref|XP_006432617.1|  hypothetical protein CICLE_v10001723mg             365   7e-120   
gb|EYU25614.1|  hypothetical protein MIMGU_mgv1a023209mg                365   8e-120   
dbj|BAC75924.1|  cysteine protease-2                                    365   8e-120   
ref|XP_009359516.1|  PREDICTED: vignain-like                            365   8e-120   
gb|ACB70409.1|  cysteine protease                                       365   9e-120   
ref|XP_007211535.1|  hypothetical protein PRUPE_ppa008267mg             363   1e-119   
ref|XP_008225270.1|  PREDICTED: zingipain-2-like                        363   2e-119   
ref|XP_010054326.1|  PREDICTED: zingipain-2-like                        366   2e-119   
dbj|BAG16376.1|  cysteine protease                                      363   2e-119   
gb|KDO63025.1|  hypothetical protein CISIN_1g018958mg                   363   2e-119   
ref|XP_006445658.1|  hypothetical protein CICLE_v10015798mg             363   2e-119   
ref|XP_002880913.1|  hypothetical protein ARALYDRAFT_481640             363   2e-119   
ref|XP_002511277.1|  cysteine protease, putative                        364   2e-119   
ref|NP_001067630.1|  Os11g0255300                                       364   3e-119   
ref|XP_006439985.1|  hypothetical protein CICLE_v10020781mg             363   3e-119   
gb|AAA92063.1|  cysteinyl endopeptidase                                 364   3e-119   
gb|AAR92155.1|  putative cysteine protease 2                            363   3e-119   
ref|XP_006659684.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    364   4e-119   
ref|XP_002515048.1|  cysteine protease, putative                        363   6e-119   
ref|XP_006421530.1|  hypothetical protein CICLE_v10005334mg             362   7e-119   
ref|XP_008368206.1|  PREDICTED: zingipain-2-like                        362   8e-119   
ref|XP_006476933.1|  PREDICTED: vignain-like                            362   8e-119   
ref|XP_004487577.1|  PREDICTED: vignain-like isoform X1                 362   8e-119   
ref|XP_007037812.1|  Cysteine proteinases superfamily protein iso...    362   1e-118   
ref|XP_010929952.1|  PREDICTED: vignain isoform X1                      362   1e-118   
ref|XP_006432594.1|  hypothetical protein CICLE_v10001719mg             361   1e-118   
ref|XP_011040442.1|  PREDICTED: vignain-like                            362   1e-118   
ref|XP_006376886.1|  hypothetical protein POPTR_0012s09270g             362   2e-118   
gb|AFW67600.1|  cysteine protease 1                                     361   2e-118   
ref|NP_565649.1|  cysteine proteinase-like protein                      361   2e-118   
gb|KCW76140.1|  hypothetical protein EUGRSUZ_D00517                     360   2e-118   
ref|XP_002466439.1|  hypothetical protein SORBIDRAFT_01g007820          361   2e-118   
ref|XP_007137980.1|  hypothetical protein PHAVU_009G170800g             361   3e-118   
ref|XP_010441769.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    361   3e-118   
emb|CAA40073.1|  endopeptidase (EP-C1)                                  361   3e-118   
ref|XP_010091035.1|  KDEL-tailed cysteine endopeptidase CEP1            360   4e-118   



>dbj|BAF46311.1| cysteine proteinase precursor [Ipomoea nil]
Length=339

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/339 (99%), Positives = 338/339 (99%), Gaps = 0/339 (0%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI
Sbjct  1     MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  60

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSS  422
             FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGY LPHECSSNTPFRYENVS+
Sbjct  61    FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYILPHECSSNTPFRYENVSA  120

Query  423   VPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKG  602
             VPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKG
Sbjct  121   VPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKG  180

Query  603   IDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANS  782
             IDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGSCKKSKSSNSAAKISGYEDVPANS
Sbjct  181   IDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGSCKKSKSSNSAAKISGYEDVPANS  240

Query  783   ESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWL  962
             ESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDG+KYWL
Sbjct  241   ESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGSKYWL  300

Query  963   VKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             VKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA
Sbjct  301   VKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  339



>gb|AAK27968.1|AF242372_1 cysteine protease [Ipomoea batatas]
Length=339

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/339 (96%), Positives = 332/339 (98%), Gaps = 0/339 (0%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             MASNSLKLL+ALALVFATSAYLATSRTL DSLM VRHEQWMAQYGRVYK E EKTKR+NI
Sbjct  1     MASNSLKLLVALALVFATSAYLATSRTLSDSLMVVRHEQWMAQYGRVYKTEAEKTKRFNI  60

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSS  422
             FKENVEYIESFNKAGTKPYKLGINAFADLTN+EF ASRNGYKLPH+CSSNTPFRYENVSS
Sbjct  61    FKENVEYIESFNKAGTKPYKLGINAFADLTNQEFKASRNGYKLPHDCSSNTPFRYENVSS  120

Query  423   VPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKG  602
             VPTTVDWR KGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKG
Sbjct  121   VPTTVDWRTKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKG  180

Query  603   IDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANS  782
              DQGCEGGLMDDAF+FIINNKGLTTESNYPYQGTDGSCKKSKSSNSAAKISGYEDVPANS
Sbjct  181   TDQGCEGGLMDDAFSFIINNKGLTTESNYPYQGTDGSCKKSKSSNSAAKISGYEDVPANS  240

Query  783   ESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWL  962
             ESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDG+KYWL
Sbjct  241   ESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGSKYWL  300

Query  963   VKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             VKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA
Sbjct  301   VKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  339



>gb|AAL14199.1| cysteine proteinase precursor [Ipomoea batatas]
 gb|AAK15148.2| cysteine proteinase-like protein [Ipomoea batatas]
Length=341

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/324 (97%), Positives = 320/324 (99%), Gaps = 0/324 (0%)
 Frame = +3

Query  108   FATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAG  287
             FATSAYLATSRTL DSLM VRHEQWMAQYGRVY+NEVEKTKR+NIFKENVEYIESFNKAG
Sbjct  18    FATSAYLATSRTLSDSLMVVRHEQWMAQYGRVYENEVEKTKRFNIFKENVEYIESFNKAG  77

Query  288   TKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSSVPTTVDWRKKGAVTP  467
             TKPYKLGINAFADLTN+EF ASRNGYKLPH+CSSNTPFRYENVSSVPTTVDWR KGAVTP
Sbjct  78    TKPYKLGINAFADLTNQEFKASRNGYKLPHDCSSNTPFRYENVSSVPTTVDWRTKGAVTP  137

Query  468   VKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFT  647
             VKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAF+
Sbjct  138   VKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFS  197

Query  648   FIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSV  827
             FIINNKGLTTESNYPYQGTDGSCKKSKSSNSAAKISGYEDVPANSESALEKAVANQPVSV
Sbjct  198   FIINNKGLTTESNYPYQGTDGSCKKSKSSNSAAKISGYEDVPANSESALEKAVANQPVSV  257

Query  828   AIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYI  1007
             AIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDG+KYWLVKNSWGTSWGEKGYI
Sbjct  258   AIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGSKYWLVKNSWGTSWGEKGYI  317

Query  1008  RMQKDIEAKEGLCGIAMQSSYPSA  1079
             RMQKDIEAKEGLCGIAMQSSYPSA
Sbjct  318   RMQKDIEAKEGLCGIAMQSSYPSA  341



>ref|XP_002316833.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
 gb|EEE97445.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
Length=362

 Score =   509 bits (1311),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 247/345 (72%), Positives = 285/345 (83%), Gaps = 7/345 (2%)
 Frame = +3

Query  51    RLSTMASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTK  230
             R++ +  N  KL+ A+ L+         SR+L ++ M  RHE WMAQYGR YK  VEK +
Sbjct  23    RMAFIPEN--KLIFAVVLLLGLWTSHVWSRSLYEASMMERHETWMAQYGRAYKGHVEKER  80

Query  231   RYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT--PFR  404
             R NIFK NVE+IESFNK G KPYKL +N FADLTN+EF ASRNGYK+    SS++  PFR
Sbjct  81    RLNIFKNNVEFIESFNKVGKKPYKLSVNEFADLTNEEFQASRNGYKMSAHLSSSSTKPFR  140

Query  405   YENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELV  584
             YENVS+VP+T+DWRKKGAVTP+KDQGQCGCCWAFSAVAA EGIT+LSTG LISLSEQELV
Sbjct  141   YENVSAVPSTMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLSTGKLISLSEQELV  200

Query  585   DCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYE  764
             DCD  G DQGC GGLMDDAF FII NKGLTTE+NYPYQG DG+C   K++       GYE
Sbjct  201   DCDTSGEDQGCNGGLMDDAFDFIIQNKGLTTEANYPYQGADGACNSGKAAAKIT---GYE  257

Query  765   DVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAED  944
             DVPANSE+AL KAVANQPVSVAIDAGGS FQFYSSGVFTG+CGT+LDHGVTAVGYG+++D
Sbjct  258   DVPANSEAALLKAVANQPVSVAIDAGGSAFQFYSSGVFTGDCGTDLDHGVTAVGYGMSDD  317

Query  945   GTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GTKYWLVKNSWGTSWGE GYIRM++DI+A+EGLCGIAM++SYP+A
Sbjct  318   GTKYWLVKNSWGTSWGENGYIRMERDIDAQEGLCGIAMEASYPTA  362



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   508 bits (1308),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 250/343 (73%), Positives = 294/343 (86%), Gaps = 6/343 (2%)
 Frame = +3

Query  63    MASNSLKL--LIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTK  230
             MA  +L+L   I LA +F   A +  ATSRTL D+ M  RHEQWMA+YGRVY +  E+ +
Sbjct  1     MAFKNLQLHQCICLAFIFIVGALVCEATSRTLQDASMYERHEQWMARYGRVYHDNNEREQ  60

Query  231   RYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN-TPFRY  407
             R+NIFKENV +I+SFN+A  KPYKLG+N FADLTN+EF ASRN +K  H CS+  T F+Y
Sbjct  61    RFNIFKENVAHIDSFNRAKDKPYKLGVNQFADLTNEEFTASRNRFK-GHMCSNKATTFKY  119

Query  408   ENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVD  587
             EN++++P+TVDWRKKGAVTP+KDQGQCGCCWAFSAVAAMEG+TKL+TG LISLSEQELVD
Sbjct  120   ENLTALPSTVDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGVTKLTTGKLISLSEQELVD  179

Query  588   CDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYED  767
             CD KG DQGC+GGLMDDAF FI NNKGLTTES+YPY+G DG+C  +K +N AAKI+G+ED
Sbjct  180   CDTKGEDQGCQGGLMDDAFQFIQNNKGLTTESDYPYKGVDGTCNTNKEANHAAKINGFED  239

Query  768   VPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDG  947
             VPANSE AL+KAVANQPVSVAIDAGG  FQFYS GVFTG+CGT LDHGVTAVGYG+ +DG
Sbjct  240   VPANSEDALQKAVANQPVSVAIDAGGFKFQFYSGGVFTGDCGTALDHGVTAVGYGVDDDG  299

Query  948   TKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  1076
             TKYWLVKNSWGTSWGE+GYIRMQ+D++AKEGLCGIAMQ+SYP+
Sbjct  300   TKYWLVKNSWGTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPT  342



>ref|XP_011045912.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=362

 Score =   508 bits (1308),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 245/345 (71%), Positives = 284/345 (82%), Gaps = 7/345 (2%)
 Frame = +3

Query  51    RLSTMASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTK  230
             R++ +  N  KL+ A+ L+         SR+L ++ M  RHE WMAQYGR YK+ VEK +
Sbjct  23    RMAFIPEN--KLIFAVVLLLGLWTSHVWSRSLYEASMMERHETWMAQYGRAYKDRVEKER  80

Query  231   RYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT--PFR  404
             R N FK NVE+IESFNK G KPYKL +N FADL N+EF ASRNGYK+P   SS++  PFR
Sbjct  81    RLNTFKNNVEFIESFNKDGKKPYKLSVNEFADLMNEEFRASRNGYKMPAHLSSSSTNPFR  140

Query  405   YENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELV  584
             YEN+S+VP+T+DWRKKGAVTP+KDQGQCGCCWAFSAVAA EGIT+LSTG LISLSEQELV
Sbjct  141   YENISAVPSTMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLSTGKLISLSEQELV  200

Query  585   DCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYE  764
             DCD  G DQGC GG MDDAF FII NKGLTTE+NYPYQG DG+C   K++       GYE
Sbjct  201   DCDTSGEDQGCNGGFMDDAFEFIIQNKGLTTEANYPYQGADGTCNSGKAAAKIT---GYE  257

Query  765   DVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAED  944
             DVPANSE+AL KAVANQPVSVAIDAGGS FQFYSSGVFTG+CGT+LDHGVTAVGYG+++D
Sbjct  258   DVPANSEAALLKAVANQPVSVAIDAGGSAFQFYSSGVFTGDCGTDLDHGVTAVGYGMSDD  317

Query  945   GTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GTKYWLVKNSWGTSWGE GYIRM++DI+AKEGLCGIAM++SYP+A
Sbjct  318   GTKYWLVKNSWGTSWGENGYIRMERDIDAKEGLCGIAMEASYPTA  362



>ref|XP_007048792.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   505 bits (1300),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 249/344 (72%), Positives = 292/344 (85%), Gaps = 6/344 (2%)
 Frame = +3

Query  63    MASNSLKL--LIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTK  230
             MA  +L+L   I LA +F   A +  ATSRTL D+ M  RHEQWMA+YGRVY++  E+ +
Sbjct  1     MAFKNLQLHQCICLAFIFIVGALVCEATSRTLQDASMYERHEQWMARYGRVYQDNNEREQ  60

Query  231   RYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN-TPFRY  407
             R+NIFKENV  I+SFN+A  KPYKLG+N FADLTN EF ASRN +K  H CS+  T F+Y
Sbjct  61    RFNIFKENVARIDSFNRAKDKPYKLGVNQFADLTNDEFTASRNRFK-GHMCSNQATTFKY  119

Query  408   ENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVD  587
             ENV+++P+T+DWRKKGAVTP+KDQGQCG CWAFSAVAAMEG+TKL+TG LISLSEQELVD
Sbjct  120   ENVTALPSTMDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGVTKLTTGKLISLSEQELVD  179

Query  588   CDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYED  767
             CD KG DQGC+GGLMDDAF FI NNKGLTTES+YPY+G DG C  +K +N AA I+G+ED
Sbjct  180   CDTKGDDQGCQGGLMDDAFQFIQNNKGLTTESDYPYKGVDGKCNTNKEANHAANINGHED  239

Query  768   VPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDG  947
             VPAN+E AL KAVANQPVSVAIDAGG +FQFYSSGVFTG+CGT+LDHGVTAVGYG  +DG
Sbjct  240   VPANNEEALHKAVANQPVSVAIDAGGYEFQFYSSGVFTGDCGTDLDHGVTAVGYGADDDG  299

Query  948   TKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             TKYWLVKNSWGTSWGE+GYIRMQ+D++AKEGLCGIAMQ+SYP+A
Sbjct  300   TKYWLVKNSWGTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPTA  343



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   502 bits (1293),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 252/333 (76%), Positives = 276/333 (83%), Gaps = 2/333 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             KL+    L+    A  A  R L ++ M  +HEQWMAQ GRVYKNE EK  RY IFKENVE
Sbjct  8     KLIFTAFLMLTVLASQAVCRNLNEASMIEKHEQWMAQNGRVYKNEAEKGNRYKIFKENVE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSSVPTTVD  440
             +IESFNKAGTK YKLGIN FADLTN EF A+RNGYK P EC   T FRYENVS+VP  +D
Sbjct  68    FIESFNKAGTKSYKLGINQFADLTNVEFRAARNGYK-PKECKG-TLFRYENVSAVPAAMD  125

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVT +KDQGQCGCCWAFSAVAA EGI +L TG LISLSEQELVDCD  G DQGC 
Sbjct  126   WRKKGAVTGIKDQGQCGCCWAFSAVAATEGIHQLKTGKLISLSEQELVDCDTAGEDQGCN  185

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAFTFIINNKGLTTE+NYPYQ  DG+C  +K +  AAKI+G+EDVPAN+E+AL K
Sbjct  186   GGLMDDAFTFIINNKGLTTEANYPYQAVDGTCNTNKEAKPAAKITGFEDVPANNEAALLK  245

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQPVSVAIDA GS FQFYSSGVFTG+CGTELDHGVTAVGYG + DGTKYWLVKNSWG
Sbjct  246   AVANQPVSVAIDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGKSSDGTKYWLVKNSWG  305

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             TSWGE GYI MQ+DI+AKEGLCGIAMQSSYP+A
Sbjct  306   TSWGENGYILMQRDIDAKEGLCGIAMQSSYPTA  338



>emb|CAL64936.1| putative cysteine protease 8 [Trifolium pratense]
Length=344

 Score =   498 bits (1282),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 248/345 (72%), Positives = 282/345 (82%), Gaps = 7/345 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MA+N+    I+LAL+F     A   TSRTL D  M  RH QWM+QYG++YK+  E+  R+
Sbjct  1     MAANNQLYHISLALLFCLGLFAIQVTSRTLQDDSMYERHGQWMSQYGKIYKDHQERETRF  60

Query  237   NIFKENVEYIESFNKAG-TKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFR  404
              IFKENV YIE+FN A  TK YKLGIN FADLTN+EFIASRN +K  H CSS    T F+
Sbjct  61    KIFKENVNYIETFNNADDTKSYKLGINQFADLTNEEFIASRNKFK-GHMCSSIMRTTSFK  119

Query  405   YENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELV  584
             YENVS +P+TVDWRKKGAVTPVK+QGQCGCCWAFSAVAA EGI KLSTG LISLSEQELV
Sbjct  120   YENVSGIPSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELV  179

Query  585   DCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYE  764
             DCD KG+DQGCEGGLMDDAF FII N GL+TE+ YPY+G DG+C  +K+S  A  I+GYE
Sbjct  180   DCDTKGVDQGCEGGLMDDAFKFIIQNHGLSTEAQYPYEGVDGTCNANKASVQAVTITGYE  239

Query  765   DVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAED  944
             DVPANSE AL+KAVANQP+SVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG++ D
Sbjct  240   DVPANSEQALQKAVANQPISVAIDASGSDFQFYKSGVFTGACGTELDHGVTAVGYGVSND  299

Query  945   GTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GTKYWLVKNSWGT WGE+GYI MQ+ IEA EG+CGIAMQ+SYP+A
Sbjct  300   GTKYWLVKNSWGTDWGEEGYIMMQRGIEAAEGICGIAMQASYPTA  344



>gb|AAP32196.1| cysteine protease 8 [Trifolium repens]
Length=343

 Score =   498 bits (1281),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 245/344 (71%), Positives = 280/344 (81%), Gaps = 6/344 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MASN+    I+LALVF     A   TSRTL D  M  RH QWM+QYG++YK+  E+  R+
Sbjct  1     MASNNQVYHISLALVFCLGLFAIQVTSRTLQDDSMYERHGQWMSQYGKIYKDHQERETRF  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRY  407
              IF ENV Y+E+ N   TK YKLGIN FADLTN+EF+ASRN +K  H CSS    T F+Y
Sbjct  61    KIFTENVNYVEASNADDTKSYKLGINQFADLTNEEFVASRNKFK-GHMCSSITRTTTFKY  119

Query  408   ENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVD  587
             ENVS++P+TVDWRKKGAVTPVK+QGQCGCCWAFSAVAA EGI KLSTG LISLSEQELVD
Sbjct  120   ENVSAIPSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVD  179

Query  588   CDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYED  767
             CD KG+DQGCEGGLMDDAF FII N GL+TE+ YPY+G DG+C  +K+S  A  I+GYED
Sbjct  180   CDTKGVDQGCEGGLMDDAFKFIIQNHGLSTEAQYPYEGVDGTCNANKASVQAVTITGYED  239

Query  768   VPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDG  947
             VPANSE AL+KAVANQP+SVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG++ DG
Sbjct  240   VPANSEQALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDG  299

Query  948   TKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             TKYWLVKNSWGT WGE+GYI MQ+ +EA EGLCGIAMQ+SYP+A
Sbjct  300   TKYWLVKNSWGTDWGEEGYIMMQRGVEAAEGLCGIAMQASYPTA  343



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score =   498 bits (1281),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 248/335 (74%), Positives = 282/335 (84%), Gaps = 4/335 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSL--MAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENV  257
             + ++L LV    A LA  R L +    M+ RHEQWMA+YGR YK++ EK KR+ IFK NV
Sbjct  10    IFVSL-LVLGMWAALANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKRFQIFKSNV  68

Query  258   EYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKL-PHECSSNTPFRYENVSSVPTT  434
             EYIES NKAG KPYKLGIN FAD TN+EF ASRNGYK  P     N  FRYE+V+ VP++
Sbjct  69    EYIESVNKAGNKPYKLGINEFADQTNEEFRASRNGYKRSPIPRPINPSFRYESVTKVPSS  128

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGIT+L+TG LISLSEQELVDCD  G DQG
Sbjct  129   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDTSGTDQG  188

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             CEGGLMDDAF FI+ N+GLTTES YPY+G D +C K K+S+ AA I+G+EDVPANSE AL
Sbjct  189   CEGGLMDDAFDFILGNEGLTTESKYPYKGVDETCNKKKASSHAASITGHEDVPANSEKAL  248

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
             +KAVANQPVSVAIDAGGSDFQ YSSGVFTGECGTELDHGVTAVGYG  EDGTKYWLVKNS
Sbjct  249   QKAVANQPVSVAIDAGGSDFQLYSSGVFTGECGTELDHGVTAVGYGKTEDGTKYWLVKNS  308

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WG+SWGE+GYIRM++D++A+EGLCGIAM++SYPSA
Sbjct  309   WGSSWGEEGYIRMERDVDAEEGLCGIAMEASYPSA  343



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   497 bits (1280),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 244/339 (72%), Positives = 285/339 (84%), Gaps = 3/339 (1%)
 Frame = +3

Query  69    SNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFK  248
             S + +L+ A+ LV     Y AT+R+L D+ M  RHE+WMAQ+GR YK++VEK KR+ IFK
Sbjct  4     STNWRLIFAVLLVLEMWTYQATARSLPDASMIERHEEWMAQHGRAYKDDVEKAKRFKIFK  63

Query  249   ENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPH--ECSSNTPFRYENVSS  422
             ENVEYI+SFN+AGT+PYKL +N FADLTN+EF ASRNGYK+    + S  + FRY NV++
Sbjct  64    ENVEYIQSFNEAGTRPYKLAVNKFADLTNEEFQASRNGYKMGSYGKASKVSSFRYANVTA  123

Query  423   VPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKG  602
             VPT++DWR+KGAVT VKDQGQCGCCWAFSAVAA EGI +L+TG LISLSEQELVDCD   
Sbjct  124   VPTSMDWRQKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGKLISLSEQELVDCDTSE  183

Query  603   IDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANS  782
              D+GC GGLMD+AF FII+N G+TTESNYPY+  DG+C   K S+ AAKI+GYEDVPANS
Sbjct  184   -DEGCNGGLMDNAFEFIISNGGITTESNYPYEAVDGTCNSKKESSHAAKITGYEDVPANS  242

Query  783   ESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWL  962
             ESAL KAVANQPVSVAIDA GSDFQFY+SGVFTG+CGTELDHGVTAVGYG   DGTKYWL
Sbjct  243   ESALLKAVANQPVSVAIDASGSDFQFYTSGVFTGQCGTELDHGVTAVGYGKTSDGTKYWL  302

Query  963   VKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             VKNSWGTSWGE GYIRMQ+D++A EGLCGIAMQ+SYPSA
Sbjct  303   VKNSWGTSWGENGYIRMQRDVDAAEGLCGIAMQASYPSA  341



>ref|XP_006469012.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   496 bits (1278),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 243/333 (73%), Positives = 283/333 (85%), Gaps = 2/333 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             L +AL L+ A      +SR L D+ M  R+EQW A+YGRVY++ VEK KR+ IFK NV +
Sbjct  10    LCLALILLGAWIPQALSSRALQDAAMYERYEQWTARYGRVYRDNVEKEKRFTIFKRNVAH  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTVD  440
             IE+FNKA  KPYKL +N FADLTN+EF  SRN +K  H CS  T PF+YENV++VP+T+D
Sbjct  70    IEAFNKASKKPYKLAVNEFADLTNEEFKVSRNRFK-GHMCSEQTGPFKYENVTAVPSTMD  128

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTPVKDQGQCGCCWAFSAVAA+EGI +L+TG L SLSEQELVDCDVKG D+GC 
Sbjct  129   WRKKGAVTPVKDQGQCGCCWAFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCN  188

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMD+AF F+  NKG+TTE+NYPY+G DG C   + +N AAKI+G+EDVPANSE+AL K
Sbjct  189   GGLMDNAFQFVQKNKGITTETNYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMK  248

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQPVSVAIDAGGSDFQFYSSGVFTG+CGTELDHGVTAVGYG A+DGTKYWLVKNSWG
Sbjct  249   AVANQPVSVAIDAGGSDFQFYSSGVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSWG  308

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             TSWGE+GYIRMQ+DI+AKEGLCGIAMQ+SYP+A
Sbjct  309   TSWGEEGYIRMQRDIDAKEGLCGIAMQASYPTA  341



>ref|XP_006469011.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score =   495 bits (1275),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 242/333 (73%), Positives = 284/333 (85%), Gaps = 2/333 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             L +AL L+ A      +SRTL D+ M  R+EQW A+YGRVY++ VEK KR+ IFK+NV +
Sbjct  10    LCLALILLGAWIPQAMSSRTLQDAAMYERYEQWTARYGRVYRDNVEKEKRFTIFKQNVAH  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTVD  440
             IE+FNKA  KPYKL +N FADLTN+EF  SRN +K  H CS  T PF+YENV++VP+T+D
Sbjct  70    IEAFNKASKKPYKLAVNEFADLTNEEFKVSRNRFK-GHMCSEQTGPFKYENVTAVPSTMD  128

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTPVKDQGQCGCCWAFSAVAA+EGI +L+TG L SLSEQELVDCDVKG D+GC 
Sbjct  129   WRKKGAVTPVKDQGQCGCCWAFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCN  188

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMD+AF F+  NKG+TTE+NYPY+G DG C   + +N AAKI+G+EDVPANSE+AL K
Sbjct  189   GGLMDNAFQFVQKNKGITTETNYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMK  248

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQPVSVAIDAGG DFQFYSSGVFTG+CGTELDHGVTAVGYG A+DGTKYWLVKNSWG
Sbjct  249   AVANQPVSVAIDAGGFDFQFYSSGVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSWG  308

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             TSWGE+GYIRMQ+DI+AK+GLCGIAMQ+SYP+A
Sbjct  309   TSWGEEGYIRMQRDIDAKQGLCGIAMQASYPTA  341



>gb|EYU25672.1| hypothetical protein MIMGU_mgv1a018700mg [Erythranthe guttata]
Length=343

 Score =   494 bits (1272),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 243/336 (72%), Positives = 279/336 (83%), Gaps = 4/336 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             + ++A+ LV    A  AT+RTL ++ M  RHEQWM QYGR YKN+ EK KRYNIFK+NVE
Sbjct  9     RFILAVVLVLQMWASQATARTLPNASMVERHEQWMVQYGRTYKNDAEKAKRYNIFKDNVE  68

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKL---PHECSSNTPFRYENVSSVPT  431
             YI+S N+A T+ YKL IN FADLTN+EF ASRNGYK+       S  + FRY NVS+VP 
Sbjct  69    YIQSVNEAETRTYKLAINKFADLTNEEFQASRNGYKMRSLSKSSSKVSSFRYANVSAVPP  128

Query  432   TVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQ  611
             ++DW KKGAVTPVKDQGQCGCCWAFSAVAA EGI +L+TGNL+SLSEQELVDCD    DQ
Sbjct  129   SIDWTKKGAVTPVKDQGQCGCCWAFSAVAATEGINQLTTGNLVSLSEQELVDCDTSE-DQ  187

Query  612   GCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESA  791
             GC GGLMD+AF FII+N GLTTESNYPY+G DG+C   K S+ AA+I+GYEDVP+NSESA
Sbjct  188   GCNGGLMDNAFEFIISNNGLTTESNYPYEGVDGTCNSKKESSHAARITGYEDVPSNSESA  247

Query  792   LEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKN  971
             L KAVANQP+SVAIDA GSDFQFYS GVFTG+CGTELDHGVTAVGYG+  DGTKYWLVKN
Sbjct  248   LLKAVANQPISVAIDASGSDFQFYSGGVFTGQCGTELDHGVTAVGYGVTSDGTKYWLVKN  307

Query  972   SWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             SWGTSWGE GYIRMQ+DI+A EGLCGIAMQ+SYP+A
Sbjct  308   SWGTSWGENGYIRMQRDIDAAEGLCGIAMQASYPTA  343



>ref|XP_006446792.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
 gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
Length=341

 Score =   494 bits (1271),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 241/333 (72%), Positives = 282/333 (85%), Gaps = 2/333 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             L +AL L+ A      +SR L D+ M  R+EQW A+YGRVY++  EK KR+ IFK+NV +
Sbjct  10    LCLALILLGAWIPQALSSRALQDAAMYERYEQWTARYGRVYRDNAEKEKRFTIFKQNVAH  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTVD  440
             IE+FNKA  KPYKL +N FADLTN+EF  SRN +K  H CS  T PF+YENV++VP+T+D
Sbjct  70    IEAFNKASKKPYKLAVNEFADLTNEEFKVSRNRFK-GHMCSEQTGPFKYENVTAVPSTMD  128

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTPVKDQGQCGCCWAFSAVAA+EGI +L+TG L SLSEQELVDCDVKG D+GC 
Sbjct  129   WRKKGAVTPVKDQGQCGCCWAFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCN  188

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMD+AF F+  NKG+TTE+NYPY+G DG C   + +N AAKI+G+EDVPANSE+AL  
Sbjct  189   GGLMDNAFQFVQKNKGITTETNYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMN  248

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQPVSVAIDAGGSDFQFYSSGVFTG+CGTELDHGVTAVGYG A+DGTKYWLVKNSWG
Sbjct  249   AVANQPVSVAIDAGGSDFQFYSSGVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSWG  308

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             TSWGE+GYIRMQ+DI+AKEGLCGIAMQ+SYP+A
Sbjct  309   TSWGEEGYIRMQRDIDAKEGLCGIAMQASYPTA  341



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   494 bits (1271),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 246/344 (72%), Positives = 282/344 (82%), Gaps = 4/344 (1%)
 Frame = +3

Query  54    LSTMASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKR  233
             ++T++ N  KL+    LV    A  A SR+L D+ M  RHE WMA+YGRVYK+  EK +R
Sbjct  1     MATVSEN--KLMFVALLVVGLWASQAWSRSLHDAAMNERHEMWMAKYGRVYKDNSEKERR  58

Query  234   YNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHEC--SSNTPFRY  407
             + IF+ NVE+IESFNK G +PYKL IN FADLTN+EF  S+NGYK       +  + FRY
Sbjct  59    FEIFRNNVEFIESFNKLGNRPYKLDINEFADLTNEEFKVSKNGYKRSSGVGLTEKSSFRY  118

Query  408   ENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVD  587
              NV++VPT++DWR+ GAVTP+KDQGQCGCCWAFSAVAAMEGITKLSTG LISLSEQELVD
Sbjct  119   ANVTAVPTSMDWRQNGAVTPIKDQGQCGCCWAFSAVAAMEGITKLSTGKLISLSEQELVD  178

Query  588   CDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYED  767
             CD  G DQGCEGGLMDDAF FI  N GLTTE+NYPYQGTDG+C  +K+ N AAKI+GYED
Sbjct  179   CDTSGEDQGCEGGLMDDAFEFIKQNGGLTTEANYPYQGTDGTCNTNKAGNDAAKITGYED  238

Query  768   VPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDG  947
             VPANSE AL KAVA+QPVSVAIDA GS FQFYS GVFTG+CGTELDHGVTAVGYG ++DG
Sbjct  239   VPANSEDALLKAVASQPVSVAIDASGSAFQFYSGGVFTGDCGTELDHGVTAVGYGTSDDG  298

Query  948   TKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             TKYWLVKNSWGTSWGE GYIRM++DIEAKEGLCGIAMQ SYP+A
Sbjct  299   TKYWLVKNSWGTSWGEDGYIRMERDIEAKEGLCGIAMQPSYPTA  342



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   493 bits (1270),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 247/342 (72%), Positives = 281/342 (82%), Gaps = 4/342 (1%)
 Frame = +3

Query  63    MASN-SLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYN  239
             MA N S +L+IA  LV    +   T+RTL D+     HEQWMAQ+GRVYK+E EK+KR+ 
Sbjct  1     MAMNPSWRLVIAALLVLEMWSSQGTARTLPDAATVQEHEQWMAQFGRVYKDEAEKSKRFR  60

Query  240   IFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYEN  413
             IFKENVEYI SFN+A  +PY+L IN FADLTN+EF+ASRNGYK+     S   + FRY N
Sbjct  61    IFKENVEYIRSFNEAAARPYRLAINKFADLTNEEFVASRNGYKMGSYMKSTKVSSFRYAN  120

Query  414   VSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
             VS+VP ++DWR+KGAVT VKDQGQCGCCWAFSAVAA EGI +L+TG LISLSEQELVDCD
Sbjct  121   VSAVPASMDWRQKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGKLISLSEQELVDCD  180

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
                 D+GC GGLMDDAF FII+N G+TTESNYPY+G DG+C   K S+ AAKI+GYEDVP
Sbjct  181   TSE-DEGCNGGLMDDAFEFIISNGGITTESNYPYEGVDGTCNSKKESSHAAKITGYEDVP  239

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             ANSE AL KAVANQPVSVAIDA GSDFQFYSSGVFTGECGTELDHGVTAVGYG   DGTK
Sbjct  240   ANSEPALLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGKTSDGTK  299

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWLVKNSWG+SWGE GYIRMQ+DI+A EGLCGIAMQ+SYP+A
Sbjct  300   YWLVKNSWGSSWGENGYIRMQRDIDAAEGLCGIAMQASYPTA  341



>ref|XP_002306369.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
 gb|EEE93365.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
Length=340

 Score =   493 bits (1269),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 248/334 (74%), Positives = 276/334 (83%), Gaps = 5/334 (1%)
 Frame = +3

Query  87    LIALALVFATSAYLATS--RTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
              I LAL+F   A+ + S  RTL D  M  RHEQWMAQYGRVYK++ EK  RYNIFKENV 
Sbjct  9     FICLALLFVLGAWPSKSAARTLQDVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVA  68

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTV  437
              I++FN    K YKLG+N FADL+N+EF ASRN +K  H CS    PFRYENVS+VP T+
Sbjct  69    RIDAFNSQTGKSYKLGVNQFADLSNEEFKASRNRFK-GHMCSPQAGPFRYENVSAVPATM  127

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGI +L+TG LISLSEQE+VDCD KG DQGC
Sbjct  128   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGC  187

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
              GGLMDDAF FI  NKGLTTE+NYPY GTDG+C   K +  AAKI+G+EDVPANSE+AL 
Sbjct  188   NGGLMDDAFKFIEQNKGLTTEANYPYTGTDGTCNTQKEATHAAKITGFEDVPANSEAALM  247

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
             KAVA QPVSVAIDAGG +FQFYSSG+FTG CGT+LDHGVTAVGYGI+ DGTKYWLVKNSW
Sbjct  248   KAVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTQLDHGVTAVGYGIS-DGTKYWLVKNSW  306

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE+GYIRMQKDI AKEGLCGIAMQ+SYPSA
Sbjct  307   GAQWGEEGYIRMQKDISAKEGLCGIAMQASYPSA  340



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   493 bits (1269),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 243/334 (73%), Positives = 280/334 (84%), Gaps = 3/334 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             L +A  +V       AT+RTL D+ M  +HEQW+AQ+GRVYK++ EK KR+NIFKENVEY
Sbjct  9     LFLAALVVLEIWGSQATARTLPDASMVEKHEQWIAQFGRVYKDDAEKAKRFNIFKENVEY  68

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPH--ECSSNTPFRYENVSSVPTTV  437
             I+SFN+AG +PYKL IN FADLTN+EF ASRNGYK+    + S  + FRY NV++VP ++
Sbjct  69    IQSFNEAGARPYKLAINKFADLTNEEFQASRNGYKMGSYGKSSKVSSFRYANVTAVPASM  128

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVT VKDQGQCGCCWAFSAVAA EGI +L+TGNLISLSEQELVDCD    D+GC
Sbjct  129   DWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGNLISLSEQELVDCDTSE-DEGC  187

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
              GGLMD+AF FII+N G+TTESNYPY+G DG+C   K S+  AKI+GYEDVPANSESAL 
Sbjct  188   NGGLMDNAFEFIISNGGITTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESALL  247

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
             KAVANQPVSVAIDA GSDFQFY+SGVFTG+CGTELDHGVTAVGYG   DGTKYWLVKNSW
Sbjct  248   KAVANQPVSVAIDASGSDFQFYTSGVFTGQCGTELDHGVTAVGYGKTSDGTKYWLVKNSW  307

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GTSWGE GYIRMQ+DI+A EGLCGIAMQ+SYP+A
Sbjct  308   GTSWGENGYIRMQRDIDAAEGLCGIAMQASYPTA  341



>dbj|BAF56428.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   493 bits (1269),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 240/333 (72%), Positives = 277/333 (83%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
             +AL LVF   A+ A +RTL D  +  RHEQWM QYG+VY +  EK  R NIFKENV+ IE
Sbjct  12    LALLLVFGFLAFEANARTLEDVSLKERHEQWMTQYGKVYTDSYEKELRSNIFKENVQRIE  71

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT---PFRYENVSSVPTTVD  440
             +FN AG KPYKLGIN FADLTN+EF A RN +K  H CS++T    F+YE+VSSVP ++D
Sbjct  72    AFNNAGNKPYKLGINQFADLTNEEFKA-RNRFK-GHMCSNSTRTPTFKYEDVSSVPASLD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR+KGAVTP+KDQGQCGCCWAFSAVAA EGITKLSTG LISLSEQELVDCD KG+DQGCE
Sbjct  130   WRQKGAVTPIKDQGQCGCCWAFSAVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCE  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI+ NKGL TE+ YPYQG D +C  +  +  AA I G+EDVPANSESAL K
Sbjct  190   GGLMDDAFKFIMQNKGLNTEAKYPYQGVDATCNANAEAKDAASIKGFEDVPANSESALLK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SVAIDA GS+FQFYSSG+FTG CGTELDHGVTAVGYG+++DGTKYWLVKNSWG
Sbjct  250   AVANQPISVAIDASGSEFQFYSSGLFTGSCGTELDHGVTAVGYGVSDDGTKYWLVKNSWG  309

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
               WGE+GYIRMQ+D+ A+EGLCGIAMQ+SYP+A
Sbjct  310   EQWGEEGYIRMQRDVAAEEGLCGIAMQASYPTA  342



>ref|XP_003526232.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   493 bits (1268),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 237/339 (70%), Positives = 280/339 (83%), Gaps = 6/339 (2%)
 Frame = +3

Query  72    NSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKE  251
             N + L + L + F   A+  T RTL D+ M  RHEQWM +YG+VYK+  E+ KR+ +FKE
Sbjct  8     NHISLAMLLCMTFL--AFQVTCRTLQDASMYERHEQWMTRYGKVYKDPQEREKRFRVFKE  65

Query  252   NVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSS  422
             NV YIE+FN A  K YKLGIN FADLTNKEFIA RNG+K  H CSS    T F++ENV++
Sbjct  66    NVNYIEAFNNAANKSYKLGINQFADLTNKEFIAPRNGFK-GHMCSSIIRTTTFKFENVTA  124

Query  423   VPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKG  602
              P+TVDWR+KGAVTP+KDQGQCGCCWAFSAVAA EGI  LS G LISLSEQELVDCD KG
Sbjct  125   TPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALSAGKLISLSEQELVDCDTKG  184

Query  603   IDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANS  782
             +DQGCEGGLMDDAF FII N GL TE+NYPY+G DG C  ++++ +AA I+GYEDVPAN+
Sbjct  185   VDQGCEGGLMDDAFKFIIQNHGLNTEANYPYKGVDGKCNANEAAKNAATITGYEDVPANN  244

Query  783   ESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWL  962
             E AL+KAVANQPVSVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG+++DGT+YWL
Sbjct  245   EMALQKAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSDDGTEYWL  304

Query  963   VKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             VKNSWGT WGE+GYIRMQ+ ++++EGLCGIAMQ+SYP+A
Sbjct  305   VKNSWGTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  343



>ref|XP_003612210.1| Cysteine proteinase [Medicago truncatula]
 gb|AES95168.1| papain family cysteine protease [Medicago truncatula]
Length=344

 Score =   492 bits (1267),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 243/345 (70%), Positives = 280/345 (81%), Gaps = 7/345 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MA+N+    I+LALVF     A   TSRTL D  M  RHE+WM  YG+VYK+  E+ KR+
Sbjct  1     MAANNQLYHISLALVFCLGLWAIQVTSRTLQDGSMHERHERWMNHYGKVYKDHQEREKRF  60

Query  237   NIFKENVEYIESFNKA-GTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFR  404
              IF EN++YIE+FN     + YKLGIN FADLTN+EF+ASRN +K  H CSS    T F+
Sbjct  61    KIFTENMKYIEAFNNGDNNESYKLGINQFADLTNEEFVASRNKFK-GHMCSSIIRTTTFK  119

Query  405   YENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELV  584
             YENVS++P+TVDWRKKGAVTPVK+QGQCGCCWAFSAVAA EGI KLSTG L+SLSEQELV
Sbjct  120   YENVSAIPSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLVSLSEQELV  179

Query  585   DCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYE  764
             DCD KG+DQGCEGGLMDDAF FII N GL TE+ YPYQG DG+C  +K+S  A  I+GYE
Sbjct  180   DCDTKGVDQGCEGGLMDDAFKFIIQNHGLNTEAQYPYQGVDGTCNANKASIQATTITGYE  239

Query  765   DVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAED  944
             DVPAN+E AL+KAVANQP+SVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG++ D
Sbjct  240   DVPANNEQALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSND  299

Query  945   GTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GTKYWLVKNSWGT WGE+GYI MQ+ +EA EGLCGIAMQ+SYP+A
Sbjct  300   GTKYWLVKNSWGTDWGEEGYIMMQRGVEAAEGLCGIAMQASYPTA  344



>ref|XP_006380488.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
 gb|ERP58285.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
Length=340

 Score =   492 bits (1266),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 246/334 (74%), Positives = 281/334 (84%), Gaps = 5/334 (1%)
 Frame = +3

Query  87    LIALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
              + LAL+F   A+   +T+RTLLD+ M  RHEQWM QYGRVYK++ E+  RY+IFKENV 
Sbjct  9     FVCLALLFILGAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVA  68

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTV  437
              I++FN    K YKLG+N FADLTN+EF ASRN +K  H CS    PFRYENVS+VP+TV
Sbjct  69    RIDAFNSQTGKSYKLGVNQFADLTNEEFKASRNRFK-GHMCSPQAGPFRYENVSAVPSTV  127

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRK+GAVTPVKDQGQCGCCWAFSAVAAMEGI KL+TG LISLSEQE+VDCD KG DQGC
Sbjct  128   DWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQGC  187

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
              GGLMDDAF FI  NKGLTTE+NYPY+GTDG+C   KS+  AAKI+G+EDVPANSE+AL 
Sbjct  188   NGGLMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTKKSAIHAAKITGFEDVPANSEAALM  247

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
             KAVA QPVSVAIDAGGSDFQFYSSG+FTG C T+LDHGVTAVGYG++ DG+KYWLVKNSW
Sbjct  248   KAVAKQPVSVAIDAGGSDFQFYSSGIFTGSCDTQLDHGVTAVGYGVS-DGSKYWLVKNSW  306

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE+GYIRMQKDI AKEGLCGIAMQ+SYP+A
Sbjct  307   GAQWGEEGYIRMQKDISAKEGLCGIAMQASYPTA  340



>ref|XP_002523448.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38907.1| cysteine protease, putative [Ricinus communis]
Length=341

 Score =   492 bits (1267),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 247/335 (74%), Positives = 276/335 (82%), Gaps = 3/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             KL+    LV       A SR+L D+ M  RHE WM +YGRVYK+  EK +R+ IF+ NVE
Sbjct  8     KLMFVALLVVGLWVSQAWSRSLHDAAMNERHEMWMVKYGRVYKDNSEKERRFEIFRNNVE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHEC--SSNTPFRYENVSSVPTT  434
             +IESFNK G +PYKL IN FADLTN+EF ASRNGYK       S  + FRY NV++VPT+
Sbjct  68    FIESFNKPGNRPYKLDINEFADLTNEEFKASRNGYKRSSNVGLSEKSSFRYGNVTAVPTS  127

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWR+KGAVTP+KDQGQCGCCWAFSAVAAMEGITKLSTG LISLSEQELVDCD  G DQG
Sbjct  128   MDWRQKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLSTGKLISLSEQELVDCDTSGEDQG  187

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             CEGGLMDDAF FI  N GLTTE+NYPYQGTDG+C  +K+ N AAKI+GYEDVPANSE AL
Sbjct  188   CEGGLMDDAFEFIKQNGGLTTEANYPYQGTDGTCNTNKAGNDAAKITGYEDVPANSEDAL  247

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
              KAVA+QPVSVAIDA GS FQFYS GVFTG+CGTELDHGVTAVGYG + DGTKYWLVKNS
Sbjct  248   LKAVASQPVSVAIDASGSAFQFYSGGVFTGDCGTELDHGVTAVGYGTS-DGTKYWLVKNS  306

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGTSWGE GYIRM++DIEAKEGLCGIAMQSSYP+A
Sbjct  307   WGTSWGEDGYIRMERDIEAKEGLCGIAMQSSYPTA  341



>ref|XP_006446793.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
 gb|ESR60033.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
Length=341

 Score =   492 bits (1266),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 241/333 (72%), Positives = 282/333 (85%), Gaps = 2/333 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             L +AL L+ A S    +SRTL D+ M  R+EQW A+YGRVY++  EK KR+ IFK+NV  
Sbjct  10    LCLALILLGAWSPQAMSSRTLQDAAMYERYEQWTARYGRVYRDNAEKEKRFTIFKQNVAN  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTVD  440
             IE+FNKA  KPYKL +N FADLTN+EF ASRN +K  H CS  T PF+YENV++VP+T+D
Sbjct  70    IEAFNKASEKPYKLAVNEFADLTNEEFKASRNRFK-GHMCSEQTGPFKYENVTAVPSTMD  128

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTPVKDQGQCGCCWAFSAVAA+EGI +L+TG L SLSEQELVDCDVKG D+GC 
Sbjct  129   WRKKGAVTPVKDQGQCGCCWAFSAVAAIEGINQLTTGKLASLSEQELVDCDVKGEDEGCN  188

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMD+AF F+  NKG+TTE NYPY+G DG C   + +N AAKI+G+EDVPANSE+AL K
Sbjct  189   GGLMDNAFQFVQKNKGITTEINYPYKGVDGKCNAKEEANHAAKINGHEDVPANSETALMK  248

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQPVSVAIDAGG DFQFYSSGVFTG+CGTELDHGVTAVGYG A+DGTKYWLVKNSWG
Sbjct  249   AVANQPVSVAIDAGGFDFQFYSSGVFTGDCGTELDHGVTAVGYGAADDGTKYWLVKNSWG  308

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              +WGE+GYIRMQ+DI+AK+GLCGIAMQ+SYP+A
Sbjct  309   ATWGEEGYIRMQRDIDAKQGLCGIAMQASYPTA  341



>ref|XP_002310053.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 ref|XP_006380490.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
 gb|EEE90503.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 gb|ERP58287.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
Length=340

 Score =   492 bits (1266),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 245/334 (73%), Positives = 282/334 (84%), Gaps = 5/334 (1%)
 Frame = +3

Query  87    LIALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
              + LAL+F   A+   +T+RTLLD+ M  RHEQWM QYGRVYK++ E+  RY+IFKENV 
Sbjct  9     FVCLALLFILGAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVA  68

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTV  437
              I++FN    K YKLG+N FADLTN+EF ASRN +K  H CS    PFRYENVS+VP+TV
Sbjct  69    RIDAFNSQTGKSYKLGVNQFADLTNEEFKASRNRFK-GHMCSPQAGPFRYENVSAVPSTV  127

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRK+GAVTPVKDQGQCGCCWAFSAVAAMEGI KL+TG LISLSEQE+VDCD KG DQGC
Sbjct  128   DWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQGC  187

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
              GGLMDDAF FI  NKGLTTE+NYPY+GTDG+C  +K++  AAKI+G+EDVPANSE+AL 
Sbjct  188   NGGLMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTNKAAIHAAKITGFEDVPANSEAALM  247

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
             KAVA QPVSVAIDAGGSDFQFYSSG+FTG C T+LDHGVTAVGYG++ DG+KYWLVKNSW
Sbjct  248   KAVAKQPVSVAIDAGGSDFQFYSSGIFTGSCDTQLDHGVTAVGYGVS-DGSKYWLVKNSW  306

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE+GYIRMQKDI AKEGLCGIAMQ+SYP+A
Sbjct  307   GAQWGEEGYIRMQKDISAKEGLCGIAMQASYPTA  340



>ref|XP_007132861.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
 gb|ESW04855.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
Length=343

 Score =   492 bits (1266),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 239/344 (69%), Positives = 280/344 (81%), Gaps = 6/344 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVF--ATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MA+ +    I+L L+F  A  A+  TSRTL D+ M  RHE+WM +YGRVYK+  E+ KR 
Sbjct  1     MATKTQFYHISLTLLFCMAIWAFQVTSRTLQDASMNERHEEWMTRYGRVYKDPQEREKRL  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRY  407
              IFKENV YIE+FN A  KPYKL IN FADLTN+EFIA RN +K  H CSS    T F+Y
Sbjct  61    RIFKENVNYIEAFNNAANKPYKLAINQFADLTNEEFIAPRNRFK-GHMCSSITRTTSFKY  119

Query  408   ENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVD  587
             ENV++VP+TVDWR+KGAVTPVKDQGQCGCCWAFSAVAA EGI  L+ G LISLSEQELVD
Sbjct  120   ENVTAVPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVAATEGIHALTAGKLISLSEQELVD  179

Query  588   CDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYED  767
             CD KG+DQGCEGGLMDDAF F+I N+GL TE+ YPY+GTD +C  + +S  A  I GYED
Sbjct  180   CDSKGVDQGCEGGLMDDAFKFVIQNQGLNTEAKYPYKGTDETCNANAASGHAVTIKGYED  239

Query  768   VPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDG  947
             VPAN+E AL+KAV NQPVSVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG+++DG
Sbjct  240   VPANNEKALQKAVVNQPVSVAIDASGSDFQFYESGVFTGSCGTELDHGVTAVGYGVSDDG  299

Query  948   TKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T+YWLVKNSWGT WGE+GYIRMQ+ ++++EGLCGIAMQ+SYP+A
Sbjct  300   TEYWLVKNSWGTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  343



>ref|XP_007132887.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
 gb|ESW04881.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
Length=343

 Score =   492 bits (1266),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 239/344 (69%), Positives = 281/344 (82%), Gaps = 6/344 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVF--ATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MA+ +    I+L L+F  A   +  TSRTL D+ M  RHE+WM +YGRVYK+  E+ KR 
Sbjct  1     MATKTQFYHISLTLLFCMAIWTFQVTSRTLQDASMNERHEEWMTRYGRVYKDPPEREKRL  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRY  407
              IFKENV YIE+FN A  KPYKL +N FADLTN+EFIA RN +K  H CSS    T F+Y
Sbjct  61    RIFKENVNYIEAFNNAANKPYKLAVNQFADLTNEEFIAPRNRFK-GHMCSSITRTTSFKY  119

Query  408   ENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVD  587
             ENV++VP+TVDWR+KGAVTPVKDQGQCGCCWAFSAVAA EGI  L+ G LISLSEQELVD
Sbjct  120   ENVTAVPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVAAAEGIHALTAGKLISLSEQELVD  179

Query  588   CDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYED  767
             CD KG+DQGCEGGLMDDAF F+I N+GL TE+NYPY+GTD +C  + +S  AA I GYED
Sbjct  180   CDSKGVDQGCEGGLMDDAFKFVIQNQGLNTEANYPYKGTDETCNANAASGHAATIKGYED  239

Query  768   VPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDG  947
             VPAN+E AL+KAV NQPVSVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG+++DG
Sbjct  240   VPANNEKALQKAVVNQPVSVAIDASGSDFQFYESGVFTGSCGTELDHGVTAVGYGVSDDG  299

Query  948   TKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T+YWLVKNSWGT WGE+GYIRMQ+ ++++EGLCGIAMQ+SYP+A
Sbjct  300   TEYWLVKNSWGTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  343



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score =   491 bits (1263),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 245/342 (72%), Positives = 284/342 (83%), Gaps = 5/342 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             M S      + LAL+F + A+   +T+RTLLD+ M  RHEQWM QYGRVYK++ E+  RY
Sbjct  1     MRSTKQFQFVCLALLFISGAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDNERATRY  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYEN  413
             +IFKENV  I++FN    K YKLG+N FADLTN+EF ASRN +K  H CS    PFRYEN
Sbjct  61    SIFKENVARIDAFNSQTGKSYKLGVNQFADLTNEEFKASRNRFK-GHMCSPQAGPFRYEN  119

Query  414   VSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
             VS+VP+T+DWRK+GAVTPVKDQGQCGCCWAFSAVAAMEGI KL+TG LISLSEQE+VDCD
Sbjct  120   VSAVPSTMDWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDCD  179

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
              KG DQGC GGLMDDAF FI  NKGLTTE+NYPY+GT G+C   K++N AAKI+G+EDVP
Sbjct  180   TKGEDQGCNGGLMDDAFKFIEKNKGLTTEANYPYKGTHGTCNTKKAANHAAKITGFEDVP  239

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             ANSE+AL KAVA QPVSVAIDAGG DFQFYSSG+FTG CGT+LDHGVTAVGYG++ DG+K
Sbjct  240   ANSEAALMKAVAKQPVSVAIDAGGYDFQFYSSGIFTGSCGTQLDHGVTAVGYGVS-DGSK  298

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWLVKNSWG  WGE+GYIRMQKD+ AKEGLCGIAMQ+SYP+A
Sbjct  299   YWLVKNSWGAQWGEEGYIRMQKDVSAKEGLCGIAMQASYPTA  340



>ref|XP_007227669.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
 gb|EMJ28868.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
Length=342

 Score =   491 bits (1264),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 245/333 (74%), Positives = 280/333 (84%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I LAL+F   A+   ATSR L D+ M  ++EQWMA+YGRVY +  EK  R+ IFKENV +
Sbjct  12    ICLALIFMLGAWSSQATSRNLQDASMYGKYEQWMARYGRVYTDIQEKEMRFKIFKENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSSVPTTVD  440
             IES N    KPYKL +N FADLTN+EF ASRNG+ L HECS+  T F+YENV++ P TVD
Sbjct  72    IESSNSDANKPYKLSVNQFADLTNEEFKASRNGF-LGHECSTKTTTFKYENVTA-PPTVD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR KGAVTP+KDQGQCGCCWAFSAVAAMEGITKL+TGNLISLSEQELVDCD KG+DQGCE
Sbjct  130   WRTKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGNLISLSEQELVDCDTKGVDQGCE  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N GL+TE+NYPY G DG+C   K ++ AAKI+G+EDVPANSE+AL K
Sbjct  190   GGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SVAIDAGGSDFQFYSSGVFTG CGT LDHGVTAVGYG++ DGTKYWLVKNSWG
Sbjct  250   AVANQPISVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSADGTKYWLVKNSWG  309

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGEKGYIRMQ+ +EAKEGLCGIAM++SYP+A
Sbjct  310   TEWGEKGYIRMQRGVEAKEGLCGIAMEASYPTA  342



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   491 bits (1263),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 246/342 (72%), Positives = 280/342 (82%), Gaps = 4/342 (1%)
 Frame = +3

Query  63    MASN-SLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYN  239
             MA N S +L+IA  LV    +   T+RTL D+     HEQWMAQ+GRVYK+E EK+KR+ 
Sbjct  1     MAMNPSWRLVIAALLVLEMWSSQGTARTLPDAATVQEHEQWMAQFGRVYKDEAEKSKRFR  60

Query  240   IFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYEN  413
             IFKENVEYI SFN+A  +PY+L IN FADLTN+EF+ASRNGYK+     S   + FRY N
Sbjct  61    IFKENVEYIRSFNEAAARPYRLAINKFADLTNEEFVASRNGYKMGSYMKSTKVSSFRYAN  120

Query  414   VSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
             VS+VP ++DWR+KGAVT VKDQGQCGCCWAFSAVAA EGI +L+T  LISLSEQELVDCD
Sbjct  121   VSAVPASMDWRQKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTRKLISLSEQELVDCD  180

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
                 D+GC GGLMDDAF FII+N G+TTESNYPY+G DG+C   K S+ AAKI+GYEDVP
Sbjct  181   TSE-DEGCNGGLMDDAFEFIISNGGITTESNYPYEGVDGTCNSKKESSHAAKITGYEDVP  239

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             ANSE AL KAVANQPVSVAIDA GSDFQFYSSGVFTGECGTELDHGVTAVGYG   DGTK
Sbjct  240   ANSEPALLKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGKTSDGTK  299

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWLVKNSWG+SWGE GYIRMQ+DI+A EGLCGIAMQ+SYP+A
Sbjct  300   YWLVKNSWGSSWGENGYIRMQRDIDAAEGLCGIAMQASYPTA  341



>ref|XP_002280204.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   491 bits (1263),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 245/342 (72%), Positives = 286/342 (84%), Gaps = 4/342 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MAS +    I LAL+F  +A+   AT+R L ++ M  RHE WM QYGR YK+  EK+KRY
Sbjct  1     MASVNQYQYICLALLFVLAAWASQATARNLHEASMYERHEDWMVQYGREYKDADEKSKRY  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN-TPFRYEN  413
              IFK+NV  IESFNKA  K YKL IN FADLTN+EF ASRN +K  H CS+  T F+YEN
Sbjct  61    KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRNRFK-AHICSTEATSFKYEN  119

Query  414   VSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
             V++VP+TVDWRKKGAVTP+KDQGQCG CWAFSAVAAMEGIT+LSTG LISLSEQELVDCD
Sbjct  120   VTAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCD  179

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
               G DQGC GGLMDDAF FI  N GLTTE+NYPY GTDG+C + K+++ AAKI+GYEDVP
Sbjct  180   TSGEDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVP  239

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E AL+KAVA+QP++VAIDAGGS+FQFYSSGVFTG+CGTELDHGV+AVGYG ++DG K
Sbjct  240   ANNEKALQKAVAHQPIAVAIDAGGSEFQFYSSGVFTGQCGTELDHGVSAVGYGTSDDGMK  299

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWLVKNSWGT WGE+GYIRMQ+D+ AKEGLCGIAMQ+SYP+A
Sbjct  300   YWLVKNSWGTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  341



>ref|XP_007226492.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
 gb|EMJ27691.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
Length=342

 Score =   490 bits (1262),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 245/333 (74%), Positives = 279/333 (84%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I LAL+F   A+   ATSR L D+ M  ++EQWMA+YGRVY +  EK  R+ IFKENV +
Sbjct  12    ICLALIFMLGAWSSQATSRNLQDASMYGKYEQWMARYGRVYTDIQEKEMRFKIFKENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSSVPTTVD  440
             IES N    KPYKL +N FADLTN+EF ASRNG+ L HECS+  T F+YENV++ P TVD
Sbjct  72    IESSNSDANKPYKLSVNQFADLTNEEFKASRNGF-LGHECSTKTTTFKYENVTA-PPTVD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR KGAVTP+KDQGQCGCCWAFSAVAAMEGITKL+TGNLISLSEQELVDCD KG+DQGCE
Sbjct  130   WRTKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGNLISLSEQELVDCDTKGVDQGCE  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N GL TE+NYPY G DG+C   K ++ AAKI+G+EDVPANSE+AL K
Sbjct  190   GGLMDDAFQFISQNHGLRTETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SVAIDAGGSDFQFYSSGVFTG CGT LDHGVTAVGYG++ DGTKYWLVKNSWG
Sbjct  250   AVANQPISVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSADGTKYWLVKNSWG  309

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGEKGYIRMQ+ +EAKEGLCGIAM++SYP+A
Sbjct  310   TEWGEKGYIRMQRGVEAKEGLCGIAMEASYPTA  342



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   490 bits (1262),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 246/335 (73%), Positives = 280/335 (84%), Gaps = 3/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             KL+ A  LV       AT+RTL D+ M  +HEQWMAQ+GRVYK++ EK+KR+ IFKENVE
Sbjct  8     KLVFAALLVLEMWGSQATARTLPDAAMIEKHEQWMAQFGRVYKDDAEKSKRFRIFKENVE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPH--ECSSNTPFRYENVSSVPTT  434
             YIESFN+AG +PY L IN FADLTN+EF ASRNGYK+    + S  + FRY NV++VP +
Sbjct  68    YIESFNEAGARPYTLAINKFADLTNEEFQASRNGYKMGSYPKSSMFSSFRYANVTAVPAS  127

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWRKKGAVT VKDQGQCGCCWAFSAVAA EGI +L+TG LISLSEQELVDCD    D+G
Sbjct  128   MDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINQLTTGKLISLSEQELVDCDTSE-DEG  186

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             C GGLMD+AF FII+N G+TTESNYPY+G DG+C   K S+SAAKI+GYEDVPANSE AL
Sbjct  187   CNGGLMDNAFEFIISNGGITTESNYPYEGVDGTCNTKKESSSAAKITGYEDVPANSEPAL  246

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
              KAVANQPVSVAIDA GSDFQFYSSGVFTG+CGTELDHGVTAVGYG   DGTKYWLVKNS
Sbjct  247   LKAVANQPVSVAIDASGSDFQFYSSGVFTGDCGTELDHGVTAVGYGKTSDGTKYWLVKNS  306

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGTSWGE GYIRMQ+DI+A EGLCGIAMQ+SYP+A
Sbjct  307   WGTSWGENGYIRMQRDIDAPEGLCGIAMQASYPTA  341



>ref|XP_006380493.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
 gb|ERP58290.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
Length=340

 Score =   490 bits (1261),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 244/331 (74%), Positives = 281/331 (85%), Gaps = 5/331 (2%)
 Frame = +3

Query  96    LALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
             LAL+F   A+   +T+RTLLD+ M  RHEQWM QYGRVYK++ E+  RY+IFKENV  I+
Sbjct  12    LALLFILGAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDTERATRYSIFKENVARID  71

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTVDWR  446
             +FN    K YKLG+N FADLTN+EF ASRN +K  H CS    PFRYENVS+VP+T+DWR
Sbjct  72    AFNSQTGKSYKLGVNQFADLTNEEFKASRNRFK-GHMCSPQAGPFRYENVSAVPSTMDWR  130

Query  447   KKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGG  626
             K+GAVTPVKDQGQCGCCWAFSAVAAMEGI KL+TG LISLSEQE+VDCD KG DQGC GG
Sbjct  131   KEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQGCNGG  190

Query  627   LMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAV  806
             LMDDAF FI  NKGLTTE+NYPY+GTDG+C  +K++  AAKI+G+EDVPANSE+AL KAV
Sbjct  191   LMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTNKAAIHAAKITGFEDVPANSEAALMKAV  250

Query  807   ANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTS  986
             A QPVSVAIDAGGSDFQFYSSG+FTG C T+LDHGVTAVGYG++ DG+KYWLVKNSWG  
Sbjct  251   AKQPVSVAIDAGGSDFQFYSSGIFTGSCDTQLDHGVTAVGYGVS-DGSKYWLVKNSWGAQ  309

Query  987   WGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGE+GYIRMQKDI AKEGLCGIAMQ+SYP+A
Sbjct  310   WGEEGYIRMQKDISAKEGLCGIAMQASYPTA  340



>ref|XP_007132895.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
 gb|ESW04889.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
Length=343

 Score =   490 bits (1261),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 238/344 (69%), Positives = 281/344 (82%), Gaps = 6/344 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVF--ATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MA+ +    I+L L+F  A  A+  TSRTL D+ M  RH +WM +YGRVYK+  E+ KR 
Sbjct  1     MATKTQFYHISLTLLFCMAIWAFQVTSRTLQDTSMNERHAEWMTRYGRVYKDPQEREKRL  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRY  407
              IFKENV YIE+FN A  KPYKL +N FADLTN+EFIA RN +K  H CSS    T F+Y
Sbjct  61    RIFKENVNYIEAFNNAANKPYKLAVNQFADLTNEEFIAPRNRFK-GHMCSSITRTTSFKY  119

Query  408   ENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVD  587
             ENV++VP+ VDWR+KGAVTPVKDQGQCGCCWAFSAVAA EGI  L+ G LISLSEQELVD
Sbjct  120   ENVTAVPSKVDWRQKGAVTPVKDQGQCGCCWAFSAVAATEGIHALTAGKLISLSEQELVD  179

Query  588   CDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYED  767
             CD KG+DQGCEGGLMDDAF F+I N+GL+TE+NYPY+GTD +C  + +S  AA I GYED
Sbjct  180   CDSKGVDQGCEGGLMDDAFKFVIQNQGLSTEANYPYKGTDETCNANAASGHAATIKGYED  239

Query  768   VPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDG  947
             VPAN+E AL+KAV NQPVSVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG+++DG
Sbjct  240   VPANNEKALQKAVVNQPVSVAIDASGSDFQFYESGVFTGSCGTELDHGVTAVGYGVSDDG  299

Query  948   TKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T+YWLVKNSWGT WGE+GYIRMQ+ ++++EGLCGIAMQ+SYP+A
Sbjct  300   TEYWLVKNSWGTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  343



>ref|XP_008223852.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   489 bits (1260),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 245/333 (74%), Positives = 279/333 (84%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I LAL+F   A+   ATSR L D+ M  ++EQWM +YGRV+    EK  R+ IFKENV +
Sbjct  12    ICLALIFMLGAWSSQATSRNLQDASMYGKYEQWMTRYGRVFTGVQEKEMRFKIFKENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSSVPTTVD  440
             IES N    KPYKL +N FADLTN+EF ASRNG+ L HECS+  T F+YENV++ P TVD
Sbjct  72    IESSNSDANKPYKLSVNQFADLTNEEFKASRNGF-LGHECSTKTTTFKYENVTA-PPTVD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR KGAVTP+KDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD KG+DQGCE
Sbjct  130   WRTKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDTKGVDQGCE  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N GL+TE+NYPY G DG+C   K ++ AAKI+G+EDVPANSE+AL K
Sbjct  190   GGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQPVSVAIDAGGSDFQFYSSGVFTG CGT LDHGVTAVGYG+++DGTKYWLVKNSWG
Sbjct  250   AVANQPVSVAIDAGGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  309

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGEKGYIRMQ+ +EAKEGLCGIAM++SYP+A
Sbjct  310   TEWGEKGYIRMQRGVEAKEGLCGIAMEASYPTA  342



>gb|AAP32198.1| cysteine protease 12 [Trifolium repens]
Length=343

 Score =   489 bits (1259),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 246/345 (71%), Positives = 284/345 (82%), Gaps = 8/345 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MA+N+    ++LAL F     A   TSRTL D  +  RHEQWM  YG+VYKN  E+ KR 
Sbjct  1     MAANNQLYHVSLALFFCLGLLAIQVTSRTLQDDSIFERHEQWMTHYGKVYKNPQEREKRL  60

Query  237   NIFKENVEYIESFNKAGTK-PYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFR  404
              IF EN++YIE+ N AG K PYKLGIN FADLTN+EFIASRN +K  H CSS    T F+
Sbjct  61    RIFTENLKYIEASNNAGNKKPYKLGINQFADLTNEEFIASRNKFK-GHMCSSIIRTTTFK  119

Query  405   YENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELV  584
             YEN +SVP+TVDWRKKGAVTPVK+QGQCGCCWAFSA+AA EGI K+STG L+SLSEQELV
Sbjct  120   YEN-TSVPSTVDWRKKGAVTPVKNQGQCGCCWAFSAIAATEGIHKISTGKLVSLSEQELV  178

Query  585   DCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYE  764
             DCD  G+DQGCEGGLMDDAF FII N G++TE+ YPYQG DG+CK +++S SAA I+GYE
Sbjct  179   DCDTNGVDQGCEGGLMDDAFKFIIQNNGISTEAGYPYQGVDGTCKANEASTSAATITGYE  238

Query  765   DVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAED  944
             DVPAN+E+AL+KAVANQP+SVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYGI+ D
Sbjct  239   DVPANNENALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGISND  298

Query  945   GTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GTKYWLVKNSWGT WGE+GYIRMQ+ I+A EGLCGIAMQ+SYP+A
Sbjct  299   GTKYWLVKNSWGTDWGEEGYIRMQRSIDAAEGLCGIAMQASYPTA  343



>gb|AAP32195.1| cysteine protease 5 [Trifolium repens]
Length=343

 Score =   489 bits (1258),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 246/345 (71%), Positives = 284/345 (82%), Gaps = 8/345 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MA+N+    ++LAL F     A   TSRTL D  +  RHEQWM  YG+VYKN  E+ KR 
Sbjct  1     MAANNQLYHVSLALFFCLGLLAIQVTSRTLQDDSIFERHEQWMTHYGKVYKNPQEREKRL  60

Query  237   NIFKENVEYIESFNKAGT-KPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFR  404
              IF EN++YIE+ N AG  KPYKLGIN FADLTN+EFIASRN +K  H CSS    T F+
Sbjct  61    RIFTENLKYIEASNNAGNNKPYKLGINQFADLTNEEFIASRNKFK-GHMCSSIIRTTTFK  119

Query  405   YENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELV  584
             YEN +SVP+TVDWRKKGAVTPVK+QGQCGCCWAFSA+AA EGI K+STG L+SLSEQELV
Sbjct  120   YEN-TSVPSTVDWRKKGAVTPVKNQGQCGCCWAFSAIAATEGIHKISTGKLVSLSEQELV  178

Query  585   DCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYE  764
             DCD  G+DQGCEGGLMDDAF FII N G++TE+ YPYQG DG+CK +++S SAA I+GYE
Sbjct  179   DCDTNGVDQGCEGGLMDDAFKFIIQNNGISTEAGYPYQGVDGTCKANEASTSAATITGYE  238

Query  765   DVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAED  944
             DVPAN+E+AL+KAVANQP+SVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYGI+ D
Sbjct  239   DVPANNENALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGISND  298

Query  945   GTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GTKYWLVKNSWGT WGE+GYIRMQ+ I+A EGLCGIAMQ+SYP+A
Sbjct  299   GTKYWLVKNSWGTDWGEEGYIRMQRSIDAAEGLCGIAMQASYPTA  343



>ref|XP_002280215.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   488 bits (1257),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 245/342 (72%), Positives = 285/342 (83%), Gaps = 4/342 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MAS +    I LAL+F  +A+   AT+R LL++ M  RHE WMAQYGRVYK+  EK+KRY
Sbjct  1     MASVNQYQYICLALLFFLAAWASQATARNLLEASMYERHEDWMAQYGRVYKDADEKSKRY  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN-TPFRYEN  413
              IFK+NV  IESFNKA  K YKL IN FADLTN+EF ASRN +K  H CS+  T F+YE+
Sbjct  61    KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRNRFK-AHICSTEATSFKYEH  119

Query  414   VSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
             V++VP+TVDWRKKGAVTP+KDQGQCG CWAFSAVAAMEGIT+LSTG LISLSEQELVDCD
Sbjct  120   VAAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCD  179

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
               G DQGC GGLMDDAF FI  N GL TE+NYPY GTDG+C + K+++ AAKI+GYEDVP
Sbjct  180   TSGEDQGCNGGLMDDAFKFIEQNHGLATEANYPYAGTDGTCNRKKAAHPAAKINGYEDVP  239

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E AL+KAVA+QP++VAIDAGG +FQFYSSGVFTG+CGTELDHGV AVGYG ++DG K
Sbjct  240   ANNEKALQKAVAHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMK  299

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWLVKNSWGT WGE GYIRMQ+D+ AKEGLCGIAMQ+SYP+A
Sbjct  300   YWLVKNSWGTGWGEVGYIRMQRDVTAKEGLCGIAMQASYPTA  341



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score =   489 bits (1259),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 248/333 (74%), Positives = 275/333 (83%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAYLATS--RTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I LAL+F   A+ + S  RTL D  M  RHEQWMAQYGRVYK++ EK  RYNIFKENV  
Sbjct  35    ICLALLFVLVAWPSKSVARTLQDVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVAR  94

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTVD  440
             I++FN    K YKLG+N FADL+N+EF ASRN +K  H CS    PFRYENVS+VP T+D
Sbjct  95    IDAFNSQTGKSYKLGVNQFADLSNEEFKASRNRFK-GHMCSPQAGPFRYENVSAVPATMD  153

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGI +L+TG LISLSEQE+VDCD KG DQGC 
Sbjct  154   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCN  213

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  NKGLTTE+NYPY GTDG+C   K +N AAKI+G+EDVPANSE+AL K
Sbjct  214   GGLMDDAFKFIEQNKGLTTEANYPYTGTDGTCNTQKEANHAAKITGFEDVPANSEAALIK  273

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVA QPVSVAIDAGG +FQFYSSG+FTG CGTELDHGVTAVGYG   DGTKYWLVKNSWG
Sbjct  274   AVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTELDHGVTAVGYG-GSDGTKYWLVKNSWG  332

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
               WGE+GYIRMQKDI AKEGLCGIAMQ+SYP+A
Sbjct  333   AQWGEEGYIRMQKDISAKEGLCGIAMQASYPTA  365



>ref|XP_006592465.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_006607017.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   488 bits (1256),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 232/335 (69%), Positives = 276/335 (82%), Gaps = 4/335 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + +A+ L  A  A+  T R+L D+ M  RHEQWM +YG+VYK+  E+ KR+ IFKENV Y
Sbjct  10    ISLAMLLCMAFLAFQVTCRSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNY  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTT  434
             IE+FN A  K YKL IN FADLTN+EFIA RN +K  H CSS    T F+YENV++VP+T
Sbjct  70    IEAFNNAANKRYKLAINQFADLTNEEFIAPRNRFK-GHMCSSIIRTTTFKYENVTAVPST  128

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             VDWR+KGAVTP+KDQGQCGCCWAFSAVAA EGI  L++G LISLSEQELVDCD KG+DQG
Sbjct  129   VDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQG  188

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             CEGGLMDDAF F+I N GL TE+NYPY+G DG C  ++++N    I+GYEDVPAN+E AL
Sbjct  189   CEGGLMDDAFKFVIQNHGLNTEANYPYKGVDGKCNANEAANDVVTITGYEDVPANNEKAL  248

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
             +KAVANQPVSVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG++ DGT+YWLVKNS
Sbjct  249   QKAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNS  308

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGT WGE+GYIRMQ+ ++++EGLCGIAMQ+SYP+A
Sbjct  309   WGTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  343



>ref|XP_003557016.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   488 bits (1256),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 234/335 (70%), Positives = 277/335 (83%), Gaps = 4/335 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + +A+ L  A  A+  T R+L D+ M  RHEQWM +YG+VYK+  E+ KR+ IFKENV Y
Sbjct  10    ISLAMLLCMAFLAFQVTCRSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNY  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTT  434
             IE+FN A  K YKL IN FADLTN+EFIA RN +K  H CSS    T F+YENV++VP+T
Sbjct  70    IEAFNNAANKRYKLAINQFADLTNEEFIAPRNRFK-GHMCSSIIRTTTFKYENVTAVPST  128

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             VDWR+KGAVTP+KDQGQCGCCWAFSAVAA EGI  L++G LISLSEQELVDCD KG+DQG
Sbjct  129   VDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQG  188

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             CEGGLMDDAF F+I N GL TE+NYPY+G DG C  ++++N AA I+GYEDVPAN+E AL
Sbjct  189   CEGGLMDDAFKFVIQNHGLNTEANYPYKGVDGKCNVNEAANDAATITGYEDVPANNEKAL  248

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
             +KAVANQPVSVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG++ DGT+YWLVKNS
Sbjct  249   QKAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNS  308

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGT WGE+GYIRMQ+ + ++EGLCGIAMQ+SYP+A
Sbjct  309   WGTEWGEEGYIRMQRGVNSEEGLCGIAMQASYPTA  343



>ref|XP_006592467.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   488 bits (1255),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 235/333 (71%), Positives = 278/333 (83%), Gaps = 4/333 (1%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
             +A+ L  A  A+  T RTL D+ M  RHEQWM +YG+VYK+  E+ KR+ IFKENV YIE
Sbjct  12    LAMLLCMAFLAFQVTCRTLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIE  71

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTTVD  440
             +FN A  K YKL IN FADLTN+EFIA RN +K  H CSS    T F+YENV++VP+TVD
Sbjct  72    AFNNAANKRYKLAINQFADLTNEEFIAPRNRFK-GHMCSSIIRTTTFKYENVTAVPSTVD  130

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR+KGAVTP+KDQGQCGCCWAFSAVAA EGI  L++G LISLSEQELVDCD KG+DQGCE
Sbjct  131   WRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCE  190

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF F+I N GL TE+NYPY+G DG C  ++++N+AA I+GYEDVPAN+E AL+K
Sbjct  191   GGLMDDAFKFVIQNHGLNTEANYPYKGVDGKCNANEAANNAATITGYEDVPANNEKALQK  250

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQPVSVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG++ DGT+YWLVKNSWG
Sbjct  251   AVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWG  310

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGE+GYIRMQ+ ++++EGLCGIAMQ+SYP+A
Sbjct  311   TEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  343



>ref|XP_007132888.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
 gb|ESW04882.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
Length=343

 Score =   488 bits (1255),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 241/344 (70%), Positives = 278/344 (81%), Gaps = 6/344 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             M + S    I+LAL+F     A+  + RTL D+ M  RHEQWM +Y RVYK+  EK KR+
Sbjct  1     MVAKSQFYHISLALLFCIGFLAFQVSCRTLQDASMHERHEQWMTRYSRVYKDPEEKEKRF  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRY  407
              IFKENV+YIE+FN A  K Y L IN FADLTN+EFIA RN +K  H CSS    T F+Y
Sbjct  61    RIFKENVKYIEAFNNAANKAYNLAINQFADLTNEEFIAPRNRFK-GHVCSSITRTTTFKY  119

Query  408   ENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVD  587
             ENVS+VP+TVDWR+KGAVTPVKDQGQCGCCWAFSAVAA EGI KLSTG LISLSEQELVD
Sbjct  120   ENVSAVPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVD  179

Query  588   CDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYED  767
             CD+KG+DQGC GGLMDDAF FII N GL TE++YPY+G DG C  + ++N AA I+GYED
Sbjct  180   CDIKGVDQGCGGGLMDDAFKFIIQNHGLNTEASYPYKGVDGKCNANAAANHAATITGYED  239

Query  768   VPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDG  947
             VPAN+E AL+KAV NQPVSVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG+++DG
Sbjct  240   VPANNEKALQKAVTNQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSDDG  299

Query  948   TKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              KYWLVKNSWGT WGE+GYIRMQ+ + A+EGLCGIAM +SYP+A
Sbjct  300   RKYWLVKNSWGTEWGEEGYIRMQRGVAAEEGLCGIAMMASYPTA  343



>ref|XP_008340724.1| PREDICTED: vignain-like [Malus domestica]
Length=338

 Score =   487 bits (1254),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 238/333 (71%), Positives = 275/333 (83%), Gaps = 3/333 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             +  AL  +    +  ATSRTL D  M  ++EQWMA YGRVY N  EK KR+NIFK NV++
Sbjct  8     MCFALIFMLGALSSHATSRTLQDPSMYGKYEQWMAHYGRVYTNINEKEKRFNIFKANVDF  67

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSSVPTTVD  440
             IES N    KPYKL +N FADLTN+EF ASRN + + HECS+  T F+YENV++ P TVD
Sbjct  68    IESSNNDANKPYKLKVNQFADLTNEEFKASRNRF-MGHECSTKTTSFKYENVTA-PATVD  125

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTP+KDQGQCGCCWAFSAVAAMEGITKL+TG LISLSEQELVDCD  G+DQGCE
Sbjct  126   WRKKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCE  185

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N GL+TE+NYPY G DG+C   K ++ AA I+G+EDVPANSE+AL K
Sbjct  186   GGLMDDAFQFITQNHGLSTETNYPYTGVDGTCNTKKEASHAATITGHEDVPANSEAALLK  245

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SVAIDAGGSDFQFYSSGVFTG CGT LDHGVTAVG+G++ DGTKYWLVKNSWG
Sbjct  246   AVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGFGVSADGTKYWLVKNSWG  305

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
               WGE+GYIRMQ+D+EAKEGLCGIAM++SYP+A
Sbjct  306   AEWGEEGYIRMQRDVEAKEGLCGIAMEASYPTA  338



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score =   488 bits (1255),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 242/337 (72%), Positives = 277/337 (82%), Gaps = 4/337 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             KL++   L+    A  + SR+L ++ M +RH+ WM QYGRVYK  VEK KR+ IFKENVE
Sbjct  8     KLVLMAMLLVTLWASQSWSRSLHEASMELRHKTWMTQYGRVYKGNVEKEKRFKIFKENVE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLP---HECSSNT-PFRYENVSSVP  428
             +IESFN  G KPYKLGINAF DLTN+EF AS NGY +    H+ S  T  FRYENV++VP
Sbjct  68    FIESFNNNGNKPYKLGINAFTDLTNEEFRASHNGYTMSMSSHQSSYRTKSFRYENVTAVP  127

Query  429   TTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGID  608
              ++DWR KGAVT +KDQGQCGCCWAFSAVAAMEGITKLSTG LISLSEQELVDCD  G+D
Sbjct  128   PSLDWRTKGAVTHIKDQGQCGCCWAFSAVAAMEGITKLSTGTLISLSEQELVDCDTSGMD  187

Query  609   QGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSES  788
             QGCEGGLMDDAF FII N GLTTE+NYPY+G DGSC   K++N AAKI+GYE+VPA  E 
Sbjct  188   QGCEGGLMDDAFEFIIENNGLTTEANYPYEGVDGSCNTRKAANHAAKITGYENVPAYDEE  247

Query  789   ALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVK  968
             AL KAVANQPVSVAIDAG S FQ YSSG+FTG+CGTELDHGVT VGYG ++DGTKYWLVK
Sbjct  248   ALRKAVANQPVSVAIDAGESAFQHYSSGIFTGDCGTELDHGVTVVGYGTSDDGTKYWLVK  307

Query  969   NSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             NSWGTSWGE GYIRM++DI+AKEGLCGIAM+ SYP+A
Sbjct  308   NSWGTSWGEDGYIRMERDIDAKEGLCGIAMEPSYPTA  344



>ref|XP_002280230.2| PREDICTED: LOW QUALITY PROTEIN: senescence-specific cysteine 
protease SAG39 [Vitis vinifera]
Length=341

 Score =   487 bits (1253),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 243/342 (71%), Positives = 284/342 (83%), Gaps = 4/342 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MAS +    I LAL+F  +A+   AT+R L ++ M  RHE WMAQYGRVYK+  EK+KRY
Sbjct  1     MASVNQYQYICLALLFVLAAWASQATARNLHEASMYERHEDWMAQYGRVYKDADEKSKRY  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN-TPFRYEN  413
              IFK+NV  IESFNKA  K YKL IN FADLTN+EF  SRN +K  H CS+  T F+YEN
Sbjct  61    KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFGTSRNRFK-AHICSTEATSFKYEN  119

Query  414   VSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
             V++VP+T+DWRKKGAVTP+KDQGQCG CWAFSAVAAMEGIT+LSTG LISLSEQELVDCD
Sbjct  120   VTAVPSTIDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCD  179

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
               G DQGC GGLMDDAF FI  N GLTTE+NYPY GTDG+C + K+++ AAKI+GYEDVP
Sbjct  180   TSGEDQGCNGGLMDDAFKFIKQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVP  239

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E AL+KAV +QP++VAIDAGG +FQFYSSGVFTG+CGTELDHGV AVGYG ++DG K
Sbjct  240   ANNEKALQKAVVHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMK  299

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWLVKNSWGT WGE+GYIRMQ+D+ AKEGLCGIAMQ+SYP+A
Sbjct  300   YWLVKNSWGTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  341



>ref|XP_008244498.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   487 bits (1254),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 241/337 (72%), Positives = 279/337 (83%), Gaps = 5/337 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKEN  254
             +L   LAL+    A+   ATSR+L D+ M  RHEQWM +YGRVY +  EK KR+ IFKEN
Sbjct  10    RLCTCLALIIMLGAWSSKATSRSLQDASMYGRHEQWMVRYGRVYTDNEEKEKRFKIFKEN  69

Query  255   VEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVS-SVP  428
             V YIES N   +KPYKL +N F DLTN+EFIASRN +K  HECS+  T F+YENV+ SVP
Sbjct  70    VAYIESSNADASKPYKLRVNQFTDLTNEEFIASRNRFK-GHECSTKTTSFKYENVTASVP  128

Query  429   TTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGID  608
              T+DWRKKGAVTP+KDQGQCGCCWAFSAVAA EGIT+L+TG L+SLSEQELVDCD KG+D
Sbjct  129   ATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQELVDCDTKGVD  188

Query  609   QGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSES  788
             QGCEGGLMDDAF FI  N GL+TE+NYPY G DG+C   K +N AAKI+G+EDVPAN E 
Sbjct  189   QGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGTCNTKKEANIAAKITGHEDVPANDEK  248

Query  789   ALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVK  968
             AL  AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG+++DGTKYWLVK
Sbjct  249   ALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVK  308

Query  969   NSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             NSWGT WGE+GYIRMQ+D++AKEGLCGIAM++SYP+A
Sbjct  309   NSWGTEWGEEGYIRMQRDVDAKEGLCGIAMEASYPTA  345



>ref|XP_002280246.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score =   487 bits (1253),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 243/342 (71%), Positives = 284/342 (83%), Gaps = 4/342 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MAS +    I LAL+F  +A+   AT+R+L ++ M  RHE WM QYGR YK+  EK+KRY
Sbjct  1     MASVNQYQYICLALLFVLAAWASQATARSLHEASMYERHEDWMVQYGREYKDADEKSKRY  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN-TPFRYEN  413
              IFK+NV  IESFNKA  K YKL IN FADLTN+EF ASRN +K  H CS+  T F+YEN
Sbjct  61    KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRNRFK-AHICSTEATSFKYEN  119

Query  414   VSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
             V++VP+TVDWRKKGAVTP+KDQGQCG CWAFSAVAAMEGIT+LSTG LISLSEQELVDCD
Sbjct  120   VTAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCD  179

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
               G DQGC GGLMDDAF FI  N GLTTE+NYPY GTDG+C + K+++ AAKI+GYEDVP
Sbjct  180   TSGEDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVP  239

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E AL+KAVA+QP++VAIDA GS+FQFYSSGVFTG+CGTELDHGV AVGYG ++DG K
Sbjct  240   ANNEKALQKAVAHQPIAVAIDASGSEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMK  299

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWLVKNSW T WGE+GYIRMQ+D+ AKEGLCGIAMQ+SYP+A
Sbjct  300   YWLVKNSWSTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  341



>ref|XP_008223851.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   486 bits (1252),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 244/333 (73%), Positives = 280/333 (84%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I LAL+F   A+   ATSR L D+ M  ++EQWMA+Y RVY +  EK  R+ IFKENV +
Sbjct  12    ICLALIFMLGAWSSQATSRNLQDASMYGKYEQWMARYERVYMDIQEKEMRFKIFKENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSSVPTTVD  440
             IES N    KPYKL +N FADLTN+EF ASRNG+ L HECS+  T F+YENV++ P TVD
Sbjct  72    IESSNGNTNKPYKLSVNQFADLTNEEFKASRNGF-LGHECSTKTTTFKYENVTA-PPTVD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR KGAVTP+KDQGQCGCCWAFSAVAAMEGITKL+TGNLISLSEQELVDCD KG+DQGCE
Sbjct  130   WRTKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGNLISLSEQELVDCDTKGVDQGCE  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N GL+TE+NYPY G DG+C   K ++ AAKI+G+EDVPANSE+AL K
Sbjct  190   GGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEASHAAKITGHEDVPANSEAALLK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SVAIDAGGSDFQFYSSGVFTG CGT LDHGVTAVGYG+++DGTKYWLVKNSWG
Sbjct  250   AVANQPISVAIDAGGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  309

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGEKGYIRMQ+ +EAKEGLCGIAM++SYP+A
Sbjct  310   TEWGEKGYIRMQRGVEAKEGLCGIAMEASYPTA  342



>ref|XP_004505498.1| PREDICTED: vignain-like [Cicer arietinum]
Length=344

 Score =   486 bits (1251),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 242/344 (70%), Positives = 277/344 (81%), Gaps = 7/344 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MA+N+    I+LAL       A   TSRTL D  M   HEQWM  YG+VYK+  EK KR 
Sbjct  1     MAANNQLYYISLALFLCLGLWAIQGTSRTLQDDSMYESHEQWMRHYGKVYKDSQEKEKRS  60

Query  237   NIFKENVEYIESFNKAGT-KPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFR  404
              IF +N+ YI++FN AG  K YKLGIN +ADLTN+EFI+SRN +K  H CSS    T F+
Sbjct  61    KIFTQNINYIQAFNNAGNDKAYKLGINQYADLTNEEFISSRNKFK-GHMCSSIIRTTTFK  119

Query  405   YENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELV  584
             YENVS+VP+TVDWRKKGAVTPVK+QGQCGCCWAFSAVAA EGI KLSTG LISLSEQELV
Sbjct  120   YENVSAVPSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELV  179

Query  585   DCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYE  764
             DCD KG+DQGCEGGLMDDAF FII N GL TE+ YPYQG DG+C  +++S  AA I+GYE
Sbjct  180   DCDTKGVDQGCEGGLMDDAFKFIIQNHGLDTEAQYPYQGVDGTCNANEASIHAATITGYE  239

Query  765   DVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAED  944
             DVP N+E AL+KAVANQP+SVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG++ D
Sbjct  240   DVPVNNEQALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSND  299

Query  945   GTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  1076
             GTKYWLVKNSWGT WGE+GYIRMQ+ ++A EGLCGIAMQ+SYP+
Sbjct  300   GTKYWLVKNSWGTDWGEQGYIRMQRGVDAAEGLCGIAMQASYPT  343



>emb|CAN64655.1| hypothetical protein VITISV_005140 [Vitis vinifera]
Length=341

 Score =   486 bits (1251),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 243/342 (71%), Positives = 284/342 (83%), Gaps = 4/342 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MAS +    I LAL+F  +A+   A +R L ++ M  RHE WMAQYGRVYK+  EK+KRY
Sbjct  1     MASVNQYRYICLALLFVLAAWASHAKARNLHEASMYERHEDWMAQYGRVYKDAGEKSKRY  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN-TPFRYEN  413
              IFK+NV  IESFNKA  K YKL IN FADLTN+EF ASRN +K  H CS+  T F+YE+
Sbjct  61    KIFKDNVARIESFNKAMNKSYKLSINEFADLTNEEFRASRNRFK-AHICSTEATSFKYEH  119

Query  414   VSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
             V +VP+TVDWRKKGAVTP+KDQGQCG CWAFSAVAAMEGIT+LSTG LISLSEQELVDCD
Sbjct  120   VXAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCD  179

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
               G DQGC GGLMDDAF FI  N GLTTE+NYPY GTDG+C + K+++ AAKI+GYEDVP
Sbjct  180   TSGEDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVP  239

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E AL+KAVA+QP++VAIDAGG +FQFYSSGVFTG+CGTELDHGV+AVGYG ++DG K
Sbjct  240   ANNEKALQKAVAHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVSAVGYGTSDDGMK  299

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWLVKNSWGT WGE+GYIRMQ+D+  KEGLCGIAMQ+SYP+A
Sbjct  300   YWLVKNSWGTGWGEEGYIRMQRDVTEKEGLCGIAMQASYPTA  341



>ref|XP_006467666.1| PREDICTED: vignain-like [Citrus sinensis]
 gb|KDO77831.1| hypothetical protein CISIN_1g042468mg [Citrus sinensis]
Length=346

 Score =   486 bits (1250),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 250/339 (74%), Positives = 280/339 (83%), Gaps = 7/339 (2%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             KL++A  LV    A  + SRTL D+ M  RHE WMAQYGRVY++  EK  R+ IFKENVE
Sbjct  9     KLVLAAILVLGVWAPQSWSRTLNDATMNERHEMWMAQYGRVYRDNAEKEMRFKIFKENVE  68

Query  261   YIESFN-KAGTKPYKLGINAFADLTNKEFIASRNGYK--LPHECSSNT---PFRYENVSS  422
             YI SFN KA  KPYKLGIN FAD TN+EF A RNGYK  LP   SS T    FRYEN +S
Sbjct  69    YIASFNNKARNKPYKLGINEFADQTNEEFRAPRNGYKRRLPSVRSSETTDVSFRYEN-AS  127

Query  423   VPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKG  602
             VP ++DWRKKGAVT VKDQGQCGCCWAFSAVAAMEGI  ++T  L SLSEQELVDCD  G
Sbjct  128   VPASIDWRKKGAVTGVKDQGQCGCCWAFSAVAAMEGINHITTRKLTSLSEQELVDCDTSG  187

Query  603   IDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANS  782
              DQGCEGGLMDDAF FII+NKGL TE+ YPY+ +DGSC K +++ SAAKISGYEDVP+N+
Sbjct  188   EDQGCEGGLMDDAFEFIISNKGLATEAKYPYKASDGSCNKKEANPSAAKISGYEDVPSNN  247

Query  783   ESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWL  962
             E+AL KAVANQPVSVAIDA GSDFQFYSSGVFTG+CGTELDHGVTAVGYG A+DGTKYWL
Sbjct  248   EAALMKAVANQPVSVAIDASGSDFQFYSSGVFTGQCGTELDHGVTAVGYGTADDGTKYWL  307

Query  963   VKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             VKNSWGT+WGE GYIRMQ+DI+AKEGLCGIAMQ+SYP+A
Sbjct  308   VKNSWGTTWGENGYIRMQRDIDAKEGLCGIAMQASYPTA  346



>ref|XP_003609015.1| Cysteine proteinase [Medicago truncatula]
 gb|AES91212.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   485 bits (1249),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 245/346 (71%), Positives = 279/346 (81%), Gaps = 8/346 (2%)
 Frame = +3

Query  63    MAS-NSLKLLIALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKR  233
             MAS N L   IAL  +F     A   TSR+L    M  RHEQWM+QY +VYK+  E+ +R
Sbjct  1     MASKNQLYYSIALTFIFCLGLCAIQVTSRSLQVDSMYERHEQWMSQYSKVYKDPQEREER  60

Query  234   YNIFKENVEYIESFNK-AGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPF  401
             + IF  NV YIE FN  A  K YKLGIN FADLTN+EFIASRN +K  H CSS    T F
Sbjct  61    HKIFTANVNYIEVFNNDANNKLYKLGINQFADLTNEEFIASRNKFK-GHMCSSIAKTTTF  119

Query  402   RYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQEL  581
             +YENVS++P+TVDWRKKGAVTPVK+QGQCGCCWAFSAVAA EGITKLSTG L+SLSEQEL
Sbjct  120   KYENVSAIPSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGITKLSTGKLVSLSEQEL  179

Query  582   VDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGY  761
             VDCD KG+DQGCEGGLMDDAF FII N GL+TE+ YPYQG DG+C  +K+S  AA I+GY
Sbjct  180   VDCDTKGVDQGCEGGLMDDAFKFIIQNHGLSTEAAYPYQGVDGTCNANKASIHAATITGY  239

Query  762   EDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAE  941
             EDVPAN+E AL+KAVANQP+SVAIDA GSDFQFY SGVF+G CGTELDHGVTAVGYG+  
Sbjct  240   EDVPANNEQALQKAVANQPISVAIDASGSDFQFYKSGVFSGSCGTELDHGVTAVGYGVGN  299

Query  942   DGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             DGTKYWLVKNSWGT WGE+GYIRMQ+ ++A EGLCGIAMQ+SYP+A
Sbjct  300   DGTKYWLVKNSWGTDWGEEGYIRMQRGVDAAEGLCGIAMQASYPTA  345



>ref|XP_007132875.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
 gb|ESW04869.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
Length=343

 Score =   485 bits (1249),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 232/334 (69%), Positives = 277/334 (83%), Gaps = 4/334 (1%)
 Frame = +3

Query  90    IALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I+LA++F  +  A   TSRTL D+ +  RHE+WMA+Y RVYK+  EK KR+ IFK+N+ Y
Sbjct  10    ISLAMLFCMAFWALQVTSRTLQDASIYERHEEWMARYSRVYKDPQEKEKRFRIFKQNMNY  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYK--LPHECSSNTPFRYENVSSVPTTV  437
             IE+FN A  KPYKL IN FADLTN+EFIA RN +K  +       T F+YENV+SVP+TV
Sbjct  70    IEAFNNAANKPYKLAINQFADLTNEEFIAPRNRFKGHMRSSIIKTTTFKYENVTSVPSTV  129

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWR+KGAVTPVKDQGQCGCCWAFSAVA+ EGI +L+TG LISLSEQELVDCD KG+DQGC
Sbjct  130   DWRQKGAVTPVKDQGQCGCCWAFSAVASAEGIHQLTTGKLISLSEQELVDCDTKGVDQGC  189

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMDDAF FII N GL TE+NYP++G DG+C    +S+ AA I GYEDVPAN+E AL+
Sbjct  190   EGGLMDDAFKFIIQNNGLNTEANYPFKGVDGTCNAKAASSHAATIRGYEDVPANNEKALQ  249

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
             KAV NQPVSVAIDA GSDF+FY SGVFTG CGTELDHGVTAVGYG+++DGT+YWLVKNSW
Sbjct  250   KAVTNQPVSVAIDASGSDFKFYKSGVFTGSCGTELDHGVTAVGYGVSDDGTEYWLVKNSW  309

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GT WGE+GYIRMQ+ ++++EGLCGIAMQ+SYP+A
Sbjct  310   GTEWGEEGYIRMQRGVDSEEGLCGIAMQASYPTA  343



>ref|XP_008244499.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   485 bits (1249),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 241/337 (72%), Positives = 278/337 (82%), Gaps = 5/337 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKEN  254
             KL   LAL+    A+   ATSR+L D+ M  RHEQWM +YGRVY +  EK KR+ IFKEN
Sbjct  10    KLCTCLALIIMLGAWSSKATSRSLQDASMYGRHEQWMVRYGRVYTDNEEKEKRFKIFKEN  69

Query  255   VEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVS-SVP  428
             V YIES N   +KPYKL +N F DLTN+EFIASRN +K  HECS+  T F+YENV+ SVP
Sbjct  70    VAYIESSNADSSKPYKLRVNQFTDLTNEEFIASRNRFK-GHECSTKTTSFKYENVTASVP  128

Query  429   TTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGID  608
              T+DWRKKGAVTP+KDQGQCGCCWAFSAVAA EGIT+L+TG L+SLSEQELVDCD KG+D
Sbjct  129   ATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQELVDCDTKGVD  188

Query  609   QGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSES  788
             QGCEGGLMDDAF FI  N GL+TE+NYPY G DG+C   K +N AAKI+ +EDVPAN E 
Sbjct  189   QGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGTCNTKKEANIAAKITDHEDVPANDEK  248

Query  789   ALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVK  968
             AL  AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG+++DGTKYWLVK
Sbjct  249   ALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVK  308

Query  969   NSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             NSWGT WGE+GYIRMQ+D++AKEGLCGIAM++SYP+A
Sbjct  309   NSWGTEWGEEGYIRMQRDVDAKEGLCGIAMEASYPTA  345



>ref|XP_007213386.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
 gb|EMJ14585.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
Length=345

 Score =   485 bits (1249),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 241/337 (72%), Positives = 278/337 (82%), Gaps = 5/337 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKEN  254
             K    LAL+    A+   ATSR+L D+ M  RHEQWM +YGRVY +  EK KR+ IFKEN
Sbjct  10    KFCTCLALIIMLGAWSSEATSRSLQDASMYGRHEQWMTRYGRVYTDNEEKEKRFKIFKEN  69

Query  255   VEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVS-SVP  428
             V YIES N   +KPYKL +N F DLTN+EFIASRN +K  HECS+  T F+YENV+ SVP
Sbjct  70    VAYIESSNADTSKPYKLRVNQFTDLTNEEFIASRNRFK-GHECSTKTTSFKYENVTTSVP  128

Query  429   TTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGID  608
              T+DWRKKGAVTP+KDQGQCGCCWAFSAVAA EGIT+L+TG L+SLSEQELVDCD KG+D
Sbjct  129   ATMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLVSLSEQELVDCDTKGVD  188

Query  609   QGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSES  788
             QGCEGGLMDDAF FI  N GL+TE+NYPY G DG+C   K +N AAKI+G+EDVPAN E 
Sbjct  189   QGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGTCNTKKEANIAAKITGHEDVPANDEK  248

Query  789   ALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVK  968
             AL  AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG+++DGTKYWLVK
Sbjct  249   ALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVK  308

Query  969   NSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             NSWGT WGE+GYIRMQ+D++AKEGLCGIAM++SYP+A
Sbjct  309   NSWGTEWGEEGYIRMQRDVDAKEGLCGIAMEASYPTA  345



>ref|XP_010103045.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB94643.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=359

 Score =   486 bits (1250),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 248/351 (71%), Positives = 282/351 (80%), Gaps = 20/351 (6%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSL--MAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENV  257
             + ++L LV    A LA  R L +    M+ RHEQWMA+YGR YK++ EK KR+ IFK NV
Sbjct  10    IFVSL-LVLGMWAALANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKRFQIFKSNV  68

Query  258   EYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKL-PHECSSNTPFRYENVSSVPTT  434
             EYIES NKAG KPYKLGIN FAD TN+EF ASRNGYK  P     N  FRYE+V+ VP++
Sbjct  69    EYIESVNKAGNKPYKLGINEFADQTNEEFRASRNGYKRSPIPRPINPSFRYESVTKVPSS  128

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEG----------------ITKLSTGNLISL  566
             VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEG                IT+L+TG LISL
Sbjct  129   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGLYGCCWAFSAVAAMEGITQLTTGKLISL  188

Query  567   SEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaa  746
             SEQELVDCD  G DQGCEGGLMDDAF FI+ N+GLTTES YPY+G D +C K K+S+ AA
Sbjct  189   SEQELVDCDTSGTDQGCEGGLMDDAFDFILGNEGLTTESKYPYKGVDETCNKKKASSHAA  248

Query  747   kisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVG  926
              I+G+EDVPANSE AL+KAVANQPVSVAIDAGGSDFQ YSSGVFTGECGTELDHGVTAVG
Sbjct  249   SITGHEDVPANSEKALQKAVANQPVSVAIDAGGSDFQLYSSGVFTGECGTELDHGVTAVG  308

Query  927   YGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YG  EDGTKYWLVKNSWG+SWGE+GYIRM++D++A+EGLCGIAM++SYPSA
Sbjct  309   YGKTEDGTKYWLVKNSWGSSWGEEGYIRMERDVDAEEGLCGIAMEASYPSA  359



>ref|XP_004506025.1| PREDICTED: vignain-like [Cicer arietinum]
Length=342

 Score =   485 bits (1248),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 237/333 (71%), Positives = 275/333 (83%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
             +AL LVF   A    +R+L D+ +  R+EQWM Q G+VYK   EK  RY IFKENV++IE
Sbjct  12    LALFLVFGLLALETNARSLEDASLLERYEQWMTQNGKVYKGSQEKALRYQIFKENVQFIE  71

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS--NTP-FRYENVSSVPTTVD  440
             +FNK G KPYKLGIN FADLTN+EF  +RN +K  H CS+   TP F+YE+V+SVP  +D
Sbjct  72    AFNKGGNKPYKLGINQFADLTNEEF-KTRNKFK-GHMCSTITRTPTFKYEHVTSVPAALD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR+KGAVTP+KDQGQCG CWAFSAVAA EGITKLS+G L+SLSEQELVDCD+KG+DQGCE
Sbjct  130   WRQKGAVTPIKDQGQCGSCWAFSAVAATEGITKLSSGKLVSLSEQELVDCDIKGVDQGCE  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF F++ NKGLTTE  YPYQG DG+C      N  A I GYEDVPANSESAL K
Sbjct  190   GGLMDDAFKFMLQNKGLTTEVVYPYQGVDGTCNAKAEGNHVASIKGYEDVPANSESALLK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SVAIDA GS+FQFYSSGVFTG CGTELDHGVTAVGYG++EDGTKYWLVKNSWG
Sbjct  250   AVANQPISVAIDASGSEFQFYSSGVFTGTCGTELDHGVTAVGYGVSEDGTKYWLVKNSWG  309

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGE+GYIRM++++ AKEGLCGIAMQ+SYP+A
Sbjct  310   TQWGEQGYIRMERNVVAKEGLCGIAMQASYPTA  342



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score =   484 bits (1247),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 244/342 (71%), Positives = 284/342 (83%), Gaps = 5/342 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MA N+    I+LAL+F   A    A +R+L D+ +  RHE+WMAQYG+VYK+  EK  R 
Sbjct  1     MALNTQYPRISLALIFILGALASQAIARSLQDASINERHEKWMAQYGKVYKDANEKVIRR  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYEN  413
              IFK NVE IESFNKAG KPYKLGIN FADLTN+EF  SRN +K  H CS    PFRYEN
Sbjct  61    KIFKRNVERIESFNKAGGKPYKLGINQFADLTNEEFKTSRNRFK-GHMCSPQAGPFRYEN  119

Query  414   VSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
             V++VP+++DWRKKGAVTP+KDQGQCG CWAFS VAA+EGIT+L+T  LISLSEQELVDCD
Sbjct  120   VTAVPSSMDWRKKGAVTPIKDQGQCGSCWAFSTVAAVEGITQLTTKKLISLSEQELVDCD  179

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
              KG DQGC+GGLMDDAF FI NN+GLTTE+NYPY G+DG+C   K +N AAKI+GYEDVP
Sbjct  180   TKGEDQGCQGGLMDDAFKFIENNQGLTTEANYPYVGSDGTCNTKKEANHAAKITGYEDVP  239

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E+AL KAV NQPVSVAIDAGG  FQFYSSG+FTG+CGTELDHGV AVGYG++ +GTK
Sbjct  240   ANNEAALLKAVTNQPVSVAIDAGGFAFQFYSSGIFTGDCGTELDHGVAAVGYGVS-NGTK  298

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWLVKNSWGT WGE+GYIRMQ+DI+AKEGLCGIAMQ+SYP+A
Sbjct  299   YWLVKNSWGTQWGEEGYIRMQRDIDAKEGLCGIAMQASYPTA  340



>emb|CAN70559.1| hypothetical protein VITISV_032465 [Vitis vinifera]
Length=341

 Score =   484 bits (1246),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 242/342 (71%), Positives = 282/342 (82%), Gaps = 4/342 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MAS +    I LAL+F  +A+   AT+R L ++ M  RHE WM QYGR YK+  EK+KRY
Sbjct  1     MASVNQYQYICLALLFVLAAWASQATARXLHEASMYERHEDWMVQYGREYKDADEKSKRY  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN-TPFRYEN  413
              IFK+NV  IESFNKA  K YKL IN FADLTN+EF ASRN +K  H CS+  T F+YEN
Sbjct  61    KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRNRFK-AHICSTEATSFKYEN  119

Query  414   VSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
             V++VP+TVDWRKKGAVTP+KDQGQCG CWAFSAVAAMEGIT+LSTG LISLSEQELVDCD
Sbjct  120   VTAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCD  179

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
               G DQGC GGLMDDAF FI  N GLTTE+NYPY GTDG+C + K+++ AAKI+GYEDVP
Sbjct  180   TSGEDQGCSGGLMDDAFKFIEQNHGLTTEANYPYAGTDGTCNRKKAAHPAAKINGYEDVP  239

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E AL+KAVA+QP++VAIDA GS+FQFYSSGVFTG+CGTELDHGV AVGYG ++DG K
Sbjct  240   ANNEKALQKAVAHQPIAVAIDASGSEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMK  299

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWLVKNSW T WGE+GYIRMQ+D+  KEGLCGIAMQ+SYP+A
Sbjct  300   YWLVKNSWSTGWGEEGYIRMQRDVTVKEGLCGIAMQASYPTA  341



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score =   484 bits (1245),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 247/333 (74%), Positives = 273/333 (82%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAYLATS--RTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I LAL+F   A+ + S  RTL D  M  RHEQWMAQYGRVYK+  EK  RYNIFK NV  
Sbjct  9     ICLALLFVLVAWPSKSVARTLQDVSMYERHEQWMAQYGRVYKDNAEKETRYNIFKANVAR  68

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTVD  440
             I+ FN    K YKLG+N FADL+N+EF ASRN +K  H CS    PFRYENVS+VP ++D
Sbjct  69    IDEFNSQTGKSYKLGVNQFADLSNEEFKASRNRFK-GHMCSPQAGPFRYENVSAVPDSMD  127

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGI +L+TG LISLSEQE+VDCD KG DQGC 
Sbjct  128   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCN  187

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  NKGLTTE+NYPY GTDG+C   K +N AAKI+G+EDVPANSE+AL K
Sbjct  188   GGLMDDAFKFIEQNKGLTTEANYPYTGTDGTCNTQKEANHAAKITGFEDVPANSEAALIK  247

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVA QPVSVAIDAGG +FQFYSSG+FTG CGT+LDHGVTAVGYGI+ DGTKYWLVKNSWG
Sbjct  248   AVAKQPVSVAIDAGGFEFQFYSSGIFTGSCGTQLDHGVTAVGYGIS-DGTKYWLVKNSWG  306

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
               WGE GYIRMQKDI AKEGLCGIAMQ+SYPSA
Sbjct  307   AQWGEGGYIRMQKDISAKEGLCGIAMQASYPSA  339



>ref|XP_007048674.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92831.1| Senescence-associated gene 12 [Theobroma cacao]
Length=344

 Score =   484 bits (1245),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 241/336 (72%), Positives = 281/336 (84%), Gaps = 5/336 (1%)
 Frame = +3

Query  84    LLIALALVFATS-AYLATSRTL--LDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKEN  254
             L +AL  +F T+  + ATSRTL   DS M  RHEQWMAQYGRVYK+  +K KR+ IFKEN
Sbjct  10    LCLALIFIFGTNLVFQATSRTLPIQDSAMYERHEQWMAQYGRVYKDSNDKEKRFKIFKEN  69

Query  255   VEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP-FRYENVSSVPT  431
             V  I++FN A  KPYKLGIN FADLTN+EF ASRN +K  H CS+    F+YENV++VP+
Sbjct  70    VARIDAFNTANGKPYKLGINQFADLTNEEFTASRNRFK-GHMCSNTAASFKYENVTAVPS  128

Query  432   TVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQ  611
              +DWR+KGAVTPVKDQGQCGCCWAFSAVAAMEGI  ++TG LISLSEQELVDCD KG DQ
Sbjct  129   AMDWRQKGAVTPVKDQGQCGCCWAFSAVAAMEGINMITTGKLISLSEQELVDCDTKGEDQ  188

Query  612   GCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESA  791
             GC+GGLMDDAF FI   +GLTTE++YPY+G DG+C  +K +N AAKI+GYEDVPANSE+ 
Sbjct  189   GCQGGLMDDAFKFIQKIQGLTTETDYPYRGVDGTCNTNKEANHAAKINGYEDVPANSETV  248

Query  792   LEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKN  971
             L KAVANQPVSVAIDAGG +FQFYS G+FTG C T+LDHGVTAVGYG+ +DGTKYWLVKN
Sbjct  249   LLKAVANQPVSVAIDAGGFEFQFYSGGIFTGACETQLDHGVTAVGYGVGDDGTKYWLVKN  308

Query  972   SWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             SWGTSWGEKGYIRMQ+D++AKEGLCGIAM +SYP+A
Sbjct  309   SWGTSWGEKGYIRMQRDVDAKEGLCGIAMAASYPTA  344



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   483 bits (1244),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 245/333 (74%), Positives = 277/333 (83%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I LAL+F   A    ATSRTL D+ M  R+EQWMA YGRVY +  EK KR+NIFKENV +
Sbjct  12    IILALIFMLGALSSQATSRTLQDASMYGRYEQWMAHYGRVYSDINEKEKRFNIFKENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTVD  440
             IES N    K +KL +N FADLTN+EF ASRN + + HECS+ T  F+YENV++ P TVD
Sbjct  72    IESSNNDANKLHKLSVNQFADLTNEEFKASRNRF-MGHECSAKTTSFKYENVTA-PPTVD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKL+TG LISLSEQELVDCD  G+DQGCE
Sbjct  130   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCE  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N GL+TE+NYPY G DG+C   K +N AAKI+G+EDVPANSE AL K
Sbjct  190   GGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEANHAAKITGHEDVPANSEEALLK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SVAIDAGGSDFQFYSSGVFTG CGT LDHGVTAVGYG++ DGTKYWLVKNSWG
Sbjct  250   AVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSADGTKYWLVKNSWG  309

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGE+GYIRMQ+ I+AKEGLCGIAM++SYP+A
Sbjct  310   TEWGEEGYIRMQRGIKAKEGLCGIAMEASYPTA  342



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score =   483 bits (1244),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 241/333 (72%), Positives = 278/333 (83%), Gaps = 3/333 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + +AL  + A  A  A +R+L D+ M  RHE WMAQ GRVYK+  EK  RY IFKENVE 
Sbjct  10    IFLALIFILAALASQAIARSLQDASMYERHEDWMAQNGRVYKDANEKEIRYKIFKENVER  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTVD  440
             IESFNKAG K YKLGIN FADLTN+EF  SRN +K  H CS    PFRYENV++VP+++D
Sbjct  70    IESFNKAGGKSYKLGINQFADLTNEEFKTSRNRFK-GHMCSPQEGPFRYENVTAVPSSMD  128

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTP+KDQGQCG CWAFSAVAA+EGIT+L++  LISLSEQELVDCD KG DQGC+
Sbjct  129   WRKKGAVTPIKDQGQCGSCWAFSAVAAVEGITQLTSHKLISLSEQELVDCDTKGEDQGCQ  188

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI NN+GLTTE+NYPY+G+DG+C  +K +N AAKI+GYEDVPAN E+AL K
Sbjct  189   GGLMDDAFKFIENNQGLTTETNYPYEGSDGTCNANKEANHAAKITGYEDVPANDEAALLK  248

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVA QPVSVAIDAGG  FQFYSSG+FTG+CGTELDHGV AVGYG++ +G KYWLVKNSWG
Sbjct  249   AVAQQPVSVAIDAGGFQFQFYSSGIFTGDCGTELDHGVAAVGYGVS-NGMKYWLVKNSWG  307

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGE GYIRMQ+DIEAKEGLCGIAMQ+SYP+A
Sbjct  308   TQWGEVGYIRMQRDIEAKEGLCGIAMQASYPTA  340



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score =   483 bits (1244),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 242/333 (73%), Positives = 277/333 (83%), Gaps = 4/333 (1%)
 Frame = +3

Query  87    LIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYI  266
              +A  LVF    + ATSR L ++ M  +HEQWM ++GRVYKN+VEK KR+ IFK+N++YI
Sbjct  11    FVAALLVFGMQDFQATSRGLYETSMVQKHEQWMTRFGRVYKNDVEKAKRFKIFKDNIDYI  70

Query  267   ESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYENVSSVPTTVD  440
             +SFNKAGTK YKL IN FADLTN EF A+ NGYK+P +  S   T F+YENV++ P T+D
Sbjct  71    DSFNKAGTKSYKLDINEFADLTNDEFRATHNGYKMPFQKKSPEITSFKYENVTA-PATMD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR KGAVT +K+QGQCGCCWAFSAVAA EGI K+ TG LISLSEQELVDCD    D GCE
Sbjct  130   WRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSS-DMGCE  188

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FII N GLTTESNYPY+GTD +CK  K SN AAKI+ YEDVPANSES+L K
Sbjct  189   GGLMDDAFKFIIKNHGLTTESNYPYEGTDSTCKTGKESNHAAKITSYEDVPANSESSLLK  248

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQPVSVAIDA GSDFQFYSSGVFTGECGTELDHGVTAVGYG A DGTKYWLVKNSWG
Sbjct  249   AVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNSWG  308

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             TSWGE GYIRMQ++++A+EGLCGIAM++SYP+A
Sbjct  309   TSWGENGYIRMQRNVDAEEGLCGIAMEASYPTA  341



>ref|XP_006360707.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   483 bits (1244),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 243/335 (73%), Positives = 275/335 (82%), Gaps = 4/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             KL     LV    A  ATSR L ++ M  +HEQWM  +GRVYK++VEK KR+NIFK+N +
Sbjct  8     KLAFVALLVLGMQASQATSRGLYETSMVQKHEQWMTHFGRVYKDDVEKAKRFNIFKDNTK  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYENVSSVPTT  434
             YI S NKAG KPYKL IN FADLTN+EF A+RNGYK+P +  S   T F+YENV++ P T
Sbjct  68    YINSVNKAGIKPYKLDINEFADLTNEEFRATRNGYKMPSQKKSPEITSFKYENVTA-PAT  126

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWR KGAVT +K+QGQCGCCWAFSAVAA EGI K+ TG LISLSEQELVDCD    D G
Sbjct  127   MDWRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSS-DMG  185

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             CEGGLMDDAF FII N GLTTESNYPY+GTDG+CK  K S+ AAKI+ YEDVPANSESAL
Sbjct  186   CEGGLMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKESSHAAKITSYEDVPANSESAL  245

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
              KAVANQPVSVAIDA GSDFQFYSSGVFTGECGTELDHGVTAVGYG A DGTKYWLVKNS
Sbjct  246   LKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNS  305

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGTSWGE GYIRMQ++++ +EGLCGIAM++SYP+A
Sbjct  306   WGTSWGENGYIRMQRNVDTEEGLCGIAMEASYPTA  340



>dbj|BAD29955.1| cysteine protease [Daucus carota]
Length=365

 Score =   484 bits (1245),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 237/331 (72%), Positives = 275/331 (83%), Gaps = 2/331 (1%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
             +AL       A LA +R+L ++ M   H+QWMA+YGRVYK   EK +R  IF+EN++YI+
Sbjct  12    LALLFTIGVLASLAAARSLNEASMTETHDQWMARYGRVYKTANEKNRRSTIFQENLKYIQ  71

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP-FRYENVSSVPTTVDWR  446
             +FNKA  KPYKLG+N FADLTN+EF  SRN +K  H C++ T  FRYENV++VP T+DWR
Sbjct  72    TFNKANNKPYKLGVNEFADLTNEEFTTSRNKFK-SHVCATVTNVFRYENVTAVPATMDWR  130

Query  447   KKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGG  626
             KKGAVTP+K+QGQCGCCWAFSAVAAMEGIT+L TG LISLSEQELVDCD  G DQGCEGG
Sbjct  131   KKGAVTPIKNQGQCGCCWAFSAVAAMEGITQLKTGKLISLSEQELVDCDTNGEDQGCEGG  190

Query  627   LMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAV  806
             LMD AF FI  N GL+TE+NYPY GTDG+C  +K +N AA I+G+EDVPANSESAL KAV
Sbjct  191   LMDYAFDFIQQNHGLSTETNYPYSGTDGTCNANKEANHAATITGHEDVPANSESALLKAV  250

Query  807   ANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTS  986
             ANQP+SVAIDA GSDFQFYSSGVFTGECGTELDHGVTAVGYG A DGTKYWLVKNSWGTS
Sbjct  251   ANQPISVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGTAADGTKYWLVKNSWGTS  310

Query  987   WGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGE+GYI+MQ+ + A EGLCGIAMQ+SYP+A
Sbjct  311   WGEEGYIQMQRGVAAAEGLCGIAMQASYPTA  341



>gb|KHN13721.1| Vignain [Glycine soja]
Length=326

 Score =   482 bits (1241),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 231/323 (72%), Positives = 272/323 (84%), Gaps = 4/323 (1%)
 Frame = +3

Query  120   AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPY  299
             A+  T R+L D+ M  RHEQWM +YG+VYK+  E+ KR+ IFKENV YIE+FN A  K Y
Sbjct  5     AFQVTCRSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRY  64

Query  300   KLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTTVDWRKKGAVTPV  470
             KL IN FADLTN+EFIA RN +K  H CSS    T F+YENV++VP+TVDWR+KGAVTP+
Sbjct  65    KLAINQFADLTNEEFIAPRNRFK-GHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPI  123

Query  471   KDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTF  650
             KDQGQCGCCWAFSAVAA EGI  L++G LISLSEQELVDCD KG+DQGCEGGLMDDAF F
Sbjct  124   KDQGQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKF  183

Query  651   IINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVA  830
             +I N GL TE+NYPY+G DG C  ++++N AA I+GYEDVPAN+E AL+KAVANQPVSVA
Sbjct  184   VIQNHGLNTEANYPYKGVDGKCNVNEAANDAATITGYEDVPANNEKALQKAVANQPVSVA  243

Query  831   IDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIR  1010
             IDA GSDFQFY SGVFTG CGTELDHGVTAVGYG++ DGT+YWLVKNSWGT WGE+GYIR
Sbjct  244   IDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIR  303

Query  1011  MQKDIEAKEGLCGIAMQSSYPSA  1079
             MQ+ ++++EGLCGIAMQ+SYP+A
Sbjct  304   MQRGVDSEEGLCGIAMQASYPTA  326



>gb|KHN08187.1| Thiol protease SEN102 [Glycine soja]
Length=326

 Score =   482 bits (1241),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 229/323 (71%), Positives = 270/323 (84%), Gaps = 4/323 (1%)
 Frame = +3

Query  120   AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPY  299
             A+  T R+L D+ M  RHEQWM +YG+VYK+  E+ KR+ IFKENV YIE+FN A  K Y
Sbjct  5     AFQVTCRSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRY  64

Query  300   KLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTTVDWRKKGAVTPV  470
             KL IN FADLTN+EFIA RN +K  H CSS    T F+YENV++VP+TVDWR+KGAVTP+
Sbjct  65    KLAINQFADLTNEEFIAPRNRFK-GHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPI  123

Query  471   KDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTF  650
             KDQGQCGCCWAFSAVAA EGI  L++G LISLSEQELVDCD KG+DQGCEGGLMDDAF F
Sbjct  124   KDQGQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKF  183

Query  651   IINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVA  830
             +I N GL TE+NYPY+G DG C  ++++N    I+GYEDVPAN+E AL+KAVANQPVSVA
Sbjct  184   VIQNHGLNTEANYPYKGVDGKCNANEAANDVVTITGYEDVPANNEKALQKAVANQPVSVA  243

Query  831   IDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIR  1010
             IDA GSDFQFY SGVFTG CGTELDHGVTAVGYG++ DGT+YWLVKNSWGT WGE+GYIR
Sbjct  244   IDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEWGEEGYIR  303

Query  1011  MQKDIEAKEGLCGIAMQSSYPSA  1079
             MQ+ ++++EGLCGIAMQ+SYP+A
Sbjct  304   MQRGVDSEEGLCGIAMQASYPTA  326



>ref|XP_004505502.1| PREDICTED: vignain-like [Cicer arietinum]
Length=345

 Score =   483 bits (1243),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 234/320 (73%), Positives = 268/320 (84%), Gaps = 5/320 (2%)
 Frame = +3

Query  132   TSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGT-KPYKLG  308
             TSRTL D  M   HEQWM  Y +VYK+  EK KR  IF +N+ YI++FN AG  KPYKLG
Sbjct  27    TSRTLQDDSMYESHEQWMRHYAKVYKDSQEKDKRSKIFTQNINYIQAFNNAGNNKPYKLG  86

Query  309   INAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTTVDWRKKGAVTPVKDQ  479
             IN +ADLTN+EFI+SRN +K  H CSS    T F+Y+NV++VP+TVDWRKKGAVTPVK+Q
Sbjct  87    INQYADLTNEEFISSRNKFK-GHMCSSIIRTTTFKYQNVTAVPSTVDWRKKGAVTPVKNQ  145

Query  480   GQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIIN  659
             GQCGCCWAFSAVAA EGI KLSTG LISLSEQELVDCD KG+DQGCEGGLMDDAF FII 
Sbjct  146   GQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQ  205

Query  660   NKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDA  839
             N GL TE+ YPYQG DG+C  +++S  AA I+GYEDVPAN+E AL+KAVANQP+SVAIDA
Sbjct  206   NHGLDTEAQYPYQGVDGTCYANEASVHAATITGYEDVPANNEQALQKAVANQPISVAIDA  265

Query  840   GGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQK  1019
              GSDFQFY SGVFTG CGTELDHGVTAVGYG++ DGTKYWLVKNSWGT WGE+GYIRMQ+
Sbjct  266   SGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSWGTDWGEQGYIRMQR  325

Query  1020  DIEAKEGLCGIAMQSSYPSA  1079
              ++A EGLCGIAMQ+SYP+A
Sbjct  326   GVDAAEGLCGIAMQASYPTA  345



>ref|XP_007132860.1| hypothetical protein PHAVU_011G130800g [Phaseolus vulgaris]
 gb|ESW04854.1| hypothetical protein PHAVU_011G130800g [Phaseolus vulgaris]
Length=343

 Score =   483 bits (1242),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 237/335 (71%), Positives = 274/335 (82%), Gaps = 6/335 (2%)
 Frame = +3

Query  90    IALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I+LAL+F     A+  + RTL D+ M   HEQWM +Y RVYK+  E+ KR+ IFKENV Y
Sbjct  10    ISLALLFCIGFLAFQVSCRTLQDASMHETHEQWMTRYSRVYKDPEEREKRFRIFKENVNY  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTT  434
             IE+FN A +KPY L IN FADLTN+EFIA RN +K  H CSS    T F+YENVS+VP+T
Sbjct  70    IEAFNNAASKPYSLAINQFADLTNEEFIAPRNRFK-GHMCSSIIRTTTFKYENVSAVPST  128

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             VDWR+KGAVTPVKDQGQCGCCWAFSAV A EGI KLSTG LISLSEQELVDCD+KG+DQG
Sbjct  129   VDWRQKGAVTPVKDQGQCGCCWAFSAVGATEGIHKLSTGKLISLSEQELVDCDIKGVDQG  188

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             C GGLMDDAF FII N GL TE++YPY+G DG C  + ++N AA I+GYEDVPAN+E AL
Sbjct  189   CGGGLMDDAFKFIIQNHGLNTEASYPYKGVDGKCNANAAANHAATITGYEDVPANNEKAL  248

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
             + AVANQPVSVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG+++DG KYWLVKNS
Sbjct  249   QTAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSDDGRKYWLVKNS  308

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGT WGE+GYIRMQ+ + A+EGLCGIAM +SYP+A
Sbjct  309   WGTEWGEEGYIRMQRGVAAEEGLCGIAMMASYPTA  343



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score =   482 bits (1241),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 246/335 (73%), Positives = 272/335 (81%), Gaps = 4/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             KL     LV    A   TSR L ++ M  +HE WMA++GRVY+++ EK KR  IFK NV+
Sbjct  8     KLAFVALLVLGMWASQTTSRDLNEASMVQKHEYWMARFGRVYRDDAEKAKRLKIFKNNVD  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLP-HECSSNT-PFRYENVSSVPTT  434
             YIES NKAG +PYKLGIN FADLTN+EF A+ NGYK+  H+ SS T  FRYENV++ P T
Sbjct  68    YIESVNKAGIRPYKLGINEFADLTNEEFRATHNGYKMSSHQKSSKTISFRYENVTA-PAT  126

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWR KGAVT VKDQGQCGCCWAFSAVAA EGI K+ TG LISLSEQELVDCD    D G
Sbjct  127   IDWRTKGAVTGVKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSS-DMG  185

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             CEGGLMDDAFTFII N GLTTESNYPY+GTDG+CK  K SN  AKI+GYEDVPANSESAL
Sbjct  186   CEGGLMDDAFTFIIKNHGLTTESNYPYEGTDGTCKTRKESNHVAKITGYEDVPANSESAL  245

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
               AVANQPVSVAIDA GSDFQFYSSGVFTGECGTELDHGVTA+GYG   DGTKYWLVKNS
Sbjct  246   LSAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAIGYGKTSDGTKYWLVKNS  305

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGTSWGE GYIRMQ+DI+A EG CGIAMQ+SYP+A
Sbjct  306   WGTSWGENGYIRMQRDIDAAEGTCGIAMQASYPTA  340



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   482 bits (1241),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 244/333 (73%), Positives = 278/333 (83%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I LAL+F   A    ATSRTL D+ M  R+EQWMA+YGRVY +  EK KR+NIFKENV +
Sbjct  12    IILALIFMLGALSSQATSRTLQDASMYGRYEQWMARYGRVYSDINEKEKRFNIFKENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSSVPTTVD  440
             IES N    K +KL +N FADLTN+EF ASRN + + HECS+  T F+YENV++ P T+D
Sbjct  72    IESSNNDANKLHKLSVNQFADLTNEEFKASRNRF-MGHECSAKTTSFKYENVTA-PPTLD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKL+TG LISLSEQELVDCD  G+DQGCE
Sbjct  130   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCE  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N GL+TE+NYPY G DG+C   K +N AAKI+G+EDVPANSE AL K
Sbjct  190   GGLMDDAFQFINQNHGLSTETNYPYTGVDGTCNTKKEANHAAKITGHEDVPANSEEALLK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SVAIDAGGSDFQFYSSGVFTG CGT LDHGVTAVGYG++ DGTKYWLVKNSWG
Sbjct  250   AVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSADGTKYWLVKNSWG  309

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGE+GYIRMQ+ I+AKEGLCGIAM++SYP+A
Sbjct  310   TEWGEEGYIRMQRGIKAKEGLCGIAMEASYPTA  342



>ref|XP_004290089.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   482 bits (1241),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 235/333 (71%), Positives = 276/333 (83%), Gaps = 3/333 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + +AL L+    +  ATSR+L D+LM  R+EQWM +YGR+Y +  EK KR+ IFKENV +
Sbjct  10    ICLALILILGAWSSEATSRSLQDALMYGRYEQWMIRYGRIYSDTDEKEKRFKIFKENVAF  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTVD  440
             IES N    KPYKL +N FADLTN+EF ASRN +K  HECS+ T  F+YEN ++VPT +D
Sbjct  70    IESSNDEANKPYKLSVNGFADLTNEEFTASRNRFK-GHECSTKTTSFKYEN-ATVPTKMD  127

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR+KGAVTP+KDQGQCGCCWAFSAVAAMEGIT+L+TG LISLSEQELVDCDV G DQGCE
Sbjct  128   WRQKGAVTPIKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCE  187

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N GL+TE+NYPY G DG+C   K ++ AA I+G+EDVPANSESAL K
Sbjct  188   GGLMDDAFEFINQNHGLSTEANYPYTGVDGTCNAQKEASHAASITGHEDVPANSESALLK  247

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG+ +DGTKYWLVKNSWG
Sbjct  248   AVANQPISVAIDASGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVGDDGTKYWLVKNSWG  307

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
               WGE+GYIRMQ+D++A EGLCGIAM++SYP+A
Sbjct  308   AEWGEQGYIRMQRDVDAPEGLCGIAMEASYPTA  340



>ref|XP_004252607.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=340

 Score =   482 bits (1241),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 242/335 (72%), Positives = 275/335 (82%), Gaps = 4/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             KL     LV    A  ATSR L ++ M  +H+QWM ++GRVYK++VEK KR+ IFK+N E
Sbjct  8     KLAFIALLVLVMQASQATSRGLYETSMVQKHDQWMTRFGRVYKDDVEKAKRFKIFKDNTE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYENVSSVPTT  434
             YI+SFNKAGTKPYKL IN FADLTN+EF A+ NGY++P +  S   T F+YENV++ P T
Sbjct  68    YIDSFNKAGTKPYKLDINEFADLTNEEFRATHNGYRMPSQKKSPEITSFKYENVTA-PAT  126

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWRKKGAVT +KDQGQCGCCWAFSAVAA EGI K+ TG LISLSEQELVDCD    D G
Sbjct  127   MDWRKKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSS-DMG  185

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             CEGGLMDDAF FII N GLTTESNYPY+GTD +CK  K SN AAKI+ YEDVPANSES L
Sbjct  186   CEGGLMDDAFKFIIKNHGLTTESNYPYEGTDSTCKTGKESNHAAKITSYEDVPANSESDL  245

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
              KAVANQPVSVAIDA  SDFQFYSSGVFTGECGTELDHGVTAVGYG A DGTKYWLVKNS
Sbjct  246   LKAVANQPVSVAIDASASDFQFYSSGVFTGECGTELDHGVTAVGYGKASDGTKYWLVKNS  305

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGTSWGE GYIRMQ++++ +EGLCGIAM++SYP+A
Sbjct  306   WGTSWGENGYIRMQRNVDTEEGLCGIAMEASYPTA  340



>ref|XP_006362426.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   482 bits (1240),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 246/338 (73%), Positives = 276/338 (82%), Gaps = 5/338 (1%)
 Frame = +3

Query  72    NSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKE  251
             N     +AL LV    A  ATSR L ++ M  +HE+WMA +GRVY+++ EK KR+NIFK+
Sbjct  6     NCKSAFLAL-LVLGMWANEATSRDLNEASMVQKHEKWMAHFGRVYRDDTEKAKRFNIFKD  64

Query  252   NVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKL--PHECSSNTPFRYENVSSV  425
             N +YIES NKAG +PYKL IN FADLTN+EF A+ NGYK+  PH  S  T FRYENV++ 
Sbjct  65    NFDYIESINKAGMRPYKLRINGFADLTNEEFRATHNGYKMSSPHMSSKTTFFRYENVTA-  123

Query  426   PTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGI  605
             P T+DWRKKGAVT VKDQGQCGCCWAFSAVAA EGI ++ TG LISLSEQELVDCD    
Sbjct  124   PATMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINEIKTGKLISLSEQELVDCDTSS-  182

Query  606   DQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSE  785
             D GCEGGLMDDAF FII N GLTTESNYPY+GTDG+CK  K SN AAKI+GYEDVPANSE
Sbjct  183   DMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKESNDAAKITGYEDVPANSE  242

Query  786   SALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLV  965
             SAL  AVANQPVSVAIDA GSDFQFYSSGVFTGECGTELDHGVTAVGYGI  DGTKYWL+
Sbjct  243   SALLNAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGITSDGTKYWLI  302

Query  966   KNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             KNSWGTSWGE GYIRMQ+ +  +EGLCGIAMQ+SYP+A
Sbjct  303   KNSWGTSWGENGYIRMQRGVVPEEGLCGIAMQASYPTA  340



>ref|XP_009359979.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   481 bits (1239),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 242/333 (73%), Positives = 274/333 (82%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I LA +F   A    ATSRTL D+ M  ++EQWMA YGR Y +  EK KR+NIFKENV +
Sbjct  12    ICLAFIFILGALSSQATSRTLQDASMYAKYEQWMASYGRAYADINEKEKRFNIFKENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSSVPTTVD  440
             IES N    K YKL +N FADLTN+EF ASRNG+ + HECS+  T F+YENV++ P TVD
Sbjct  72    IESSNNDANKLYKLSVNQFADLTNEEFKASRNGF-MGHECSTKTTAFKYENVTA-PPTVD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR KGAVTP+KDQGQCGCCWAFSAVAAMEGITKL+TG LISLSEQELVDCD  G+DQGC 
Sbjct  130   WRNKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCG  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N GL+TE+NYPY G DG+C   K ++ AAKI+GYEDVPANSE AL K
Sbjct  190   GGLMDDAFQFINKNHGLSTETNYPYTGVDGTCNTKKEASHAAKITGYEDVPANSEEALLK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SVAIDAGGSDFQFYSSGVFTG CGT LDHGVTAVGYGI+ DGTKYWLVKNSWG
Sbjct  250   AVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGISADGTKYWLVKNSWG  309

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGE+GYIRMQ+ +EAKEGLCGIAM++SYP+A
Sbjct  310   TQWGEEGYIRMQRGVEAKEGLCGIAMEASYPTA  342



>ref|XP_011038211.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   481 bits (1239),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 229/335 (68%), Positives = 271/335 (81%), Gaps = 2/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             + +IA  L+  T AY   SR L +  M+ RHEQWMA +G+VY +  EK +R+ IFK+NVE
Sbjct  8     QCIIAFILILGTWAYEVASRELQEPSMSARHEQWMATFGKVYADAAEKERRFEIFKDNVE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYENVSSVPTT  434
             YIESFN AG KPYKL +N FADLT +E   +RNGY+ P +      T F YENV++VP T
Sbjct  68    YIESFNTAGNKPYKLSVNKFADLTTEELKVARNGYRRPLQTRPMKVTSFEYENVTAVPAT  127

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWRKKGAVTP+KDQGQCG CWAFS VAA EGI +L+TG L+SLSEQELVDCD +G DQG
Sbjct  128   MDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDTQGEDQG  187

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             CEGGLM+D F FII N G+T+E+NYPYQ  DG+C   K ++  AKI+GYE VPANSE+AL
Sbjct  188   CEGGLMEDGFEFIIKNHGITSEANYPYQAADGTCNSKKEASHIAKITGYESVPANSEAAL  247

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
              KAVANQP+SV+IDAGGSDFQFYSSGVFTG+CGTELDHGVTAVGYG   DGTKYWLVKNS
Sbjct  248   LKAVANQPISVSIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGETSDGTKYWLVKNS  307

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGTSWGE+GYIRMQ+D++A+EGLCGIAM SSYP+A
Sbjct  308   WGTSWGEEGYIRMQRDVDAEEGLCGIAMDSSYPTA  342



>dbj|BAF56430.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   481 bits (1238),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 237/333 (71%), Positives = 274/333 (82%), Gaps = 6/333 (2%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
             + L LVF   ++ A +RTL D+ M  RHEQWMAQYG+VYK+  EK  R  IFKENV+ IE
Sbjct  12    LTLLLVFGFLSFEANARTLEDASMHERHEQWMAQYGKVYKDSYEKELRSKIFKENVQRIE  71

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT---PFRYENVSSVPTTVD  440
             +FN AG K YKLGIN FADLTN+EF A RN +K  H CS++T    F+YE+V+SVP ++D
Sbjct  72    AFNNAGNKSYKLGINQFADLTNEEFKA-RNRFK-GHMCSNSTRTPTFKYEHVTSVPASLD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR+KGAVTP+KDQGQCGCCWAFSAVAA EGITKLSTG LISLSEQELVDCD KG+DQGCE
Sbjct  130   WRQKGAVTPIKDQGQCGCCWAFSAVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCE  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI+ NKGL TE+ YPYQG D +C  +  +  AA I G+EDVPANSESAL K
Sbjct  190   GGLMDDAFKFIMQNKGLNTEAKYPYQGVDATCNANAEAKDAASIKGFEDVPANSESALLK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SVAIDA GS+FQFYSSGVFTG CGTELDHGVTAVGYG ++ GTKYWLVKNSWG
Sbjct  250   AVANQPISVAIDASGSEFQFYSSGVFTGSCGTELDHGVTAVGYG-SDGGTKYWLVKNSWG  308

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
               WGE+GYIRMQ+D+ A+EGLCG AMQ+SYP+A
Sbjct  309   EQWGEQGYIRMQRDVAAEEGLCGFAMQASYPTA  341



>gb|EYU25680.1| hypothetical protein MIMGU_mgv1a019612mg [Erythranthe guttata]
Length=328

 Score =   481 bits (1237),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 236/329 (72%), Positives = 270/329 (82%), Gaps = 4/329 (1%)
 Frame = +3

Query  102   LVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNK  281
             +V    A  AT+RTL D+ M  RHEQWM QYGR YKN+ EK  R+NIFK+NVEYI+S N+
Sbjct  1     MVLQIWASQATARTLPDTSMVERHEQWMVQYGRTYKNDAEKANRFNIFKDNVEYIQSVNE  60

Query  282   AGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT---PFRYENVSSVPTTVDWRKK  452
             A T+ YKL IN FADL ++EF ASRNGYK+  +  S++    FRY NVS VP ++DW KK
Sbjct  61    AETRTYKLAINKFADLKHEEFQASRNGYKMRSQSKSSSKVLSFRYANVSGVPPSMDWTKK  120

Query  453   GAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLM  632
             GAVTPVKDQGQCGCCWAFSAVAA EGI +L+TGNL+SLSEQELVDCD    DQGC GGLM
Sbjct  121   GAVTPVKDQGQCGCCWAFSAVAATEGINQLTTGNLVSLSEQELVDCDTSE-DQGCNGGLM  179

Query  633   DDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVAN  812
             D+AF FII+N GLTTESNYPY+G DG+C   K S+ AA+I+GYEDVP+NSESAL KAVAN
Sbjct  180   DNAFEFIISNNGLTTESNYPYEGVDGTCNSKKESSHAARITGYEDVPSNSESALLKAVAN  239

Query  813   QPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWG  992
             QP+SVAIDA G D QFYS+GVFTG+CGTELDHGVTAVGYG   DGTKYWLVKNSWGTSWG
Sbjct  240   QPISVAIDASGPDIQFYSTGVFTGQCGTELDHGVTAVGYGATNDGTKYWLVKNSWGTSWG  299

Query  993   EKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             E GYIRMQ+DI A EGLCGIAMQ+SYP+A
Sbjct  300   ENGYIRMQRDIHAAEGLCGIAMQASYPTA  328



>ref|XP_006376349.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
 gb|ERP54146.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
Length=342

 Score =   480 bits (1236),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 230/335 (69%), Positives = 269/335 (80%), Gaps = 2/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             +   A  L+  T AY   SR L +  M+ RHEQWM  YG+VY +  EK +R+ IFK+NVE
Sbjct  8     QCFFAFILILGTWAYEVASRELQEPSMSARHEQWMETYGKVYADAAEKERRFEIFKDNVE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYENVSSVPTT  434
             YIESFN AG KPYKL +N FADLTN+E   +RNGY+ P +      T F+YENV++VP T
Sbjct  68    YIESFNTAGNKPYKLSVNKFADLTNEELKVARNGYRRPLQTRPMKVTSFKYENVTAVPAT  127

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWRKKGAVTP+KDQGQCG CWAFS VAA EGI +L+TG L+SLSEQELVDCD +G DQG
Sbjct  128   MDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDTQGEDQG  187

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             CEGGLM+D F FII N G+TTE+NYPYQ  DG+C   K ++  AKI+GYE VPANSE+AL
Sbjct  188   CEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSRKEASRIAKITGYESVPANSEAAL  247

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
              KAVA+QP+SV+IDAGGSDFQFYSSGVFTG+CGTELDHGVTAVGYG   DGTKYWLVKNS
Sbjct  248   LKAVASQPISVSIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGETSDGTKYWLVKNS  307

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGTSWGE+GYIRMQ+D EA+EGLCGIAM SSYP+A
Sbjct  308   WGTSWGEEGYIRMQRDTEAEEGLCGIAMDSSYPTA  342



>ref|XP_009359957.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   480 bits (1236),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 241/333 (72%), Positives = 277/333 (83%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I LAL+F     +  ATSR L D+ M  ++EQWMA+YGRVY    EK KR+NIFKENV +
Sbjct  12    ICLALIFMLGDLSSQATSRALQDASMYGKYEQWMARYGRVYTGINEKEKRFNIFKENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSSVPTTVD  440
             IES NK   K YKL +N FADLTN++F ASRNG+ + HECS+  T F+YENV++ P TVD
Sbjct  72    IESSNKDANKLYKLSVNQFADLTNEQFKASRNGF-MGHECSAAKTSFKYENVTA-PPTVD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTP+KDQGQCGCCWAFSAVAAMEGITKL+TG LISLSEQELVDCD  G+DQGC+
Sbjct  130   WRKKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGCQ  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N GL+TE+NYPY G DG+C   K +N AAKI+G+EDVPAN E AL K
Sbjct  190   GGLMDDAFQFINQNHGLSTEANYPYTGVDGTCNTKKEANHAAKITGHEDVPANREDALMK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG+++DGTKYWLVKNSWG
Sbjct  250   AVANQPISVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  309

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGE+GYIRMQ+ IEAKEGLCGIAM++SYP+A
Sbjct  310   TEWGEEGYIRMQRGIEAKEGLCGIAMEASYPTA  342



>ref|XP_008244476.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=339

 Score =   479 bits (1234),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 239/332 (72%), Positives = 276/332 (83%), Gaps = 3/332 (1%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
               L L+F   +  ATSR+L D+ M  ++EQWM +YGRVY +  EK  R+ IFKENV +IE
Sbjct  9     FGLILMFGAWSCEATSRSLQDASMYGKYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIE  68

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSS-VPTTVDW  443
             S N    KPYKLG+N FADLTN+EF ASRNG+K  HECS+ T  F+YENV + VP  +DW
Sbjct  69    SSNNDVNKPYKLGVNQFADLTNEEFKASRNGFK-GHECSTKTTSFKYENVKAPVPAAMDW  127

Query  444   RKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEG  623
             RKKGAVTP+KDQGQCGCCWAFSAVAA EGIT+L+TG LISLSEQELVDCD  G+DQGCEG
Sbjct  128   RKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCEG  187

Query  624   GLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKA  803
             GLMDDAF FI  N GL+TE+NYPY G DGSC   K+++ AAKI+GYEDVPANSE AL  A
Sbjct  188   GLMDDAFQFIQQNHGLSTEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTA  247

Query  804   VANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGT  983
             VA+QPVSVAIDAGGSDFQFYSSGVFTG CGT LDHGVTAVGYG+++DGTKYWLVKNSWGT
Sbjct  248   VAHQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGT  307

Query  984   SWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              WGE+GYIRMQ+D+EAKEGLCGIAM++SYP+A
Sbjct  308   EWGEEGYIRMQRDVEAKEGLCGIAMEASYPTA  339



>ref|XP_008228922.1| PREDICTED: vignain-like [Prunus mume]
Length=326

 Score =   478 bits (1231),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 237/319 (74%), Positives = 271/319 (85%), Gaps = 3/319 (1%)
 Frame = +3

Query  129   ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLG  308
             ATSR+L D+ M  R+EQWM +YGRVY +  EK  R+ IFKENV +IES N    KPYKLG
Sbjct  9     ATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNNDVNKPYKLG  68

Query  309   INAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSS-VPTTVDWRKKGAVTPVKDQG  482
             +N FADLTN+EF ASRNG+K  HECS+ T  F+YENV + VP  +DWRKKGAVTP+KDQG
Sbjct  69    VNQFADLTNEEFKASRNGFK-GHECSTKTTSFKYENVKAPVPAAMDWRKKGAVTPIKDQG  127

Query  483   QCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINN  662
             QCGCCWAFSAVAA EGIT+L+TG LISLSEQELVDCD  G+DQGCEGGLMDDAF FI  N
Sbjct  128   QCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFIQQN  187

Query  663   KGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAG  842
              GL+TE+NYPY G DGSC   K+++ AAKI+GYEDVPANSE AL  AVA+QPVSVAIDAG
Sbjct  188   HGLSTEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAG  247

Query  843   GSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKD  1022
             GSDFQFYSSGVFTG CGT LDHGVTAVGYG+++DGTKYWLVKNSWGT WGE+GYIRMQ+D
Sbjct  248   GSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIRMQRD  307

Query  1023  IEAKEGLCGIAMQSSYPSA  1079
             +EAKEGLCGIAM++SYP+A
Sbjct  308   VEAKEGLCGIAMEASYPTA  326



>ref|XP_007212585.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
 gb|EMJ13784.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
Length=339

 Score =   479 bits (1232),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 242/334 (72%), Positives = 276/334 (83%), Gaps = 5/334 (1%)
 Frame = +3

Query  90    IALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I   L+F   A+   ATSR+L D+ M  R+EQWM +YGRVY +  EK  R+ IFKENV +
Sbjct  7     IGFGLLFMLGAWSCEATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAF  66

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSS-VPTTV  437
             IES N    KPYKLG+N FADLTN+EF ASRNG+K  HECS+ T  F+YENV + VP T+
Sbjct  67    IESSNNDVNKPYKLGVNQFADLTNEEFKASRNGFK-GHECSTKTTSFKYENVKAPVPATM  125

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVTPVKDQGQCGCCWAFSAVAA EGIT+L+TG LISLSEQELVDCD  G DQGC
Sbjct  126   DWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGC  185

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMDDAF FI  N GL+ E+NYPY G DGSC   K+++ AAKI+GYEDVPANSE AL 
Sbjct  186   EGGLMDDAFQFIQQNHGLSAEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALL  245

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
              AVA+QPVSVAIDAGGSDFQFYSSGVFTG CGT LDHGVTAVGYG+++DGTKYWLVKNSW
Sbjct  246   TAVAHQPVSVAIDAGGSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSW  305

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GT WGE+GYIRMQ+D+EAKEGLCGIAM++SYP+A
Sbjct  306   GTEWGEEGYIRMQRDVEAKEGLCGIAMEASYPTA  339



>gb|AAT34987.1| putative cysteine protease [Gossypium hirsutum]
Length=344

 Score =   479 bits (1232),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 247/347 (71%), Positives = 281/347 (81%), Gaps = 11/347 (3%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLA-TSRTLLDSLMAVRHEQWMAQYGRVYKNEVE--KTKR  233
             MA   + L +AL L F  S  LA  SR LLD   ++RHE+WM+Q+GRVY +E E  K KR
Sbjct  1     MALLQIFLFVALVLSFCFSIQLAGLSRPLLDE-DSMRHEEWMSQHGRVYADEQEDHKNKR  59

Query  234   YNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN----TPF  401
             +N+FKENVE IE FN    K +KL IN FADLTN+EF AS NG+K P   SS     TPF
Sbjct  60    FNVFKENVERIEEFNDG--KTFKLAINQFADLTNEEFRASYNGFKGPMVLSSQITKPTPF  117

Query  402   RYENVSS-VPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQE  578
             RYENVSS +P +VDWRKKGAVTPVK+QGQCGCCWAFSAVAA+EGIT++STG LISLSEQE
Sbjct  118   RYENVSSALPVSVDWRKKGAVTPVKNQGQCGCCWAFSAVAAIEGITQISTGKLISLSEQE  177

Query  579   LVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisG  758
             LVDCD KGID GCEGGLMD AF FIINN GLTTESNYPY+G DG+C  +K++  A  I+G
Sbjct  178   LVDCDTKGIDHGCEGGLMDTAFEFIINNGGLTTESNYPYKGEDGTCNFNKTNPIAVSITG  237

Query  759   YEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIA  938
             YEDVPAN E AL KAVA+QPVSVAI+AGGSDFQFYSSGVFTGECGTELDH VTAVGYG +
Sbjct  238   YEDVPANDEQALMKAVAHQPVSVAIEAGGSDFQFYSSGVFTGECGTELDHAVTAVGYGES  297

Query  939   EDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             EDG+KYW+VKNSWGT WGE GYI MQKDI+ K+GLCGIAMQ+SYP+A
Sbjct  298   EDGSKYWIVKNSWGTKWGESGYIEMQKDIKVKQGLCGIAMQASYPTA  344



>ref|XP_010045986.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84688.1| hypothetical protein EUGRSUZ_B01505 [Eucalyptus grandis]
Length=342

 Score =   478 bits (1231),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 237/343 (69%), Positives = 281/343 (82%), Gaps = 5/343 (1%)
 Frame = +3

Query  63    MASNSL-KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYN  239
             MAS  + KL++ +  +    A    SR L  + M  RHEQWMA++G VY+++ EK +R++
Sbjct  1     MASTLVGKLVLVMVAILGLWASQVRSRELHKATMRQRHEQWMARHGWVYQDDAEKERRFS  60

Query  240   IFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKL---PHECSSNTPFRYE  410
             IFK NV++IESFNK G KPY L INAFADLT +EF ASRNGYK    P + S+  PFRYE
Sbjct  61    IFKNNVDFIESFNKDGNKPYTLAINAFADLTIEEFKASRNGYKRSSSPRQVSTK-PFRYE  119

Query  411   NVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDC  590
             +V++VP+++DWRKKGAVTP+KDQGQCG CWAFSAV AMEG  +L+TG LISLSEQELVDC
Sbjct  120   HVTAVPSSMDWRKKGAVTPIKDQGQCGSCWAFSAVGAMEGNNQLTTGKLISLSEQELVDC  179

Query  591   DVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDV  770
             D  G DQGCEGG MD+AF FII N GLTTE+NYPYQ  DG+C   K ++SAAKI+GYEDV
Sbjct  180   DTSGEDQGCEGGFMDNAFEFIIGNHGLTTETNYPYQAVDGTCNARKEASSAAKITGYEDV  239

Query  771   PANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGT  950
             PANSESAL KAVA+QPVSVAIDAG S FQFYSSG+FTGECGT LDHGVTAVGYG +EDGT
Sbjct  240   PANSESALLKAVAHQPVSVAIDAGESAFQFYSSGIFTGECGTNLDHGVTAVGYGTSEDGT  299

Query  951   KYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             KYWLVKNSWGT WGE+GYIRM++DI+AKEGLCGIAM++SYP+A
Sbjct  300   KYWLVKNSWGTGWGEEGYIRMKRDIDAKEGLCGIAMEASYPTA  342



>ref|XP_003607571.1| Cysteine proteinase EP-B [Medicago truncatula]
 gb|AAQ63885.1| putative cysteine proteinase [Medicago truncatula]
 gb|AES89768.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   478 bits (1231),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 244/345 (71%), Positives = 278/345 (81%), Gaps = 9/345 (3%)
 Frame = +3

Query  66    ASNSLKLLIALALVFATS--AYLATSRTLLD-SLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             A+N L   I+LAL F     A   TSRTL D S++  +HEQWM  YG+VYK+  E+  R 
Sbjct  3     ANNQLYHSISLALFFCLGLFAIQVTSRTLQDDSIIYEKHEQWMVHYGKVYKDLQERENRL  62

Query  237   NIFKENVEYIESFNKAGT-KPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP---FR  404
              IFKENV YIE+ N AG  K YKLGIN FADLTN+EFIASRN +K  H CSS T    F+
Sbjct  63    KIFKENVNYIEASNNAGNNKLYKLGINQFADLTNEEFIASRNKFK-GHMCSSITKTSTFK  121

Query  405   YENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELV  584
             YEN +SVP+TVDWRKKGAVTPVK+QGQCGCCWAFSAVAA EGI KLSTG L+SLSEQELV
Sbjct  122   YEN-ASVPSTVDWRKKGAVTPVKNQGQCGCCWAFSAVAATEGIHKLSTGKLVSLSEQELV  180

Query  585   DCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYE  764
             DCD KG+DQGCEGGLMDDAF FII N GL TE+ YPYQG DG+C  +K+S  A  I+GYE
Sbjct  181   DCDTKGVDQGCEGGLMDDAFKFIIQNHGLNTEAQYPYQGVDGTCSANKASIHAVTITGYE  240

Query  765   DVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAED  944
             DVPAN+E AL+KAVANQP+SVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG+  D
Sbjct  241   DVPANNEQALQKAVANQPISVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVGND  300

Query  945   GTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GTKYWLVKNSWGT WGE+GYI+MQ+ ++A EGLCGIAM++SYP+A
Sbjct  301   GTKYWLVKNSWGTDWGEEGYIKMQRGVDAAEGLCGIAMEASYPTA  345



>ref|XP_004505500.1| PREDICTED: vignain-like [Cicer arietinum]
Length=345

 Score =   478 bits (1230),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 231/320 (72%), Positives = 267/320 (83%), Gaps = 5/320 (2%)
 Frame = +3

Query  132   TSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGT-KPYKLG  308
             TSRTL D  M   H+QWM  Y +VYK+  EK KR  IF +N+ YI++FN AG  KPYKLG
Sbjct  27    TSRTLQDDSMYESHDQWMRHYAKVYKDSQEKEKRSKIFTQNINYIQAFNNAGNNKPYKLG  86

Query  309   INAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTTVDWRKKGAVTPVKDQ  479
             IN +ADLTN+EFIASRN +K  H CSS    T F+Y+NV+++P+TVDWRKKGAVTPVK+Q
Sbjct  87    INQYADLTNEEFIASRNKFK-GHMCSSIIRTTTFKYQNVTALPSTVDWRKKGAVTPVKNQ  145

Query  480   GQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIIN  659
             GQCGCCWAFSAVAA EGI KLSTG LISLSEQELVDCD KG+DQGCEGGLMDDAF FII 
Sbjct  146   GQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQ  205

Query  660   NKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDA  839
             N GL TE+ YPYQG DG+C  +++S  AA I+GYEDV AN+E AL+KA+ANQP+SVAIDA
Sbjct  206   NHGLDTEAQYPYQGVDGTCYANEASVHAATITGYEDVAANNEQALQKALANQPISVAIDA  265

Query  840   GGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQK  1019
              GSDFQFY SGVFTG CGTELDHGVTAVGYG++ DGTKYWLVKNSWGT WGE+GYIRMQ+
Sbjct  266   SGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSWGTDWGEQGYIRMQR  325

Query  1020  DIEAKEGLCGIAMQSSYPSA  1079
              ++A EGLCGIAMQ+SYP+A
Sbjct  326   GVDAAEGLCGIAMQASYPTA  345



>ref|XP_004306851.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   478 bits (1229),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 236/333 (71%), Positives = 275/333 (83%), Gaps = 3/333 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             L +AL L+    +  ATSR+L D+L   R+EQWMA+YGRVY +  EK +R+ IFK N  +
Sbjct  10    LCLALVLMLGAWSSEATSRSLQDALAYGRYEQWMARYGRVYNDATEKEERFKIFKANEAF  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSSVPTTVD  440
             IES N  G KPYKLG+N FADLTN+EFIASRN + L HECS+ +T F+YEN S+VP T+D
Sbjct  70    IESSNNEGNKPYKLGLNQFADLTNEEFIASRNRF-LGHECSTKSTTFKYEN-STVPATID  127

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR+KGAVTPVKDQGQCGCCWAFSAVAAMEGIT+L+TG LISLSEQELVDCDV G DQGCE
Sbjct  128   WRQKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCE  187

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMD+AF FI  N GL+TE+NYPY G DG+C   K +N AA I+G+EDVP N ESAL+K
Sbjct  188   GGLMDNAFEFINQNHGLSTEANYPYTGVDGTCNAKKEANHAASITGHEDVPPNDESALQK  247

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SVAIDA GS FQFYSSGVFTG CGT LDHGVTAVGYG+++DGTK+WLVKNSWG
Sbjct  248   AVANQPISVAIDASGSGFQFYSSGVFTGPCGTSLDHGVTAVGYGVSDDGTKFWLVKNSWG  307

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
               WGE+GYIRMQ+DI A EGLCGIAM+ SYP+A
Sbjct  308   AQWGEEGYIRMQRDIPAPEGLCGIAMEPSYPTA  340



>dbj|BAF56427.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   478 bits (1229),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 227/335 (68%), Positives = 271/335 (81%), Gaps = 3/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             ++  AL L     A+  +SRTL D+ M  RHEQWMA+YG+VYK+  EK KR+NIF+ENV+
Sbjct  9     QISFALVLCLGLWAFQVSSRTLQDASMHERHEQWMARYGKVYKDLQEKEKRFNIFQENVK  68

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYK--LPHECSSNTPFRYENVSSVPTT  434
             YIE+ N AG KPYKLG+N F DLTNKEFIA+RN +K  +    +  T F+YENV++ P+T
Sbjct  69    YIEASNNAGNKPYKLGVNQFTDLTNKEFIATRNKFKGHMSSSITRTTTFKYENVTA-PST  127

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             VDWR++GAVTPVK+QG CGCCWAFSAVAA EGI KLSTGNL+SLSEQELVDCD  G DQG
Sbjct  128   VDWRQEGAVTPVKNQGTCGCCWAFSAVAATEGIHKLSTGNLVSLSEQELVDCDTSGADQG  187

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             C+GGLMDDAF FII N GL TE+ YPYQG DG+C  ++     A I+GYEDVP+N+E AL
Sbjct  188   CQGGLMDDAFKFIIQNGGLNTEAQYPYQGVDGTCNTNEEVTHVATITGYEDVPSNNEQAL  247

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
             ++AVANQP+SVAIDA GSDFQ Y SGVFTG CGT+LDHGV  VGYG+++DGTKYWLVKNS
Sbjct  248   QQAVANQPISVAIDASGSDFQNYQSGVFTGSCGTQLDHGVAVVGYGVSDDGTKYWLVKNS  307

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WG  WGE+GYIRMQ+D+EA EGLCGIAMQ SYP+A
Sbjct  308   WGEDWGEEGYIRMQRDVEAPEGLCGIAMQPSYPTA  342



>ref|XP_007214432.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
 gb|EMJ15631.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
Length=339

 Score =   478 bits (1229),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 239/332 (72%), Positives = 275/332 (83%), Gaps = 3/332 (1%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
               L L+F      ATSR+L D+ M  R+EQWM +YGR+Y +  EK  R+ IFKENV +IE
Sbjct  9     FGLILMFGAWCCEATSRSLQDASMYGRYEQWMTRYGRIYNDVNEKENRFKIFKENVAFIE  68

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSS-VPTTVDW  443
             S N    KPYKLG+N FADLTN+EF ASRNG+K  HECS+ T  F+YENV + VP T+DW
Sbjct  69    SSNNDVNKPYKLGVNQFADLTNEEFKASRNGFK-GHECSTKTTSFKYENVKAPVPATMDW  127

Query  444   RKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEG  623
             RKKGAVTP+KDQGQCGCCWAFSAVAA EGIT+L+TG LISLSEQELVDCD  G DQGCEG
Sbjct  128   RKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEG  187

Query  624   GLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKA  803
             GLMDDAF FI  N GL+TE+NYPY G DGSC   K+++ AAKI+GYEDVPANSE AL  A
Sbjct  188   GLMDDAFQFIQQNHGLSTEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTA  247

Query  804   VANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGT  983
             VA+QPVSVAIDAGGSDFQFYSSGVFTG CGT LDHGVTAVGYG+++DGTK+WLVKNSWGT
Sbjct  248   VAHQPVSVAIDAGGSDFQFYSSGVFTGACGTSLDHGVTAVGYGVSDDGTKFWLVKNSWGT  307

Query  984   SWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              WGE+GYIRMQ+D+EAKEGLCGIAM++SYP+A
Sbjct  308   EWGEEGYIRMQRDVEAKEGLCGIAMEASYPTA  339



>dbj|BAB13759.1| cysteine proteinase [Astragalus sinicus]
Length=343

 Score =   477 bits (1228),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 235/344 (68%), Positives = 275/344 (80%), Gaps = 6/344 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             M  N     I+LAL+      A   TSRTL D+ M  RH+QWM QY ++Y +  E  KR+
Sbjct  1     MGCNKQLYYISLALLMCLGLWAVQVTSRTLQDASMYERHQQWMGQYAKIYNDHQEWEKRF  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRY  407
              IFKENV YIE+ NK G + YKLG+N F DLTN+EFIA RN +K  H CSS      ++Y
Sbjct  61    QIFKENVNYIETSNKEGGRFYKLGVNQFVDLTNEEFIAPRNRFK-GHMCSSIIRTNTYKY  119

Query  408   ENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVD  587
             ENV++VP+ VDWR+KGAVTPVKDQGQCGCCWAFSAVAA EGI +LSTG LISLSEQELVD
Sbjct  120   ENVTTVPSNVDWRQKGAVTPVKDQGQCGCCWAFSAVAATEGIHQLSTGKLISLSEQELVD  179

Query  588   CDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYED  767
             CD KG+DQGCEGGLMDDAF FII N GL TE+ YPYQG DG+C  +++S +AA I+ YED
Sbjct  180   CDTKGVDQGCEGGLMDDAFKFIIQNHGLDTEAKYPYQGVDGTCNANEASINAATITSYED  239

Query  768   VPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDG  947
             VP N+E AL+KAVANQP+SVAIDA GSDFQFY+SGVFTG CGTELDHGVTAVGYG+++DG
Sbjct  240   VPTNNEQALQKAVANQPISVAIDASGSDFQFYTSGVFTGSCGTELDHGVTAVGYGVSDDG  299

Query  948   TKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             TKYWLVKNSWGTSWGE+GYIRMQ+ ++A EGLCGIAMQ+SYP A
Sbjct  300   TKYWLVKNSWGTSWGEEGYIRMQRGVDAVEGLCGIAMQASYPIA  343



>gb|AAA50755.1| cysteine proteinase [Alnus glutinosa]
Length=340

 Score =   477 bits (1227),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 232/332 (70%), Positives = 276/332 (83%), Gaps = 2/332 (1%)
 Frame = +3

Query  87    LIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYI  266
             L+ +  + A ++ LA +R+L D+ M  RHE+WMA YGRVYK+  EK KRY IF+ENV  I
Sbjct  10    LVVMVTLGALASQLAAARSLQDASMRERHEEWMASYGRVYKDINEKQKRYKIFEENVALI  69

Query  267   ESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSSVPTTVDW  443
             ES NK   KPYKL +N FADLTN+EF ASRN +K  H CS+ +T F+Y NVS+VP+ +DW
Sbjct  70    ESSNKDANKPYKLSVNQFADLTNEEFKASRNRFK-GHICSTKSTSFKYGNVSAVPSAMDW  128

Query  444   RKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEG  623
             R KGAVTPVKDQGQCGCCWAFSAVAA EGITKL+TG LISLSEQELVDCD  G+DQGCEG
Sbjct  129   RMKGAVTPVKDQGQCGCCWAFSAVAATEGITKLTTGELISLSEQELVDCDTSGVDQGCEG  188

Query  624   GLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKA  803
             GLMD+AFTFI +N GL +E+NYPY+G DG+C  +K +  AA+I+G+EDVPANSE AL  A
Sbjct  189   GLMDNAFTFIQHNHGLASEANYPYKGVDGTCNTNKQAIHAAEINGFEDVPANSEEALLNA  248

Query  804   VANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGT  983
             VA+QPVSVAIDAGGS FQFYS GVF G CGT+LDHGVTAVGYG ++DGTKYWLVKNSWGT
Sbjct  249   VAHQPVSVAIDAGGSGFQFYSKGVFIGACGTQLDHGVTAVGYGTSDDGTKYWLVKNSWGT  308

Query  984   SWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              WGE+GYIRMQ+D++AKEGLCGIAM++SYP+A
Sbjct  309   QWGEEGYIRMQRDVDAKEGLCGIAMKASYPTA  340



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score =   477 bits (1227),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 239/335 (71%), Positives = 275/335 (82%), Gaps = 5/335 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSL-MAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             L  A  LV  + A  ATSR L ++  M  +HEQWM+ +GRVYK++VEK KR+ IF+ NVE
Sbjct  10    LAFAALLVLVSFASQATSRDLYEAASMVQKHEQWMSHFGRVYKDDVEKAKRFKIFQHNVE  69

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLP--HECSSNTPFRYENVSSVPTT  434
             YIE  NKAGT+PYKLGIN FADL+N+EF  +RNGYK+    + S  T F+Y NV++ P T
Sbjct  70    YIEFVNKAGTRPYKLGINEFADLSNEEFRDTRNGYKMTSHQQLSKTTSFKYANVTA-PAT  128

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWR KGAVT +KDQGQCGCCWAFSAVAA EGI K+ TG LISLSEQELVDCD    D G
Sbjct  129   MDWRTKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSS-DMG  187

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             CEGGLMDDAF FII N GLTTESNYPY+GT+ +CK  K SN AAKI+GYEDVPANSESAL
Sbjct  188   CEGGLMDDAFKFIIKNNGLTTESNYPYEGTNATCKTGKESNHAAKITGYEDVPANSESAL  247

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
              KAVANQP+SVAIDA GSDFQFYS+GVFTGECGTELDHGVTA+GYG   DGT+YWLVKNS
Sbjct  248   LKAVANQPISVAIDASGSDFQFYSTGVFTGECGTELDHGVTAIGYGKTSDGTQYWLVKNS  307

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGTSWGE GYIRMQ+D++A+EGLCGIAMQ+SYP+A
Sbjct  308   WGTSWGENGYIRMQRDVDAEEGLCGIAMQASYPTA  342



>ref|XP_007132275.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
 gb|ESW04269.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
Length=341

 Score =   477 bits (1227),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 234/333 (70%), Positives = 274/333 (82%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
             +AL +VFA  A  A +RTL D+ M  RHEQWM  +G++Y +  EK ++Y IFKENV+ IE
Sbjct  11    LALVIVFAFCALEANARTLQDASMRERHEQWMVTHGKLYLDSSEKEQKYQIFKENVQRIE  70

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS--NTP-FRYENVSSVPTTVD  440
             +FN AG KPYKLGIN FADLTN+EF A RN +K  H CS+   TP F+YE+V+++PT++D
Sbjct  71    AFNNAGNKPYKLGINQFADLTNEEFKA-RNRFK-GHICSTITRTPTFKYEHVTALPTSLD  128

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR+KGAVTP+KDQGQCG CWAFSAVAA EGITKLSTG LISLSEQEL+DCD KG DQGCE
Sbjct  129   WRQKGAVTPIKDQGQCGSCWAFSAVAATEGITKLSTGKLISLSEQELIDCDTKGEDQGCE  188

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI+NNKGLTTE+ YPY+G DG+C     S+ AA I GYEDVPANSESAL K
Sbjct  189   GGLMDDAFKFILNNKGLTTEATYPYEGIDGTCNAKAESSHAASIKGYEDVPANSESALLK  248

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQPVSVAIDA G +FQFY+ GVF G C T LDHGVTAVGYG+++DG+KYWLVKNSWG
Sbjct  249   AVANQPVSVAIDASGYEFQFYAGGVFNGSCDTNLDHGVTAVGYGVSDDGSKYWLVKNSWG  308

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
               WGEKGYIRMQ+D+ AKEGLCGIAM +SYP+A
Sbjct  309   VKWGEKGYIRMQRDVSAKEGLCGIAMLASYPTA  341



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score =   477 bits (1227),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 233/333 (70%), Positives = 274/333 (82%), Gaps = 2/333 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + ++L L+    +  ATSRTL D+ M  R+EQW+ +YGRVY +  EK  R+ IFKENV +
Sbjct  12    MCLSLILMLGAWSSGATSRTLQDASMYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVS-SVPTTVD  440
             IES NK   KPY+L +N FADLTN+EF ASRNG+K  HECS+ T F+YEN++ S+P T+D
Sbjct  72    IESSNKDANKPYRLSVNQFADLTNEEFKASRNGFK-GHECSTKTSFKYENLTASLPATMD  130

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTP+KDQGQCGCCWAFSAVAA EGIT+L+TG LISLSEQELVDCD  G DQGCE
Sbjct  131   WRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCE  190

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N+G++TE+NYPY G DG+C   K ++ AAKI+G+EDVPANSE AL  
Sbjct  191   GGLMDDAFQFIQQNRGISTEANYPYDGVDGTCNAKKEASRAAKITGFEDVPANSEKALLT  250

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLVKNSWG
Sbjct  251   AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  310

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  311   TEWGEAGYIRMQRDVAAGEGLCGIAMAASYPTA  343



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score =   476 bits (1224),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 239/322 (74%), Positives = 271/322 (84%), Gaps = 4/322 (1%)
 Frame = +3

Query  120   AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPY  299
             AY ATSR L ++ +  RHEQWMA++GRVYK++ EK KR+ IFK+N EYI+S N AG KPY
Sbjct  3     AYQATSRDLYEASIVKRHEQWMARFGRVYKDDAEKAKRFKIFKDNTEYIDSVNMAGIKPY  62

Query  300   KLGINAFADLTNKEFIASRNGYKLP-HECSSN-TPFRYENVSSVPTTVDWRKKGAVTPVK  473
             KL +N FADLTN EF  +RNGY++P H+ S   T F+YENV++ P T+DWRKKGAVT +K
Sbjct  63    KLDVNEFADLTNDEFRVTRNGYRMPSHKKSPEITSFKYENVTA-PATMDWRKKGAVTGIK  121

Query  474   DQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFI  653
             DQGQCGCCWAFSAVAA EGI K+ TG LISLSEQELVDCD    D GCEGGLMDDAF FI
Sbjct  122   DQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSS-DMGCEGGLMDDAFKFI  180

Query  654   INNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAI  833
             I N GLTTESNYPY+GTD +CK  K SN AAKI+ YEDVPANSESAL KAVANQPVSVAI
Sbjct  181   IKNHGLTTESNYPYEGTDSTCKTGKESNHAAKITSYEDVPANSESALLKAVANQPVSVAI  240

Query  834   DAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRM  1013
             DA GSDFQFYSSGVFTGECGTELDHGVTAVGYG A DGTKYWLVKNSWGTSWGE GYIRM
Sbjct  241   DASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNSWGTSWGENGYIRM  300

Query  1014  QKDIEAKEGLCGIAMQSSYPSA  1079
             Q++++ +EGLCGIAM++SYP+A
Sbjct  301   QRNVDTEEGLCGIAMEASYPTA  322



>ref|XP_011014442.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=360

 Score =   477 bits (1228),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 239/334 (72%), Positives = 277/334 (83%), Gaps = 5/334 (1%)
 Frame = +3

Query  87    LIALALVFATSAYLATS--RTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
              + LAL+F   A+ + S  RTLLD+ M  RHEQWM QYGRVYK++ E+  RY+IFKENV 
Sbjct  29    FVCLALLFIVGAWPSKSIARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVA  88

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTV  437
              +++FN    K YKLG+N FADLTN+EF ASRN +K  H CS    PFRYENVS+VP+T+
Sbjct  89    RVDAFNSQTGKSYKLGVNQFADLTNEEFKASRNRFK-GHMCSPQAGPFRYENVSAVPSTM  147

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRK+GAVTP KDQGQCGCCWAFSAVAA+EGI KL+TG LI LSEQE+VDCD KG DQGC
Sbjct  148   DWRKEGAVTPAKDQGQCGCCWAFSAVAAIEGINKLTTGKLIFLSEQEVVDCDTKGEDQGC  207

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
              GGLMDDAF FI  NKGLTTE+NYPY+GTDG+C   K++N AAKI+G+E VPANSE+AL 
Sbjct  208   NGGLMDDAFKFIEQNKGLTTEANYPYKGTDGTCNTKKATNHAAKITGFEYVPANSEAALM  267

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
             KAVA QPVSVAIDAGG DFQFYSSG+FTG C T+LDHGVTAVGYG++ DG+KYWLVKNSW
Sbjct  268   KAVAEQPVSVAIDAGGYDFQFYSSGIFTGSCDTQLDHGVTAVGYGVS-DGSKYWLVKNSW  326

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE+GYIRMQKDI AKEGLCGIAMQ+SYP+A
Sbjct  327   GAQWGEEGYIRMQKDIPAKEGLCGIAMQASYPTA  360



>ref|XP_003538185.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   476 bits (1226),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 235/333 (71%), Positives = 271/333 (81%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
             +AL LVFA  A+   +RTL D+ M  RHEQWMA +G+VY +  EK ++Y  FKENV+ IE
Sbjct  13    LALCLVFAFCAFEGNARTLEDAPMRERHEQWMAIHGKVYTHSYEKEQKYQTFKENVQRIE  72

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECS--SNTP-FRYENVSSVPTTVD  440
             +FN AG KPYKLGIN FADLTN+EF A  N +K  H CS  + TP FRYEN+++VP T+D
Sbjct  73    AFNHAGNKPYKLGINHFADLTNEEFKAI-NRFK-GHVCSKITRTPTFRYENMTAVPATLD  130

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR++GAVTP+KDQGQCGCCWAFSAVAA EGITKLSTG LISLSEQELVDCD KG+DQGCE
Sbjct  131   WRQEGAVTPIKDQGQCGCCWAFSAVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCE  190

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI+ NKGL  E+ YPY+G DG+C      N A  I GYEDVPANSESAL K
Sbjct  191   GGLMDDAFKFILQNKGLAAEAIYPYEGVDGTCNAKAEGNHATSIKGYEDVPANSESALLK  250

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQPVSVAI+A G +FQFYS GVFTG CGT LDHGVTAVGYG+++DGTKYWLVKNSWG
Sbjct  251   AVANQPVSVAIEASGFEFQFYSGGVFTGSCGTNLDHGVTAVGYGVSDDGTKYWLVKNSWG  310

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
               WG+KGYIRMQ+D+ AKEGLCGIAM +SYP+A
Sbjct  311   VKWGDKGYIRMQRDVAAKEGLCGIAMLASYPNA  343



>ref|XP_007212667.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
 gb|EMJ13866.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
Length=326

 Score =   476 bits (1224),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 236/319 (74%), Positives = 270/319 (85%), Gaps = 3/319 (1%)
 Frame = +3

Query  129   ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLG  308
             ATSR+L D+ M  R+EQWM +YGRVY +  EK  R+ IFKENV +IES N    KPYKLG
Sbjct  9     ATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNNDVNKPYKLG  68

Query  309   INAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSS-VPTTVDWRKKGAVTPVKDQG  482
             +N FADLTN+EF ASRNG+K  HECS+ T  F+YEN+ + VP T+DWRKKGAVTP+KDQG
Sbjct  69    VNQFADLTNEEFKASRNGFK-GHECSTKTTSFKYENIKAPVPATMDWRKKGAVTPIKDQG  127

Query  483   QCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINN  662
             QCGCCWAFSAVAA EGIT+L+TG LISLSEQELVDCD  G DQGCEGGLMDDAF FI  N
Sbjct  128   QCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFQFIQQN  187

Query  663   KGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAG  842
              GL+ E+NYPY G DGSC   K+++ AAKI+GYEDVPANSE AL  AVA+QPVSVAIDAG
Sbjct  188   HGLSAEANYPYNGVDGSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAG  247

Query  843   GSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKD  1022
             GSDFQFYSSGVFTG CGT LDHGVTAVGYG+++DGTKYWLVKNSWGT WGE+GYIRMQ+D
Sbjct  248   GSDFQFYSSGVFTGSCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWGTEWGEEGYIRMQRD  307

Query  1023  IEAKEGLCGIAMQSSYPSA  1079
             +EAKEGLCGIAM++SYP+A
Sbjct  308   VEAKEGLCGIAMEASYPTA  326



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score =   476 bits (1225),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 239/340 (70%), Positives = 278/340 (82%), Gaps = 3/340 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             MAS S  L  AL  +    A  A+SR++ +  M+ R EQW+A  GRVY++  EK KR  I
Sbjct  1     MASTSRSL--ALLFIVGIWACQASSRSVPEVSMSDRFEQWLASCGRVYQDASEKEKRLQI  58

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKL-PHECSSNTPFRYENVS  419
             FKENVEYIES N   +K YKLG+N F DLTN+EF A RNGYKL P   S  + FRYENV+
Sbjct  59    FKENVEYIESHNADTSKKYKLGVNEFTDLTNEEFKAMRNGYKLRPSTSSKKSSFRYENVA  118

Query  420   SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVK  599
             +VP+++DWRKKGAVT +KDQGQCGCCWAFSAVAAMEGI +L TG LISLSEQELVDCD+ 
Sbjct  119   AVPSSMDWRKKGAVTNIKDQGQCGCCWAFSAVAAMEGINQLKTGKLISLSEQELVDCDIN  178

Query  600   GIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPAN  779
             G DQGC GG MD+AF FII+NKGLTTESNYPY+G DGSC K K++N AA+I+ +EDVP+N
Sbjct  179   GEDQGCNGGFMDNAFEFIISNKGLTTESNYPYEGVDGSCNKKKAANHAAQITSFEDVPSN  238

Query  780   SESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYW  959
             SE+AL KAVANQPVSVAIDAGGSDFQ Y SG+FTGEC T LDHGVTAVGYG A+DGTKYW
Sbjct  239   SEAALLKAVANQPVSVAIDAGGSDFQHYKSGIFTGECSTFLDHGVTAVGYGTADDGTKYW  298

Query  960   LVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             LVKNSWGTSWGE GYIRMQ+DI+A+EGLCGIAM++SYP+A
Sbjct  299   LVKNSWGTSWGEDGYIRMQRDIDAEEGLCGIAMEASYPTA  338



>gb|KDP23984.1| hypothetical protein JCGZ_25372 [Jatropha curcas]
Length=340

 Score =   476 bits (1225),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 235/333 (71%), Positives = 278/333 (83%), Gaps = 3/333 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             +  A  L+    AY A +R+L D+ M  RHE+WMA+YG VYK+  EK  R+ IF ENVE 
Sbjct  10    ICFAFILILVALAYQAEARSLPDASMYERHEEWMAKYGIVYKDANEKEMRHKIFNENVER  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTVD  440
             IE FN+A  KPYKLGIN FADLTN+EF  SRN +K  H CS    PFRYENV++VP+++D
Sbjct  70    IEYFNRAANKPYKLGINQFADLTNEEFKTSRNRFK-GHMCSPQAGPFRYENVTAVPSSMD  128

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTP+KDQGQCG CWAFSAVAA+EGIT+L+T  LISLSEQELVDCD KG DQGC+
Sbjct  129   WRKKGAVTPIKDQGQCGSCWAFSAVAAVEGITQLTTQKLISLSEQELVDCDTKGEDQGCQ  188

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N+GLTTE+NYPY+G+DG+C  +K +N AAKI+GYEDVPAN+E+AL K
Sbjct  189   GGLMDDAFKFIETNQGLTTEANYPYEGSDGTCNSNKEANHAAKITGYEDVPANNEAALLK  248

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVA QPVSVAIDAGG +FQFYSSG+FTG+CGTELDHGV AVGYG+++ GT YWLVKNSWG
Sbjct  249   AVAKQPVSVAIDAGGYEFQFYSSGIFTGDCGTELDHGVAAVGYGVSQ-GTNYWLVKNSWG  307

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGE+GYIRMQ+DI+AKEGLCGIAMQ+SYP+A
Sbjct  308   TQWGEEGYIRMQRDIDAKEGLCGIAMQASYPTA  340



>gb|AFV30165.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   475 bits (1222),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 225/335 (67%), Positives = 272/335 (81%), Gaps = 3/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             ++  AL L     A+  +SRTL D+ M  RHEQWMA+YGRVYK+  EK KR++IFKENV 
Sbjct  9     QVSFALVLCLGLWAFQVSSRTLQDASMQERHEQWMARYGRVYKDLQEKEKRFSIFKENVN  68

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYK--LPHECSSNTPFRYENVSSVPTT  434
             YIE+ N AG KPYKLG+N FADLTN+EFIA+RN +K  +    +  T F+YENV++ P+T
Sbjct  69    YIEASNNAGDKPYKLGVNQFADLTNEEFIATRNKFKGHMSSSITRTTTFKYENVTA-PST  127

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             VDWR++GAVTPVK+QG CGCCWAFSAVAA EGI KLSTGNL+SLSEQELVDCD  G DQG
Sbjct  128   VDWRQEGAVTPVKNQGTCGCCWAFSAVAATEGIHKLSTGNLVSLSEQELVDCDTSGADQG  187

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             C+GGLMDDAF FII N GL TE+ YPYQG DG+C  ++ +   A I+GYEDVP+N+E AL
Sbjct  188   CQGGLMDDAFKFIIQNGGLNTEAQYPYQGVDGTCNTNEEATHVATITGYEDVPSNNEQAL  247

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
             ++AVANQP+S+AIDA GSDFQ Y SGVFTG CGT+LDHGV  VGYG+++DGTKYWLVKNS
Sbjct  248   QQAVANQPISIAIDASGSDFQNYQSGVFTGSCGTQLDHGVAVVGYGVSDDGTKYWLVKNS  307

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WG  WGE+GYIRMQ+D++A EGLCG+AMQ SYP+A
Sbjct  308   WGADWGEEGYIRMQRDVDAPEGLCGLAMQPSYPTA  342



>ref|XP_011038210.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   475 bits (1222),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 228/335 (68%), Positives = 268/335 (80%), Gaps = 2/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             +   A+ L+  T A   T R L +  M+ RHEQWMA +G+VY +  EK +R+ IFK+NVE
Sbjct  8     QCFFAIFLILGTWACQVTPRELQEPSMSARHEQWMATFGKVYADAAEKERRFEIFKDNVE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYENVSSVPTT  434
             YIESFN AG KPYKL +N FADLTN+E   +RNGY+ P +      T F YENV++VP T
Sbjct  68    YIESFNTAGNKPYKLSVNKFADLTNEELKIARNGYRRPLQTRPMKVTSFEYENVTAVPAT  127

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWRKKGAVTP+KDQGQCG CWAFS VAA EGI +L+TG L+SLSEQELVDCD +G DQG
Sbjct  128   MDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDTQGEDQG  187

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             CEGGLM+D F FII N G+T+E+NYPYQ  DG+C   K ++  AKI+GYE VPANSE+AL
Sbjct  188   CEGGLMEDGFEFIIKNHGITSEANYPYQAADGTCNSKKEASHIAKITGYESVPANSEAAL  247

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
              KAVANQP+SV+IDAGGSDFQFYSSGVFTG+CGTELDHGVTAVGYG   DGTKYWL KNS
Sbjct  248   LKAVANQPISVSIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGETSDGTKYWLFKNS  307

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGTSWGE GYIRMQ+DI+A+EGLCGIAM SSYP+A
Sbjct  308   WGTSWGEAGYIRMQRDIDAEEGLCGIAMDSSYPTA  342



>gb|EYU25679.1| hypothetical protein MIMGU_mgv1a023356mg, partial [Erythranthe 
guttata]
Length=347

 Score =   475 bits (1222),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 270/336 (80%), Gaps = 4/336 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             + ++A  LV       AT+RTL D+ +  RHEQWM QYGR YKN+ EK KR+NIFK+NVE
Sbjct  13    RFILAAVLVLQMWVSQATARTLPDASIVERHEQWMVQYGRTYKNDAEKAKRFNIFKDNVE  72

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKL---PHECSSNTPFRYENVSSVPT  431
             YI+S N+  T+ YKL IN FADLTN+EF ASRNGYK+       S  + + Y NVS+VP 
Sbjct  73    YIQSVNETETRAYKLAINKFADLTNEEFQASRNGYKMRSQSKSSSKVSSYMYANVSAVPP  132

Query  432   TVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQ  611
             ++DW KKGAVTPVKDQGQCGCCWAFSAVAA EGI +L+TGNL+SLSEQELVDCD    DQ
Sbjct  133   SMDWTKKGAVTPVKDQGQCGCCWAFSAVAATEGINQLTTGNLVSLSEQELVDCDTSE-DQ  191

Query  612   GCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESA  791
             GC GGLMD AF FII+N GLTTESNYPY+G DG+C   K S+  AKI+GYEDVP+NSESA
Sbjct  192   GCNGGLMDYAFEFIISNNGLTTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPSNSESA  251

Query  792   LEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKN  971
             L KAV NQP+SVAIDA GSDFQFYSSGVFTG+CGTELDHGVT VGYG+  D TKYWLVKN
Sbjct  252   LLKAVVNQPISVAIDASGSDFQFYSSGVFTGQCGTELDHGVTVVGYGVTSDETKYWLVKN  311

Query  972   SWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             SWGTSWGE GYIRMQ+DI+  EGLCGIAMQ+SYP+A
Sbjct  312   SWGTSWGENGYIRMQRDIDTVEGLCGIAMQASYPTA  347



>ref|XP_007132865.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
 gb|ESW04859.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
Length=344

 Score =   474 bits (1221),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 231/345 (67%), Positives = 272/345 (79%), Gaps = 7/345 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATS--AYLATSRTLLDSL-MAVRHEQWMAQYGRVYKNEVEKTKR  233
             M S +    I+LAL+F      +  T RTL D + M  RHE+WM +YG VYK+  E+ KR
Sbjct  1     MVSKNQFYHISLALLFCMGFWGFQVTCRTLQDDVSMYERHEEWMTRYGSVYKDPEEREKR  60

Query  234   YNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFR  404
             + IFK+NV YIE+FN A  KPY+LG N FADLTN+EFIA RN +K  H CSS    T F+
Sbjct  61    FRIFKKNVNYIETFNNAANKPYQLGTNQFADLTNEEFIAGRNRFK-GHMCSSILRTTTFK  119

Query  405   YENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELV  584
             YENV+++P+TVDWR+KGAVTPVKDQGQCGCCWAFSAVAA EGI  L++G LISLSEQELV
Sbjct  120   YENVTTIPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVAATEGIHALTSGKLISLSEQELV  179

Query  585   DCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYE  764
             DCD KG+DQGCEGG MD AF FII N G+ TE NYPY+G DG C     + + A I+GYE
Sbjct  180   DCDTKGVDQGCEGGFMDGAFKFIIKNHGINTEVNYPYKGVDGKCNAKAEAVNGATITGYE  239

Query  765   DVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAED  944
             DVP N+ESALEKAV++QPVSVAIDA GSDFQFY SGVF+G CGTELDHGVTAVGYG+++D
Sbjct  240   DVPVNNESALEKAVSSQPVSVAIDASGSDFQFYKSGVFSGSCGTELDHGVTAVGYGVSDD  299

Query  945   GTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G KYWLVKNSWGT WGE+GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  300   GKKYWLVKNSWGTEWGEEGYIRMQRDVAAAEGLCGIAMMASYPTA  344



>gb|KHN32069.1| Vignain [Glycine soja]
Length=333

 Score =   474 bits (1220),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 230/330 (70%), Positives = 272/330 (82%), Gaps = 11/330 (3%)
 Frame = +3

Query  120   AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPY  299
             A+  T R+L D+ M  RHEQWM +YG+VYK+  E+ KR+ IFKENV YIE+FN A  K Y
Sbjct  5     AFQVTCRSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRY  64

Query  300   KLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTTVDWRKKGAVTPV  470
             KL IN FADLTN+EFIA RN +K  H CSS    T F+YENV++VP+TVDWR+KGAVTP+
Sbjct  65    KLAINQFADLTNEEFIAPRNRFK-GHMCSSIIRTTTFKYENVTAVPSTVDWRQKGAVTPI  123

Query  471   KDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTF  650
             KDQGQCGCCWAFSAVAA EGI  L++G LISLSEQELVDCD KG+DQGCEGGLMDDAF F
Sbjct  124   KDQGQCGCCWAFSAVAATEGIHALTSGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKF  183

Query  651   IINNKGLTTESNYPYQGTDGsck-------kskssnsaakisGYEDVPANSESALEKAVA  809
             +I N GL TE+NYPY+G DG+ +        ++++N AA I+GYEDVPAN+E AL+KAVA
Sbjct  184   VIQNHGLNTEANYPYKGVDGNQRCCYYYWVLNEAANDAATITGYEDVPANNEKALQKAVA  243

Query  810   NQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSW  989
             NQPVSVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG++ DGT+YWLVKNSWGT W
Sbjct  244   NQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTEYWLVKNSWGTEW  303

Query  990   GEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GE+GYIRMQ+ + ++EGLCGIAMQ+SYP+A
Sbjct  304   GEEGYIRMQRGVNSEEGLCGIAMQASYPTA  333



>ref|XP_002307151.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
 gb|EEE94147.2| hypothetical protein POPTR_0005s09140g, partial [Populus trichocarpa]
Length=309

 Score =   473 bits (1217),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 236/311 (76%), Positives = 260/311 (84%), Gaps = 3/311 (1%)
 Frame = +3

Query  150   DSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADL  329
             D  M  RHEQWMAQYGRVYK++ EK  RYNIFKENV  I++FN    K Y LG+N FADL
Sbjct  1     DVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVARIDAFNSQTGKSYNLGVNQFADL  60

Query  330   TNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAF  506
             TN+EF ASRN +K  H CS    PFRYENVS+VP T+DWRKKGAVTPVKDQGQCGCCWAF
Sbjct  61    TNEEFKASRNRFK-GHMCSPQAGPFRYENVSAVPATMDWRKKGAVTPVKDQGQCGCCWAF  119

Query  507   SAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESN  686
             SAVAAMEGI +L+TG LISLSEQE+VDCD KG DQGC GGLMDDAF FI  NKGLTTE+N
Sbjct  120   SAVAAMEGINQLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEQNKGLTTEAN  179

Query  687   YPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYS  866
             YPY GTDG+C   K  + AAKI+G++DVPANSE+AL KAVA QPVSVAIDAGG +FQFYS
Sbjct  180   YPYTGTDGTCNTQKEVSHAAKITGFQDVPANSEAALMKAVAKQPVSVAIDAGGFEFQFYS  239

Query  867   SGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLC  1046
             SG+FTG CGTELDHGVTAVGYG   DGTKYWLVKNSWG  WGE+GYIRMQKDI AKEGLC
Sbjct  240   SGIFTGSCGTELDHGVTAVGYG-GSDGTKYWLVKNSWGAQWGEEGYIRMQKDISAKEGLC  298

Query  1047  GIAMQSSYPSA  1079
             GIAMQ+SYP+A
Sbjct  299   GIAMQASYPTA  309



>ref|XP_008228868.1| PREDICTED: LOW QUALITY PROTEIN: zingipain-2-like [Prunus mume]
Length=345

 Score =   474 bits (1220),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 241/345 (70%), Positives = 275/345 (80%), Gaps = 7/345 (2%)
 Frame = +3

Query  51    RLSTMASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTK  230
             RL   A   L L++   ++    +  ATSR+L D+ M  RHEQWMA+YGR Y +  EK K
Sbjct  6     RLQGKACVCLALIL---IMLGACSSEATSRSLQDASMYGRHEQWMARYGRTYNDIREKEK  62

Query  231   RYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRY  407
             R+NIFKENV  IES N    K YKL +N FADLTN EF ASRN +K  HECS+ T  F+Y
Sbjct  63    RFNIFKENVX-IESSNDDANKLYKLSVNQFADLTNDEFKASRNRFK-GHECSTKTTSFKY  120

Query  408   ENVS-SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELV  584
             ENV+ SVPTT+DWRKKGAVTP+KDQGQCGCCWAFSAVAA EGIT+L+TG LISLSEQELV
Sbjct  121   ENVTASVPTTMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELV  180

Query  585   DCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYE  764
             DCD  G DQGCEGGLMDDAF FI  N GL+TE+NYPY G DG+C   K ++ AAKI+GYE
Sbjct  181   DCDTNGEDQGCEGGLMDDAFQFIQQNHGLSTEANYPYSGVDGTCNTKKEASIAAKITGYE  240

Query  765   DVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAED  944
             DVP NSE AL KAVANQPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG+ +D
Sbjct  241   DVPTNSEQALLKAVANQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVGDD  300

Query  945   GTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GTK+WLVKNSWGT WGE+GYIRMQ+D++A EGLCGIAM +SYP+A
Sbjct  301   GTKFWLVKNSWGTEWGEEGYIRMQRDVDAAEGLCGIAMSASYPTA  345



>ref|XP_004297571.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   474 bits (1220),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 235/332 (71%), Positives = 272/332 (82%), Gaps = 3/332 (1%)
 Frame = +3

Query  87    LIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYI  266
             L  + L+F   +  ATSRTL D+ M  R+EQWMA+YGRVY +  EK KR+ IFK NV  +
Sbjct  12    LALILLMFGAWSSEATSRTLQDASMYGRYEQWMARYGRVYNDINEKEKRFQIFKANVAIV  71

Query  267   ESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSSVPTTVDW  443
             ES N   +KPYKL +N FADLTN+EFI SRN +K  HECS+  T F+YENV+ VP TVDW
Sbjct  72    ESSNNDASKPYKLSVNQFADLTNEEFITSRNRFK-GHECSTKTTSFKYENVT-VPATVDW  129

Query  444   RKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEG  623
             R+KGAVTPVKDQGQCGCCWAFSAVAAMEGIT+L+TG LISLSEQELVDCDV G DQGCEG
Sbjct  130   RQKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCEG  189

Query  624   GLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKA  803
             GLMD+AF FI  N GL+TE+NYPY G DG+C   K ++ AA I+G+EDVPANSESAL KA
Sbjct  190   GLMDNAFDFINQNHGLSTEANYPYTGVDGTCNAQKEASHAASITGHEDVPANSESALLKA  249

Query  804   VANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGT  983
             VANQP+SVAIDA GSDFQ YSSGVFTG CGT LDHGVTAVGYG+++DGT+YWLVKNSWG 
Sbjct  250   VANQPISVAIDASGSDFQLYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTQYWLVKNSWGA  309

Query  984   SWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              WGE+GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  310   QWGEEGYIRMQRDVTAPEGLCGIAMAASYPTA  341



>gb|KDP21078.1| hypothetical protein JCGZ_21549 [Jatropha curcas]
Length=326

 Score =   473 bits (1218),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 232/317 (73%), Positives = 264/317 (83%), Gaps = 2/317 (1%)
 Frame = +3

Query  135   SRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGIN  314
             SR+L ++ +  RHE WMAQ+ RVYK+  EK  R+ IF+ENV++IESFNKAG K YKLGIN
Sbjct  10    SRSLYEASLEERHEIWMAQHERVYKDATEKEMRFQIFRENVKFIESFNKAGNKSYKLGIN  69

Query  315   AFADLTNKEFIASRNGYKLPHECSS--NTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQC  488
             AF DLTNKEF ASRNGYK     SS     F+YENV+++P+++DWR KG VTP+KDQGQC
Sbjct  70    AFTDLTNKEFRASRNGYKRSSYSSSSGTNSFKYENVTTIPSSLDWRSKGVVTPIKDQGQC  129

Query  489   GCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKG  668
             GCCWAFSAVAAMEGITKLST  LISLSEQEL+DCD  GIDQGCEGGLMDDAF FII N G
Sbjct  130   GCCWAFSAVAAMEGITKLSTEKLISLSEQELIDCDTSGIDQGCEGGLMDDAFEFIIQNNG  189

Query  669   LTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGS  848
             LTTE+NYPYQ  DG+C   K++N AA I+ YEDVP N+E AL  AVANQPVSVAIDAG S
Sbjct  190   LTTEANYPYQAEDGTCNTEKAANHAATITSYEDVPENNEEALRMAVANQPVSVAIDAGES  249

Query  849   DFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIE  1028
              FQ YSSG+FTG+CGTELDHGVT VGYG ++DGTKYWLVKNSWGTSWGE GYIRMQ+DI+
Sbjct  250   AFQHYSSGIFTGDCGTELDHGVTVVGYGTSDDGTKYWLVKNSWGTSWGEDGYIRMQRDID  309

Query  1029  AKEGLCGIAMQSSYPSA  1079
             AKEGLCGIAMQ SYP+A
Sbjct  310   AKEGLCGIAMQPSYPTA  326



>ref|XP_010099379.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB78104.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=348

 Score =   474 bits (1220),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 238/339 (70%), Positives = 275/339 (81%), Gaps = 7/339 (2%)
 Frame = +3

Query  78    LKLLIALALVFATSAYLATSRTLLD-SLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKEN  254
             L L+I+L   +A     ATSR+L D S + +RHE+WM+++G VYK+  EK KR+ IFKEN
Sbjct  12    LALVISLG-TWAKYNVEATSRSLQDASTLKIRHEEWMSRHGIVYKDADEKAKRFEIFKEN  70

Query  255   VEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS----NTPFRYENVSS  422
             V  IE+FN+A  KPYKLGIN FADLTN+EFI  RN +K  H C S    +T F+YENV+S
Sbjct  71    VARIEAFNRAAIKPYKLGINKFADLTNEEFITKRNKFK-AHVCDSGRAISTSFKYENVTS  129

Query  423   VPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKG  602
             VP+ +DWRKKGAVTPVKDQGQCGCCWAFS VAAMEGITKLSTG L+SLSEQELVDCDVKG
Sbjct  130   VPSALDWRKKGAVTPVKDQGQCGCCWAFSTVAAMEGITKLSTGKLLSLSEQELVDCDVKG  189

Query  603   IDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANS  782
              DQGC GGLMD+AF FI +N GLTTE+NYPY+G DG+C   K +  AAKI+GYEDVPANS
Sbjct  190   EDQGCNGGLMDEAFKFIQHNGGLTTEANYPYEGVDGTCNAKKEATHAAKITGYEDVPANS  249

Query  783   ESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWL  962
             E  L KAV +QPVSVAIDA G +FQFYS GVFTG CGT LDHGVTAVGYG  +DGTKYWL
Sbjct  250   EKDLLKAVTHQPVSVAIDASGFEFQFYSGGVFTGACGTNLDHGVTAVGYGATKDGTKYWL  309

Query  963   VKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             VKNSWG  WGEKGYIRMQ+D++AKEGLCGIAM +SYP+A
Sbjct  310   VKNSWGKQWGEKGYIRMQRDVDAKEGLCGIAMMASYPTA  348



>ref|XP_006376431.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
 gb|ERP54228.1| hypothetical protein POPTR_0013s12980g [Populus trichocarpa]
Length=342

 Score =   474 bits (1219),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 227/335 (68%), Positives = 267/335 (80%), Gaps = 2/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             +   A  L+    A+   SR L +S M+ RHEQWMA YG+VY +  EK +R+ IFK NVE
Sbjct  8     QCFFAFILILGMWAFEVASRELQESYMSARHEQWMATYGKVYVDAAEKERRFKIFKNNVE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYENVSSVPTT  434
             YIESFN AG KPYKL +N FAD TN++F  +RNGY+ P +      T F+YENV++VP T
Sbjct  68    YIESFNTAGNKPYKLSVNKFADQTNEKFKGARNGYRRPFQTRPMKVTSFKYENVTAVPAT  127

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWRKKGAVTP+KDQGQCG CWAFS VAA EGI +L+TG L+SLSEQELVDCD +G DQG
Sbjct  128   MDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDNQGEDQG  187

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             CEGGLM+D F FII N G+TTE+NYPYQ  DG+C   K ++  AKI+GYE VPANSE+ L
Sbjct  188   CEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSKKQASHIAKITGYESVPANSEAEL  247

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
              K VANQP+SV+IDAGGSDFQFYSSGVFTG+CGTELDHGVTAVGYG   DGTKYWLVKNS
Sbjct  248   LKVVANQPISVSIDAGGSDFQFYSSGVFTGKCGTELDHGVTAVGYGETSDGTKYWLVKNS  307

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGTSWGE+GYIRMQ+DI+ +EGLCGIAM SSYP+A
Sbjct  308   WGTSWGEEGYIRMQRDIDTEEGLCGIAMDSSYPTA  342



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score =   474 bits (1219),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 239/343 (70%), Positives = 279/343 (81%), Gaps = 6/343 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MAS +    +A   +     ++  ATSR L ++ +  +H+QWM+ +GRVYK+++EK KR+
Sbjct  1     MASLTFNWKVAFGALLVLEMFVSQATSRDLYEASIFQKHKQWMSLFGRVYKDDIEKAKRF  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKL--PHECSSNTPFRYE  410
              IFK+N EYIE  NK GT+PY LGIN FADL+N+EF ASRNGYK+    + S +T F+YE
Sbjct  61    KIFKDNFEYIEFVNKVGTRPYILGINEFADLSNEEFKASRNGYKMYSHQQLSKSTSFKYE  120

Query  411   NVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDC  590
             NV++ P T+DWR KGAVT +KDQGQCGCCWAFSAVAA EGI K+ TG LISLSEQELVDC
Sbjct  121   NVTA-PATMDWRTKGAVTGIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDC  179

Query  591   DVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDV  770
             D +  D GCEGGLMDDAF FII N GLTTESNYPY+GTD +CK  K SN AAKI+GYEDV
Sbjct  180   DTRS-DMGCEGGLMDDAFKFIIKNNGLTTESNYPYEGTDATCKTGKESNHAAKITGYEDV  238

Query  771   PANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGT  950
             P NSESAL KAVANQP+SVAIDA GSDFQFYSSGVFTG+CGTELDHGVTAVGYG   DGT
Sbjct  239   PDNSESALLKAVANQPISVAIDASGSDFQFYSSGVFTGKCGTELDHGVTAVGYGKIGDGT  298

Query  951   KYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             KYWLVKNSWGTSWGE GYIRMQ+D++A+EGLCGIAMQ+SYPSA
Sbjct  299   KYWLVKNSWGTSWGENGYIRMQRDVDAEEGLCGIAMQASYPSA  341



>ref|XP_003605890.1| Cysteine proteinase [Medicago truncatula]
 gb|AES88087.1| papain family cysteine protease [Medicago truncatula]
Length=343

 Score =   474 bits (1219),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 265/324 (82%), Gaps = 6/324 (2%)
 Frame = +3

Query  120   AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKA-GTKP  296
             A   TSRTL D  M  RH QWM+QYG+VYK+  E+ KR+ IF ENV YIE+FNK    K 
Sbjct  22    AIQVTSRTLQDD-MYERHRQWMSQYGKVYKDSQEREKRFKIFTENVNYIEAFNKGDNNKL  80

Query  297   YKLGINAFADLTNKEFIASRNGYKLPHECSSNT---PFRYENVSSVPTTVDWRKKGAVTP  467
             Y LG+N FADLTN EF +SRN +K  H CSS T    F+YEN S++P++VDWRKKGAVTP
Sbjct  81    YTLGVNQFADLTNDEFTSSRNKFK-GHMCSSITRTSTFKYENASAIPSSVDWRKKGAVTP  139

Query  468   VKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFT  647
             VK+QGQCGCCWAFSAVAA EGI KLSTG LISLSEQELVDCD KG+DQGCEGGLMDDAF 
Sbjct  140   VKNQGQCGCCWAFSAVAATEGIHKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFK  199

Query  648   FIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSV  827
             FII N GL TE+NYPYQG DG+C  +K S +A  I+GYEDVP N+E AL+KAVANQP+SV
Sbjct  200   FIIQNHGLNTEANYPYQGVDGTCNANKGSINAVTITGYEDVPTNNEQALQKAVANQPISV  259

Query  828   AIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYI  1007
             AIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG++ DGTKYWLVKNSWGT WGE+GYI
Sbjct  260   AIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSNDGTKYWLVKNSWGTEWGEEGYI  319

Query  1008  RMQKDIEAKEGLCGIAMQSSYPSA  1079
              MQ+ ++A EGLCGIAMQ+SYP+A
Sbjct  320   MMQRGVDAAEGLCGIAMQASYPTA  343



>ref|XP_004303175.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   473 bits (1218),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 232/333 (70%), Positives = 275/333 (83%), Gaps = 3/333 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + +AL ++    +  ATSR+L D +M  R+EQWMA+Y RVY +  EK KR+ IFKENV +
Sbjct  10    IYLALIIMLGAWSSEATSRSLQDVIMYGRYEQWMARYERVYSDFDEKEKRFQIFKENVAF  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSSVPTTVD  440
             +ES N    KPYKL +N FADLTN+EF ASRN +K  HECS+  T ++YENV+ VP T+D
Sbjct  70    VESSNGEANKPYKLSVNRFADLTNEEFTASRNRFK-GHECSTETTSYKYENVT-VPATMD  127

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR+KGAVTP+KDQGQCGCCWAFSAVAAMEGIT+L+TG LISLSEQELVDCDV G DQGCE
Sbjct  128   WRQKGAVTPIKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGCE  187

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N GL+TE+NYPY G DG+C   K ++ AA I+G+EDVPANSESAL K
Sbjct  188   GGLMDDAFQFINQNHGLSTEANYPYTGVDGTCNAQKEASHAASITGHEDVPANSESALLK  247

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++++GTKYWLVKNSWG
Sbjct  248   AVANQPISVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDNGTKYWLVKNSWG  307

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
               WGE GYIRMQ+D++A+EGLCGIAM +SYP+A
Sbjct  308   AEWGEGGYIRMQRDVDAQEGLCGIAMAASYPTA  340



>ref|XP_009357172.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=343

 Score =   473 bits (1218),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 230/333 (69%), Positives = 272/333 (82%), Gaps = 2/333 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + ++L L+    +  ATSRTL D+ M  R+EQW+ +YGR+Y +  EK  R+ IFKENV +
Sbjct  12    MCLSLILMLGAWSSGATSRTLQDARMYGRYEQWLTRYGRIYNDVNEKETRFKIFKENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVS-SVPTTVD  440
             IES NK   KPY+L +N FADLTN+EF  SRNG+K  HECS+ T F+YEN++ S+P T+D
Sbjct  72    IESSNKDANKPYRLSVNQFADLTNEEFKTSRNGFK-GHECSTKTSFKYENLTASLPATMD  130

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTP+KDQGQCGCCWAFSAVAA EGIT+L+TG LISLSEQELVDCD  G DQGCE
Sbjct  131   WRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGCE  190

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N+G++TE+NYPY G DG+C   K ++ AAKI+G+EDVPANSE AL  
Sbjct  191   GGLMDDAFQFIQQNRGISTEANYPYDGVDGTCNAKKEASRAAKITGFEDVPANSEKALLT  250

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLVKNSWG
Sbjct  251   AVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWG  310

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
               WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  311   AEWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  343



>ref|XP_010045988.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   473 bits (1218),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 236/343 (69%), Positives = 280/343 (82%), Gaps = 5/343 (1%)
 Frame = +3

Query  63    MASNSL-KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYN  239
             MAS  + KL++ +  +    A  A SR L  + M  RHEQ MA++GRVY+++ EK +R++
Sbjct  1     MASTLVGKLVLVMVAILGLWASQARSRELHGATMWERHEQRMARHGRVYQDDAEKERRFS  60

Query  240   IFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKL---PHECSSNTPFRYE  410
             IFK NV++IESFNK G KPY L INAF DLT +EF ASRNGYK    P + S+  PFRYE
Sbjct  61    IFKNNVDFIESFNKDGNKPYTLAINAFVDLTIEEFKASRNGYKRSSSPRQVSTK-PFRYE  119

Query  411   NVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDC  590
             +V++VP+++DWRKKGAV P+KDQGQCG CWAFSAV AMEG  +L+TG LISLSEQELVDC
Sbjct  120   HVTAVPSSMDWRKKGAVMPIKDQGQCGSCWAFSAVGAMEGNNQLTTGKLISLSEQELVDC  179

Query  591   DVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDV  770
             D  G DQGCEGG MD+AF FII N GLTTE+NYPYQ  DG+C   K ++SAAKI+GYEDV
Sbjct  180   DTSGEDQGCEGGFMDNAFEFIIGNHGLTTETNYPYQAVDGTCNARKEASSAAKINGYEDV  239

Query  771   PANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGT  950
             PANSESAL KAVA+QPVSVAIDAG S FQFYSSG+FTGECGT LDHGVTAVGYG +EDGT
Sbjct  240   PANSESALLKAVAHQPVSVAIDAGESAFQFYSSGIFTGECGTNLDHGVTAVGYGTSEDGT  299

Query  951   KYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             KYWLVKNSWGT WGE+GYIRM++DI+AKEGLCGIAM++SYP+A
Sbjct  300   KYWLVKNSWGTGWGEEGYIRMKRDIDAKEGLCGIAMEASYPTA  342



>ref|XP_009344439.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
 ref|XP_009344444.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   473 bits (1216),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 233/334 (70%), Positives = 274/334 (82%), Gaps = 3/334 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + ++L L+  T +  ATSRTL D+ M  R+EQW+ +YGRVY +  EK  R+ IFKENV +
Sbjct  1     MCLSLILMLGTWSSGATSRTLQDAPMYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAF  60

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVS-SVPTTV  437
             IES NK   KPYKL +N FADLTN+EF AS+NG+K  HECS+  T F+YENV+ S+P T+
Sbjct  61    IESSNKYANKPYKLSVNQFADLTNEEFKASKNGFK-GHECSTKTTSFKYENVTASLPATM  119

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVTP+KDQGQCGCCWAFSAVAA EGIT+L+TG L+SLSEQELVDCD  G DQGC
Sbjct  120   DWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLMSLSEQELVDCDTAGEDQGC  179

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMDDAF FI  N G++TE+NYPY+G DG+C   K ++ AAKI+G+EDVPANSE AL 
Sbjct  180   EGGLMDDAFQFIQQNHGISTEANYPYEGVDGTCNTKKETSHAAKITGFEDVPANSEKALL  239

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
              AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLVKNSW
Sbjct  240   AAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSW  299

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  300   GAEWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  333



>ref|XP_006446763.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
 gb|ESR60003.1| hypothetical protein CICLE_v10017432mg [Citrus clementina]
Length=343

 Score =   473 bits (1216),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 231/341 (68%), Positives = 275/341 (81%), Gaps = 2/341 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             +   SL  L  + L+FAT+    TSR L ++ ++ +HEQWM++YG+VYKN  EK KR+ I
Sbjct  3     LRCQSLCKLALIFLIFATATSQVTSRKLQEASLSEKHEQWMSKYGKVYKNPEEKEKRFRI  62

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYENV  416
             FK+NVE+IES N AG KPYKL +N FAD TN+EF A RNGY+ P+  +S   T F+YENV
Sbjct  63    FKDNVEFIESLNAAGNKPYKLSVNEFADQTNQEFKAFRNGYRRPNGLASRKGTSFKYENV  122

Query  417   SSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDV  596
               VP T+DWRK GAVTP+K+QG CG CWAFSAVAA EGIT+L+TG LISLSEQELV CD 
Sbjct  123   IDVPATMDWRKNGAVTPIKNQGPCGSCWAFSAVAATEGITQLTTGKLISLSEQELVSCDT  182

Query  597   KGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPA  776
              G+D GCEGG M+DAF FII+N G+TTE+NYPYQ  DG+C K+K ++  AKI GYE VPA
Sbjct  183   SGVDHGCEGGEMEDAFKFIIHNDGITTEANYPYQAADGTCNKTKEASHVAKIKGYETVPA  242

Query  777   NSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKY  956
             NSE AL KAVANQPV+V+IDA GS FQFYSSGVFTG+CGTELDHGVTAVGYG   +GTKY
Sbjct  243   NSEEALLKAVANQPVAVSIDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGATANGTKY  302

Query  957   WLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WLVKNSWGTSWGE+GYIRM++DI+AKEGLCGIAM SSYP+A
Sbjct  303   WLVKNSWGTSWGEEGYIRMKRDIDAKEGLCGIAMDSSYPTA  343



>ref|XP_004489011.1| PREDICTED: vignain-like [Cicer arietinum]
Length=343

 Score =   473 bits (1216),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 231/332 (70%), Positives = 259/332 (78%), Gaps = 2/332 (1%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
                 L     A+ ATSR L D  M  RHEQWM QYG+VYKN  E+ KR+ IFKENV YIE
Sbjct  12    FTFVLCLGLWAFQATSRNLQDDSMHERHEQWMGQYGKVYKNAKEREKRFGIFKENVNYIE  71

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYK--LPHECSSNTPFRYENVSSVPTTVDW  443
               N  G K YKLGIN FADLTN EF+ASRN +   L    +  T F+Y NVS+VP+TVDW
Sbjct  72    VSNSVGNKSYKLGINEFADLTNHEFVASRNKFNAYLDGSSTKTTTFKYHNVSAVPSTVDW  131

Query  444   RKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEG  623
             R +GAVTPVKDQGQCGCCWAFSAVA+ EGI KLSTGNL+SLSEQELVDCD  G DQGCEG
Sbjct  132   RLEGAVTPVKDQGQCGCCWAFSAVASTEGIHKLSTGNLVSLSEQELVDCDTSGEDQGCEG  191

Query  624   GLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKA  803
             GLMDDAF FII N GL TE+ YPYQG DG+C  ++  N  A ISGYEDVPAN E AL+KA
Sbjct  192   GLMDDAFKFIIQNNGLNTEAEYPYQGVDGTCNTNEEGNHVATISGYEDVPANDELALQKA  251

Query  804   VANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGT  983
             VANQP+SVAIDA GSDFQFYSSGVFTG CGTELDHGV  VGYG++ED  +YWLVKNSWG 
Sbjct  252   VANQPISVAIDASGSDFQFYSSGVFTGSCGTELDHGVAVVGYGVSEDEIEYWLVKNSWGI  311

Query  984   SWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              WGE+GYIRMQ+ ++A EGLCGIAMQ+SYP+A
Sbjct  312   KWGEEGYIRMQRGVDALEGLCGIAMQASYPTA  343



>ref|XP_004297572.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   472 bits (1215),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 238/334 (71%), Positives = 274/334 (82%), Gaps = 4/334 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYL-ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             L +AL L+     Y  ATSRTL D+ M  R+EQWMA+YGRVY +  EK KR+ IFKENV 
Sbjct  10    LCLALILMMFGGWYSEATSRTLQDASMYGRYEQWMARYGRVYNDINEKEKRFQIFKENVA  69

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTV  437
              +ES N   +KPY L +N FADLTN+EFIASRN +K  HECS+ T  F+YEN + VP TV
Sbjct  70    IVESSNNDASKPYTLSVNQFADLTNEEFIASRNRFK-GHECSTKTMSFKYENFT-VPATV  127

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWR+KGAVTPVKDQGQCGCCWAFSAVAAMEGIT+L+TG LISLSEQELVDCDV G DQGC
Sbjct  128   DWRQKGAVTPVKDQGQCGCCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGEDQGC  187

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMD+AF FI  N GL+TE++YPY G DG+C   K ++ AA I+G+EDVPANSESAL 
Sbjct  188   EGGLMDNAFDFINQNHGLSTEAHYPYTGVDGTCNAQKEASHAASITGHEDVPANSESALL  247

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
             KAVANQP+SVAIDA GSDFQ YSSGVFTG CGT LDHGVTAVGYGI++DGTKYWLVKNSW
Sbjct  248   KAVANQPISVAIDASGSDFQLYSSGVFTGTCGTSLDHGVTAVGYGISDDGTKYWLVKNSW  307

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE+GYIRMQ+D++A EGLCGIAM +SYP+A
Sbjct  308   GAQWGEEGYIRMQRDVDAPEGLCGIAMAASYPTA  341



>ref|XP_009349242.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=484

 Score =   478 bits (1229),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 238/334 (71%), Positives = 273/334 (82%), Gaps = 5/334 (1%)
 Frame = +3

Query  87    LIALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             +  LA +F   A    ATSRTL D+ M  ++EQWMA+YGR Y    EK K +NIFKENV 
Sbjct  153   VFCLAFIFILGALSSQATSRTLQDASMYAKYEQWMARYGRAYAEINEKEKHFNIFKENVA  212

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTV  437
             +IES N    K YKL +N FADLTN+EF ASRNG+ + HECS+ T  F+YENV++ P TV
Sbjct  213   FIESSNNDANKLYKLSVNQFADLTNEEFKASRNGF-MGHECSTKTTAFKYENVTA-PPTV  270

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWR KGAVTP+KDQGQCGCCWAFSAVAAMEGITKL+TG LISLSEQELVDCD  G+DQGC
Sbjct  271   DWRNKGAVTPIKDQGQCGCCWAFSAVAAMEGITKLTTGKLISLSEQELVDCDTSGVDQGC  330

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
              GGLMDDAF FI  N GL+TE+NYPY G DG+C   K ++ AA+I+GYEDVPANSE AL 
Sbjct  331   GGGLMDDAFQFINKNHGLSTETNYPYTGVDGTCNTKKEASHAAQITGYEDVPANSEEALL  390

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
             KAVANQP+SVAIDAGGSDFQFYSSGVFTG CGT LDHGVTAVGYGI+ DGTKYWLVKNSW
Sbjct  391   KAVANQPISVAIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGISADGTKYWLVKNSW  450

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GT WGE+GYIRMQ+ ++AKEGLCGIAM++SYP+A
Sbjct  451   GTQWGEEGYIRMQRGVKAKEGLCGIAMEASYPTA  484



>ref|XP_009365508.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=542

 Score =   479 bits (1234),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 233/333 (70%), Positives = 273/333 (82%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             +  AL+F   A    ATSRTL D+ M  ++EQWMA+YGRVY +  EK KR+NIFK NV++
Sbjct  212   MCFALIFMLGALSSHATSRTLQDASMYGKYEQWMARYGRVYTDINEKEKRFNIFKANVDF  271

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTVD  440
             IES N    KPYKL +N FADLTN+EF  SRN + + HECS+ T  F+YENV++ P TVD
Sbjct  272   IESSNNDANKPYKLKVNQFADLTNEEFKTSRNRF-MGHECSTKTTSFKYENVTA-PATVD  329

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTP+KDQGQCGCCWAFSAVAAM+GITKL+TG LISLSEQELVDCD   +DQGCE
Sbjct  330   WRKKGAVTPIKDQGQCGCCWAFSAVAAMKGITKLTTGKLISLSEQELVDCDTSSVDQGCE  389

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N GL+TE+NYPY G DG+C     ++ AA I+G+EDVPANSE+AL K
Sbjct  390   GGLMDDAFQFITQNHGLSTETNYPYTGVDGTCNTKNEASHAATITGHEDVPANSEAALLK  449

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SV IDAGGSDFQFYSSGVFTG CGT LDHGVTAVG+G++ DGTKYWLVKNSWG
Sbjct  450   AVANQPISVVIDAGGSDFQFYSSGVFTGTCGTSLDHGVTAVGFGVSADGTKYWLVKNSWG  509

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
               WGE+GYIRMQ+D+E KEGLCGIAM++SYP+A
Sbjct  510   AEWGEEGYIRMQRDVEVKEGLCGIAMEASYPTA  542



>ref|XP_009601306.1| PREDICTED: ervatamin-B-like isoform X1 [Nicotiana tomentosiformis]
Length=341

 Score =   472 bits (1214),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 235/335 (70%), Positives = 274/335 (82%), Gaps = 3/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             KL  A  LV    A  A+SR L ++ M  +H QWMA++GR YK++ EK KR  IFKEN E
Sbjct  8     KLAFAALLVLGMHASRASSRGLYEASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKENAE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLP-HECSS-NTPFRYENVSSVPTT  434
             YI+S NKAG +PYKLGIN FADLTN+EF A+ NGY++P H+ SS  T F+YENV+++  +
Sbjct  68    YIDSVNKAGIRPYKLGINDFADLTNEEFRATHNGYRMPSHQKSSETTSFKYENVTALAAS  127

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWRKKGAVT VK+QGQCGCCWAFSAVAA EGI K+  G LISLSEQELVDCD    D G
Sbjct  128   MDWRKKGAVTGVKNQGQCGCCWAFSAVAATEGINKIKNGKLISLSEQELVDCDTS-WDMG  186

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             C+GGLMD AF +II N GLTTESNYPY+G DG+CK  K S  AAKI+GY+DVPANSESAL
Sbjct  187   CQGGLMDYAFKYIIKNHGLTTESNYPYEGIDGTCKTGKKSKHAAKITGYKDVPANSESAL  246

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
             +KAVA+QPVSVAIDA G DFQFYSSGVFTGECGTELDHGVTA+GYG   DGT YWLVKNS
Sbjct  247   QKAVAHQPVSVAIDASGPDFQFYSSGVFTGECGTELDHGVTAIGYGKTSDGTDYWLVKNS  306

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGTSWGEKGYIRMQ++I+A+EGLCGIAM++SYP+A
Sbjct  307   WGTSWGEKGYIRMQRNIDAEEGLCGIAMEASYPTA  341



>ref|XP_010045987.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=364

 Score =   473 bits (1216),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 230/323 (71%), Positives = 275/323 (85%), Gaps = 2/323 (1%)
 Frame = +3

Query  117   SAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKP  296
             +A  A SR L D+ M  RHEQWMA++GRVY++  EK + ++IFK  VEYIESFN+ G KP
Sbjct  42    TASQAWSRELHDATMRERHEQWMARHGRVYEDAAEKERCFSIFKTTVEYIESFNQDGNKP  101

Query  297   YKLGINAFADLTNKEFIASRNGYKLPH--ECSSNTPFRYENVSSVPTTVDWRKKGAVTPV  470
             YKL INAFADLT++EF ASR GYK       +S  PF+YE+V+++P+++DWRKKGAVTP+
Sbjct  102   YKLAINAFADLTSEEFKASRTGYKRSSSLRAASMKPFQYESVTAIPSSMDWRKKGAVTPI  161

Query  471   KDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTF  650
             KDQGQCGC WAFSAVAAMEGIT+L+TG L SLSEQELVDCD  G DQGC GGLMDDAF F
Sbjct  162   KDQGQCGCRWAFSAVAAMEGITQLTTGKLTSLSEQELVDCDRSGEDQGCGGGLMDDAFQF  221

Query  651   IINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVA  830
             II+N GLTTE+NYPYQ  D +C   K++++AAKISGYEDVP+NSESAL KAVA+QPVSVA
Sbjct  222   IISNHGLTTEANYPYQAVDNTCNARKAASTAAKISGYEDVPSNSESALLKAVAHQPVSVA  281

Query  831   IDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIR  1010
             IDAG +DFQFYS+G+FTGECGT+LDHGVTAVGYG +E+GTKYWLVKNSWGT WGE+GYIR
Sbjct  282   IDAGETDFQFYSTGIFTGECGTDLDHGVTAVGYGTSENGTKYWLVKNSWGTGWGEEGYIR  341

Query  1011  MQKDIEAKEGLCGIAMQSSYPSA  1079
             MQ+DI+A EGLCGIAM++SYP+A
Sbjct  342   MQRDIDAAEGLCGIAMEASYPTA  364



>ref|XP_003539970.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   472 bits (1214),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 230/335 (69%), Positives = 274/335 (82%), Gaps = 6/335 (2%)
 Frame = +3

Query  90    IALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I+LAL+F     A+  TSRTL D+ M  RHE+WMA+Y +VYK+  E+ KR+ IFKENV Y
Sbjct  10    ISLALLFCLGFWAFQVTSRTLQDASMYERHEEWMARYAKVYKDPEEREKRFKIFKENVNY  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTT  434
             IE+FN A  KPYKLGIN FADLTN+EFIA RN +K  H CSS    T F+YENV+++P+T
Sbjct  70    IEAFNNAANKPYKLGINQFADLTNEEFIAPRNRFK-GHMCSSITRTTTFKYENVTALPST  128

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             VDWR+KGAVTP+KDQGQCGCCWAFSAVAA EGI  L++G LISLSEQE+VDCD KG DQG
Sbjct  129   VDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALNSGKLISLSEQEVVDCDTKGEDQG  188

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             C GG MD AF FII N GL TE+NYPY+  DG C  ++++N AA I+GYEDVP N+E AL
Sbjct  189   CAGGFMDGAFKFIIQNHGLNTEANYPYKAVDGKCNANEAANHAATITGYEDVPVNNEKAL  248

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
             +KAVANQPVSVAIDA GSDFQFY +GVFTG CGT+LDHGVTAVGYG++ DGT+YWLVKNS
Sbjct  249   QKAVANQPVSVAIDASGSDFQFYKTGVFTGSCGTQLDHGVTAVGYGVSADGTQYWLVKNS  308

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGT WGE+GYI MQ+ ++A+EGLCGIAM +SYP+A
Sbjct  309   WGTEWGEEGYIMMQRGVKAQEGLCGIAMMASYPTA  343



>ref|XP_011037399.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score =   471 bits (1213),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 226/335 (67%), Positives = 266/335 (79%), Gaps = 2/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             +   A  L+    A+   SR L +S M+ RHEQWMA YG+VY +  E  +R+ IFK+NVE
Sbjct  8     QCFFAFILILGMWAFEVASRELQESSMSARHEQWMATYGKVYVDAAEIERRFKIFKDNVE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT--PFRYENVSSVPTT  434
             YIESFN AG KPYKL +N FAD TN+EF  + NGY+ P +        F+YENV+++P  
Sbjct  68    YIESFNTAGNKPYKLSVNKFADQTNEEFKGAHNGYRRPFQTRPMKVKSFKYENVTAIPAA  127

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWRKKGAVTP+KDQGQCG CWAFS VAA EGI +L+TG L+SLSEQELVDCD +G DQG
Sbjct  128   MDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDTQGEDQG  187

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             CEGGLM+D F FII N G+TTE+NYPYQ  DG+C   K ++  AKI+GYE VPANSE+ L
Sbjct  188   CEGGLMEDGFEFIIKNHGITTEANYPYQAADGTCNPEKRASHIAKITGYESVPANSEAEL  247

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
              KAVANQP+SV+IDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYG   DGTKYWLVKNS
Sbjct  248   LKAVANQPISVSIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGKTSDGTKYWLVKNS  307

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGTSWGE+GYIRMQ+DI+A+EGLCGIAM SSYP+A
Sbjct  308   WGTSWGEEGYIRMQRDIDAEEGLCGIAMDSSYPTA  342



>ref|XP_003539989.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   472 bits (1214),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 230/335 (69%), Positives = 274/335 (82%), Gaps = 6/335 (2%)
 Frame = +3

Query  90    IALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I+LAL+F     A+  TSRTL D+ M  RHE+WMA+Y +VYK+  E+ KR+ IFKENV Y
Sbjct  10    ISLALLFCLGFWAFQVTSRTLQDASMYERHEEWMARYAKVYKDPEEREKRFKIFKENVNY  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTT  434
             IE+FN A  KPYKLGIN FADLTN+EFIA RN +K  H CSS    T F+YENV+++P+T
Sbjct  70    IEAFNNAADKPYKLGINQFADLTNEEFIAPRNKFK-GHMCSSITRTTTFKYENVTALPST  128

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             VDWR+KGAVTP+KDQGQCGCCWAFSAVAA EGI  L++G LISLSEQE+VDCD KG DQG
Sbjct  129   VDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALNSGKLISLSEQEVVDCDTKGEDQG  188

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             C GG MD AF FII N GL TE+NYPY+  DG C  ++++N AA I+GYEDVP N+E AL
Sbjct  189   CAGGFMDGAFKFIIQNHGLNTEANYPYKAVDGKCNANEAANHAATITGYEDVPVNNEKAL  248

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
             +KAVANQPVSVAIDA GSDFQFY +GVFTG CGT+LDHGVTAVGYG++ DGT+YWLVKNS
Sbjct  249   QKAVANQPVSVAIDASGSDFQFYKTGVFTGSCGTQLDHGVTAVGYGVSADGTQYWLVKNS  308

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGT WGE+GYI MQ+ ++A+EGLCGIAM +SYP+A
Sbjct  309   WGTEWGEEGYIMMQRGVKAQEGLCGIAMMASYPTA  343



>ref|XP_003527349.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   471 bits (1213),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 228/335 (68%), Positives = 267/335 (80%), Gaps = 6/335 (2%)
 Frame = +3

Query  90    IALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I+LAL+F +   A+  T RTL D+ M  RHE+WM +Y +VYK+  E+ +R+ IFKENV Y
Sbjct  10    ISLALLFCSGFLAFQVTCRTLQDASMYERHEEWMGRYAKVYKDPQERERRFKIFKENVNY  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTT  434
             IE+FN A  KPY LGIN FADLTN+EFIA RN +K  H CSS    T F+YENV+++P+T
Sbjct  70    IEAFNNAANKPYTLGINQFADLTNEEFIAPRNRFK-GHMCSSITRTTTFKYENVTAIPST  128

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             VDWR+KGAVTP+KDQGQCGCCWAFSAVAA EGI  LS G LISLSEQE+VDCD KG DQG
Sbjct  129   VDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALSAGKLISLSEQEVVDCDTKGEDQG  188

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             C GG MD AF FII N GL  E NYPY+  DG C    ++N  A I+GYEDVP N+E AL
Sbjct  189   CAGGFMDGAFKFIIQNHGLNNEPNYPYKAVDGKCNAKAAANHVATITGYEDVPVNNEKAL  248

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
             +KAVANQPVSVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG++ DGT+YWLVKNS
Sbjct  249   QKAVANQPVSVAIDASGSDFQFYQSGVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNS  308

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGT WGE+GYIRMQ+ ++A+EGLCGIAM +SYP+A
Sbjct  309   WGTEWGEEGYIRMQRGVKAEEGLCGIAMMASYPTA  343



>ref|XP_006360708.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   471 bits (1213),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 237/335 (71%), Positives = 273/335 (81%), Gaps = 4/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             KL     LV    A  ATSR L ++ +  +HEQWMA++GRVYK++VEK KR+ IFK+N E
Sbjct  8     KLAFVALLVLGMQASQATSRGLYETSIVKKHEQWMARFGRVYKDDVEKAKRFKIFKDNTE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECS--SNTPFRYENVSSVPTT  434
             YI+S N AG KPYKL +N F+DLTN+EF A+ NGY++P +      T F+YENV++ P T
Sbjct  68    YIDSVNMAGIKPYKLDVNEFSDLTNEEFRATHNGYRMPSQKKYPEITSFKYENVTA-PAT  126

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWR KGAVT +K+QGQCGCCWAFSAVAA EGI K+ TG LISLSEQELVDCD    D G
Sbjct  127   MDWRLKGAVTGIKNQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSS-DMG  185

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             CEGGLMDDAF FII N GLTTESNYPY+GTD +CK  K SN AAKI+ YEDVPANSESAL
Sbjct  186   CEGGLMDDAFKFIIKNHGLTTESNYPYEGTDNTCKTGKESNHAAKITSYEDVPANSESAL  245

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
              KAVANQPVSVAIDA GSDFQFYSSGVFTGECGTELDHGVTAVGYG A DGTKYWLVKNS
Sbjct  246   LKAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAVGYGEASDGTKYWLVKNS  305

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGTSWGE GYIRMQ++++ +EGLCGIAM++SYP+A
Sbjct  306   WGTSWGENGYIRMQRNVDTEEGLCGIAMEASYPTA  340



>ref|XP_006449486.1| hypothetical protein CICLE_v10018236mg [Citrus clementina]
 gb|ESR62726.1| hypothetical protein CICLE_v10018236mg [Citrus clementina]
Length=312

 Score =   470 bits (1210),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 239/313 (76%), Positives = 266/313 (85%), Gaps = 7/313 (2%)
 Frame = +3

Query  159   MAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFN-KAGTKPYKLGINAFADLTN  335
             M  RHE WMAQYGRVY++  EK  R+ IFKEN EYI SFN KA  KPYKLGIN FAD TN
Sbjct  1     MNERHEMWMAQYGRVYRDNAEKEMRFKIFKENAEYIASFNSKARNKPYKLGINEFADQTN  60

Query  336   KEFIASRNGYK--LPHECSSNT---PFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCW  500
             +EF A RNGYK  LP+  SS+T    FRYENVS VP ++DWRK GAVT VKDQGQCGCCW
Sbjct  61    EEFRAPRNGYKRRLPNVRSSDTTDVSFRYENVS-VPASIDWRKNGAVTGVKDQGQCGCCW  119

Query  501   AFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTE  680
             AFSAVAAMEGI +++T  L SLSEQELVDCD  G DQGCEGGLMDDAF FIINNKGL TE
Sbjct  120   AFSAVAAMEGINQITTRKLTSLSEQELVDCDTSGEDQGCEGGLMDDAFEFIINNKGLATE  179

Query  681   SNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQF  860
             + YPY+ +DGSC K +++ SAAKISGYEDVP+N+E+AL KAVANQPVSVAIDA GSDFQF
Sbjct  180   AKYPYKASDGSCNKKEANPSAAKISGYEDVPSNNEAALMKAVANQPVSVAIDASGSDFQF  239

Query  861   YSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEG  1040
             YSSGVFTG+CGTELDHGVTAVGYG A+DGTKYWLVKNSWGT+WGE GYIRMQ+DI+AKEG
Sbjct  240   YSSGVFTGQCGTELDHGVTAVGYGTADDGTKYWLVKNSWGTTWGENGYIRMQRDIDAKEG  299

Query  1041  LCGIAMQSSYPSA  1079
             LCGIAMQ+SYP+A
Sbjct  300   LCGIAMQASYPTA  312



>ref|XP_009357173.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   471 bits (1213),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 234/334 (70%), Positives = 271/334 (81%), Gaps = 3/334 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + ++L L+    +  ATSRTL D+ M  R+EQW+ +YGRVY N  EK  R+ IF ENV +
Sbjct  12    MCLSLILMMGAWSSGATSRTLQDASMYGRYEQWLTRYGRVYNNVNEKETRFKIFNENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVS-SVPTTV  437
             IES NK   KPYKL +N FADLTN+EF ASRNG+K  HECS+  T F+YENV+ S+P T+
Sbjct  72    IESSNKYANKPYKLSVNQFADLTNEEFKASRNGFK-GHECSTETTSFKYENVTASLPATM  130

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVTP+KDQGQCGCCWAFSAVAA EGIT+L+TG LISLSEQELVDCD  G DQGC
Sbjct  131   DWRKKGAVTPIKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQELVDCDTAGEDQGC  190

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMDDAF FI  N G++TE+NYPY G DG+C   K ++ AAKI+G+EDVPANSE AL 
Sbjct  191   EGGLMDDAFQFIQQNHGISTEANYPYDGVDGACNAKKEASHAAKITGFEDVPANSEKALL  250

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
              AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLVKNSW
Sbjct  251   AAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSW  310

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  311   GAEWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  344



>ref|XP_006469128.1| PREDICTED: vignain-like [Citrus sinensis]
Length=343

 Score =   470 bits (1210),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 230/341 (67%), Positives = 272/341 (80%), Gaps = 2/341 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             +   SL  L  + L+ A +A   TSR L ++ ++ +HEQWM++YG+VYKN  EK KR+ I
Sbjct  3     LRCQSLCKLALIFLILAIAASQVTSRKLQEASLSEKHEQWMSKYGKVYKNPEEKEKRFRI  62

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYENV  416
             FK+NVE+IES N AG KPYKL IN FAD TN+EF A RNGY+ P   +S   T F+YENV
Sbjct  63    FKDNVEFIESLNAAGNKPYKLSINEFADQTNQEFKAFRNGYRRPDGLTSRKGTSFKYENV  122

Query  417   SSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDV  596
               VP T+DWRK GAVTP+K+QG CG CWAFSAVAA EGIT+L+TG LISLSEQELV CD 
Sbjct  123   IDVPATMDWRKNGAVTPIKNQGPCGSCWAFSAVAATEGITQLTTGKLISLSEQELVSCDT  182

Query  597   KGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPA  776
              G+D GCEGG M+DAF FII+N G+TTE+NYPYQ  DG+C K+  ++  AKI GYE VPA
Sbjct  183   SGVDHGCEGGEMEDAFKFIIHNDGITTEANYPYQAVDGTCNKTNEASHVAKIKGYETVPA  242

Query  777   NSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKY  956
             NSE AL KAVANQPV+V+IDA GS FQFYSSGVFTG+CGTELDHGVTAVGYG   +GTKY
Sbjct  243   NSEEALLKAVANQPVAVSIDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGATANGTKY  302

Query  957   WLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WLVKNSWGTSWGE+GYIRM++DI+AKEGLCGIAM SSYP+A
Sbjct  303   WLVKNSWGTSWGEEGYIRMKRDIDAKEGLCGIAMDSSYPTA  343



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   470 bits (1209),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 228/328 (70%), Positives = 265/328 (81%), Gaps = 3/328 (1%)
 Frame = +3

Query  102   LVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNK  281
             L+    A  AT+RTL +  MA RHEQWMAQ GR Y++  EK +RY IFK NVE IESFN 
Sbjct  16    LLLCACASHATARTLSEMTMAERHEQWMAQQGRAYRDSAEKERRYQIFKANVELIESFN-  74

Query  282   AGTKPYKLGINAFADLTNKEFIASRNGYKLP--HECSSNTPFRYENVSSVPTTVDWRKKG  455
             AG   YKLG+N FADLTN+EF A  NG+K        +   F YENV++VP+++DWR KG
Sbjct  75    AGNSKYKLGVNQFADLTNEEFKAMMNGFKPSTLKTLKATNVFSYENVTAVPSSMDWRAKG  134

Query  456   AVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMD  635
             AVTP+KDQGQCGCCWAFSAVAAMEGITKL TG L+SLSEQELVDCDV   DQGC+GGLMD
Sbjct  135   AVTPIKDQGQCGCCWAFSAVAAMEGITKLKTGKLMSLSEQELVDCDVASDDQGCDGGLMD  194

Query  636   DAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQ  815
             +AF FIINN+GLTTE+NYPY+G DG+C   KS++  A I GYEDVPANSE+AL KAVANQ
Sbjct  195   NAFKFIINNRGLTTETNYPYKGIDGTCNSKKSASHVASIKGYEDVPANSEAALLKAVANQ  254

Query  816   PVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGE  995
             PVSVAI+A    FQFYSSG+FTG CGT+LDHGVT VGYG  +DGTKYWLVKNSWG+SWGE
Sbjct  255   PVSVAIEASSGSFQFYSSGIFTGSCGTDLDHGVTTVGYGTTKDGTKYWLVKNSWGSSWGE  314

Query  996   KGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             KGYIRM++D+ AKEGLCGIAM++SYP+A
Sbjct  315   KGYIRMERDVAAKEGLCGIAMEASYPTA  342



>ref|XP_011078435.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=340

 Score =   470 bits (1209),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 231/340 (68%), Positives = 273/340 (80%), Gaps = 1/340 (0%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSL-MAVRHEQWMAQYGRVYKNEVEKTKRYN  239
             MA +  K+ + + L+    AY  TSR + + L M  RHE+WM +YGRVYKNE EK  RY 
Sbjct  1     MALSIAKISVFIVLILTLWAYQTTSRLVPERLAMLERHEEWMERYGRVYKNEEEKMMRYK  60

Query  240   IFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVS  419
             IFK+NVE+IE+FN AGT+PYKLGINAFAD TN+EF A+RNG     + S  TPF+YENVS
Sbjct  61    IFKDNVEFIEAFNAAGTRPYKLGINAFADQTNEEFKAARNGLFKVQKLSKATPFKYENVS  120

Query  420   SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVK  599
             ++P+++DWRKKGAVTPVKDQGQCG CWAFSA+AA EGI ++STG LISLSEQE+VDCD  
Sbjct  121   ALPSSMDWRKKGAVTPVKDQGQCGSCWAFSAIAATEGINQISTGKLISLSEQEIVDCDKT  180

Query  600   GIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPAN  779
               DQGCEGG M+DAF FII+NKG+ +ES YPY  TDG+C K + S  AAKI+ YE VP N
Sbjct  181   SQDQGCEGGYMEDAFEFIIDNKGIASESTYPYSATDGTCNKKEESPIAAKITSYEKVPEN  240

Query  780   SESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYW  959
             +E AL KAVA QPVSV+IDAGG +FQFYSSGVFTG+CGT+LDHGVTAVGYG   DGTKYW
Sbjct  241   NEKALLKAVAKQPVSVSIDAGGMEFQFYSSGVFTGDCGTDLDHGVTAVGYGKTSDGTKYW  300

Query  960   LVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             LVKNSWGTSWGE+GYI M++D+ AKEGLCGIAM SSYP A
Sbjct  301   LVKNSWGTSWGEEGYIMMERDVAAKEGLCGIAMDSSYPIA  340



>ref|XP_003556992.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   470 bits (1209),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 227/335 (68%), Positives = 266/335 (79%), Gaps = 6/335 (2%)
 Frame = +3

Query  90    IALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I+LAL+F +    +  T RTL D+ M  RHE+WM +Y +VYK+  E+ +R+ IFKENV Y
Sbjct  10    ISLALLFCSGFLTFQVTCRTLQDASMYERHEEWMGRYAKVYKDPQERERRFKIFKENVNY  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTT  434
             IE+FN A  KPY LGIN FADLTN+EFIA RN +K  H CSS    T F+YENV+++P+T
Sbjct  70    IEAFNNAANKPYTLGINQFADLTNEEFIAPRNRFK-GHMCSSITRTTTFKYENVTAIPST  128

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             VDWR+KGAVTP+KDQGQCGCCWAFSAVAA EGI  LS G LISLSEQE+VDCD KG DQG
Sbjct  129   VDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALSAGKLISLSEQEVVDCDTKGEDQG  188

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             C GG MD AF FII N GL  E NYPY+  DG C    ++N  A I+GYEDVP N+E AL
Sbjct  189   CAGGFMDGAFKFIIQNHGLNNEPNYPYKAVDGKCNAKAAANHVATITGYEDVPVNNEKAL  248

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
             +KAVANQPVSVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG++ DGT+YWLVKNS
Sbjct  249   QKAVANQPVSVAIDASGSDFQFYQSGVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNS  308

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGT WGE+GYIRMQ+ ++A+EGLCGIAM +SYP+A
Sbjct  309   WGTEWGEEGYIRMQRGVKAEEGLCGIAMMASYPTA  343



>ref|XP_009354269.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   469 bits (1207),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 231/334 (69%), Positives = 271/334 (81%), Gaps = 3/334 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + + L L+    +  ATSR+L D+ +  R+EQW+A+YGRVY +  EK  R+ IFKENV +
Sbjct  1     MCLGLILMLGAWSSQATSRSLQDASIYARYEQWLARYGRVYNDVDEKEIRFKIFKENVAF  60

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSS-VPTTV  437
             IES NK   KP+KL +N FADLTN+EF ASRNG+K  HECS+  T F+YENV++ +P T+
Sbjct  61    IESSNKDANKPHKLSVNQFADLTNEEFKASRNGFK-GHECSTKTTSFKYENVTAALPATM  119

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVTPVKDQGQCGCCWAFSAVAA EG+T+L+TG LISLSEQELVDCD  G DQGC
Sbjct  120   DWRKKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGC  179

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMDDAF FI  N G++TE+NYPY G DG+C   K +  AAKI+G+EDVPANSE AL 
Sbjct  180   EGGLMDDAFQFIQQNHGISTETNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALL  239

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
              AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLVKNSW
Sbjct  240   TAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSW  299

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  300   GAEWGEAGYIRMQRDVAAPEGLCGIAMSASYPTA  333



>ref|XP_009601307.1| PREDICTED: ervatamin-B-like isoform X2 [Nicotiana tomentosiformis]
Length=331

 Score =   468 bits (1205),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 233/332 (70%), Positives = 273/332 (82%), Gaps = 3/332 (1%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
             +A  LV    A  A+SR L ++ M  +H QWMA++GR YK++ EK KR  IFKEN EYI+
Sbjct  1     MAPLLVLGMHASRASSRGLYEASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKENAEYID  60

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLP-HECSS-NTPFRYENVSSVPTTVDW  443
             S NKAG +PYKLGIN FADLTN+EF A+ NGY++P H+ SS  T F+YENV+++  ++DW
Sbjct  61    SVNKAGIRPYKLGINDFADLTNEEFRATHNGYRMPSHQKSSETTSFKYENVTALAASMDW  120

Query  444   RKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEG  623
             RKKGAVT VK+QGQCGCCWAFSAVAA EGI K+  G LISLSEQELVDCD    D GC+G
Sbjct  121   RKKGAVTGVKNQGQCGCCWAFSAVAATEGINKIKNGKLISLSEQELVDCDTS-WDMGCQG  179

Query  624   GLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKA  803
             GLMD AF +II N GLTTESNYPY+G DG+CK  K S  AAKI+GY+DVPANSESAL+KA
Sbjct  180   GLMDYAFKYIIKNHGLTTESNYPYEGIDGTCKTGKKSKHAAKITGYKDVPANSESALQKA  239

Query  804   VANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGT  983
             VA+QPVSVAIDA G DFQFYSSGVFTGECGTELDHGVTA+GYG   DGT YWLVKNSWGT
Sbjct  240   VAHQPVSVAIDASGPDFQFYSSGVFTGECGTELDHGVTAIGYGKTSDGTDYWLVKNSWGT  299

Query  984   SWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             SWGEKGYIRMQ++I+A+EGLCGIAM++SYP+A
Sbjct  300   SWGEKGYIRMQRNIDAEEGLCGIAMEASYPTA  331



>ref|XP_003607548.1| Cysteine protease [Medicago truncatula]
 ref|XP_003637653.1| Cysteine protease [Medicago truncatula]
 gb|AES89745.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   469 bits (1207),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 236/325 (73%), Positives = 267/325 (82%), Gaps = 7/325 (2%)
 Frame = +3

Query  120   AYLATSRTLLD-SLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGT-K  293
             A   TSRTL D S +  +HEQWM  YG+VYK+  E+  R  IFKENV YIE+ N AG  K
Sbjct  23    AIQVTSRTLQDDSNIYEKHEQWMVHYGKVYKDLQERENRLKIFKENVNYIEASNNAGNNK  82

Query  294   PYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP---FRYENVSSVPTTVDWRKKGAVT  464
              YKLGIN FADLTN+EFIASRN +K  H CSS T    F+YEN +SVP+TVDWRKKGAVT
Sbjct  83    LYKLGINQFADLTNEEFIASRNKFK-GHMCSSITKTSTFKYEN-ASVPSTVDWRKKGAVT  140

Query  465   PVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAF  644
             PVK+QGQCGCCWAFSAVAA EGI KLSTG L+SLSEQELVDCD KG+DQGCEGGLMDDAF
Sbjct  141   PVKNQGQCGCCWAFSAVAATEGIHKLSTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAF  200

Query  645   TFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVS  824
              FII N GL TE+ YPYQG DG+C  +K+S  A  I+GYEDVPAN+E AL+KAVANQP+S
Sbjct  201   KFIIQNHGLNTEAQYPYQGVDGTCSANKASIHAVTITGYEDVPANNEQALQKAVANQPIS  260

Query  825   VAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGY  1004
             VAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG+  DGTKYWLVKNSWGT WGE+GY
Sbjct  261   VAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVGNDGTKYWLVKNSWGTDWGEEGY  320

Query  1005  IRMQKDIEAKEGLCGIAMQSSYPSA  1079
             I+MQ+ ++A EGLCGIAM++SYP+A
Sbjct  321   IKMQRGVDAAEGLCGIAMEASYPTA  345



>ref|XP_006376351.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
 gb|ERP54148.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
Length=342

 Score =   469 bits (1206),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 224/333 (67%), Positives = 263/333 (79%), Gaps = 2/333 (1%)
 Frame = +3

Query  87    LIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYI  266
               A  L+    AY   SR L +  M+ RHEQWMA +G+VY +  E  +R+ IFK+NVEYI
Sbjct  10    FFAFILILGMWAYEVASRELQEPSMSARHEQWMATFGKVYADAAETERRFEIFKDNVEYI  69

Query  267   ESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYENVSSVPTTVD  440
             ESFN  G KPYKL +N FAD TN+E   +RNGY+ P +      T F+YENV++VP T+D
Sbjct  70    ESFNTTGNKPYKLSVNKFADQTNEELKVARNGYRRPLQTRPMKVTSFKYENVTAVPATMD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVT +KDQGQCG CWAFS VAA EGI +L+TG L+SLSEQELVDCD++G DQGCE
Sbjct  130   WRKKGAVTLIKDQGQCGSCWAFSTVAATEGINQLTTGKLVSLSEQELVDCDIQGEDQGCE  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLM+D F FII N G+TTE+NYPYQ  DG+C     ++  AKI+GYE VPANSE+AL K
Sbjct  190   GGLMEDGFEFIIKNHGITTEANYPYQAADGTCNSKIEASRIAKITGYESVPANSEAALLK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP+SV+IDAGGSDFQFYSSG FTG+CGTELDHGVTAVGYG   DGTKYWLVKNSWG
Sbjct  250   AVANQPISVSIDAGGSDFQFYSSGDFTGQCGTELDHGVTAVGYGETSDGTKYWLVKNSWG  309

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             TSWGE+GYIRMQ+D EA+EGLCGIAM SSYP+A
Sbjct  310   TSWGEEGYIRMQRDTEAEEGLCGIAMDSSYPTA  342



>ref|XP_003607574.1| Cysteine protease [Medicago truncatula]
 gb|AES89771.1| papain family cysteine protease [Medicago truncatula]
Length=345

 Score =   468 bits (1205),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 234/325 (72%), Positives = 269/325 (83%), Gaps = 7/325 (2%)
 Frame = +3

Query  120   AYLATSRTLLD-SLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGT-K  293
             A   TSRTL D S++  +HEQWM  YG+VYK+  E+  R  IFKENV YIE+ N AG  K
Sbjct  23    AIQVTSRTLQDDSIIYEKHEQWMVHYGKVYKDLQERENRLKIFKENVNYIEASNNAGNNK  82

Query  294   PYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP---FRYENVSSVPTTVDWRKKGAVT  464
              YKLGIN FAD+TN+EFIASRN +K  H CSS T    F+YEN +SVP+TVDWRKKGAVT
Sbjct  83    LYKLGINQFADITNEEFIASRNKFK-GHMCSSITKTSTFKYEN-ASVPSTVDWRKKGAVT  140

Query  465   PVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAF  644
             PVK+QGQCGCCWAFSAVAA EGI KLSTG L+SLSEQELVDCD KG+DQGCEGGLMDDAF
Sbjct  141   PVKNQGQCGCCWAFSAVAATEGIHKLSTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAF  200

Query  645   TFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVS  824
              FII N GL TE+ YPYQG DG+C  +++S  AA I+GYEDVPAN+E+AL+KAVANQP+S
Sbjct  201   KFIIQNHGLHTEAQYPYQGVDGTCSANETSTPAATIAGYEDVPANNENALQKAVANQPIS  260

Query  825   VAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGY  1004
             VAIDA GSDFQFY SGVFTG CGT+LDHGVTAVGYGI+ DGTKYWLVKNSWG  WGE+GY
Sbjct  261   VAIDASGSDFQFYKSGVFTGSCGTQLDHGVTAVGYGISNDGTKYWLVKNSWGNDWGEEGY  320

Query  1005  IRMQKDIEAKEGLCGIAMQSSYPSA  1079
             IRMQ+ ++A +GLCGIAM +SYP+A
Sbjct  321   IRMQRSVDAAQGLCGIAMMASYPTA  345



>ref|XP_009354268.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   468 bits (1205),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 232/334 (69%), Positives = 270/334 (81%), Gaps = 3/334 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + + L L+    +  ATSR+L D+ M  R+EQW+A+YGRVY +  EK  R+ IFKENV +
Sbjct  12    MCLGLILMLGAWSSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSS-VPTTV  437
             IES NK    PYKL +N FADLTN+EF ASRNG+K  HECS+  T F+YENV++ +P T+
Sbjct  72    IESSNKDANTPYKLRVNQFADLTNEEFKASRNGFK-GHECSTKTTSFKYENVTAALPATM  130

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVTPVKDQGQCGCCWAFSAVAA EG+T+L+TG LISLSEQELVDCD  G DQGC
Sbjct  131   DWRKKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGC  190

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMDDAF FI  N G++TE+NYPY G DG+C   K +  AAKI+G+EDVPANSE AL 
Sbjct  191   EGGLMDDAFQFIQQNHGISTETNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALL  250

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
              AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLVKNSW
Sbjct  251   TAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSW  310

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  311   GAEWGEAGYIRMQRDVAAPEGLCGIAMSASYPTA  344



>ref|XP_002274223.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Vitis 
vinifera]
Length=340

 Score =   468 bits (1205),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 235/335 (70%), Positives = 269/335 (80%), Gaps = 2/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             K++    L+    A  A SRTL +  M+ RHE WM  YGR YK+  EK +R+ IFKENVE
Sbjct  6     KIICITLLIMGVWASQALSRTLHEVSMSERHEDWMGLYGRTYKDIAEKERRFKIFKENVE  65

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYENVSSVPTT  434
             YIES N AG + YKL IN FAD TN+EF ASRNGY +     S+  T FRYENV++VP++
Sbjct  66    YIESVNSAGNRRYKLSINEFADQTNEEFKASRNGYNMSSRPRSSEITSFRYENVAAVPSS  125

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWRKKGAVTP+KDQGQCGCCWAFSAVAAMEG+T+L TG LISLSEQELVDCD  G DQG
Sbjct  126   MDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGVTQLKTGELISLSEQELVDCDTSGEDQG  185

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             C GGLMD AF FII N GLTTE+NYPY+G D +C K K+++SAAKI  YEDVPANSE+AL
Sbjct  186   CGGGLMDSAFEFIIGNGGLTTEANYPYKGVDATCNKKKAASSAAKIKNYEDVPANSEAAL  245

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
              KAVA  PVSVAIDAGGSDFQFYSSGVFTG+CGTELDHGVTAVGYG  +DGTKYWLVKNS
Sbjct  246   LKAVAQHPVSVAIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGKTDDGTKYWLVKNS  305

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGT WGE GYI M++DI A EGLCGIAM++SYP+A
Sbjct  306   WGTGWGEDGYIWMERDIGADEGLCGIAMEASYPTA  340



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   468 bits (1204),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 235/342 (69%), Positives = 278/342 (81%), Gaps = 5/342 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MA  +    I+LAL+F   A +  A +RTL D+ M  +HE+WM+++GRVY +  EK  RY
Sbjct  1     MAFTTRNGCISLALIFLLGALVSQAMARTLQDASMHEKHEEWMSRFGRVYNDGNEKEIRY  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYEN  413
              IFKENV+ IESFNKA  K YKLGIN FADLTN+EF  SRN +K  H CSS   PFRYEN
Sbjct  61    KIFKENVQRIESFNKASGKSYKLGINQFADLTNEEFKTSRNRFK-GHMCSSQAGPFRYEN  119

Query  414   VSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
             +++ P+++DWRKKGAVT +KDQGQCG CWAFSAVAA+EGIT+L+T  LISLSEQELVDCD
Sbjct  120   LTAAPSSMDWRKKGAVTAIKDQGQCGSCWAFSAVAAVEGITQLATSKLISLSEQELVDCD  179

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
              KG DQGC+GGLMDDAF FI  N+GLTTE+NYPY+G+DG+C   + +N AAKI+G+EDVP
Sbjct  180   TKGEDQGCQGGLMDDAFKFIEQNQGLTTEANYPYEGSDGTCNTKQEANHAAKINGFEDVP  239

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E AL KAVA QPVSVAIDAGG  FQFYSSG+FTG+CGTELDHGV AVGYG   +G  
Sbjct  240   ANNEGALMKAVAKQPVSVAIDAGGFGFQFYSSGIFTGDCGTELDHGVAAVGYG-ESNGMN  298

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWLVKNSWGT WGE+GYIRMQKDI+AKEGLCGIAMQ+SYP+A
Sbjct  299   YWLVKNSWGTQWGEEGYIRMQKDIDAKEGLCGIAMQASYPTA  340



>gb|EYU43350.1| hypothetical protein MIMGU_mgv1a021555mg [Erythranthe guttata]
Length=325

 Score =   468 bits (1203),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 235/321 (73%), Positives = 265/321 (83%), Gaps = 6/321 (2%)
 Frame = +3

Query  129   ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLG  308
             AT+RT  D+ M   HE+WM Q GRVYKN+ EK  RY IFK NVEYI+S N A T+PYKL 
Sbjct  7     ATARTTPDASMVKMHEKWMVQNGRVYKNDAEKAFRYKIFKANVEYIQSSNNAETRPYKLA  66

Query  309   INAFADLTNKEFIASRNGYKL----PHECSSNTPFRYENVSSVPTTVDWRKKGAVTPVKD  476
             +N FADLTN+EF ASRNGYK+        S  + FRY NV+ VPT++DW KKGAVTPVKD
Sbjct  67    VNKFADLTNEEFQASRNGYKMGSRSKSPSSKVSSFRYGNVT-VPTSIDWTKKGAVTPVKD  125

Query  477   QGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFII  656
             QGQCGCCWAFSAVAA EGI +L+TGNLISLSEQELVDCD    DQGC GGLMD+AF FII
Sbjct  126   QGQCGCCWAFSAVAATEGINQLTTGNLISLSEQELVDCDTSE-DQGCNGGLMDNAFEFII  184

Query  657   NNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAID  836
             +N GLTTESNYPY+G DG+C   K S+  AKI+GYEDVPANSESAL KAVA QP+SVAID
Sbjct  185   SNNGLTTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVAKQPISVAID  244

Query  837   AGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQ  1016
             A GSDFQFYS GVFTG+CGTELDHGVTAVGYG+  DGTKYWLVKNSWG+SWGE GYIRMQ
Sbjct  245   ASGSDFQFYSGGVFTGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGSSWGENGYIRMQ  304

Query  1017  KDIEAKEGLCGIAMQSSYPSA  1079
             +DI+A+EGLCGIAMQ+SYP+A
Sbjct  305   RDIDAEEGLCGIAMQASYPTA  325



>ref|XP_010045985.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84687.1| hypothetical protein EUGRSUZ_B01504 [Eucalyptus grandis]
Length=342

 Score =   467 bits (1202),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 229/336 (68%), Positives = 273/336 (81%), Gaps = 4/336 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             KL++ +  V    A  A SR L ++ M  RH+QWMA++GRVY+++ EK +R++IFK NV+
Sbjct  8     KLVLVMVAVLGLWASQARSRELHEATMRERHDQWMARHGRVYQDDAEKERRFSIFKNNVD  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKL---PHECSSNTPFRYENVSSVPT  431
              +ESFNK G KPY L INAFADLT +EF ASRNGY     P + S+  PFRYENV++VP+
Sbjct  68    LVESFNKNGNKPYTLAINAFADLTIEEFKASRNGYMRSSSPRQVSTK-PFRYENVTAVPS  126

Query  432   TVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQ  611
             ++DWRKKGAVTP+K+QGQCG CWAFSAV AMEGI +L+TG LISLSEQELVDCD  G D 
Sbjct  127   SMDWRKKGAVTPIKNQGQCGSCWAFSAVGAMEGIIQLTTGKLISLSEQELVDCDTSGKDH  186

Query  612   GCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESA  791
             GCEGG MDDAF FII   GLTTE+NYPYQ  DG+C   K+++SAAKI+GY DVPAN+ESA
Sbjct  187   GCEGGYMDDAFKFIIGRHGLTTETNYPYQAVDGTCNARKANSSAAKITGYADVPANNESA  246

Query  792   LEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKN  971
             L KAV +QPVSVAIDAG   FQFYSSG+FTGECGT LDHGVTAVGYG +E+GTKYWLVKN
Sbjct  247   LLKAVGHQPVSVAIDAGEWAFQFYSSGIFTGECGTNLDHGVTAVGYGTSENGTKYWLVKN  306

Query  972   SWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             SWGT WGEKGYIRM++DI+AKEGLCGIAM +S+P A
Sbjct  307   SWGTGWGEKGYIRMKRDIDAKEGLCGIAMMASFPIA  342



>ref|XP_008353750.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   467 bits (1201),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 231/334 (69%), Positives = 269/334 (81%), Gaps = 3/334 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             +   L L+    +  ATSR+L D+ M  R+EQW+A+YGRVY +  EK  R+ IFKENV +
Sbjct  12    MCFGLILMLGAWSSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSS-VPTTV  437
             IES NK   KPYKL +N FADLTN+EF ASRNG+K  HECS+  T F+Y+NV++ +P T+
Sbjct  72    IESSNKDANKPYKLSVNQFADLTNEEFKASRNGFK-GHECSTKTTSFKYKNVTAALPATM  130

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWR KGAVTPVKDQGQCGCCWAFSAVAA EG+T+L+TG LISLSEQELVDCD  G DQGC
Sbjct  131   DWRTKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGRLISLSEQELVDCDTAGEDQGC  190

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMDDAF FI  N G++TE+NYPY G DG+C   K +  AAKI+G+EDVPANSE AL 
Sbjct  191   EGGLMDDAFQFIQQNHGISTETNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALL  250

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
              AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLVKNSW
Sbjct  251   TAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSW  310

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  311   GXEWGEXGYIRMQRDVAAAEGLCGIAMSASYPTA  344



>ref|XP_008342776.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   466 bits (1199),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 231/334 (69%), Positives = 268/334 (80%), Gaps = 3/334 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + + L L+    +  ATSR+L D+ M  R+EQW+A+YGRVY +  EK  R+ IFKENV +
Sbjct  1     MCLGLILMLXAWSSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAF  60

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSS-VPTTV  437
             IES NK   KPYKL +N F DLTN+EF ASRNG+K  HECS+  T F+YENV++ +P T+
Sbjct  61    IESSNKDANKPYKLSVNQFXDLTNEEFKASRNGFK-GHECSTKTTSFKYENVTAALPATM  119

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVTPVKDQGQCGCCWAFSAVAA EG+T+L+TG LISLSEQELVDCD  G DQGC
Sbjct  120   DWRKKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGXLISLSEQELVDCDTAGEDQGC  179

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMDDAF FI  N G++TE NYPY G DG+C   K +  AAKI+G+EDVPANSE AL 
Sbjct  180   EGGLMDDAFQFIQQNHGISTEXNYPYBGVDGTCNTKKEAIIAAKITGFEDVPANSEKALL  239

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
              AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLV NSW
Sbjct  240   TAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVXNSW  299

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  300   GAEWGEXGYIRMQRDVAAPEGLCGIAMSASYPTA  333



>ref|XP_002280263.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=339

 Score =   466 bits (1199),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 230/341 (67%), Positives = 277/341 (81%), Gaps = 4/341 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MAS +    +++AL+F  +A+   ATSR+L ++ M  RHE WMA+YGR+YK+  EK KR+
Sbjct  1     MASTNQYQYVSMALLFILAAWASQATSRSLHEASMYERHEDWMARYGRMYKDANEKEKRF  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENV  416
              IFK+NV  IESFNKA  K YKL IN FADLTN+EF + RN +K  H CS  T F+YENV
Sbjct  61    KIFKDNVARIESFNKAMDKTYKLSINEFADLTNEEFRSLRNRFK-AHICSEATTFKYENV  119

Query  417   SSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDV  596
             ++VP+T+DWRKKGAVTP+KDQ QCGCCWAFSAVAA EGIT+++TG LISLSEQELVDCD 
Sbjct  120   TAVPSTIDWRKKGAVTPIKDQQQCGCCWAFSAVAATEGITQITTGKLISLSEQELVDCDT  179

Query  597   KGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPA  776
              G +QGC GGLMDDAF FI    GL +E+ YPY+G DG+C   K ++ AAKI GYEDVPA
Sbjct  180   GGENQGCSGGLMDDAFRFI-KIHGLASEATYPYEGDDGTCNSKKEAHPAAKIKGYEDVPA  238

Query  777   NSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKY  956
             N+E AL+KAVA+QPV+VAIDAGG +FQFY+SGVFTG+CGTELDHGV AVGYGI +DG  Y
Sbjct  239   NNEKALQKAVAHQPVAVAIDAGGFEFQFYTSGVFTGQCGTELDHGVAAVGYGIGDDGMMY  298

Query  957   WLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WLVKNSWGT WGE+GYIRMQ+D+ AKEGLCGIAMQ+SYP+A
Sbjct  299   WLVKNSWGTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  339



>ref|XP_008342781.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   466 bits (1198),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 231/334 (69%), Positives = 268/334 (80%), Gaps = 3/334 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + + L L+    +  ATSR+L D+ M  R+EQW+A+YGRVY +  EK  R+ IFKENV +
Sbjct  1     MCLGLILMLXAWSSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKENVAF  60

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSS-VPTTV  437
             IES NK   KPYKL +N F DLTN+EF ASRNG+K  HECS+  T F+YENV++ +P T+
Sbjct  61    IESSNKDANKPYKLSVNQFXDLTNEEFKASRNGFK-GHECSTKTTSFKYENVTAALPATM  119

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVTPVKDQGQCGCCWAFSAVAA EG+T+L+TG LISLSEQELVDCD  G DQGC
Sbjct  120   DWRKKGAVTPVKDQGQCGCCWAFSAVAATEGVTQLTTGXLISLSEQELVDCDTAGEDQGC  179

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMDDAF F   N G++TE NYPY G DG+C   K +  AAKI+G+EDVPANSE AL 
Sbjct  180   EGGLMDDAFQFXQQNHGISTEXNYPYBGVDGTCNTKKEAIIAAKITGFEDVPANSEKALL  239

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
              AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLVKNSW
Sbjct  240   TAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSW  299

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  300   GAEWGEXGYIRMQRDVAAPEGLCGIAMSASYPTA  333



>ref|XP_003527388.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   466 bits (1199),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 230/335 (69%), Positives = 266/335 (79%), Gaps = 6/335 (2%)
 Frame = +3

Query  90    IALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I+LAL+F     A+  T RTL D+ M  RH QWMA+Y +VYK+  E+ KR+ IFKENV Y
Sbjct  10    ISLALLFCMGFLAFQVTCRTLQDASMYERHAQWMARYAKVYKDPQEREKRFRIFKENVNY  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTT  434
             IE+FN A  K YKL IN FADLTN+EFIA RN +K  H CSS    T F+YENV+ +P+T
Sbjct  70    IETFNSADNKSYKLDINQFADLTNEEFIAPRNRFK-GHMCSSITRTTTFKYENVTVIPST  128

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             VDWR+KGAVTP+KDQGQCGCCWAFSAVAA EGI  L+ G LISLSEQE+VDCD KG DQG
Sbjct  129   VDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGIHALNAGKLISLSEQEVVDCDTKGQDQG  188

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             C GG MD AF FII N GL TE NYPY+  DG C    ++N AA I+GYEDVP N+E AL
Sbjct  189   CAGGFMDGAFKFIIQNHGLNTEPNYPYKAADGKCNAKAAANHAATITGYEDVPVNNEKAL  248

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
             +KAVANQPVSVAIDA GSDFQFY SGVFTG CGTELDHGVTAVGYG++ DGT+YWLVKNS
Sbjct  249   QKAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNS  308

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGT WGE+GYIRMQ+ ++A+EGLCGIAM +SYP+A
Sbjct  309   WGTEWGEEGYIRMQRGVKAEEGLCGIAMMASYPTA  343



>ref|XP_009601308.1| PREDICTED: ervatamin-B-like isoform X3 [Nicotiana tomentosiformis]
Length=323

 Score =   464 bits (1194),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 230/322 (71%), Positives = 269/322 (84%), Gaps = 3/322 (1%)
 Frame = +3

Query  120   AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPY  299
             A  A+SR L ++ M  +H QWMA++GR YK++ EK KR  IFKEN EYI+S NKAG +PY
Sbjct  3     ASRASSRGLYEASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKENAEYIDSVNKAGIRPY  62

Query  300   KLGINAFADLTNKEFIASRNGYKLP-HECSS-NTPFRYENVSSVPTTVDWRKKGAVTPVK  473
             KLGIN FADLTN+EF A+ NGY++P H+ SS  T F+YENV+++  ++DWRKKGAVT VK
Sbjct  63    KLGINDFADLTNEEFRATHNGYRMPSHQKSSETTSFKYENVTALAASMDWRKKGAVTGVK  122

Query  474   DQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFI  653
             +QGQCGCCWAFSAVAA EGI K+  G LISLSEQELVDCD    D GC+GGLMD AF +I
Sbjct  123   NQGQCGCCWAFSAVAATEGINKIKNGKLISLSEQELVDCDTS-WDMGCQGGLMDYAFKYI  181

Query  654   INNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAI  833
             I N GLTTESNYPY+G DG+CK  K S  AAKI+GY+DVPANSESAL+KAVA+QPVSVAI
Sbjct  182   IKNHGLTTESNYPYEGIDGTCKTGKKSKHAAKITGYKDVPANSESALQKAVAHQPVSVAI  241

Query  834   DAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRM  1013
             DA G DFQFYSSGVFTGECGTELDHGVTA+GYG   DGT YWLVKNSWGTSWGEKGYIRM
Sbjct  242   DASGPDFQFYSSGVFTGECGTELDHGVTAIGYGKTSDGTDYWLVKNSWGTSWGEKGYIRM  301

Query  1014  QKDIEAKEGLCGIAMQSSYPSA  1079
             Q++I+A+EGLCGIAM++SYP+A
Sbjct  302   QRNIDAEEGLCGIAMEASYPTA  323



>ref|XP_006362428.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=341

 Score =   464 bits (1195),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 236/333 (71%), Positives = 273/333 (82%), Gaps = 4/333 (1%)
 Frame = +3

Query  87    LIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYI  266
              +AL ++    A  ATSR L ++ M  ++E+WMA++GRVY+++ EK KR+NIFK+N +YI
Sbjct  11    FLALLVIGILWANEATSRDLNEASMVQKNEKWMARFGRVYRDDTEKAKRFNIFKDNFDYI  70

Query  267   ESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLP--HECSSNTPFRYENVSSVPTTVD  440
             +S NKAG +PYKL IN FADLTN+EF A+ NGYK+   H  S  T FRYENV++ P T+D
Sbjct  71    QSINKAGMRPYKLSINGFADLTNEEFRATHNGYKMSSHHTSSKTTFFRYENVTA-PATMD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVT VKDQ QCGCCWAFSAVAA +GI ++ TG LISLSEQELVDCD    D GCE
Sbjct  130   WRKKGAVTGVKDQWQCGCCWAFSAVAATKGINEIKTGKLISLSEQELVDCDTSS-DMGCE  188

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FII N GLTTESNYPY+GTDG+CK  K SN AAKI+GYEDVPANSESAL  
Sbjct  189   GGLMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKESNDAAKITGYEDVPANSESALLN  248

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQPVSVAIDA GSDFQFYSSGVFTGE GT+LDHGVTAVGYGI  DGTKYWLVKNSWG
Sbjct  249   AVANQPVSVAIDASGSDFQFYSSGVFTGEYGTDLDHGVTAVGYGITSDGTKYWLVKNSWG  308

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             TSWGE GYIRMQ+ +  +EG+CGIAMQ+SYP+A
Sbjct  309   TSWGENGYIRMQRGVVPEEGICGIAMQASYPTA  341



>ref|XP_002531152.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31237.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score =   464 bits (1194),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 231/333 (69%), Positives = 274/333 (82%), Gaps = 5/333 (2%)
 Frame = +3

Query  90    IALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             I+LAL+F   A    A +RTL D+ +  +HE+WM ++ RVY +  EK  RY IFKENV+ 
Sbjct  10    ISLALIFFLGALASQAIARTLQDASIHEKHEEWMTRFKRVYSDAKEKEIRYKIFKENVQR  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTVD  440
             IESFNKA  K YKLGIN FADLTN+EF  SRN +K  H CSS   PFRYEN+++VP+++D
Sbjct  70    IESFNKASEKSYKLGINQFADLTNEEFKTSRNRFK-GHMCSSQAGPFRYENITAVPSSMD  128

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRK+GAVT +KDQGQCG CWAFSAVAA+EGIT+L+T  LISLSEQELVDCD KG DQGC+
Sbjct  129   WRKEGAVTAIKDQGQCGSCWAFSAVAAVEGITQLATSKLISLSEQELVDCDTKGEDQGCQ  188

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLMDDAF FI  N+GLTTE+NYPY+G+DG+C   + +N AAKI+G+EDVPAN+E AL K
Sbjct  189   GGLMDDAFKFIEQNQGLTTEANYPYEGSDGTCNTKQEANHAAKINGFEDVPANNEGALMK  248

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVA QPVSVAIDAGG +FQFYSSG+FTG+CGTELDHGV AVGYG   +G  YWLVKNSWG
Sbjct  249   AVAKQPVSVAIDAGGFEFQFYSSGIFTGDCGTELDHGVAAVGYG-ESNGMNYWLVKNSWG  307

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGE+GYIRMQKDI+AKEGLCGIAMQ+SYP+A
Sbjct  308   TQWGEEGYIRMQKDIDAKEGLCGIAMQASYPTA  340



>ref|XP_007132896.1| hypothetical protein PHAVU_011G134100g [Phaseolus vulgaris]
 gb|ESW04890.1| hypothetical protein PHAVU_011G134100g [Phaseolus vulgaris]
Length=308

 Score =   463 bits (1191),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 229/310 (74%), Positives = 258/310 (83%), Gaps = 5/310 (2%)
 Frame = +3

Query  159   MAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNK  338
             M  RHEQWM +Y RVYK+  EK KR+ IFKENV YIE+FN A  K Y L IN FADLTN+
Sbjct  1     MHERHEQWMTRYSRVYKDPEEKEKRFRIFKENVNYIEAFNNAANKAYNLAINQFADLTNE  60

Query  339   EFIASRNGYKLPHECSS---NTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFS  509
             EFIA RN +K  H CSS    T F+YENVS+VP+TVDWR KGAVTPVKDQGQCGCCWAFS
Sbjct  61    EFIAPRNRFK-GHVCSSITRTTTFKYENVSAVPSTVDWRLKGAVTPVKDQGQCGCCWAFS  119

Query  510   AVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNY  689
             AVAA EGI KLSTG LISLSEQELVDCD+KG+DQGC GGLMDDAF FII N GL TE++Y
Sbjct  120   AVAATEGIHKLSTGKLISLSEQELVDCDIKGVDQGCGGGLMDDAFKFIIQNHGLNTEASY  179

Query  690   PYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSS  869
             PY+G DG C  + ++N AA I+GYEDVP N+E AL+KAVANQPVSVAIDA GSDFQFY S
Sbjct  180   PYKGVDGKCNANAAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYKS  239

Query  870   GVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCG  1049
             GVFTG CGTELDHGVTAVGYG+++DG KYWLVKNSWGT WGE+GYIRMQ+ + A+EGLCG
Sbjct  240   GVFTGSCGTELDHGVTAVGYGVSDDG-KYWLVKNSWGTEWGEEGYIRMQRGVAAEEGLCG  298

Query  1050  IAMQSSYPSA  1079
             IAM +SYP+A
Sbjct  299   IAMMASYPTA  308



>ref|XP_009354321.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=393

 Score =   466 bits (1198),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 230/319 (72%), Positives = 265/319 (83%), Gaps = 3/319 (1%)
 Frame = +3

Query  129   ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLG  308
             ATSR+L D+ M  R+EQW+A+YGRVY +  EK  R+ IFKENV +IES NK   KP+KL 
Sbjct  76    ATSRSLQDASMYGRYEQWLARYGRVYNDVDEKEIRFKIFKENVAFIESSNKDANKPHKLS  135

Query  309   INAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVSS-VPTTVDWRKKGAVTPVKDQG  482
             +N FADLTN+EF ASRNG+K  HECS+  T F+YENV++ +P T+DWRKKGAVTPVKDQG
Sbjct  136   VNQFADLTNEEFKASRNGFK-GHECSTKTTSFKYENVTAALPATMDWRKKGAVTPVKDQG  194

Query  483   QCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINN  662
             QCGCCWAFSAVAA EG+T+L+TG LISLSEQELVDCD  G DQGCEGGLMDDAF FI  N
Sbjct  195   QCGCCWAFSAVAATEGVTQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQN  254

Query  663   KGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAG  842
              G++TE+NYPY G DG+C   K +  AAKI+G+EDVPANSE AL  AVA+QPVSVAIDA 
Sbjct  255   HGISTETNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDAS  314

Query  843   GSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKD  1022
             GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLVKNSWG  WGE GYIRMQ+D
Sbjct  315   GSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGAEWGEAGYIRMQRD  374

Query  1023  IEAKEGLCGIAMQSSYPSA  1079
             + A EGLCGIAM +SYP+A
Sbjct  375   VAAPEGLCGIAMSASYPTA  393



>ref|XP_004306836.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   464 bits (1193),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 232/341 (68%), Positives = 272/341 (80%), Gaps = 4/341 (1%)
 Frame = +3

Query  60    TMASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYN  239
             T  S  + L + L ++ A S+  ATSR+L D+L   R+EQW+A+YGRVY + +EK  R+ 
Sbjct  4     TNQSKCICLALVLIMLGAWSSE-ATSRSLQDALAYGRYEQWIARYGRVYNDAIEKEDRFK  62

Query  240   IFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENV  416
             IFKEN  Y+ES NK G K YKL +N FADLTN+EF A+RN + L HECS+  T F+YEN 
Sbjct  63    IFKENEAYVESSNKDGNKLYKLSLNQFADLTNEEFTATRNRF-LGHECSTKTTTFKYEN-  120

Query  417   SSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDV  596
             + VP T+DWRKKGAVTPVKDQGQCG CWAFSAV AMEGIT+L+TG LISLSEQELVDCDV
Sbjct  121   AYVPATMDWRKKGAVTPVKDQGQCGSCWAFSAVGAMEGITQLTTGKLISLSEQELVDCDV  180

Query  597   KGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPA  776
              G+DQGC GGLMDDAF F+I N G+ TE+NYPY   DG+C   K +  AA I+G+EDVPA
Sbjct  181   NGVDQGCSGGLMDDAFQFVIQNHGINTEANYPYTAADGTCNAKKEAGHAATITGHEDVPA  240

Query  777   NSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKY  956
             NSESAL KAVANQP+SVAIDA G DFQ YSSGVFTG CGTELDHGVTAVGYG+  DGTKY
Sbjct  241   NSESALLKAVANQPISVAIDASGYDFQLYSSGVFTGTCGTELDHGVTAVGYGVDADGTKY  300

Query  957   WLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WLVKNSWG  WGE+GYIRMQ+D+ A EGLCGIAM++SYP+A
Sbjct  301   WLVKNSWGAQWGEEGYIRMQRDVAAPEGLCGIAMEASYPTA  341



>ref|XP_008342777.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   463 bits (1192),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 229/334 (69%), Positives = 268/334 (80%), Gaps = 3/334 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + + L L+    +  ATSR+L D+ M  R++QW+A+YGR+Y +  EK  R+ IFKENV +
Sbjct  1     MCLGLILMLGAWSSEATSRSLQDASMYGRYKQWLARYGRIYNDTNEKETRFKIFKENVAF  60

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP-FRYENVS-SVPTTV  437
             IE  NK   KPYKL +N FADLTN+EF A+RNG+K  HECS+ T  F+YENV+  +P T+
Sbjct  61    IEFSNKDANKPYKLSVNQFADLTNEEFKATRNGFK-GHECSTKTSSFKYENVTVPLPATM  119

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVTPVKDQGQCGCCWAFSAVAA EGIT+L+TG LISLSEQ LVDCD  G DQGC
Sbjct  120   DWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQXLVDCDTAGEDQGC  179

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMDDAF FI  N G++TE+NYPY G DG+C   K +  AAKI+G+EDVPANSE AL 
Sbjct  180   EGGLMDDAFQFIQQNHGISTEANYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALL  239

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
              AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLVKNSW
Sbjct  240   TAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSW  299

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  300   GAEWGEAGYIRMQRDVAAAEGLCGIAMSASYPTA  333



>ref|XP_009797968.1| PREDICTED: vignain-like [Nicotiana sylvestris]
Length=340

 Score =   463 bits (1192),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 237/335 (71%), Positives = 271/335 (81%), Gaps = 4/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             KL  A  LV    A  A+SR   +  M  +HEQWM ++ RVYK++ EK KR  IFKEN E
Sbjct  8     KLAFAALLVLGMQASRASSRGFYEGSMVQKHEQWMDRFRRVYKDDAEKEKRLKIFKENAE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKL-PHECSS-NTPFRYENVSSVPTT  434
             YI+S NKAG +PYKLGIN FADLTN+EF A+ NGYK+  H+ SS  T F+YENV++ PT+
Sbjct  68    YIDSVNKAGIRPYKLGINEFADLTNEEFRATHNGYKMRSHQKSSETTSFKYENVTA-PTS  126

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWRKKGAVT VKDQGQCGCCWAFSAVAA EGI K+  G LISLSEQELVDCD    + G
Sbjct  127   IDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINKIKKGKLISLSEQELVDCDTS-WNMG  185

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             C+GGLMD AF FII N GLTTESNYPY+G DG+CK  K SN AAKI+GYEDVP NSESAL
Sbjct  186   CQGGLMDYAFKFIIKNHGLTTESNYPYEGIDGTCKTGKKSNHAAKIAGYEDVPVNSESAL  245

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
              KAVA+QPVSVAIDA G DFQFYSSGVFTGECGTELDHGVTA+GYG   DGT YWLVKNS
Sbjct  246   LKAVAHQPVSVAIDASGPDFQFYSSGVFTGECGTELDHGVTAIGYGKTSDGTDYWLVKNS  305

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WGTSWGEKGYIRM+++I+A+EGLCGIAM++SYP+A
Sbjct  306   WGTSWGEKGYIRMRRNIDAEEGLCGIAMEASYPTA  340



>ref|XP_010277773.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Nelumbo 
nucifera]
Length=345

 Score =   464 bits (1193),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 233/319 (73%), Positives = 267/319 (84%), Gaps = 2/319 (1%)
 Frame = +3

Query  129   ATSRTL-LDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKL  305
             A +RTL  ++ M  RHEQWMA +G +Y++ VEK KR+ IFK+NVE IE+FN AG KPYKL
Sbjct  27    AAARTLPAEASMLERHEQWMASHGVLYEDAVEKEKRFTIFKDNVERIEAFNMAGNKPYKL  86

Query  306   GINAFADLTNKEFIASRNGYKLPHE-CSSNTPFRYENVSSVPTTVDWRKKGAVTPVKDQG  482
              +N FAD TN+EF ASRNGYK   +  SS T FRYEN++SV  ++DWR KGAVTP+KDQG
Sbjct  87    SVNRFADQTNEEFKASRNGYKRSTQPSSSKTSFRYENMTSVLPSMDWRSKGAVTPIKDQG  146

Query  483   QCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINN  662
              CGCCWAFSAVAAMEGITKL  G LISLSEQELVDCD  G D GCEGG MD+AF FI +N
Sbjct  147   DCGCCWAFSAVAAMEGITKLKAGKLISLSEQELVDCDTAGGDYGCEGGFMDNAFQFIQHN  206

Query  663   KGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAG  842
              GLTTE+NYPY+ TDG+C K KS+ SAAKISGYEDVPAN+E AL KAV+NQPVSVAIDAG
Sbjct  207   GGLTTEANYPYKQTDGTCDKRKSALSAAKISGYEDVPANNEVALLKAVSNQPVSVAIDAG  266

Query  843   GSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKD  1022
             G DFQFYSSG+FTGECGT LDHGVTAVGYG + DGTKYWLVKNSWGT+WGEKGYIRM++D
Sbjct  267   GFDFQFYSSGIFTGECGTNLDHGVTAVGYGTSSDGTKYWLVKNSWGTTWGEKGYIRMKRD  326

Query  1023  IEAKEGLCGIAMQSSYPSA  1079
             + +KEGLCGIAMQ+SYP A
Sbjct  327   VASKEGLCGIAMQASYPIA  345



>ref|XP_010317330.1| PREDICTED: uncharacterized protein LOC101251741 [Solanum lycopersicum]
Length=802

 Score =   479 bits (1234),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 248/352 (70%), Positives = 286/352 (81%), Gaps = 16/352 (5%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLA-----------TSRTLLDSLMAVRHEQWMAQYGRVYK  209
             +  N  K+ +AL + +  SA+LA           TSR L ++ M  +HE+WMA++GRVY+
Sbjct  454   LTDNQQKVQMALTINWK-SAFLALAVLTMWTIEVTSRELNEASMVQKHEKWMARFGRVYR  512

Query  210   NEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLP-HECS  386
             ++ EK KR+NIFK+NV+YIES NK+G +PYKL IN FADLTN+EF A+ NGYK   H+ S
Sbjct  513   DDAEKAKRFNIFKDNVDYIESINKSGMRPYKLSINGFADLTNEEFRATHNGYKPSSHQKS  572

Query  387   SNT-PFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLIS  563
             S T  FRYE+V++ P T+DWRKKGAVT VKDQGQCGCCWAFSAVAA EGI ++ TG LIS
Sbjct  573   SKTVSFRYEDVTA-PATMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGINEIKTGKLIS  631

Query  564   LSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsa  743
             LSEQELVDCD    D GCEGGLMDDAF FII N GLTTESNYPY+GTDG+CK  K SN A
Sbjct  632   LSEQELVDCDTSS-DMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDGTCKTGKKSNGA  690

Query  744   akisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAV  923
             AKI+GYEDVPANSES+L  AVANQPVSVAIDA GSDFQFYSSGVFTGECGTELDHGVTAV
Sbjct  691   AKITGYEDVPANSESSLLSAVANQPVSVAIDASGSDFQFYSSGVFTGECGTELDHGVTAV  750

Query  924   GYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GYGI  DGTKYWLVKNSWGTSWGE GYIRMQ+ I+AKEG+CGIAMQ+SYP+A
Sbjct  751   GYGITSDGTKYWLVKNSWGTSWGENGYIRMQRGIDAKEGICGIAMQASYPTA  802



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score =   462 bits (1190),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 228/324 (70%), Positives = 264/324 (81%), Gaps = 5/324 (2%)
 Frame = +3

Query  120   AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPY  299
             A  +T+RTL    M  +HEQWM QYGR YK++ EK  RY IFK+NVEYI+S ++A  + Y
Sbjct  3     ASQSTARTLPHKSMIEKHEQWMLQYGRTYKDDAEKAFRYKIFKQNVEYIQSVDEAENRTY  62

Query  300   KLGINAFADLTNKEFIASRNGYKLPHECSSNT----PFRYENVSSVPTTVDWRKKGAVTP  467
             KL IN FADLT+ EF ASRNG+K+  +   ++     FRY NVS+VP ++DW KKGAVTP
Sbjct  63    KLAINKFADLTSDEFKASRNGFKMGSQSIKSSFEVSSFRYGNVSAVPPSIDWTKKGAVTP  122

Query  468   VKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFT  647
             VKDQGQCGCCWAFSAVAA EG+ +L TG LISLSEQELVDCD    DQGC GGLMD+AF 
Sbjct  123   VKDQGQCGCCWAFSAVAATEGLNQLKTGKLISLSEQELVDCDTSE-DQGCNGGLMDNAFE  181

Query  648   FIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSV  827
             FII+N GLTTESNYPY+G DG+C   K S+  AKI+GYEDVPANSESAL KAVANQP+SV
Sbjct  182   FIISNNGLTTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISV  241

Query  828   AIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYI  1007
             AIDA GSDFQFYS GVF+G+CGTELDHGVTAVGYG+  DGTKYWLVKNSWG+SWGE GYI
Sbjct  242   AIDASGSDFQFYSGGVFSGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGSSWGENGYI  301

Query  1008  RMQKDIEAKEGLCGIAMQSSYPSA  1079
             RMQ+DI+A EGLCGIAMQ+SYP+A
Sbjct  302   RMQRDIDAAEGLCGIAMQASYPTA  325



>gb|KDO63329.1| hypothetical protein CISIN_1g047793mg, partial [Citrus sinensis]
Length=324

 Score =   462 bits (1189),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 225/323 (70%), Positives = 264/323 (82%), Gaps = 2/323 (1%)
 Frame = +3

Query  117   SAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKP  296
             +A   TSR L ++ ++ +HEQWM++YG+VYKN  EK KR+ IFK+NVE+IES N AG KP
Sbjct  2     AASQVTSRKLQEASLSEKHEQWMSKYGKVYKNPEEKEKRFRIFKDNVEFIESLNAAGNKP  61

Query  297   YKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYENVSSVPTTVDWRKKGAVTPV  470
             YKL IN FAD TN+EF A RNGY+ P   +S   T F+YENV  VP T+DWRK GAVTP+
Sbjct  62    YKLSINEFADQTNQEFKAFRNGYRRPDGLTSRKGTSFKYENVIDVPATMDWRKNGAVTPI  121

Query  471   KDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTF  650
             K+QG CG CWAFSAVAA EGIT+L+TG LISLSEQELV CD  G+D GCEGG M+DAF F
Sbjct  122   KNQGPCGSCWAFSAVAATEGITQLTTGKLISLSEQELVSCDTSGVDHGCEGGEMEDAFKF  181

Query  651   IINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVA  830
             II+N G+TTE+NYPYQ  DG+C K+  ++  AKI GYE VPANSE AL KAVANQPV+V+
Sbjct  182   IIHNDGITTEANYPYQAVDGTCNKTNEASHVAKIKGYETVPANSEEALLKAVANQPVAVS  241

Query  831   IDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIR  1010
             IDA GS FQFYSSGVFTG+CGTELDHGVTAVGYG   +GTKYWLVKNSWGTSWGE+GYIR
Sbjct  242   IDASGSAFQFYSSGVFTGDCGTELDHGVTAVGYGATANGTKYWLVKNSWGTSWGEEGYIR  301

Query  1011  MQKDIEAKEGLCGIAMQSSYPSA  1079
             M++DI+AKEGLCGIAM SSYP+A
Sbjct  302   MKRDIDAKEGLCGIAMDSSYPTA  324



>ref|XP_008342782.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   462 bits (1189),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 228/334 (68%), Positives = 268/334 (80%), Gaps = 3/334 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + + L L+    +  ATSR+L D+ M  R++QW+A+YGR+Y +  EK  R+ IFKENV +
Sbjct  1     MCLGLILMLGAWSSEATSRSLQDASMYGRYKQWLARYGRIYNDTNEKETRFKIFKENVAF  60

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP-FRYENVS-SVPTTV  437
             IE  NK   KPYKL +N FADLTN+EF A+RNG+K  HECS+ T  F+YENV+  +P T+
Sbjct  61    IEFSNKDANKPYKLSVNQFADLTNEEFKATRNGFK-GHECSTKTSSFKYENVTVPLPATM  119

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVTPVKDQGQCGCCWAFSAVAA EGIT+L+TG LISLSEQ LVDCD  G DQGC
Sbjct  120   DWRKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGKLISLSEQVLVDCDTAGEDQGC  179

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMD+AF FI  N G++TE+NYPY G DG+C   K +  AAKI+G+EDVPANSE AL 
Sbjct  180   EGGLMDBAFQFIQQNHGISTEANYPYBGVDGTCNTKKEAIIAAKITGFEDVPANSEKALL  239

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
              AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLVKNSW
Sbjct  240   TAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSW  299

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  300   GAEWGEAGYIRMQRDVAAAEGLCGIAMSASYPTA  333



>ref|XP_004308524.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   462 bits (1188),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 233/340 (69%), Positives = 271/340 (80%), Gaps = 4/340 (1%)
 Frame = +3

Query  60    TMASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYN  239
             T  S  + L   L ++ A S+  ATSR+L D+L   R+EQW+A+YGRVY +  EK  R+ 
Sbjct  4     TNQSKCMCLAFVLIMLGAWSSE-ATSRSLQDALAYGRYEQWIARYGRVYNDINEKEDRFK  62

Query  240   IFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP-FRYENV  416
             IFKEN  Y+ES NK G K YKL +N FADLTN+EF ASRN + L HECS+ T  F+YENV
Sbjct  63    IFKENEAYVESSNKDGNKLYKLSLNQFADLTNEEFTASRNRF-LGHECSTKTTTFKYENV  121

Query  417   SSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDV  596
             + VP T+DWRKKGAVTPVKDQGQCG CWAFSAV AMEGIT+L+TG LISLSEQELVDCDV
Sbjct  122   T-VPATMDWRKKGAVTPVKDQGQCGSCWAFSAVGAMEGITQLTTGKLISLSEQELVDCDV  180

Query  597   KGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPA  776
              G+DQGC GGLMDDAF F+I N G+ TE+NYPY   DG+C   K++  AA I+G+EDVPA
Sbjct  181   NGVDQGCSGGLMDDAFQFVIQNHGINTEANYPYTAADGTCNAKKAAGHAATITGHEDVPA  240

Query  777   NSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKY  956
             NSESAL KAVANQP+SVAIDA G DFQ YSSGVFTG CGTELDHGVTAVGYG+  DGTKY
Sbjct  241   NSESALLKAVANQPISVAIDASGYDFQLYSSGVFTGTCGTELDHGVTAVGYGVDADGTKY  300

Query  957   WLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  1076
             WLVKNSWG  WGE+GYIRMQ+D+ A EGLCGIAM++SYP+
Sbjct  301   WLVKNSWGAQWGEEGYIRMQRDVAAPEGLCGIAMEASYPT  340



>ref|XP_009767421.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=334

 Score =   461 bits (1187),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 223/334 (67%), Positives = 261/334 (78%), Gaps = 0/334 (0%)
 Frame = +3

Query  78    LKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENV  257
             +K LI L  +    A   T+RTL+D  + +++EQWM QYGRVYKN  EK   + IFK+N 
Sbjct  1     MKFLILLFAILGIWASKTTARTLVDEPLMLKYEQWMIQYGRVYKNNAEKDSHFKIFKKNA  60

Query  258   EYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSSVPTTV  437
             E IE+FN A  +PYKLGINAFADLTN+EF A+RNG K+P      T FRYENV+++PTT+
Sbjct  61    ERIEAFNDAANQPYKLGINAFADLTNEEFRAARNGLKIPFCEPKITSFRYENVTAIPTTM  120

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWR KGAVTP+KDQGQCG CWAFSA+AA EGITKLSTG LISLSEQEL+DCD    DQGC
Sbjct  121   DWRIKGAVTPIKDQGQCGSCWAFSAIAATEGITKLSTGKLISLSEQELMDCDRNSEDQGC  180

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGG M+DAF FI+ NKGLTTE+ YPY+  D  C   K S+  A I GYE VP  +E AL 
Sbjct  181   EGGYMEDAFEFIVKNKGLTTETTYPYKAADEKCNTKKESSHVADIKGYEKVPKYNEKALL  240

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
              AVANQP+SV+IDA    FQFY+SGVFTG CGTELDHGVTAVGYG AEDGTKYWL+KNSW
Sbjct  241   NAVANQPISVSIDASDFSFQFYTSGVFTGTCGTELDHGVTAVGYGKAEDGTKYWLIKNSW  300

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G+SWGE GYIRM++DI+AKEGLCGIAM +SYP+A
Sbjct  301   GSSWGENGYIRMERDIDAKEGLCGIAMDASYPTA  334



>ref|XP_008800071.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   461 bits (1187),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 229/323 (71%), Positives = 259/323 (80%), Gaps = 4/323 (1%)
 Frame = +3

Query  120   AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPY  299
             ++ A+SRTL D  M  +HEQWMA YGRVYK+  EK +R+ IF+ NVE IESFN AG   +
Sbjct  21    SHAASSRTLTDVSMKEKHEQWMALYGRVYKDAAEKERRFKIFQANVELIESFN-AGNHKF  79

Query  300   KLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTTVDWRKKGAVTPV  470
             KLG N FADLTN+EF A           SS      F+YEN ++VP ++DWR KGAVTP+
Sbjct  80    KLGANQFADLTNEEFRAVHTXXXXXXXASSGMATKSFKYENATAVPVSMDWRAKGAVTPI  139

Query  471   KDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTF  650
             KDQGQCGCCWAFSAVAAMEGITKLSTG LISLSEQELVDCD KG DQGC GGLMDDAF F
Sbjct  140   KDQGQCGCCWAFSAVAAMEGITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKF  199

Query  651   IINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVA  830
             II N GLTTE+NYPY+  DG+C   KS + AA I GYEDVPANSE+AL KAVANQPVSVA
Sbjct  200   IIKNGGLTTEANYPYEAADGTCNAGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVA  259

Query  831   IDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIR  1010
             IDAGGS FQ YSSGVFTG+CGTELDHGVTAVGY    DGTKYWLVKNSWG+SWGE GYIR
Sbjct  260   IDAGGSAFQLYSSGVFTGDCGTELDHGVTAVGYDKTSDGTKYWLVKNSWGSSWGENGYIR  319

Query  1011  MQKDIEAKEGLCGIAMQSSYPSA  1079
             M++D++AKEGLCGIAM++SYP+A
Sbjct  320   MERDVDAKEGLCGIAMEASYPTA  342



>emb|CDP18644.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   461 bits (1187),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 224/336 (67%), Positives = 267/336 (79%), Gaps = 2/336 (1%)
 Frame = +3

Query  78    LKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENV  257
             +K++I    +    A    +R L D  M  R+EQWM+ +GRVYK+  EK +R+ IFK+NV
Sbjct  1     MKVVIGFFFLLGLLAIQGAARNLNDEAMVERYEQWMSLHGRVYKDSAEKERRFKIFKDNV  60

Query  258   EYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPH--ECSSNTPFRYENVSSVPT  431
             E+IESFN+AG +PYKLGIN FADLTN+EF+AS NG K+        +T F+YENV++VP 
Sbjct  61    EFIESFNRAGNRPYKLGINQFADLTNEEFVASHNGLKMSSSPRLFMSTSFKYENVTAVPA  120

Query  432   TVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQ  611
             TVDWR KGAVTP+KDQGQCG CWAFSA+AA EGITKLSTG LISLSEQE+VDCD    DQ
Sbjct  121   TVDWRTKGAVTPIKDQGQCGSCWAFSAIAATEGITKLSTGKLISLSEQEIVDCDRTSQDQ  180

Query  612   GCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESA  791
             GC GG M+DAF FI+ NKG+ TE+ YPY   DG+C K+K ++ AAKI+ YE VPANSE+A
Sbjct  181   GCSGGYMEDAFEFIVKNKGIATETTYPYTAADGTCSKTKEASHAAKIASYEKVPANSEAA  240

Query  792   LEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKN  971
             L KAVANQPVSV+IDAGG  FQFYSSGVFTG+CGT+LDHGVTAVGYG   +GTKYWLVKN
Sbjct  241   LLKAVANQPVSVSIDAGGMAFQFYSSGVFTGDCGTDLDHGVTAVGYGKTSNGTKYWLVKN  300

Query  972   SWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             SWGTSWGE GYI+M++ I AKEGLCGIAM SSYP+A
Sbjct  301   SWGTSWGESGYIKMKRGIAAKEGLCGIAMDSSYPTA  336



>ref|XP_007050065.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX94222.1| Senescence-associated gene 12 [Theobroma cacao]
Length=342

 Score =   461 bits (1187),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 226/333 (68%), Positives = 265/333 (80%), Gaps = 2/333 (1%)
 Frame = +3

Query  87    LIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYI  266
             +IA  L+ A       SR L ++ ++ RHEQWM +YGRVYKN+ E   R++IFK N+ +I
Sbjct  10    IIAFFLILAVCIPNVMSRQLHEASLSQRHEQWMEEYGRVYKNDAETELRFSIFKSNLAFI  69

Query  267   ESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYENVSSVPTTVD  440
             ESFN AG +PYKL IN FAD TN+EF A RNGY      +S   T FRYENV+++P +VD
Sbjct  70    ESFNAAGNRPYKLSINEFADQTNEEFRAYRNGYGRAQRLTSRKETSFRYENVTALPASVD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTP+KDQ QCG CWAFSAVAA EGI +L+TG LISLSEQELVDCD +G DQGC 
Sbjct  130   WRKKGAVTPIKDQAQCGSCWAFSAVAATEGIHQLTTGKLISLSEQELVDCDTQGEDQGCA  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GG M+DAF FII N G+ +E  YPY+G DG+C K+K ++ AA I+GYE VPANSE AL K
Sbjct  190   GGEMEDAFEFIIRNHGIASEVTYPYKGDDGTCNKTKEASHAATITGYEVVPANSEKALMK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQPVSV+IDAGG  FQFYSSG+FTG+CGTELDHGVTAVGYG +EDGT YWLVKNSWG
Sbjct  250   AVANQPVSVSIDAGGYAFQFYSSGIFTGDCGTELDHGVTAVGYGTSEDGTMYWLVKNSWG  309

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGEKGYIRMQ+DI+AKEGLCGIAM SSYP+A
Sbjct  310   TGWGEKGYIRMQRDIKAKEGLCGIAMDSSYPTA  342



>ref|XP_009617815.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=339

 Score =   461 bits (1186),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 232/334 (69%), Positives = 269/334 (81%), Gaps = 3/334 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             +L  A  LV      L TSRTL ++ +  +HEQWM+QYGRVYK++ +K KR   FK+N+E
Sbjct  8     RLNFATLLVLGLCISLVTSRTLYEASITEKHEQWMSQYGRVYKDDTKKAKRLETFKQNLE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECS-SNTPFRYENVSSVPTTV  437
             YIES NK  T+ YKLGIN FAD+TN+EF A RNGY++  +    NT F+YENV+ VP ++
Sbjct  68    YIESTNKDVTRTYKLGINQFADMTNEEFKAIRNGYRISSQQKIKNTSFQYENVT-VPYSM  126

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVT +KDQGQCGCCWAFSAVAA EGI K+ TG LISLSEQELVDCD    +QGC
Sbjct  127   DWRKKGAVTKIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTNS-NQGC  185

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMDDAF +II N GLT+ESNYPY+G DG+CK  K SN  AKISGY+DVP NSESAL 
Sbjct  186   EGGLMDDAFKYIIKNHGLTSESNYPYKGIDGTCKTEKESNHIAKISGYKDVPENSESALL  245

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
             KAVANQPVSVAIDA GSDFQFYSSG+FTG+CGTELDHGV AVGYG  +DGTKYW+VKNSW
Sbjct  246   KAVANQPVSVAIDASGSDFQFYSSGIFTGKCGTELDHGVVAVGYGATKDGTKYWIVKNSW  305

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G SWGE GYIRM++DI AK GLCGIAM++SYP A
Sbjct  306   GVSWGENGYIRMKRDIVAKTGLCGIAMKASYPIA  339



>ref|XP_008348586.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   461 bits (1185),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 230/332 (69%), Positives = 267/332 (80%), Gaps = 3/332 (1%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
             ++L L+    +  ATSRTL D+ +  R+EQW+ +YGRVY +  EK  R+ IFKENV +IE
Sbjct  14    LSLILMLGAWSXGATSRTLQDASIYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAFIE  73

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENVS-SVPTTVDW  443
             S N    KPYKL +N FADLTN+EF  SRNG+K  HECS+  T F+YENV+ S+P T+DW
Sbjct  74    SSNXDANKPYKLSVNQFADLTNEEFKVSRNGFK-GHECSTKTTSFKYENVTASLPATMDW  132

Query  444   RKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEG  623
             RKKGAVTPVKDQGQCGCCWAFSAVAA EGIT+L+TG LISLSEQELVDCD    DQGCEG
Sbjct  133   RKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGTLISLSEQELVDCDTASEDQGCEG  192

Query  624   GLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKA  803
             GLMDDAF FI  N G+ TE+NYPY+G DG+C   K ++ AAKI+G+EDVPANSE  L  A
Sbjct  193   GLMDDAFQFIQQNHGIGTEANYPYEGVDGTCNSKKEASHAAKITGFEDVPANSEKDLLAA  252

Query  804   VANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGT  983
             VA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLVKNSWG 
Sbjct  253   VAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGA  312

Query  984   SWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  313   EWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  344



>ref|XP_009357171.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   461 bits (1185),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 229/332 (69%), Positives = 269/332 (81%), Gaps = 3/332 (1%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
             ++L L+    +  ATSRTL D+ +  R+EQW+ +YGRVY +  EK  R+ IFKENV +IE
Sbjct  14    LSLILMLGAWSSGATSRTLQDASIYGRYEQWLTRYGRVYNDVNEKETRFKIFKENVAFIE  73

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP-FRYENVS-SVPTTVDW  443
             S NK   KP +L +N FADLTN+EF ASRNG+K  HECS+ T  F+YENV+ S+P T+DW
Sbjct  74    SSNKDANKPCRLSVNQFADLTNEEFKASRNGFK-GHECSTKTSSFKYENVTASLPATMDW  132

Query  444   RKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEG  623
             RKKGAVTPVKDQGQCGCCWAFSAVAA EGIT+L+TG LISLSEQELVDCD    DQGCEG
Sbjct  133   RKKGAVTPVKDQGQCGCCWAFSAVAATEGITQLTTGTLISLSEQELVDCDTASEDQGCEG  192

Query  624   GLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKA  803
             GLMDDAF FI  N G++TE+NYPY+G DG+C   K ++ AAKI+G+EDVPANSE  L  A
Sbjct  193   GLMDDAFQFIQQNHGISTEANYPYEGVDGTCNAKKEASHAAKITGFEDVPANSEKDLLAA  252

Query  804   VANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGT  983
             VA+QPVSVAIDA GSDFQFYSSGVF+G CGT LDHGVTAVGYG++EDGTKYWLVKNSWG 
Sbjct  253   VAHQPVSVAIDASGSDFQFYSSGVFSGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSWGA  312

Query  984   SWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  313   EWGEAGYIRMQRDVAAAEGLCGIAMAASYPTA  344



>ref|XP_008362421.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Malus domestica]
Length=344

 Score =   460 bits (1184),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 230/334 (69%), Positives = 267/334 (80%), Gaps = 3/334 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + + L L+    +  ATSR+L D+ M  R+EQW+A YGRV+ +  EK  R+ IFKENV +
Sbjct  12    MCLGLILMLGAWSSEATSRSLKDASMYGRYEQWLALYGRVHNDINEKETRFKIFKENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN-TPFRYENVS-SVPTTV  437
             IE  NK   KPYKL +N FADLTN+EF A+RNG+K  HECS+  + F+YENV+  +P T+
Sbjct  72    IEFSNKDAHKPYKLSVNQFADLTNEEFKATRNGFK-GHECSTKASSFKYENVTVPLPATM  130

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVTPVKD GQCGCCWAFSAVAA EGIT+L+TGNLISLSEQELVDCD  G DQGC
Sbjct  131   DWRKKGAVTPVKDXGQCGCCWAFSAVAATEGITQLTTGNLISLSEQELVDCDTAGEDQGC  190

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMDDAF FI  N G++TE NYPY G DG+C   K +  AAKI+G+EDVPANSE AL 
Sbjct  191   EGGLMDDAFQFIQQNHGISTEXNYPYNGVDGTCNTKKEAIIAAKITGFEDVPANSEKALL  250

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
              AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLVKNSW
Sbjct  251   TAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSW  310

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  311   GAEWGEAGYIRMQRDVAAAEGLCGIAMSASYPTA  344



>ref|XP_004306597.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   460 bits (1184),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 230/340 (68%), Positives = 273/340 (80%), Gaps = 6/340 (2%)
 Frame = +3

Query  69    SNSLKLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             +N +K  I+LAL+    A+   ATSRTL D  M  R+EQWMA++GRV+ +  EK  R+ I
Sbjct  4     TNQIKC-ISLALILMLGAWSSEATSRTLQDVTMYGRYEQWMARHGRVFSSIDEKESRFKI  62

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP-FRYENVS  419
             FKEN+ YIES N   +K ++LG+N FA LTN+EF +  NG+K  HE S+ T  FRYENV+
Sbjct  63    FKENLAYIESSNNDASKTFRLGVNQFAHLTNEEFTSLSNGFK-GHESSTKTSSFRYENVT  121

Query  420   SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVK  599
              VP T+DWR KGAVTP+K+QGQCGCCWAFSAVAAMEGIT+L+ G LISLSEQELVDCD  
Sbjct  122   -VPATMDWRSKGAVTPIKNQGQCGCCWAFSAVAAMEGITQLTMGKLISLSEQELVDCDKS  180

Query  600   GIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPAN  779
             G DQGCEGGLMDDAF FI  N GL+TE+NYPY G DG C   K ++ AA I+G+EDVPAN
Sbjct  181   GEDQGCEGGLMDDAFEFINQNHGLSTEANYPYTGVDGKCNARKEASHAASITGHEDVPAN  240

Query  780   SESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYW  959
             SESAL KAVA+QP+SVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG+++DGTKYW
Sbjct  241   SESALLKAVASQPISVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSDDGTKYW  300

Query  960   LVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             LVKNSWG  WGE+GYIRMQ+D++A EGLCGIAM +SYP+A
Sbjct  301   LVKNSWGAQWGEEGYIRMQRDVDAAEGLCGIAMAASYPTA  340



>ref|XP_010906196.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=342

 Score =   459 bits (1182),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 232/347 (67%), Positives = 270/347 (78%), Gaps = 8/347 (2%)
 Frame = +3

Query  48    LRLSTMASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKT  227
             + L    S  + L + L   FA+ A   T+R L +  M  RHEQWM+Q+GRVY +  EK 
Sbjct  1     MTLPLTKSLCMALFVLLLCTFASHA---TARMLSEMTMHERHEQWMSQHGRVYGDSAEKE  57

Query  228   KRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTP  398
             +R+ IFK NVE IESFN AG   YKLG+N FADLT +EF A  NG+K P   ++      
Sbjct  58    RRFQIFKANVELIESFN-AGNSKYKLGVNQFADLTIEEFKAMMNGFK-PSSVNTFKATNV  115

Query  399   FRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQE  578
             FRYENV++VPT++DWR +GAVTP+KDQG  GCCWAFSAVAAMEGITKL TG LISLSEQE
Sbjct  116   FRYENVTAVPTSMDWRAEGAVTPIKDQGDYGCCWAFSAVAAMEGITKLKTGKLISLSEQE  175

Query  579   LVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisG  758
             LVDCDV G DQGCEGGLMDDAF FII N GLTTE+NYPY+G DG+C   KS + AA I G
Sbjct  176   LVDCDVAGEDQGCEGGLMDDAFEFIIRNGGLTTETNYPYKGIDGTCNTKKSFSHAASIKG  235

Query  759   YEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIA  938
             YEDVPANSE+AL  AV+NQPVSVAI+A G  FQFYSSGVFTG CGT+LDHGVTAVGYG A
Sbjct  236   YEDVPANSEAALLNAVSNQPVSVAIEASGYSFQFYSSGVFTGSCGTDLDHGVTAVGYGTA  295

Query  939   EDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              DGTKYWLVKNSWG+SWGE GY+RM++D+ AKEGLCGIAM++SYP+A
Sbjct  296   RDGTKYWLVKNSWGSSWGESGYVRMERDVAAKEGLCGIAMKASYPTA  342



>gb|KHN38752.1| Vignain [Glycine soja]
Length=308

 Score =   458 bits (1178),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 225/310 (73%), Positives = 255/310 (82%), Gaps = 5/310 (2%)
 Frame = +3

Query  159   MAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNK  338
             M  RHEQWMA +G+VY +  EK ++Y  FKENV+ IE+FN AG KPYKLGIN FADLTN+
Sbjct  1     MRERHEQWMAIHGKVYTHSYEKEQKYQTFKENVQRIEAFNNAGNKPYKLGINHFADLTNE  60

Query  339   EFIASRNGYKLPHECSSNT---PFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFS  509
             EF A  N +K  H CS  T    FRYENV++VP ++DWR+KGAVTP+KDQGQCGCCWAFS
Sbjct  61    EFKAI-NRFK-GHVCSKRTRTTTFRYENVTAVPASLDWRQKGAVTPIKDQGQCGCCWAFS  118

Query  510   AVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNY  689
             AVAA EGITKLSTG LISLSEQELVDCD KG+DQGCEGGLMDDAF FI+ NKGL  E+ Y
Sbjct  119   AVAATEGITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKGLAAEAIY  178

Query  690   PYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSS  869
             PY+G DG+C      N AA I GYEDVPANSESAL KAVANQPVSVAI+A G +FQFYS 
Sbjct  179   PYEGVDGTCNAKAEGNHAASIKGYEDVPANSESALLKAVANQPVSVAIEASGFEFQFYSG  238

Query  870   GVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCG  1049
             GVFTG CGT LDHGVTAVGYG+++DGTKYWLVKNSWG  WG+KGYIRMQ+D+ AKEGLCG
Sbjct  239   GVFTGSCGTNLDHGVTAVGYGVSDDGTKYWLVKNSWGVKWGDKGYIRMQRDVAAKEGLCG  298

Query  1050  IAMQSSYPSA  1079
             IAM +SYP+A
Sbjct  299   IAMLASYPNA  308



>gb|KHN07749.1| Vignain [Glycine soja]
Length=301

 Score =   457 bits (1175),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 220/302 (73%), Positives = 258/302 (85%), Gaps = 4/302 (1%)
 Frame = +3

Query  183   MAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNG  362
             M +YG+VYK+  E+ KR+ +FKENV YIE+FN A  K YKLGIN FADLTNKEFIA RNG
Sbjct  1     MTRYGKVYKDPQEREKRFRVFKENVNYIEAFNNAANKSYKLGINQFADLTNKEFIAPRNG  60

Query  363   YKLPHECSS---NTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGI  533
             +K  H CSS    T F++ENV++ P+TVDWR+KGAVTP+KDQGQCGCCWAFSAVAA EGI
Sbjct  61    FK-GHMCSSIIRTTTFKFENVTATPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGI  119

Query  534   TKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGs  713
               LS G LISLSEQELVDCD KG+DQGCEGGLMDDAF FII N GL TE+NYPY+G DG 
Sbjct  120   HALSAGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLNTEANYPYKGVDGK  179

Query  714   ckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECG  893
             C  ++++ +AA I+GYEDVPAN+E AL+KAVANQPVSVAIDA GSDFQFY SGVFTG CG
Sbjct  180   CNANEAAKNAATITGYEDVPANNEMALQKAVANQPVSVAIDASGSDFQFYKSGVFTGSCG  239

Query  894   TELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYP  1073
             TELDHGVTAVGYG+++DGT+YWLVKNS GT WGE+GYIRMQ+ ++++EGLCGIAMQ+SYP
Sbjct  240   TELDHGVTAVGYGVSDDGTEYWLVKNSRGTEWGEEGYIRMQRGVDSEEGLCGIAMQASYP  299

Query  1074  SA  1079
             +A
Sbjct  300   TA  301



>gb|EYU19037.1| hypothetical protein MIMGU_mgv1a018631mg [Erythranthe guttata]
Length=325

 Score =   457 bits (1176),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 227/324 (70%), Positives = 263/324 (81%), Gaps = 5/324 (2%)
 Frame = +3

Query  120   AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPY  299
             A  +T+RTL +  M  +HEQWM Q GR YK++ EK  RY IFK+NVEYI+S ++A    Y
Sbjct  3     ASQSTARTLPNKSMIEKHEQWMVQCGRTYKDDAEKAFRYKIFKQNVEYIQSVDEAQNWTY  62

Query  300   KLGINAFADLTNKEFIASRNGYKLPHECSSNT----PFRYENVSSVPTTVDWRKKGAVTP  467
             KL IN FADLTN+EF ASRNG+K   +   ++     FRY NVS+VP ++DW KKGAVTP
Sbjct  63    KLAINKFADLTNEEFQASRNGFKKGSQSIKSSFEVSSFRYGNVSAVPPSIDWTKKGAVTP  122

Query  468   VKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFT  647
             VKDQGQCGCCWAFSAVAA EG+ ++ TGNLISLSEQELVDCD    DQGC  GLMD+AF 
Sbjct  123   VKDQGQCGCCWAFSAVAATEGLNQIKTGNLISLSEQELVDCDTSE-DQGCNDGLMDNAFE  181

Query  648   FIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSV  827
             FII+N GLTTESNYPY+G DG+C   K S+  AKI+GYEDVPANSESAL KAVANQP+SV
Sbjct  182   FIISNNGLTTESNYPYEGVDGTCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISV  241

Query  828   AIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYI  1007
             AIDA GSDFQFYS GVF+G+CGTELDHGVTAVGYG+  DGTKYWLVKNSWG+SWGE GYI
Sbjct  242   AIDASGSDFQFYSGGVFSGQCGTELDHGVTAVGYGVTSDGTKYWLVKNSWGSSWGENGYI  301

Query  1008  RMQKDIEAKEGLCGIAMQSSYPSA  1079
             RMQ+DI+A EGLCGIAMQ+SYP+A
Sbjct  302   RMQRDIDAAEGLCGIAMQASYPTA  325



>ref|XP_004306813.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   457 bits (1177),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 231/341 (68%), Positives = 270/341 (79%), Gaps = 4/341 (1%)
 Frame = +3

Query  60    TMASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYN  239
             T  S  + L + L ++ A S+  ATSR+L D+L   R+EQW+A YGRVY +  EK  R+ 
Sbjct  4     TNQSKCICLALVLIMLGAWSSE-ATSRSLQDALAYGRYEQWIAHYGRVYNDINEKEDRFK  62

Query  240   IFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS-NTPFRYENV  416
             IFKEN  Y+ES NK G K YKL +N FADLTN+EF ASRN + L +ECS+  T F+YEN 
Sbjct  63    IFKENEAYVESSNKDGNKLYKLSLNQFADLTNEEFTASRNRF-LGNECSTKTTTFKYEN-  120

Query  417   SSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDV  596
             ++VP T+DWRKKGAVTPVKDQGQCG CWAFSAV AMEGIT+L+ G LISLSEQELVDCDV
Sbjct  121   ATVPATMDWRKKGAVTPVKDQGQCGSCWAFSAVGAMEGITQLTIGKLISLSEQELVDCDV  180

Query  597   KGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPA  776
              G+DQGC GGLMDDAF F+I N G+ TE+NYPY   DG+C   K +  AA I+G+EDVPA
Sbjct  181   NGVDQGCSGGLMDDAFQFVIQNHGINTEANYPYTAADGTCNAKKEAGHAATITGHEDVPA  240

Query  777   NSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKY  956
             NSESAL KAVANQP+SVAIDA G DFQ YSSGVFTG CGTELDHGVTAVGYG+  DGTKY
Sbjct  241   NSESALLKAVANQPISVAIDASGYDFQLYSSGVFTGTCGTELDHGVTAVGYGVDADGTKY  300

Query  957   WLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WLVKNSWG  WGE+GYIRMQ+D+ A EGLCGIAM++SYP+A
Sbjct  301   WLVKNSWGAQWGEQGYIRMQRDVAAPEGLCGIAMEASYPTA  341



>ref|XP_004294729.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   457 bits (1176),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 227/333 (68%), Positives = 265/333 (80%), Gaps = 3/333 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + +AL L+    +  ATSR+L D+L   R+EQW+A+Y RVYK+  EK   + IFKEN  Y
Sbjct  10    ICLALVLMLGAWSSEATSRSLQDALAYGRYEQWIARYRRVYKDVNEKEDHFKIFKENEAY  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP-FRYENVSSVPTTVD  440
             +ES NK G K YKL +N FADLTN+EF  SRN + L HECS+ T  F+YEN ++VP T+D
Sbjct  70    VESSNKDGNKLYKLSLNQFADLTNEEFTTSRNRF-LGHECSTKTTTFKYEN-ATVPATMD  127

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTPVKDQGQCG CWAFSAVAAMEGIT+L+TG LISLSEQELVDCDV G+DQGC 
Sbjct  128   WRKKGAVTPVKDQGQCGSCWAFSAVAAMEGITQLTTGKLISLSEQELVDCDVNGVDQGCS  187

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GG MDDAF F+I N G+ TE+NYPY   DG+C   K +  AA I+G+EDVPANSESAL K
Sbjct  188   GGEMDDAFKFVIQNHGINTEANYPYTAADGTCNAKKEAGHAATITGHEDVPANSESALLK  247

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQP++VAIDA G DFQ YSSGVFTG CGTELDHGVTAVGYG+  DGTKYWLVKNSWG
Sbjct  248   AVANQPIAVAIDASGFDFQLYSSGVFTGTCGTELDHGVTAVGYGVDADGTKYWLVKNSWG  307

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
               WGE+GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  308   AQWGEEGYIRMQRDVAAPEGLCGIAMDASYPTA  340



>emb|CDP18645.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   457 bits (1176),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 219/316 (69%), Positives = 259/316 (82%), Gaps = 2/316 (1%)
 Frame = +3

Query  138   RTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINA  317
             RTL D  M  RHEQWM+ +GRVY ++ EK +R+ IFK+NVE+IE+FN+AG +PYKLG+N 
Sbjct  22    RTLNDEAMVERHEQWMSLHGRVYTDDAEKERRFQIFKKNVEFIEAFNQAGKRPYKLGVNQ  81

Query  318   FADLTNKEFIASRNGYKLPHECS--SNTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCG  491
             FADLTN+EF ASRNG+K            F+YENV++VP T+DWRKKGAV P+KDQGQCG
Sbjct  82    FADLTNEEFKASRNGFKASSSLKLIRGASFKYENVTAVPATMDWRKKGAVAPIKDQGQCG  141

Query  492   CCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGL  671
              CWAFSA+AA EGITKLSTG LISLSEQE+VDCD    DQGC GG M+DAF FI+ NKG+
Sbjct  142   SCWAFSAIAATEGITKLSTGKLISLSEQEIVDCDRTSQDQGCNGGEMEDAFAFIVKNKGI  201

Query  672   TTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSD  851
              +E+ YPY   DG+C K+K ++ AAKI+GYE VPAN+E+AL KAVANQPVSV+IDA G  
Sbjct  202   ASEATYPYTAADGTCSKTKEASHAAKIAGYEKVPANNEAALLKAVANQPVSVSIDASGMA  261

Query  852   FQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEA  1031
             FQFY+SGVFTG+CGT+LDHGVTAVGYG A +GTKYWLVKNSWGTSWGE GYIRMQ+ I A
Sbjct  262   FQFYTSGVFTGDCGTDLDHGVTAVGYGKASNGTKYWLVKNSWGTSWGESGYIRMQRGISA  321

Query  1032  KEGLCGIAMQSSYPSA  1079
             KEGLCGIAM SSYP+A
Sbjct  322   KEGLCGIAMDSSYPTA  337



>ref|XP_008800073.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   456 bits (1172),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 226/323 (70%), Positives = 257/323 (80%), Gaps = 4/323 (1%)
 Frame = +3

Query  120   AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPY  299
             ++ A+SRTL D     +HEQWMA YGR YK+  EK +R+ IF+ NVE IESFN AG   +
Sbjct  21    SHAASSRTLTDVSTKEKHEQWMALYGRAYKDAAEKERRFKIFQANVELIESFN-AGNHKF  79

Query  300   KLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFRYENVSSVPTTVDWRKKGAVTPV  470
             KLG N FADLTN+EF A           SS      F+YEN ++VP ++DWR KGAVTP+
Sbjct  80    KLGANQFADLTNEEFRAVHTXXXXXXXASSGMATKSFKYENATAVPVSMDWRAKGAVTPI  139

Query  471   KDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTF  650
             KDQGQCGCCWAFSAVAAMEGITKLSTG LISLSEQELVDCD KG DQGC GGLMDDAF F
Sbjct  140   KDQGQCGCCWAFSAVAAMEGITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKF  199

Query  651   IINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVA  830
             II N GLTTE+NYPY+  DG+C   KS + AA I GYEDVPANSE+AL KAVANQPVSVA
Sbjct  200   IIKNGGLTTEANYPYEAADGTCNAGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVA  259

Query  831   IDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIR  1010
             IDAGGS FQ YSSGVFTG+CGT+LDHGVTAVGY    DGTKYWLVKNSWG+SWGE GYIR
Sbjct  260   IDAGGSAFQLYSSGVFTGDCGTDLDHGVTAVGYDKTSDGTKYWLVKNSWGSSWGENGYIR  319

Query  1011  MQKDIEAKEGLCGIAMQSSYPSA  1079
             M++D++AKEGLCGIAM++SYP+A
Sbjct  320   MERDVDAKEGLCGIAMEASYPTA  342



>gb|KHN07750.1| KDEL-tailed cysteine endopeptidase CEP1 [Glycine soja]
Length=309

 Score =   454 bits (1167),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 221/310 (71%), Positives = 253/310 (82%), Gaps = 4/310 (1%)
 Frame = +3

Query  159   MAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNK  338
             M  RHEQWMA+Y +VYK+  E+ KR+ IFKENV YIE+FN A  K YKL IN FADLTN+
Sbjct  1     MYERHEQWMARYAKVYKDPQEREKRFRIFKENVNYIETFNSADNKSYKLDINQFADLTNE  60

Query  339   EFIASRNGYKLPHECSS---NTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFS  509
             EFIA RN +K  H CSS    T F+YENV+++P+TVDWR+KGAVTP+KDQGQCGCCWAFS
Sbjct  61    EFIAPRNRFK-GHMCSSITRTTTFKYENVTAIPSTVDWRQKGAVTPIKDQGQCGCCWAFS  119

Query  510   AVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNY  689
             AVAA EGI  L+ G LISLSEQE+VDCD KG DQGC GG MD AF FII N GL TE NY
Sbjct  120   AVAATEGIHALNAGKLISLSEQEVVDCDTKGQDQGCAGGFMDGAFKFIIQNHGLNTEPNY  179

Query  690   PYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSS  869
             PY+  DG C    ++N AA I+GYEDVP N+E AL+KAVANQPVSVAIDA GSDFQFY S
Sbjct  180   PYKAADGKCNAKAAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYKS  239

Query  870   GVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCG  1049
             GVFTG CGTELDHGVTAVGYG++ DGT+YWLVKNSWGT WGE+GYIRMQ+ ++AKEGLCG
Sbjct  240   GVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNSWGTEWGEEGYIRMQRGVKAKEGLCG  299

Query  1050  IAMQSSYPSA  1079
             IAM +SYP+A
Sbjct  300   IAMMASYPTA  309



>gb|KHN33962.1| Vignain [Glycine soja]
Length=309

 Score =   454 bits (1167),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 217/310 (70%), Positives = 251/310 (81%), Gaps = 4/310 (1%)
 Frame = +3

Query  159   MAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNK  338
             M  RHE+WM +Y +VYK+  E+ +R+ IFKENV YIE+FN A  KPY LGIN FADLTN+
Sbjct  1     MYERHEEWMGRYAKVYKDPQERERRFKIFKENVNYIEAFNNAANKPYTLGINQFADLTNE  60

Query  339   EFIASRNGYKLPHECSS---NTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFS  509
             EFIA RN +K  H CSS    T F+YENV+++P+TVDWR+KGAVTP+KDQGQCGCCWAFS
Sbjct  61    EFIAPRNRFK-GHMCSSITRTTTFKYENVTAIPSTVDWRQKGAVTPIKDQGQCGCCWAFS  119

Query  510   AVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNY  689
             AVAA EGI  LS G LISLSEQE+VDCD KG DQGC GG MD AF FII N GL  E NY
Sbjct  120   AVAATEGIHALSAGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNNEPNY  179

Query  690   PYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSS  869
             PY+  DG C    ++N  A I+GYEDVP N+E AL+KAVANQPVSVAIDA GSDFQFY S
Sbjct  180   PYKAVDGKCNAKAAANHVATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYQS  239

Query  870   GVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCG  1049
             GVFTG CGTELDHGVTAVGYG++ DGT+YWLVKNSWGT WGE+GYIRMQ+ ++A+EGLCG
Sbjct  240   GVFTGSCGTELDHGVTAVGYGVSADGTEYWLVKNSWGTEWGEEGYIRMQRGVKAEEGLCG  299

Query  1050  IAMQSSYPSA  1079
             IAM +SYP+A
Sbjct  300   IAMMASYPTA  309



>ref|XP_009798361.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=339

 Score =   455 bits (1170),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 228/334 (68%), Positives = 265/334 (79%), Gaps = 3/334 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             +L  A+ LV      L TSR L ++ +  +HEQWM QYGRVY ++ EKT+R   FK+N+E
Sbjct  8     RLNFAILLVLGLCVSLVTSRALYEASITEKHEQWMTQYGRVYTDDTEKTERLETFKQNLE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPF-RYENVSSVPTTV  437
             YIES NK  T+ YKLGIN FAD+TN+EF ASRNGY++  +    T F +YENV+ V  ++
Sbjct  68    YIESINKDVTRTYKLGINQFADMTNEEFKASRNGYRISSQQKIKTTFFQYENVT-VAYSM  126

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVT +KDQGQCGCCWAFSAVAA EGI K+ TG LISLSEQELVDCD    +QGC
Sbjct  127   DWRKKGAVTKIKDQGQCGCCWAFSAVAATEGINKIKTGKLISLSEQELVDCDTSS-NQGC  185

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMDDAF +II N GLT+ESNYPY+G DG+CK  K SN  AKI GY+DVP NSE AL 
Sbjct  186   EGGLMDDAFKYIIKNHGLTSESNYPYKGIDGTCKTEKESNHVAKIRGYKDVPENSELALL  245

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
             KAVANQPVSVAIDA GSDFQFYSSG+FTG+CGTELDHGVT VGYG  +DGTKYW+VKNSW
Sbjct  246   KAVANQPVSVAIDASGSDFQFYSSGIFTGKCGTELDHGVTTVGYGATKDGTKYWIVKNSW  305

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G SWGE GYIRM++DI AK GLCGIAM++SYP A
Sbjct  306   GVSWGENGYIRMKRDIVAKTGLCGIAMKASYPIA  339



>gb|KHN13720.1| Vignain [Glycine soja]
Length=309

 Score =   452 bits (1164),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 218/310 (70%), Positives = 258/310 (83%), Gaps = 4/310 (1%)
 Frame = +3

Query  159   MAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNK  338
             M  RHE+WMA+Y +VYK+  E+ KR+ IFKENV YIE+FN A  KPYKLGIN FADLTN+
Sbjct  1     MYERHEEWMARYAKVYKDPEEREKRFKIFKENVNYIEAFNNAADKPYKLGINQFADLTNE  60

Query  339   EFIASRNGYKLPHECSS---NTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFS  509
             EFIA RN +K  H CSS    T F+YENV+++P+TVDWR+KGAVTP+KDQGQCGCCWAFS
Sbjct  61    EFIAPRNRFK-GHMCSSITRTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQCGCCWAFS  119

Query  510   AVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNY  689
             AVAA EGI  L++G LISLSEQE+VDCD KG DQGC GG MD AF FII N GL TE+NY
Sbjct  120   AVAATEGIHALNSGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNTEANY  179

Query  690   PYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSS  869
             PY+  DG C  ++++N AA I+GYEDVP N+E AL+KAVANQPVSVAIDA GSDFQFY +
Sbjct  180   PYKAVDGKCNANEAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYKT  239

Query  870   GVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCG  1049
             GVFTG CGT+LDHGVTAVGYG++ DGT+YWLVKNSWGT WGE+GYI MQ+ ++A+EGLCG
Sbjct  240   GVFTGSCGTQLDHGVTAVGYGVSADGTQYWLVKNSWGTEWGEEGYIMMQRGVKAQEGLCG  299

Query  1050  IAMQSSYPSA  1079
             IAM +SYP+A
Sbjct  300   IAMMASYPTA  309



>ref|XP_010052206.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   454 bits (1167),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 222/335 (66%), Positives = 271/335 (81%), Gaps = 2/335 (1%)
 Frame = +3

Query  81    KLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
             K ++  A+V    A  A +R L +  M  RHEQWMA++GRVYK + EK +R+ IFK NVE
Sbjct  8     KFILVAAMVLGLYASQAWARELRELSMRERHEQWMARHGRVYKADGEKERRFMIFKNNVE  67

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP--FRYENVSSVPTT  434
             +IESFN+  T+PYKLGIN FADLTN EF A+RNGYK     SS+ P  FRYENV++VP+T
Sbjct  68    FIESFNENNTRPYKLGINGFADLTNDEFKATRNGYKRSSSVSSSGPKSFRYENVTAVPST  127

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             VDWR+KGAVTPVK+QGQCGCCWAFSAVAA EGI +L+TGNL+SLS Q+LVDCD KG ++G
Sbjct  128   VDWRQKGAVTPVKEQGQCGCCWAFSAVAATEGIHQLTTGNLVSLSVQQLVDCDTKGDNRG  187

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             C GG ++ AF FII+N GLTTE NYPY+   G+C   ++ + AAKI+GYEDVP+NSESAL
Sbjct  188   CAGGFVNAAFKFIIDNDGLTTEDNYPYEAVKGTCDAGQAESPAAKITGYEDVPSNSESAL  247

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
              +AVANQPVSVAIDA GS FQFYS GVFTG+C T+LDHGVT VGYG ++DGTKYWLVKNS
Sbjct  248   SQAVANQPVSVAIDADGSHFQFYSGGVFTGDCQTDLDHGVTVVGYGTSDDGTKYWLVKNS  307

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WG  WGE GYIRM++DI+A EGLCGIA++++YP+A
Sbjct  308   WGAGWGENGYIRMKRDIDAVEGLCGIAIRAAYPTA  342



>ref|XP_010038688.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW47321.1| hypothetical protein EUGRSUZ_K01109 [Eucalyptus grandis]
Length=340

 Score =   454 bits (1167),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 227/338 (67%), Positives = 263/338 (78%), Gaps = 5/338 (1%)
 Frame = +3

Query  72    NSLKLLIALALVFATSAYLATSRTL-LDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFK  248
             N   +L+ L  +    A+ A  RT   D  M   H QWMA+YGRVYK+  E+  R+ IFK
Sbjct  6     NQYFILVPLVFLLGAWAHQAAGRTFQRDDPMYEMHGQWMARYGRVYKDVEERQSRFEIFK  65

Query  249   ENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP-FRYENVSSV  425
              N + IESFN A  KPY+LG+N FADLTN+EF A RN +K  H CS+    FRYEN+++V
Sbjct  66    ANAQGIESFNHANDKPYRLGVNQFADLTNEEFKA-RNRFK-SHMCSTEAASFRYENITAV  123

Query  426   PTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGI  605
             P+++DWRKKGAVTPVK+QGQCGCCWAFSAVAA+EG+ +++TG LISLSEQELVDCDV G 
Sbjct  124   PSSMDWRKKGAVTPVKNQGQCGCCWAFSAVAAVEGVNEITTGKLISLSEQELVDCDVGGQ  183

Query  606   DQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSE  785
             DQGCEGG MD AF F+    GLTTE+NYPY GTDG C     SN A  I GYEDVPANSE
Sbjct  184   DQGCEGGWMDSAFQFV-EKHGLTTETNYPYNGTDGKCNVKSESNRAVIIKGYEDVPANSE  242

Query  786   SALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLV  965
              AL KAVA QPVSVAIDAGG DFQFYSSGVFTG CGTELDHGVTAVGYG ++DGTK+WLV
Sbjct  243   GALLKAVAKQPVSVAIDAGGFDFQFYSSGVFTGACGTELDHGVTAVGYGTSDDGTKFWLV  302

Query  966   KNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             KNSWG  WGEKGYIRMQ+D+ AKEGLCGIAM++SYP+A
Sbjct  303   KNSWGEEWGEKGYIRMQRDVSAKEGLCGIAMKASYPTA  340



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score =   454 bits (1168),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 224/334 (67%), Positives = 262/334 (78%), Gaps = 2/334 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
              +IA  ++    A  ATSRTL ++ M  RHEQWM QYGRVYK+E EK+ R+ IF +NV++
Sbjct  28    FMIAALILLGAWACQATSRTLPEASMFERHEQWMIQYGRVYKDEAEKSVRFQIFMDNVKF  87

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLP--HECSSNTPFRYENVSSVPTTV  437
             IE FNK G + YKL +N FAD TN+EF ASRNGYK+      S  T FRYENV++VP+++
Sbjct  88    IEEFNKDGRQSYKLAVNEFADQTNEEFQASRNGYKMAVSSRPSQTTLFRYENVTAVPSSM  147

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVTPVKDQGQCG CWAFS +AA EGITKL TG LISLSEQELVDCD  G DQGC
Sbjct  148   DWRKKGAVTPVKDQGQCGSCWAFSTIAATEGITKLKTGKLISLSEQELVDCDKTGEDQGC  207

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGG M+D F FI+ NKG+  E++YPY   DG+C   + ++ AAKISGYE VPANSE+AL 
Sbjct  208   EGGYMEDGFEFIVKNKGIALEASYPYTAADGTCNSKEEASRAAKISGYEKVPANSETALL  267

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
             KAVANQPVSV+IDA G  FQFYSSGVFTGECGT+LDHGVTAVGYG   DGTKYWLVKNSW
Sbjct  268   KAVANQPVSVSIDASGVAFQFYSSGVFTGECGTDLDHGVTAVGYGKTSDGTKYWLVKNSW  327

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G SWG+ GYI MQ+ + AK GLCGIAM +SYP+A
Sbjct  328   GASWGDSGYIMMQRGVAAKGGLCGIAMDASYPTA  361



>ref|XP_008368631.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   453 bits (1165),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 226/334 (68%), Positives = 262/334 (78%), Gaps = 3/334 (1%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + + L L+    +  ATSR+L D+ M  R+EQW+A+YGRVY +  E   R+ IFKE V +
Sbjct  12    MCLGLILMLGAWSSQATSRSLKDASMYGRYEQWLARYGRVYNDINEMETRFKIFKEXVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSS-VPTTV  437
             IE  NK   KPYKL +N F DLTN+EF ASRNG+K  HECS+ T  F+YENV++ +P T+
Sbjct  72    IEXSNKDANKPYKLSVNQFXDLTNEEFKASRNGFK-GHECSTKTTSFKYENVTAALPATM  130

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRKKGAVTP KDQGQCGCCWAFSAVAA EG T+L+TG LISLSEQELVDCD  G DQGC
Sbjct  131   DWRKKGAVTPXKDQGQCGCCWAFSAVAATEGXTQLTTGXLISLSEQELVDCDTAGEDQGC  190

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
             EGGLMDDAF F   N G++TE NYPY G  G+C   K +  AAKI+G+EDVPANSE AL 
Sbjct  191   EGGLMDDAFQFXQQNHGISTEXNYPYNGVXGTCNTKKEAIIAAKITGFEDVPANSEKALL  250

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
              AVA+QPVSVAIDA GSDFQFYSSGVFTG CGT LDHGVTAVGYG++EDGTKYWLVKNSW
Sbjct  251   TAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAVGYGVSEDGTKYWLVKNSW  310

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  311   GAEWGEAGYIRMQRDVAAXEGLCGIAMSASYPTA  344



>emb|CDP05747.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   452 bits (1163),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 231/339 (68%), Positives = 261/339 (77%), Gaps = 8/339 (2%)
 Frame = +3

Query  78    LKLLIALA--LVFATSAYLATSRTLLD---SLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             LKL+  L    V    A  ATSR L +   + M   HE+WMA YGRVYK++ EK KR+ I
Sbjct  5     LKLMPILVSFFVLVIGASQATSRLLHENDEAAMVEEHEKWMATYGRVYKDDAEKAKRFQI  64

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSS  422
             FK+N EYIESFNKAGTK Y L IN FAD+TN+EF A RNGYK P   S +  FRYENV+ 
Sbjct  65    FKKNFEYIESFNKAGTKTYSLSINRFADMTNEEFRA-RNGYK-PFTSSKSASFRYENVTD  122

Query  423   VPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKG  602
             VP+++DWR++GAVTPVK+QG CGCCWAFSAVAA EG+ +L TG LISLSEQELVDCD   
Sbjct  123   VPSSLDWREEGAVTPVKNQGDCGCCWAFSAVAATEGVHQLKTGELISLSEQELVDCDTDE  182

Query  603   IDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANS  782
              D+GCEGGLMD AF+FII N GLTTES+YPY G DGSC  ++    AA I  YEDVP N+
Sbjct  183   -DRGCEGGLMDSAFSFIIKNHGLTTESHYPYLGIDGSCSANEEHPPAATIKSYEDVPENN  241

Query  783   ESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWL  962
             ESAL KAVANQPVSVAIDAGG DF FYSSGVFTGECGT LDHG TAVGYGI+EDG KYWL
Sbjct  242   ESALLKAVANQPVSVAIDAGGQDFAFYSSGVFTGECGTHLDHGATAVGYGISEDGIKYWL  301

Query  963   VKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             VKNSWG  WGE GYIRMQ+DI   +GLCGIAM +SYP A
Sbjct  302   VKNSWGVDWGEDGYIRMQRDIHDVQGLCGIAMNASYPIA  340



>ref|XP_003596314.1| Cysteine proteinase [Medicago truncatula]
 gb|AES66565.1| papain family cysteine protease [Medicago truncatula]
Length=341

 Score =   450 bits (1158),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 231/340 (68%), Positives = 268/340 (79%), Gaps = 1/340 (0%)
 Frame = +3

Query  63    MASNSLKLL-IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYN  239
             + +N L  +  AL L     ++ ATSRTL +  M   HEQWM Q+G+VYK   EK KR+ 
Sbjct  2     VMNNQLHYIPFALFLCLGLLSFQATSRTLQNDPMYEMHEQWMVQHGKVYKAAHEKQKRFG  61

Query  240   IFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVS  419
             IFKENV YIE+FN  G K YKLG+N FADLTN EFIA+RN +      S  T F+Y+NVS
Sbjct  62    IFKENVNYIEAFNNVGNKSYKLGLNHFADLTNHEFIAARNKFNGYLHGSIITTFKYKNVS  121

Query  420   SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVK  599
              VP+ VDWR++GAVTPVK+QGQCGCCWAFSAVA+ EGI KL+TGNL+SLSEQELVDCD  
Sbjct  122   DVPSAVDWRQEGAVTPVKNQGQCGCCWAFSAVASTEGIHKLTTGNLVSLSEQELVDCDTN  181

Query  600   GIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPAN  779
             G DQGCEGGLMDDAF FII N GL+TE+ YPYQG DG+C K++  +SAA ISGYE+VP N
Sbjct  182   GEDQGCEGGLMDDAFEFIIQNNGLSTEAEYPYQGVDGTCNKTEVGSSAATISGYENVPVN  241

Query  780   SESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYW  959
              E AL+KAVANQPVSVAIDA GSDFQFY SGVFTG CGTELDHGV  VGYG+ ED T+YW
Sbjct  242   DEQALQKAVANQPVSVAIDASGSDFQFYKSGVFTGSCGTELDHGVAVVGYGVGEDETEYW  301

Query  960   LVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             LVKNSWGT WGE+GYIRMQ+ ++A EGLCGIAMQ SYP+A
Sbjct  302   LVKNSWGTQWGEEGYIRMQRGVDASEGLCGIAMQPSYPTA  341



>ref|XP_006592475.1| PREDICTED: vignain-like [Glycine max]
Length=336

 Score =   450 bits (1157),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 218/330 (66%), Positives = 261/330 (79%), Gaps = 4/330 (1%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
             IAL L+ A       SR L ++ M  RHEQWMA+YG+VYK+  EK KR+ IFK NVE+IE
Sbjct  11    IALFLLLALGIPQMMSRKLHETSMRERHEQWMAEYGKVYKDAAEKEKRFLIFKHNVEFIE  70

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSSVPTTVDWRK  449
             SFN A  KPYKLG+N  ADLT +EF ASRNG K P+E S+ TPF+YENV+++P  +DWR 
Sbjct  71    SFNAAANKPYKLGVNHLADLTVEEFKASRNGLKRPYELST-TPFKYENVTAIPAAIDWRT  129

Query  450   KGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGL  629
             KGAVT +KDQGQCG CWAFS VAA EGI +++TG L+SLSEQELVDCD KG+DQGCEGG 
Sbjct  130   KGAVTSIKDQGQCGSCWAFSTVAATEGIHQITTGKLVSLSEQELVDCDTKGVDQGCEGGY  189

Query  630   MDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVA  809
             M+D F FII N G+T+E+NYPY+  DG  K +K+++  A+I GYE VP NSE  L+KAVA
Sbjct  190   MEDGFEFIIKNGGITSEANYPYKAVDG--KCNKATSPVAQIKGYEKVPPNSEKTLQKAVA  247

Query  810   NQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSW  989
             NQPVSV+IDA G  F FYSSG++ GECGTELDHGVTAVGYGIA +GT YWLVKNSWGT W
Sbjct  248   NQPVSVSIDANGEGFMFYSSGIYNGECGTELDHGVTAVGYGIA-NGTDYWLVKNSWGTQW  306

Query  990   GEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GEKGY+RMQ+ + AK GLCGIA+ SSYP+A
Sbjct  307   GEKGYVRMQRGVAAKHGLCGIALDSSYPTA  336



>ref|XP_006380495.1| hypothetical protein POPTR_0007s07290g [Populus trichocarpa]
 gb|ERP58292.1| hypothetical protein POPTR_0007s07290g [Populus trichocarpa]
Length=321

 Score =   449 bits (1155),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 228/334 (68%), Positives = 267/334 (80%), Gaps = 24/334 (7%)
 Frame = +3

Query  87    LIALALVFATSAY--LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVE  260
              + LAL+F + A+   +T+RTLLD+ M  RHEQWM QYGRVYK++ E+  RY+IFKENV 
Sbjct  9     FVCLALLFISGAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDTERATRYSIFKENVA  68

Query  261   YIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTTV  437
              I++FN    K YKLG+N FADLTN+EF ASRN +K  H CS    PFRYENVS+VP+T+
Sbjct  69    RIDAFNSQTGKSYKLGVNQFADLTNEEFKASRNRFK-GHMCSPQAGPFRYENVSAVPSTM  127

Query  438   DWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGC  617
             DWRK+GAVTPVKDQGQCGCCWAFSAVAAMEGI KL+TG LISLSEQE+VDCD KG DQGC
Sbjct  128   DWRKEGAVTPVKDQGQCGCCWAFSAVAAMEGINKLTTGKLISLSEQEVVDCDTKGEDQGC  187

Query  618   EGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALE  797
              G                   +NYPY+GTDG+C  +K++  AAKI+G+EDVPANSE+AL 
Sbjct  188   NG-------------------ANYPYKGTDGTCNTNKAAIHAAKITGFEDVPANSEAALM  228

Query  798   KAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
             KAVA QPVSVAIDAGGSDFQFYSSG+FTG C T+LDHGVTAVGYG++ DG+KYWLVKNSW
Sbjct  229   KAVAKQPVSVAIDAGGSDFQFYSSGIFTGSCDTQLDHGVTAVGYGVS-DGSKYWLVKNSW  287

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G  WGE+GYIRMQKDI AKEGLCGIAMQ+SYP+A
Sbjct  288   GAQWGEEGYIRMQKDISAKEGLCGIAMQASYPTA  321



>ref|XP_007213554.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
 gb|EMJ14753.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
Length=343

 Score =   450 bits (1157),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 221/338 (65%), Positives = 270/338 (80%), Gaps = 5/338 (1%)
 Frame = +3

Query  75    SLKLLIALALVFATSAYLATSRTLLDSL--MAVRHEQWMAQYGRVYKNEVEKTKRYNIFK  248
             S  +L+ L LV    A  A  RTLLD+   M  RHEQWMA+Y  +YK++ E+ KR+ IFK
Sbjct  8     SSSILLTL-LVLGVWASQANCRTLLDAHTSMLDRHEQWMARYVPIYKDDEEREKRFQIFK  66

Query  249   ENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLP-HECSSNTPFRYENVSSV  425
             +NVE+IESFN A  +PYKL IN FAD +++EF ASRN Y+   +  SS TPFRYENV+++
Sbjct  67    DNVEFIESFNYASNQPYKLNINGFADQSHEEFQASRNRYRTSLNTMSSKTPFRYENVTAI  126

Query  426   PTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGI  605
             P+++DWRKKGAVTP+KDQG+CGCCWAFSAVAA EG TKL +G L+SLSEQELVDCD +G 
Sbjct  127   PSSMDWRKKGAVTPIKDQGECGCCWAFSAVAATEGTTKLKSGKLVSLSEQELVDCDTQGE  186

Query  606   DQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSE  785
             +QGCEGGLMDDAF F++ NKGL  E+NYPY+G DG C K+K +  AAKI+GYEDVPAN E
Sbjct  187   NQGCEGGLMDDAFKFVMRNKGLAAEANYPYRGIDGICNKNKVAYHAAKITGYEDVPAN-E  245

Query  786   SALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLV  965
              AL KAVANQPVSVAIDAGG +FQFYS G+ TG+CGT L+HGVT VGYG   DGTKYWLV
Sbjct  246   LALLKAVANQPVSVAIDAGGYEFQFYSRGILTGDCGTHLNHGVTVVGYGTGADGTKYWLV  305

Query  966   KNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             KNSWG  WGE GY+R+Q+D+  ++GLCGIAM++SYP+A
Sbjct  306   KNSWGAEWGEGGYVRIQRDVHTRQGLCGIAMKASYPTA  343



>ref|XP_003527350.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003556993.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   449 bits (1156),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 219/343 (64%), Positives = 264/343 (77%), Gaps = 4/343 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATS--AYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MA+      I+LAL F     A+   SRTL D+ M  RHEQWMA+YG+VYK+  EK KR+
Sbjct  1     MATKIQFHHISLALFFCLGFLAFQVASRTLQDASMYERHEQWMARYGKVYKDPEEKEKRF  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGY--KLPHECSSNTPFRYE  410
              +FKENV YIE+FN A  KPYKLGIN FADLT++EFI  RN +        +  T F+YE
Sbjct  61    RVFKENVNYIEAFNNAANKPYKLGINQFADLTSEEFIVPRNRFNGHTRSSNTRTTTFKYE  120

Query  411   NVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDC  590
             NV+ +P ++DWR+KGAVTP+K+QG CGCCWAFSA+AA EGI K+STG L+SLSEQE+VDC
Sbjct  121   NVTVLPDSIDWRQKGAVTPIKNQGSCGCCWAFSAIAATEGIHKISTGKLVSLSEQEVVDC  180

Query  591   DVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDV  770
             D KG D GCEGG MD AF FII N G+ TE++YPY+G DG C   + +  AA I+GYEDV
Sbjct  181   DTKGTDHGCEGGYMDGAFKFIIQNHGINTEASYPYKGVDGKCNIKEEAVHAATITGYEDV  240

Query  771   PANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGT  950
             P N+E AL+KAVANQPVSVAIDA G+DFQFY SG+FTG CGTELDHGVTAVGYG   +GT
Sbjct  241   PINNEKALQKAVANQPVSVAIDASGADFQFYKSGIFTGSCGTELDHGVTAVGYGENNEGT  300

Query  951   KYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             KYWLVKNSWGT WGE+GYI MQ+ ++A EG+CGIAM +SYP+A
Sbjct  301   KYWLVKNSWGTEWGEEGYIMMQRGVKAVEGICGIAMMASYPTA  343



>gb|KCW76137.1| hypothetical protein EUGRSUZ_D00513 [Eucalyptus grandis]
Length=328

 Score =   447 bits (1151),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 220/328 (67%), Positives = 267/328 (81%), Gaps = 2/328 (1%)
 Frame = +3

Query  102   LVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNK  281
             +V    A  A +R L +  M  RHEQWMA++GRVYK + EK +R+ IFK NVE+IESFN+
Sbjct  1     MVLGLYASQAWARELRELSMRERHEQWMARHGRVYKADGEKERRFMIFKNNVEFIESFNE  60

Query  282   AGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP--FRYENVSSVPTTVDWRKKG  455
               T+PYKLGIN FADLTN EF A+RNGYK     SS+ P  FRYENV++VP+TVDWR+KG
Sbjct  61    NNTRPYKLGINGFADLTNDEFKATRNGYKRSSSVSSSGPKSFRYENVTAVPSTVDWRQKG  120

Query  456   AVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMD  635
             AVTPVK+QGQCGCCWAFSAVAA EGI +L+TGNL+SLS Q+LVDCD KG ++GC GG ++
Sbjct  121   AVTPVKEQGQCGCCWAFSAVAATEGIHQLTTGNLVSLSVQQLVDCDTKGDNRGCAGGFVN  180

Query  636   DAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQ  815
              AF FII+N GLTTE NYPY+   G+C   ++ + AAKI+GYEDVP+NSESAL +AVANQ
Sbjct  181   AAFKFIIDNDGLTTEDNYPYEAVKGTCDAGQAESPAAKITGYEDVPSNSESALSQAVANQ  240

Query  816   PVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGE  995
             PVSVAIDA GS FQFYS GVFTG+C T+LDHGVT VGYG ++DGTKYWLVKNSWG  WGE
Sbjct  241   PVSVAIDADGSHFQFYSGGVFTGDCQTDLDHGVTVVGYGTSDDGTKYWLVKNSWGAGWGE  300

Query  996   KGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              GYIRM++DI+A EGLCGIA++++YP+A
Sbjct  301   NGYIRMKRDIDAVEGLCGIAIRAAYPTA  328



>emb|CBI21973.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   446 bits (1148),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 229/342 (67%), Positives = 270/342 (79%), Gaps = 25/342 (7%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MAS +    I LAL+F  +A+   AT+R L ++ M  RHE WM QYGR YK+  EK+KRY
Sbjct  1     MASVNQYQYICLALLFVLAAWASQATARNLHEASMYERHEDWMVQYGREYKDADEKSKRY  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN-TPFRYEN  413
              IFK+NV  IESFNKA  K YKL IN FADLTN+EF ASRN +K  H CS+  T F+YEN
Sbjct  61    KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRNRFK-AHICSTEATSFKYEN  119

Query  414   VSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
             V++VP+TVDWRKKGAVTP+KDQGQCG CWAFSAVAAMEGIT+LSTG LISLSEQELVDCD
Sbjct  120   VTAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCD  179

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
               G DQGC                     +NYPY GTDG+C + K+++ AAKI+GYEDVP
Sbjct  180   TSGEDQGC---------------------TNYPYAGTDGTCNRKKAAHPAAKINGYEDVP  218

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E AL+KAVA+QP++VAIDAGGS+FQFYSSGVFTG+CGTELDHGV+AVGYG ++DG K
Sbjct  219   ANNEKALQKAVAHQPIAVAIDAGGSEFQFYSSGVFTGQCGTELDHGVSAVGYGTSDDGMK  278

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWLVKNSWGT WGE+GYIRMQ+D+ AKEGLCGIAMQ+SYP+A
Sbjct  279   YWLVKNSWGTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  320



>gb|KHN32068.1| Vignain [Glycine soja]
Length=309

 Score =   445 bits (1145),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 212/309 (69%), Positives = 254/309 (82%), Gaps = 2/309 (1%)
 Frame = +3

Query  159   MAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNK  338
             M  RHE+WMA+Y +VYK+  E+ KR+ IFKENV YIE+FN A  KPYKLGIN FADLTN+
Sbjct  1     MYERHEEWMARYAKVYKDPEEREKRFKIFKENVNYIEAFNNAANKPYKLGINQFADLTNE  60

Query  339   EFIASRNGY--KLPHECSSNTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSA  512
             EFI  RN +   +     + T F+YENV+++P+TVDWR+KGAVTP+KDQGQCGCCWAFSA
Sbjct  61    EFIVPRNRFNGHMRFSFITTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQCGCCWAFSA  120

Query  513   VAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYP  692
             VAA EGI  L++G LISLSEQE+VDCD KG DQGC GG MD AF FII N GL TE+NYP
Sbjct  121   VAATEGIHALNSGKLISLSEQEVVDCDTKGEDQGCAGGFMDGAFKFIIQNHGLNTEANYP  180

Query  693   YQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSG  872
             Y+  DG C  ++++N AA I+GYEDVP N+E AL+KAVANQPVSVAIDA GSDFQFY +G
Sbjct  181   YKAVDGKCNANEAANHAATITGYEDVPVNNEKALQKAVANQPVSVAIDASGSDFQFYKTG  240

Query  873   VFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGI  1052
             VFTG CGT+LDHGVTAVGYG++ DGT+YWLVKNSWGT WGE+GYI MQ+ ++A+EGLCGI
Sbjct  241   VFTGSCGTQLDHGVTAVGYGVSADGTQYWLVKNSWGTEWGEEGYIMMQRGVKAQEGLCGI  300

Query  1053  AMQSSYPSA  1079
             AM +SYP+A
Sbjct  301   AMMASYPTA  309



>emb|CBI21976.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   445 bits (1145),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 228/342 (67%), Positives = 269/342 (79%), Gaps = 23/342 (7%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MAS +    I LAL+F  +A+   AT+R L ++ M  RHE WMAQYGRVYK+  EK+KRY
Sbjct  1     MASVNQYQYICLALLFVLAAWASQATARNLHEASMYERHEDWMAQYGRVYKDADEKSKRY  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN-TPFRYEN  413
              IFK+NV  IESFNKA  K YKL IN FADLTN+EF  SRN +K  H CS+  T F+YEN
Sbjct  61    KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFGTSRNRFK-AHICSTEATSFKYEN  119

Query  414   VSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
             V++VP+T+DWRKKGAVTP+KDQGQCG CWAFSAVAAMEGIT+LSTG LISLSEQELVDCD
Sbjct  120   VTAVPSTIDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCD  179

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
               G DQGC G                   +NYPY GTDG+C + K+++ AAKI+GYEDVP
Sbjct  180   TSGEDQGCNG-------------------ANYPYAGTDGTCNRKKAAHPAAKINGYEDVP  220

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E AL+KAV +QP++VAIDAGG +FQFYSSGVFTG+CGTELDHGV AVGYG ++DG K
Sbjct  221   ANNEKALQKAVVHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMK  280

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWLVKNSWGT WGE+GYIRMQ+D+ AKEGLCGIAMQ+SYP+A
Sbjct  281   YWLVKNSWGTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  322



>ref|XP_007132814.1| hypothetical protein PHAVU_011G126700g [Phaseolus vulgaris]
 gb|ESW04808.1| hypothetical protein PHAVU_011G126700g [Phaseolus vulgaris]
Length=333

 Score =   444 bits (1142),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 216/340 (64%), Positives = 268/340 (79%), Gaps = 8/340 (2%)
 Frame = +3

Query  63    MASNSLK-LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYN  239
             MAS + K  ++AL L+ A       SR L ++ +  RHE WM +YG+VYK+  EK KR+ 
Sbjct  1     MASTTQKQYILALFLLLAVGISQVMSRKLHETSLRERHENWMQEYGKVYKDAAEKEKRFL  60

Query  240   IFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVS  419
             IFK+NVE+IESFN  G KPYKLG+N FADLT +EF ASRNG+K PHE S+ TPF+YENV+
Sbjct  61    IFKDNVEFIESFNAVGNKPYKLGVNHFADLTVQEFKASRNGFKRPHEFST-TPFKYENVT  119

Query  420   SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVK  599
             ++P  +DWRKKGAVTP+K+QG    CWAFS VAA EGI +++TG L+SLSEQELVDCD K
Sbjct  120   AIPAAIDWRKKGAVTPIKNQGS---CWAFSTVAATEGIHQIATGKLVSLSEQELVDCDTK  176

Query  600   GIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPAN  779
             G+DQGCEGG M+D F FII N G+++E+NYPY+  DG     K ++  A+I GYE VP N
Sbjct  177   GVDQGCEGGYMEDGFEFIIKNGGISSEANYPYKAADG--SCKKGTSPVAQIKGYEKVPPN  234

Query  780   SESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYW  959
             SE AL+KAVANQPVSV+I+A GS F FYSSG+++GECGTELDHGVTAVGYGIA +GT+YW
Sbjct  235   SEKALQKAVANQPVSVSINADGSGFMFYSSGIYSGECGTELDHGVTAVGYGIA-NGTEYW  293

Query  960   LVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             LVKNSWGT WGE+GY+RM++ I AK GLCGIA+ SSYP+A
Sbjct  294   LVKNSWGTQWGEEGYVRMKRGIAAKHGLCGIALDSSYPTA  333



>ref|XP_006582264.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN33267.1| Vignain [Glycine soja]
Length=338

 Score =   444 bits (1142),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 217/332 (65%), Positives = 263/332 (79%), Gaps = 4/332 (1%)
 Frame = +3

Query  87    LIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYI  266
             ++AL L+ +       SR L ++ M+ RHEQWM +YG+VYK+  EK KR  IFK+NVE+I
Sbjct  10    ILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLLIFKDNVEFI  69

Query  267   ESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSSVPTTVDWR  446
             ESFN AG KPYKL IN  AD TN+EF+AS NGYK      S TPF+Y NV+ +PT VDWR
Sbjct  70    ESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKYKGS-HSQTPFKYGNVTDIPTAVDWR  128

Query  447   KKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGG  626
             + GAVT VKDQGQCG CWAFS VAA EGI ++STG L+SLSEQELVDCD   +D GC+GG
Sbjct  129   QNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCD--SVDHGCDGG  186

Query  627   LMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAV  806
             LM+D F FII N G+++E+NYPY   DG+C  SK ++ AA+I GYE VPANSE AL++AV
Sbjct  187   LMEDGFEFIIKNGGISSEANYPYTAVDGTCDASKEASPAAQIKGYETVPANSEEALQQAV  246

Query  807   ANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGT-KYWLVKNSWGT  983
             ANQPVSV+IDAGGS FQFYSSGVFTG+CGT+LDHGVT VGYG  +DGT +YW+VKNSWGT
Sbjct  247   ANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDHGVTVVGYGTTDDGTHEYWIVKNSWGT  306

Query  984   SWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              WGE+GYIRMQ+ I+A+EGLCGIAM +SYP+A
Sbjct  307   QWGEEGYIRMQRGIDAQEGLCGIAMDASYPTA  338



>ref|XP_003526207.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=336

 Score =   444 bits (1141),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 210/314 (67%), Positives = 257/314 (82%), Gaps = 4/314 (1%)
 Frame = +3

Query  138   RTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINA  317
             R L ++ M  RHEQWM +YG+VYK+  EK KR+ IFK+NVE+IESFN  G KPYKLG+N 
Sbjct  27    RKLHETSMRERHEQWMTEYGKVYKDAAEKDKRFQIFKDNVEFIESFNADGNKPYKLGVNH  86

Query  318   FADLTNKEFIASRNGYKLPHECSSNTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCC  497
              ADLT +EF ASRNG+K PHE S+ T F+YENV+++P  +DWR KGAVTP+KDQGQCG C
Sbjct  87    LADLTVEEFKASRNGFKRPHEFSTTT-FKYENVTAIPAAIDWRTKGAVTPIKDQGQCGSC  145

Query  498   WAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTT  677
             WAFS +AA EGI +++TG L+SLSEQELVDCD KG+DQGCEGG M+D F FII N G+T+
Sbjct  146   WAFSTIAATEGIHQITTGKLVSLSEQELVDCDTKGVDQGCEGGYMEDGFEFIIKNGGITS  205

Query  678   ESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQ  857
             E+NYPY+  DG  K +K+++  A+I GYE VP NSE+AL+KAVANQPVSV+IDA G+ F 
Sbjct  206   ETNYPYKAVDG--KCNKATSPVAQIKGYEKVPPNSETALQKAVANQPVSVSIDADGAGFM  263

Query  858   FYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKE  1037
             FYSSG++ GECGTELDHGVTAVGYG A +GT YW+VKNSWGT WGEKGY+RMQ+ I AK 
Sbjct  264   FYSSGIYNGECGTELDHGVTAVGYGTA-NGTDYWIVKNSWGTQWGEKGYVRMQRGIAAKH  322

Query  1038  GLCGIAMQSSYPSA  1079
             GLCGIA+ SSYP++
Sbjct  323   GLCGIALDSSYPTS  336



>ref|XP_002525123.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37250.1| cysteine protease, putative [Ricinus communis]
Length=349

 Score =   444 bits (1142),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 217/333 (65%), Positives = 261/333 (78%), Gaps = 1/333 (0%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             L IAL  V A  A  A SR L +  M  RHE+WMA++G+VYK++ EK +R+ IFK NV +
Sbjct  10    LPIALFFVLAMCADQAASRELHELEMTGRHEKWMAKHGKVYKDDKEKLRRFQIFKSNVVF  69

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN-TPFRYENVSSVPTTVD  440
             IESFN AG K Y LGIN FADLTN+EF A  NGYK P   S   TPF+YENV+++P+++D
Sbjct  70    IESFNTAGNKSYMLGINKFADLTNEEFRAFWNGYKRPLGASRKITPFKYENVTALPSSID  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR KGAVTP+KDQG CG CWAFSAVAA EGI KL TG L+SLSEQELVDCDVKG D+GC+
Sbjct  130   WRSKGAVTPIKDQGVCGSCWAFSAVAATEGIHKLRTGKLVSLSEQELVDCDVKGQDKGCQ  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGLM DAF FI  + G+T+E+NYPYQG DG C   K ++ A KI+GY+ VP NSE+AL K
Sbjct  190   GGLMVDAFKFIKRHGGMTSEANYPYQGRDGKCDTKKEASRAVKITGYQAVPKNSEAALLK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVANQPVSVAIDAG   FQFY SG+FTG CG +++HGV AVGYG +  G+KYW+VKNSWG
Sbjct  250   AVANQPVSVAIDAGSLSFQFYRSGIFTGICGKDINHGVAAVGYGRSNSGSKYWIVKNSWG  309

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T WGEKGYIRM++D+ +KEGLCGIAM+ SYP+A
Sbjct  310   TEWGEKGYIRMKRDVRSKEGLCGIAMECSYPTA  342



>gb|KHN08873.1| Vignain [Glycine soja]
Length=335

 Score =   444 bits (1141),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 217/332 (65%), Positives = 263/332 (79%), Gaps = 4/332 (1%)
 Frame = +3

Query  87    LIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYI  266
             ++AL L+ +       SR L ++ M+ RHEQWM +YG+VYK+  EK KR  IFK+NVE+I
Sbjct  7     ILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLLIFKDNVEFI  66

Query  267   ESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSSVPTTVDWR  446
             ESFN AG KPYKL IN  AD TN+EF+AS NGYK      S TPF+Y NV+ +PT VDWR
Sbjct  67    ESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKYKGS-HSQTPFKYGNVTDIPTAVDWR  125

Query  447   KKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGG  626
             + GAVT VKDQGQCG CWAFS VAA EGI ++STG L+SLSEQELVDCD   +D GC+GG
Sbjct  126   QNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCD--SVDHGCDGG  183

Query  627   LMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAV  806
             LM+D F FII N G+++E+NYPY   DG+C  SK ++ AA+I GYE VPANSE AL++AV
Sbjct  184   LMEDGFEFIIKNGGISSEANYPYTAVDGTCDASKEASPAAQIKGYETVPANSEEALQQAV  243

Query  807   ANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGT-KYWLVKNSWGT  983
             ANQPVSV+IDAGGS FQFYSSGVFTG+CGT+LDHGVT VGYG  +DGT +YW+VKNSWGT
Sbjct  244   ANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDHGVTVVGYGTTDDGTHEYWIVKNSWGT  303

Query  984   SWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              WGE+GYIRMQ+ I+A+EGLCGIAM +SYP+A
Sbjct  304   QWGEEGYIRMQRGIDAQEGLCGIAMDASYPTA  335



>ref|XP_007132817.1| hypothetical protein PHAVU_011G127000g [Phaseolus vulgaris]
 gb|ESW04811.1| hypothetical protein PHAVU_011G127000g [Phaseolus vulgaris]
Length=340

 Score =   444 bits (1141),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 211/317 (67%), Positives = 257/317 (81%), Gaps = 4/317 (1%)
 Frame = +3

Query  135   SRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGIN  314
             SR + ++ ++ RHEQWM QYGR YK+  EK KR+ IFK+NV++IE FN AG KPYKLGIN
Sbjct  26    SRNIHEASISQRHEQWMKQYGRTYKDAAEKQKRFLIFKDNVQFIEFFNTAGNKPYKLGIN  85

Query  315   AFADLTNKEFIASRNGYKLPHE--CSSNTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQC  488
               AD TN+EFIAS  GYK  HE   ++ TPF+YENV+ +PT VDWR+ GAVTP+KDQG+C
Sbjct  86    HLADQTNEEFIASHTGYKGSHELRITAQTPFKYENVTRIPTAVDWRENGAVTPIKDQGRC  145

Query  489   GCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKG  668
             G CWAFS VAA EGI +++TG L+SLSEQELVDCD   +DQGC+GGLM+D F FII N G
Sbjct  146   GSCWAFSTVAATEGIYQITTGKLVSLSEQELVDCD--SVDQGCDGGLMEDGFEFIIKNGG  203

Query  669   LTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGS  848
             +T+E NYPY G + +C   K ++  A+I GYE VP NSE AL+KAVANQPVSV+IDAGGS
Sbjct  204   ITSEVNYPYTGVNETCDTKKEASPEAQIKGYETVPPNSEEALQKAVANQPVSVSIDAGGS  263

Query  849   DFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIE  1028
              FQFYSSGVFTG+CGT+LDHGVTAVGYGI ++GT+YW+VKNSW T WGE+GYIRM++ I+
Sbjct  264   AFQFYSSGVFTGQCGTQLDHGVTAVGYGITDNGTEYWIVKNSWSTQWGEEGYIRMERGID  323

Query  1029  AKEGLCGIAMQSSYPSA  1079
             AKEGLCGIAM +SYP A
Sbjct  324   AKEGLCGIAMDASYPVA  340



>emb|CBI21972.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   442 bits (1138),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 227/342 (66%), Positives = 268/342 (78%), Gaps = 25/342 (7%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYL--ATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MAS +    I LAL+F  +A+   AT+R+L ++ M  RHE WM QYGR YK+  EK+KRY
Sbjct  1     MASVNQYQYICLALLFVLAAWASQATARSLHEASMYERHEDWMVQYGREYKDADEKSKRY  60

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN-TPFRYEN  413
              IFK+NV  IESFNKA  K YKL IN FADLTN+EF ASRN +K  H CS+  T F+YEN
Sbjct  61    KIFKDNVARIESFNKAMDKSYKLSINEFADLTNEEFRASRNRFK-AHICSTEATSFKYEN  119

Query  414   VSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
             V++VP+TVDWRKKGAVTP+KDQGQCG CWAFSAVAAMEGIT+LSTG LISLSEQELVDCD
Sbjct  120   VTAVPSTVDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCD  179

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
               G DQGC                     +NYPY GTDG+C + K+++ AAKI+GYEDVP
Sbjct  180   TSGEDQGC---------------------TNYPYAGTDGTCNRKKAAHPAAKINGYEDVP  218

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E AL+KAVA+QP++VAIDA GS+FQFYSSGVFTG+CGTELDHGV AVGYG ++DG K
Sbjct  219   ANNEKALQKAVAHQPIAVAIDASGSEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMK  278

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWLVKNSW T WGE+GYIRMQ+D+ AKEGLCGIAMQ+SYP+A
Sbjct  279   YWLVKNSWSTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  320



>dbj|BAF56429.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   443 bits (1139),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 223/344 (65%), Positives = 265/344 (77%), Gaps = 8/344 (2%)
 Frame = +3

Query  63    MASNSLK--LLIALALVFATSAYLATSRTLLDSLMAV--RHEQWMAQYGRVYKNEVEKTK  230
             MAS++ +   ++AL L+ A       SR L ++  ++  RHEQWMA+Y +VYK+  EK K
Sbjct  1     MASSTRQKQYILALFLLLAVGISRVISRELHETETSLIERHEQWMAKYDKVYKDAAEKEK  60

Query  231   RYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECS-SNTPFRY  407
             R+ IFK+NVE+IESFN AG KPYKLG+N  ADLT +EF ASRNG K  ++     T F+Y
Sbjct  61    RFLIFKDNVEFIESFNAAGNKPYKLGVNHLADLTIEEFKASRNGLKRSYDYEVGTTSFKY  120

Query  408   ENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVD  587
             ENV+++P +VDWRKKGAVTP+KDQGQCG CWAFS VAA EGI K+STG L+SLSEQELVD
Sbjct  121   ENVTAIPASVDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGIHKISTGKLVSLSEQELVD  180

Query  588   CDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYED  767
             CD KG DQGCEGG M+D F FII N G+TTE+NYPY+  DG      ++  AA+I GYE 
Sbjct  181   CDRKGTDQGCEGGYMEDGFEFIIKNGGITTEANYPYKAVDG--SCKNATAPAAQIKGYEK  238

Query  768   VPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDG  947
             VP NSE AL KAVANQPVSV+IDA    F FYSSG+FTGECGTELDHGVTAVGYG A +G
Sbjct  239   VPVNSEKALLKAVANQPVSVSIDAADGSFMFYSSGIFTGECGTELDHGVTAVGYGRA-NG  297

Query  948   TKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             T YW+VKNSWGT WGE+GYIRMQ+ I AKEGLCGIAM SSYP+A
Sbjct  298   TDYWIVKNSWGTVWGEQGYIRMQRGIAAKEGLCGIAMDSSYPTA  341



>ref|XP_006652104.1| PREDICTED: vignain-like [Oryza brachyantha]
Length=342

 Score =   443 bits (1139),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 224/344 (65%), Positives = 262/344 (76%), Gaps = 7/344 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTL--LDSLMAVRHEQWMAQYGRVYKNEVEKTKRY  236
             MA  S  L+  L  ++  SA LA +R L   D+ MA RHE+WMAQYGRVYK+  EK +R+
Sbjct  1     MAIPSAPLVAVLGCLYLCSAVLA-ARELGDDDAAMAARHERWMAQYGRVYKDAAEKARRF  59

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASR-NGYKLPHECSSNTPFRYEN  413
              +FK NV +IESFN  G + + LG+N FADLTN EF A+  N   +P      T FRYEN
Sbjct  60    EVFKANVAFIESFNGGGGRKFWLGVNQFADLTNYEFRATNTNKGFIPSTVRVPTGFRYEN  119

Query  414   VS--SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVD  587
             VS  ++P TVDWR KGAVTP+KDQGQCGCCWAFSAVAAMEGI KLSTG LISLSEQELVD
Sbjct  120   VSIDALPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVD  179

Query  588   CDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYED  767
             CDV G DQGCEGGLMDDAF FI+NN GLTTESNYPY   DG   K  S ++AA I GYED
Sbjct  180   CDVHGEDQGCEGGLMDDAFKFIVNNGGLTTESNYPYTAADG-KCKGGSGSAAATIKGYED  238

Query  768   VPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDG  947
             VPAN E+AL KAVA+QPVSVA+D G   FQFYS GV +G CGT+LDHG+ A+GYG A DG
Sbjct  239   VPANDEAALMKAVASQPVSVAVDGGDMTFQFYSGGVMSGSCGTDLDHGIVAIGYGTAGDG  298

Query  948   TKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             TKYWL+KNSWGT+WGE G++RM+KDI  K G+CG+AM+ SYP+A
Sbjct  299   TKYWLLKNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPTA  342



>ref|XP_010906194.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X1 [Elaeis guineensis]
Length=343

 Score =   443 bits (1139),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 223/334 (67%), Positives = 258/334 (77%), Gaps = 4/334 (1%)
 Frame = +3

Query  87    LIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYI  266
             +    LV    A  AT+RTL +  MA RHEQWM ++GRVYK   EK +R+ IFK NVE+I
Sbjct  11    MALFVLVLCACASHATARTLTEMTMAERHEQWMVRHGRVYKESAEKERRFQIFKANVEFI  70

Query  267   ESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLP--HECSSNTPFRYENVSSVPTTVD  440
             ESFN AG   YKLG+N FADLTN+EF A RNG K        + + FRY NV++VPT +D
Sbjct  71    ESFN-AGNSKYKLGVNQFADLTNEEFKAMRNGLKPSGVKTSKATSVFRYANVTAVPTRMD  129

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WR KGAVTP+KDQG CG CWAF+ VAAMEGITKL T  LISLSEQELV+CDV G D+GC 
Sbjct  130   WRTKGAVTPIKDQGDCGSCWAFAVVAAMEGITKLKTHKLISLSEQELVECDVGGEDEGCN  189

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGL D A  FII N GL TE+NYPY+G DG+C   KS++ AA I GYE VPANSE+AL K
Sbjct  190   GGLPDAALEFIIKNGGLATETNYPYKGMDGTCNTKKSASHAASIKGYEQVPANSEAALLK  249

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFT-GECGTELDHGVTAVGYGIAEDGTKYWLVKNSW  977
             AVANQPVSV ID+GGS FQFY+SGVFT G C T+LDH VTAVGYG A+DGTKYWLVKNSW
Sbjct  250   AVANQPVSVNIDSGGSSFQFYASGVFTGGSCETDLDHSVTAVGYGKAKDGTKYWLVKNSW  309

Query  978   GTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G+SWGEKGYIRM++D+ AKEGLCGIAMQ+ YP+A
Sbjct  310   GSSWGEKGYIRMERDVSAKEGLCGIAMQAYYPTA  343



>ref|XP_006582263.1| PREDICTED: vignain-like [Glycine max]
Length=338

 Score =   442 bits (1138),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 217/332 (65%), Positives = 262/332 (79%), Gaps = 4/332 (1%)
 Frame = +3

Query  87    LIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYI  266
             ++AL L+ +       SR L ++ M+ RHEQWM +YG+VYK+  EK KR  IFK+NVE+I
Sbjct  10    ILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLLIFKDNVEFI  69

Query  267   ESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSSVPTTVDWR  446
             ESFN AG KPYKL IN  AD TN+EF+AS NGYK      S TPF+Y NV+ +PT VDWR
Sbjct  70    ESFNAAGNKPYKLSINHLADQTNEEFVASHNGYKYKGS-HSQTPFKYGNVTDIPTAVDWR  128

Query  447   KKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGG  626
             + GAVT VKDQGQCG CWAFS VAA EGI ++STG L+SLSEQELVDCD   +D GC+GG
Sbjct  129   QNGAVTAVKDQGQCGSCWAFSTVAATEGIYQISTGMLMSLSEQELVDCD--SVDHGCDGG  186

Query  627   LMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAV  806
             LM+D F FII N G+++E+NYPY   DG+C  SK ++ AA+I GYE VPANSE AL++AV
Sbjct  187   LMEDGFEFIIKNGGISSEANYPYTAVDGTCDASKEASPAAQIKGYETVPANSEEALQQAV  246

Query  807   ANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGT-KYWLVKNSWGT  983
             ANQPVSV+IDAGGS FQFYSSGVFTG+CGT+LDHGVT VGYG  +DGT +YW+VKNSWGT
Sbjct  247   ANQPVSVSIDAGGSGFQFYSSGVFTGQCGTQLDHGVTVVGYGTTDDGTHEYWIVKNSWGT  306

Query  984   SWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              WGE+GYIRMQ+ I+A EGLCGIAM +SYP+A
Sbjct  307   QWGEEGYIRMQRGIDALEGLCGIAMDASYPTA  338



>gb|AAR92154.1| putative cysteine protease 1 [Iris x hollandica]
Length=340

 Score =   442 bits (1138),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 224/341 (66%), Positives = 267/341 (78%), Gaps = 6/341 (2%)
 Frame = +3

Query  66    ASNSLKLLIALALVFAT--SAYLATSRTLLDSL-MAVRHEQWMAQYGRVYKNEVEKTKRY  236
             A  ++KLL ALAL+     ++     R+L ++  M  RHEQWMAQ+GRVYKN  EK  R+
Sbjct  3     AFKTVKLLPALALLIVAIWASQGEAGRSLGENKSMLERHEQWMAQHGRVYKNAAEKAHRF  62

Query  237   NIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENV  416
              IF+ NVE IESFN    K +KLG+N FADLTN+EF  +RN  K P + +S   F+YENV
Sbjct  63    EIFRANVERIESFNAENHK-FKLGVNQFADLTNEEF-KTRNTLK-PSKMASTKSFKYENV  119

Query  417   SSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDV  596
             ++VP T+DWR KGAVTP+KDQGQCG CWAFSAVAA EGITKLSTG LISLSEQE+VDCDV
Sbjct  120   TAVPATMDWRTKGAVTPIKDQGQCGSCWAFSAVAATEGITKLSTGKLISLSEQEVVDCDV  179

Query  597   KGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPA  776
                DQGC GG MDDAF +II NKG+TTE+NYPY+  DG+C   K+++ AA I+GYEDV  
Sbjct  180   TSDDQGCNGGEMDDAFEYIIKNKGITTEANYPYKAADGTCNTKKAASHAASITGYEDVTV  239

Query  777   NSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKY  956
             NSE+AL KA ANQP++VAIDAG   FQ YSSGVFTG+CGT+LDHGVT VGYG   DGTKY
Sbjct  240   NSEAALLKAAANQPIAVAIDAGDFAFQMYSSGVFTGDCGTDLDHGVTLVGYGATSDGTKY  299

Query  957   WLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WLVKNSWGTSWGE GYIRM++D++AKEGLCGIAM +SYP+A
Sbjct  300   WLVKNSWGTSWGEDGYIRMERDVDAKEGLCGIAMDASYPTA  340



>ref|XP_006582267.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=336

 Score =   442 bits (1137),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 209/314 (67%), Positives = 256/314 (82%), Gaps = 4/314 (1%)
 Frame = +3

Query  138   RTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINA  317
             R L ++ M  RHEQWM +YG+VYK+  EK KR+ IFK+NVE+IESFN  G KPYKLG+N 
Sbjct  27    RKLHETSMRERHEQWMTEYGKVYKDAAEKEKRFQIFKDNVEFIESFNADGNKPYKLGVNH  86

Query  318   FADLTNKEFIASRNGYKLPHECSSNTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCC  497
              ADLT +EF ASRNG+K PHE S+ T F+YENV+++P  +DWR KGAVTP+KDQGQCG C
Sbjct  87    LADLTVEEFKASRNGFKRPHEFSTTT-FKYENVTAIPAAIDWRTKGAVTPIKDQGQCGSC  145

Query  498   WAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTT  677
             WAFS +AA EGI +++TG L+SLSEQELVDCD KG+DQGCEGG M+D F FII N G+T+
Sbjct  146   WAFSTIAATEGIHQITTGKLVSLSEQELVDCDTKGVDQGCEGGYMEDGFEFIIKNGGITS  205

Query  678   ESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQ  857
             E+NYPY+  DG  K +K+++  A+I GYE VP NSE+ L+KAVANQPVSV+IDA G+ F 
Sbjct  206   ETNYPYKAVDG--KCNKATSPVAQIKGYEKVPPNSETTLQKAVANQPVSVSIDADGAGFM  263

Query  858   FYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKE  1037
             FYSSG++ GECGTELDHGVTAVGYG A +GT YW+VKNSWGT WGEKGY+RMQ+ I AK 
Sbjct  264   FYSSGIYNGECGTELDHGVTAVGYGTA-NGTDYWIVKNSWGTQWGEKGYVRMQRGIAAKH  322

Query  1038  GLCGIAMQSSYPSA  1079
             GLCGIA+ SSYP++
Sbjct  323   GLCGIALDSSYPTS  336



>gb|KHN28095.1| Thiol protease [Glycine soja]
Length=336

 Score =   442 bits (1137),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 209/314 (67%), Positives = 256/314 (82%), Gaps = 4/314 (1%)
 Frame = +3

Query  138   RTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINA  317
             R L ++ M  RHEQWM +YG+VYK+  EK KR+ IFK+NVE+IESFN  G KPYKLG+N 
Sbjct  27    RKLHETSMRERHEQWMTEYGKVYKDAAEKDKRFQIFKDNVEFIESFNADGNKPYKLGVNH  86

Query  318   FADLTNKEFIASRNGYKLPHECSSNTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCC  497
              ADLT +EF ASRNG+K PHE S+ T F+YENV+++P  +DWR KGAVTP+KDQGQCG C
Sbjct  87    LADLTVEEFKASRNGFKRPHEFSTTT-FKYENVTAIPAAIDWRTKGAVTPIKDQGQCGSC  145

Query  498   WAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTT  677
             WAFS +AA EGI +++TG L+SLSEQELVDCD KG+DQGCEGG M+D F FII N G+T+
Sbjct  146   WAFSTIAATEGIHQITTGKLVSLSEQELVDCDTKGVDQGCEGGYMEDGFEFIIKNGGITS  205

Query  678   ESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQ  857
             E+NYPY+  DG  K +K+++  A+I GYE VP NSE+ L+KAVANQPVSV+IDA G+ F 
Sbjct  206   ETNYPYKAVDG--KCNKATSPVAQIKGYEKVPPNSETTLQKAVANQPVSVSIDADGAGFM  263

Query  858   FYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKE  1037
             FYSSG++ GECGTELDHGVTAVGYG A +GT YW+VKNSWGT WGEKGY+RMQ+ I AK 
Sbjct  264   FYSSGIYNGECGTELDHGVTAVGYGTA-NGTDYWIVKNSWGTQWGEKGYVRMQRGIAAKH  322

Query  1038  GLCGIAMQSSYPSA  1079
             GLCGIA+ SSYP++
Sbjct  323   GLCGIALDSSYPTS  336



>ref|XP_009354265.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   442 bits (1138),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 220/333 (66%), Positives = 257/333 (77%), Gaps = 1/333 (0%)
 Frame = +3

Query  84    LLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEY  263
             + + L L+    +  ATSR+L D+ M  RHEQW+A+YGRVY N  EK  R+ I KENV +
Sbjct  12    MYLGLILMLGAWSSQATSRSLQDAAMYGRHEQWLARYGRVYNNVNEKETRFKILKENVAF  71

Query  264   IESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSS-VPTTVD  440
             +ES NK   KPYKL +N FADLTN+EF ASRNG+K     +    F+YE V++ +P T+D
Sbjct  72    VESSNKDANKPYKLSVNQFADLTNEEFKASRNGFKGQEYSTKTNSFKYEKVTAALPATMD  131

Query  441   WRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCE  620
             WRKKGAVTPVKDQGQCG CWAFSAVAA EGIT L+TG LISLSEQELVDCD  G DQGC 
Sbjct  132   WRKKGAVTPVKDQGQCGSCWAFSAVAATEGITHLTTGKLISLSEQELVDCDTGGEDQGCW  191

Query  621   GGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEK  800
             GGL+DDAF FI  N G++TE+NYPY G   +C   K +  AAKI+GYE VPANSE AL  
Sbjct  192   GGLIDDAFQFIQQNHGISTEANYPYIGVGDTCNTKKEAIIAAKITGYEVVPANSEKALLT  251

Query  801   AVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWG  980
             AVA+QPVSVAIDA GS+FQFYSSGVF G CGT LDHGVTAVGYG+++DGTKYWLVKNSWG
Sbjct  252   AVAHQPVSVAIDASGSNFQFYSSGVFNGTCGTSLDHGVTAVGYGVSDDGTKYWLVKNSWG  311

Query  981   TSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
               WGE GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  312   AKWGEAGYIRMQRDVSAPEGLCGIAMSASYPTA  344



>ref|XP_007132874.1| hypothetical protein PHAVU_011G132000g [Phaseolus vulgaris]
 gb|ESW04868.1| hypothetical protein PHAVU_011G132000g [Phaseolus vulgaris]
Length=329

 Score =   442 bits (1136),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 220/345 (64%), Positives = 260/345 (75%), Gaps = 22/345 (6%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATS--AYLATSRTLLDSL-MAVRHEQWMAQYGRVYKNEVEKTKR  233
             M S +    I+LAL+F      +  T RTL D + M  RHE+WM +YG VY +  E+ KR
Sbjct  1     MVSKNQFYHISLALLFCMGFWGFQVTCRTLQDDVSMYERHEEWMTRYGSVYNDPEEREKR  60

Query  234   YNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSS---NTPFR  404
             + I K+NV YIE+FN A  KPY+LG N FADLTN+EFIA RN +K  H CSS    T F+
Sbjct  61    FRILKKNVNYIETFNNAANKPYQLGTNQFADLTNEEFIAGRNRFK-GHMCSSILRTTTFK  119

Query  405   YENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELV  584
             YENV+++P+TVDWR+KGAVTPVKDQGQCGCCWAFSAVAA EGI  L++G LISLSEQELV
Sbjct  120   YENVTAIPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVAATEGIHALTSGKLISLSEQELV  179

Query  585   DCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYE  764
             DCD KG+DQGCEGG MD                NYPY+G DG C     + + A I+GYE
Sbjct  180   DCDTKGVDQGCEGGFMD---------------VNYPYKGVDGKCNAKAEAVNGATITGYE  224

Query  765   DVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAED  944
             DVP N+ESALEKAV++QPVSVAIDA GSDFQFY SGVF+G CGTELDHGVTAVGYG+++D
Sbjct  225   DVPVNNESALEKAVSSQPVSVAIDASGSDFQFYKSGVFSGSCGTELDHGVTAVGYGVSDD  284

Query  945   GTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             G KYWLVKNSWGT WGE+GYIRMQ+D+ A EGLCGIAM +SYP+A
Sbjct  285   GKKYWLVKNSWGTEWGEEGYIRMQRDVAAAEGLCGIAMMASYPTA  329



>ref|XP_003540013.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003540014.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN27798.1| Vignain [Glycine soja]
 gb|KHN27800.1| Vignain [Glycine soja]
Length=337

 Score =   441 bits (1134),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 215/332 (65%), Positives = 262/332 (79%), Gaps = 5/332 (2%)
 Frame = +3

Query  87    LIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYI  266
             ++AL L+ +       SR L ++ M+ RHEQWM +YG+VYK+  EK KR  IFK+NVE+I
Sbjct  10    ILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLLIFKDNVEFI  69

Query  267   ESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECS-SNTPFRYENVSSVPTTVDW  443
             ESFN AG +PYKL IN  AD TN+EF+AS NGYK  H+ S S TPF+YENV+ VP  VDW
Sbjct  70    ESFNAAGNRPYKLSINHLADQTNEEFVASHNGYK--HKGSHSQTPFKYENVTGVPNAVDW  127

Query  444   RKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEG  623
             R+ GAVT VKDQGQCG CWAFS VAA EGI +++T  L+SLSEQELVDCD   +D GC+G
Sbjct  128   RENGAVTAVKDQGQCGSCWAFSTVAATEGIYQITTSMLMSLSEQELVDCD--SVDHGCDG  185

Query  624   GLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKA  803
             G M+  F FII N G+++E+NYPY   DG+C  +K ++ AA+I GYE VPANSE AL+KA
Sbjct  186   GYMEGGFEFIIKNGGISSEANYPYTAVDGTCDANKEASPAAQIKGYETVPANSEDALQKA  245

Query  804   VANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGT  983
             VANQPVSV IDAGGS FQFYSSGVFTG+CGT+LDHGVTAVGYG  +DGT+YW+VKNSWGT
Sbjct  246   VANQPVSVTIDAGGSAFQFYSSGVFTGQCGTQLDHGVTAVGYGSTDDGTQYWIVKNSWGT  305

Query  984   SWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
              WGE+GYIRMQ+  +A+EGLCGIAM +SYP+A
Sbjct  306   QWGEEGYIRMQRGTDAQEGLCGIAMDASYPTA  337



>ref|XP_008659445.1| PREDICTED: ervatamin-B-like [Zea mays]
 gb|AFW86316.1| hypothetical protein ZEAMMB73_635707 [Zea mays]
Length=340

 Score =   441 bits (1134),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 221/346 (64%), Positives = 256/346 (74%), Gaps = 15/346 (4%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             MA+    +L  L   F   A LA      DS M  RHEQWMAQY RVYK+  EK +R+ +
Sbjct  1     MATLKASILAILGFAFFCGAALAARDLSDDSAMVARHEQWMAQYSRVYKDASEKARRFEV  60

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEF--IASRNGYKLPHECSSN----TPFR  404
             FK NV++IESFN  G   + LG+N FADLTN EF  I +  G+K     SSN    T FR
Sbjct  61    FKANVKFIESFNAGGNNKFWLGVNQFADLTNDEFRSIKTNKGFK-----SSNMKIPTGFR  115

Query  405   YENVS--SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQE  578
             YENVS  ++PTT+DWR KGAVTP+KDQGQCGCCWAFSAVAA EGI K+STG L+SL+EQE
Sbjct  116   YENVSVDALPTTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLVSLAEQE  175

Query  579   LVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisG  758
             LVDCDV G DQGCEGGLMDDAF FIINN GLTTES+YPY   DG CK   +S +  K  G
Sbjct  176   LVDCDVHGEDQGCEGGLMDDAFKFIINNGGLTTESSYPYTAADGKCKSGSNSAATIK--G  233

Query  759   YEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIA  938
             YEDVPAN E+AL KAVANQPVSVA+D G   FQFYSSGV TG CGT+LDHG+ A+GYG  
Sbjct  234   YEDVPANDEAALMKAVANQPVSVAVDGGDMTFQFYSSGVMTGSCGTDLDHGIAAIGYGKT  293

Query  939   EDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  1076
              DGTKYWL+KNSWGT+WGE GY+RM+KDI  K G+CG+AM+ SYP+
Sbjct  294   SDGTKYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_004973089.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   441 bits (1134),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 220/342 (64%), Positives = 253/342 (74%), Gaps = 7/342 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             MAS    LL  L   F  S  LA      DS M  RHEQWMAQY RVYK+  EK +R+ +
Sbjct  1     MASPKAFLLAILGCAFLFSGALAARTLSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEV  60

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRN--GYKLPHECSSNTPFRYENV  416
             FK NV++IESFN AG + + LG+N FADLTN EF A++   G+K P      T FRYENV
Sbjct  61    FKANVKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFK-PSPMKVPTGFRYENV  119

Query  417   S--SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDC  590
             S  ++P T+DWR KGAVTP+KDQGQCGCCWAFSAVAA EGI K+STG LISLSEQELVDC
Sbjct  120   SIDALPATIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDC  179

Query  591   DVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDV  770
             DV G DQGCEGGLMDDAF FII N GLTTES YPY   DG CK   +S +  K   YEDV
Sbjct  180   DVHGEDQGCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKCKSGSNSAATIKS--YEDV  237

Query  771   PANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGT  950
             PAN+E+AL KAVANQPVSVA+D G   FQFYS GV TG CGT+LDHG+ A+GYG A DGT
Sbjct  238   PANNEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGT  297

Query  951   KYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  1076
              YWL+KNSWGT+WGE GY+RM+KDI  K G+CG+AM+ SYP+
Sbjct  298   NYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>gb|KCW84689.1| hypothetical protein EUGRSUZ_B01506, partial [Eucalyptus grandis]
Length=295

 Score =   439 bits (1128),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 213/295 (72%), Positives = 253/295 (86%), Gaps = 2/295 (1%)
 Frame = +3

Query  159   MAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNK  338
             M  RHEQWMA++GRVY++  EK + ++IFK  VEYIESFN+ G KPYKL INAFADLT++
Sbjct  1     MRERHEQWMARHGRVYEDAAEKERCFSIFKTTVEYIESFNQDGNKPYKLAINAFADLTSE  60

Query  339   EFIASRNGYKLPH--ECSSNTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSA  512
             EF ASR GYK       +S  PF+YE+V+++P+++DWRKKGAVTP+KDQGQCGC WAFSA
Sbjct  61    EFKASRTGYKRSSSLRAASMKPFQYESVTAIPSSMDWRKKGAVTPIKDQGQCGCRWAFSA  120

Query  513   VAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYP  692
             VAAMEGIT+L+TG L SLSEQELVDCD  G DQGC GGLMDDAF FII+N GLTTE+NYP
Sbjct  121   VAAMEGITQLTTGKLTSLSEQELVDCDRSGEDQGCGGGLMDDAFQFIISNHGLTTEANYP  180

Query  693   YQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSG  872
             YQ  D +C   K++++AAKISGYEDVP+NSESAL KAVA+QPVSVAIDAG +DFQFYS+G
Sbjct  181   YQAVDNTCNARKAASTAAKISGYEDVPSNSESALLKAVAHQPVSVAIDAGETDFQFYSTG  240

Query  873   VFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKE  1037
             +FTGECGT+LDHGVTAVGYG +E+GTKYWLVKNSWGT WGE+GYIRMQ+DI+A E
Sbjct  241   IFTGECGTDLDHGVTAVGYGTSENGTKYWLVKNSWGTGWGEEGYIRMQRDIDAAE  295



>ref|XP_004974538.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   440 bits (1132),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 223/342 (65%), Positives = 254/342 (74%), Gaps = 7/342 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             MAS    LL  L   F  S  LA      DS M  RHEQWMAQY RVYK+  EK +R+ +
Sbjct  1     MASPKAFLLAILGCAFLFSGALAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEV  60

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASR--NGYKLPHECSSNTPFRYENV  416
             FK NV++IESFN AG + + LG+N FADLTN EF A++   G+K P      T FRYENV
Sbjct  61    FKANVKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFK-PSPMKVPTGFRYENV  119

Query  417   S--SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDC  590
             S  ++P T+DWR KGAVTP+KDQGQCGCCWAFSAVAA EGI K+STG LISLSEQELVDC
Sbjct  120   SIDALPATIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDC  179

Query  591   DVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDV  770
             DV G DQGCEGGLMDDAF FII N GLTTES YPY   D   K    SNSAA I GYEDV
Sbjct  180   DVHGEDQGCEGGLMDDAFKFIIKNGGLTTESGYPYTAAD--DKCKSGSNSAATIKGYEDV  237

Query  771   PANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGT  950
             PAN+E+AL KAVANQPVSVA+D G   FQFYS GV TG CGT+LDHG+ A+GYG A DGT
Sbjct  238   PANNEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGT  297

Query  951   KYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  1076
              YWL+KNSWGT+WGE GY+RM+KDI  K G+CG+AM+ SYP+
Sbjct  298   NYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>gb|AFW76902.1| hypothetical protein ZEAMMB73_056195 [Zea mays]
Length=340

 Score =   439 bits (1129),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 217/342 (63%), Positives = 253/342 (74%), Gaps = 7/342 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             MA+    +L  L+  F   A LA      DS M  RHEQWMAQY RVYK+  EK +R+ +
Sbjct  1     MATLQASILAVLSFAFFCGAALAARDLNEDSAMVARHEQWMAQYSRVYKDAAEKARRFEV  60

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRN--GYKLPHECSSNTPFRYENV  416
             FK NV++IESFN  G + + LGIN FADLTN EF  ++   G+K P     +T FRYENV
Sbjct  61    FKANVKFIESFNTGGNRKFWLGINQFADLTNDEFRTTKTNKGFK-PSLDKVSTGFRYENV  119

Query  417   S--SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDC  590
             S  ++P T+DWR  GAVTP+KDQGQCGCCWAFSAVAA EGI K+STG LISLSEQELVDC
Sbjct  120   SVDAIPATIDWRTNGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDC  179

Query  591   DVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDV  770
             DV G DQGCEGGLMDDAF FII N GLTTESNYPY   DG CK   +S +  K  GYEDV
Sbjct  180   DVHGEDQGCEGGLMDDAFKFIIKNGGLTTESNYPYTAADGKCKSGSNSAANIK--GYEDV  237

Query  771   PANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGT  950
             P N E+AL KAVANQPVSVA+D G   FQFYS GV TG CGT+LDHG+ A+GYG   DGT
Sbjct  238   PTNDEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKTSDGT  297

Query  951   KYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  1076
             KYWL+KNSWGT+WGE GY+RM+KDI  K+G+CG+AM+ SYP+
Sbjct  298   KYWLMKNSWGTTWGENGYLRMEKDISDKKGMCGLAMEPSYPT  339



>gb|KHN27797.1| Thiol protease SEN102 [Glycine soja]
Length=335

 Score =   439 bits (1128),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 216/330 (65%), Positives = 259/330 (78%), Gaps = 5/330 (2%)
 Frame = +3

Query  90    IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIE  269
             IAL L+ A       SR L ++ M  RHEQWMA+YG+VYK+  EK KR+ IFK NVE+IE
Sbjct  11    IALFLLLALGIPQMMSRKLHETSMRERHEQWMAEYGKVYKDAAEKEKRFLIFKHNVEFIE  70

Query  270   SFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSSVPTTVDWRK  449
             SFN A  KPYKLG+N  ADLT +EF ASRNG K P+E S+ TPF+YENV+++P  +DWR 
Sbjct  71    SFNAAANKPYKLGVNHLADLTVEEFKASRNGLKRPYELST-TPFKYENVTAIPAAIDWRT  129

Query  450   KGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGL  629
             KGAVT +KDQGQ   CWAFS VAA EGI +++TG L+SLSEQELVDCD KG+DQGCEGG 
Sbjct  130   KGAVTSIKDQGQW-SCWAFSTVAATEGIHQITTGKLVSLSEQELVDCDTKGVDQGCEGGY  188

Query  630   MDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVA  809
             M+D F FII N G+T+E+NYPY+  DG  K +K+++  A+I GYE VP NSE  L+KAVA
Sbjct  189   MEDGFEFIIKNGGITSEANYPYKAVDG--KCNKATSPVAQIKGYEKVPPNSEKTLQKAVA  246

Query  810   NQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSW  989
             NQPVSV+IDA G  F FYSSG++ GECGTELDHGVTAVGYGIA +GT YWLVKNSWGT W
Sbjct  247   NQPVSVSIDANGEGFMFYSSGIYNGECGTELDHGVTAVGYGIA-NGTDYWLVKNSWGTQW  305

Query  990   GEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             GEKGY+RMQ+ + AK GLCGIA+ SSYP+A
Sbjct  306   GEKGYVRMQRGVAAKHGLCGIALDSSYPTA  335



>gb|KHN27806.1| Vignain [Glycine soja]
Length=313

 Score =   438 bits (1126),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 214/316 (68%), Positives = 256/316 (81%), Gaps = 5/316 (2%)
 Frame = +3

Query  135   SRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGIN  314
             SR L ++ M+ RHEQWM +YG+VYK+  EK KR  IFK+NVE+IESFN AG KPYKLGIN
Sbjct  2     SRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLLIFKDNVEFIESFNAAGNKPYKLGIN  61

Query  315   AFADLTNKEFIASRNGYKLPHECS-SNTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCG  491
               AD TN+EF+AS NGYK  H+ S S TPF+YENV+ VP  VDWR+ GAVT VKDQGQCG
Sbjct  62    HLADQTNEEFVASHNGYK--HKASHSQTPFKYENVTGVPNAVDWRENGAVTAVKDQGQCG  119

Query  492   CCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGL  671
              CWAFS VAA EGI +++T  L+SLSEQELVDCD   +D GC+GG M+  F FII N G+
Sbjct  120   SCWAFSTVAATEGIYQITTSMLMSLSEQELVDCD--SVDHGCDGGYMEGGFEFIIKNGGI  177

Query  672   TTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSD  851
             ++E+NYPY   DG+C  +K ++ AA+I GYE VPANSE AL+KAVANQPVSV IDAGGS 
Sbjct  178   SSEANYPYTAVDGTCDANKEASPAAQIKGYETVPANSEDALQKAVANQPVSVTIDAGGSA  237

Query  852   FQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEA  1031
             FQFYSSGVFTG+CGT+LDHGVTAVGYG  +DGT+YW+VKNSWGT WGE+GYIRMQ+  +A
Sbjct  238   FQFYSSGVFTGQCGTQLDHGVTAVGYGSTDDGTQYWIVKNSWGTQWGEEGYIRMQRGTDA  297

Query  1032  KEGLCGIAMQSSYPSA  1079
             +EGLCGIAM +SYP+A
Sbjct  298   QEGLCGIAMDASYPTA  313



>ref|XP_004974539.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   439 bits (1128),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 218/341 (64%), Positives = 249/341 (73%), Gaps = 5/341 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             MAS    LL  L   F  S  LA      DS M  RHEQWMAQY RVYK+  EK +R  +
Sbjct  1     MASPKAFLLAILGCAFLFSGALAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRLEV  60

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHE-CSSNTPFRYENVS  419
             F  NV++IESFN AG + + LG+N FADLTN EF A++      H      T FRYENVS
Sbjct  61    FNANVKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKVPTGFRYENVS  120

Query  420   --SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
               ++P T+DWR KGAVTP+KDQGQCGCCWAFSAVAA EGI K+STG LISLSEQELVDCD
Sbjct  121   IDALPATIDWRSKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCD  180

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
             V G DQGCEGGLMDDAF FII N GLTTES YPY   DG CK   +S +  K  GYEDVP
Sbjct  181   VHGEDQGCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKCKSGSNSAATIK--GYEDVP  238

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E+AL KAVANQPVSVA+D G   FQFYS GV TG CGT+LDHG+ A+GYG A DGT 
Sbjct  239   ANNEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGTN  298

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  1076
             YWL+KNSWGT+WGE GY+RM+KDI  K G+CG+AM+ SYP+
Sbjct  299   YWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>ref|XP_006384060.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
 gb|ERP61857.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
Length=339

 Score =   439 bits (1128),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 214/336 (64%), Positives = 261/336 (78%), Gaps = 4/336 (1%)
 Frame = +3

Query  75    SLKLLIALALVFATSAYLATSRTLLDS-LMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKE  251
             S+ + +   L+ AT       R L +   M  RHE+WMAQ+GRVY +  EK KRY IFKE
Sbjct  7     SIHIFLPFLLILATKI---VCRPLDEQEYMLKRHEEWMAQHGRVYGDMKEKEKRYLIFKE  63

Query  252   NVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSSVPT  431
             N+E IE+FN    + YKLG+N FADLTN+EF A  +GYK       ++ FR+EN+S++PT
Sbjct  64    NIERIEAFNNGSDRGYKLGVNKFADLTNEEFRAMHHGYKRQSSKLMSSSFRHENLSAIPT  123

Query  432   TVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQ  611
             ++DWRK GAVTPVKDQG CGCCWAFSAVAA+EGI KL TG LISLSEQ+LVDCDVKG+DQ
Sbjct  124   SMDWRKAGAVTPVKDQGTCGCCWAFSAVAAIEGIIKLKTGKLISLSEQQLVDCDVKGVDQ  183

Query  612   GCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESA  791
             GC GGLMD+AF FI+ N GLT+E+ YPYQG DG+CK  K+++  AKI+GYEDVP N+E+A
Sbjct  184   GCGGGLMDNAFQFILRNGGLTSEATYPYQGVDGTCKSKKTASIEAKITGYEDVPVNNENA  243

Query  792   LEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKN  971
             L +AVA QPVSVA++ GG DFQFY SGVF G+CGT LDH VTA+GYG   DGT YWLVKN
Sbjct  244   LLQAVAKQPVSVAVEGGGYDFQFYKSGVFKGDCGTYLDHAVTAIGYGTNSDGTNYWLVKN  303

Query  972   SWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             SWGTSWGE GY+RMQ+ I A+EGLCG+AM +SYP+A
Sbjct  304   SWGTSWGESGYMRMQRGIGAREGLCGVAMDASYPTA  339



>ref|XP_004974540.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   438 bits (1127),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 217/341 (64%), Positives = 249/341 (73%), Gaps = 5/341 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             M S    LL  L   F  S  LA      DS M  RHEQWMAQY RVYK+  EK +R+ +
Sbjct  1     MTSPKAFLLAILGCAFLFSGALAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEV  60

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHE-CSSNTPFRYENVS  419
             F  NV++IESFN AG + + LG+N FADLTN EF A++      H      T FRYENVS
Sbjct  61    FNANVKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKVPTGFRYENVS  120

Query  420   --SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
               ++P T+DWR KGAVTP+KDQGQCGCCWAFSAVAA EGI K+STG LISLSEQELVDCD
Sbjct  121   IDALPATIDWRSKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCD  180

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
             V G DQGCEGGLMDDAF FII N GLTTES YPY   DG CK   +S +  K  GYEDVP
Sbjct  181   VHGEDQGCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKCKSGSNSAATIK--GYEDVP  238

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E+AL KAVANQPVSVA+D G   FQFYS GV TG CGT+LDHG+ A+GYG A DGT 
Sbjct  239   ANNEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGTN  298

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  1076
             YWL+KNSWGT+WGE GY+RM+KDI  K G+CG+AM+ SYP+
Sbjct  299   YWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>gb|KHN05669.1| Vignain [Glycine soja]
Length=315

 Score =   436 bits (1122),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 215/291 (74%), Positives = 241/291 (83%), Gaps = 5/291 (2%)
 Frame = +3

Query  216   VEKTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT  395
             +EK ++Y IFKENV+ IE+FN AG KPYKLGIN FADLTN+EF A  N +K  H CS  T
Sbjct  27    IEKEQKYQIFKENVQRIEAFNNAGNKPYKLGINHFADLTNEEFKAI-NRFK-GHVCSKRT  84

Query  396   ---PFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISL  566
                 FRYENV++VP ++DWR+KGAVTP+KDQGQCGCCWAFSAVAA EGITKL TG LISL
Sbjct  85    RTTTFRYENVTAVPASLDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGITKLRTGKLISL  144

Query  567   SEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaa  746
             SEQELVDCD KG+DQGCEGGLMDDAF FI+ NKGL TE+ YPY+G DG+C      N A 
Sbjct  145   SEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKGLATEAIYPYEGFDGTCNAKADGNHAG  204

Query  747   kisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVG  926
              I GYEDVPANSESAL KAVANQPVSVAI+A G  FQFYS GVFTG CGT LDHGVT+VG
Sbjct  205   SIKGYEDVPANSESALLKAVANQPVSVAIEASGFKFQFYSGGVFTGSCGTNLDHGVTSVG  264

Query  927   YGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YG+++DGTKYWLVKNSWG  WGEKGYIRMQ+D+ AKEGLCGIAM +SYPSA
Sbjct  265   YGVSDDGTKYWLVKNSWGVKWGEKGYIRMQRDVAAKEGLCGIAMLASYPSA  315



>gb|KDP40484.1| hypothetical protein JCGZ_24483 [Jatropha curcas]
Length=339

 Score =   437 bits (1123),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 217/334 (65%), Positives = 257/334 (77%), Gaps = 6/334 (2%)
 Frame = +3

Query  84    LLIALALVFATSAYLATS--RTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENV  257
             L I   L+F   A+   S  RT+    M  +HEQWM +YGRVYK++ EK  RY IFKENV
Sbjct  8     LCIGFGLLFILGAWTCESMARTVHKPPMYRKHEQWMTRYGRVYKDDNEKEMRYKIFKENV  67

Query  258   EYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNT-PFRYENVSSVPTT  434
             E I+SFN    + Y+LG+N FADLTN+EF  +RN +K  H CS+   PFRY+NV++VP T
Sbjct  68    ERIDSFNSDTRRSYRLGVNQFADLTNEEFNTARNRFK-GHMCSAQAGPFRYQNVTAVPAT  126

Query  435   VDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQG  614
             +DWRKKGAVTP+KDQGQCG CWAFSAVAA+EGI ++ TG LI+LSEQELVDCD  G DQG
Sbjct  127   MDWRKKGAVTPIKDQGQCGSCWAFSAVAAVEGIAQIKTGKLIALSEQELVDCDNNGEDQG  186

Query  615   CEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESAL  794
             C+GGLMDDAF F I   GL +E+ YPY   + +C   + +  A KI+GYEDVPAN E+AL
Sbjct  187   CQGGLMDDAFKF-IEKHGLASEATYPYHAAESACNTKEEAKPAVKITGYEDVPANDEAAL  245

Query  795   EKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNS  974
               AVANQPVSVAIDA G +FQFYSSG+FTG CGTELDHGV AVGYG+  DG K+WLVKNS
Sbjct  246   LNAVANQPVSVAIDASGFEFQFYSSGIFTGSCGTELDHGVAAVGYGV-NDGNKFWLVKNS  304

Query  975   WGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  1076
             WGT WGEKGYIRMQ+DI AKEGLCGIAMQ+SYP+
Sbjct  305   WGTQWGEKGYIRMQRDIAAKEGLCGIAMQASYPT  338



>ref|XP_004974541.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   437 bits (1123),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 217/341 (64%), Positives = 248/341 (73%), Gaps = 5/341 (1%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             M S    LL  L   F  S  LA      DS M  RHEQWMAQY RVYK+  EK +R  +
Sbjct  1     MTSPKAFLLAILGCAFLFSGALAARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRLEV  60

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHE-CSSNTPFRYENVS  419
             F  NV++IESFN AG + + LG+N FADLTN EF A++      H      T FRYENVS
Sbjct  61    FNANVKFIESFNAAGNRKFWLGVNQFADLTNDEFRATKTNKGFKHSPMKVPTGFRYENVS  120

Query  420   --SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
               ++P T+DWR KGAVTP+KDQGQCGCCWAFSAVAA EGI K+STG LISLSEQELVDCD
Sbjct  121   IDALPATIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLISLSEQELVDCD  180

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
             V G DQGCEGGLMDDAF FII N GLTTES YPY   DG CK   +S +  K  GYEDVP
Sbjct  181   VHGEDQGCEGGLMDDAFKFIIKNGGLTTESGYPYTAADGKCKSGSNSAATIK--GYEDVP  238

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E+AL KAVANQPVSVA+D G   FQFYS GV TG CGT+LDHG+ A+GYG A DGT 
Sbjct  239   ANNEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKASDGTN  298

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  1076
             YWL+KNSWGT+WGE GY+RM+KDI  K G+CG+AM+ SYP+
Sbjct  299   YWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>gb|AFW86317.1| hypothetical protein ZEAMMB73_339067 [Zea mays]
Length=433

 Score =   440 bits (1132),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 217/351 (62%), Positives = 258/351 (74%), Gaps = 11/351 (3%)
 Frame = +3

Query  42    GSLRLSTMASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVE  221
             G ++ STMA+    +   +   F   A +A      DS+M  RHEQWMAQY RVYK+  E
Sbjct  87    GLMQRSTMATLKASISAIIGFAFFCGAAMAARDLSDDSVMVARHEQWMAQYSRVYKDASE  146

Query  222   KTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN---  392
             K +R+ +FK NV++IESFN  G   + LG+N FADLTN EF +++    L    SSN   
Sbjct  147   KARRFEVFKANVQFIESFNAGGNNKFWLGVNQFADLTNDEFRSTKTNKGLK---SSNMKI  203

Query  393   -TPFRYENVSS--VPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLIS  563
              T FRYENVS+  +PTT+DWR KGAVTP+KDQGQCGCCWAFSAVAA EGI K+STG L+S
Sbjct  204   PTGFRYENVSADALPTTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLVS  263

Query  564   LSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsa  743
             L+EQELVDCDV G DQGCEGGLMDDAF FII N GLTTES+YPY   DG CK   +S + 
Sbjct  264   LAEQELVDCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESSYPYTAADGKCKSGSNSAAT  323

Query  744   akisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAV  923
              K  GYEDVPAN E+AL KAVANQPVSVA+D G   FQFYS GV TG CGT+LDHG+ A+
Sbjct  324   IK--GYEDVPANDEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAI  381

Query  924   GYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  1076
             GYG   DGTKYWL+KNSWGT+WGE GY+RM+KDI  K G+CG+AM+ SYP+
Sbjct  382   GYGKTSDGTKYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  432



>ref|XP_006367781.1| PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed cysteine endopeptidase 
CEP1-like [Solanum tuberosum]
Length=339

 Score =   436 bits (1121),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 219/332 (66%), Positives = 259/332 (78%), Gaps = 3/332 (1%)
 Frame = +3

Query  87    LIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYI  266
             + A  LV       ATSRTL +S M  +H++WMA+Y R YK+E+EK +R+ +FK+N EYI
Sbjct  10    IFATLLVLNLWIIQATSRTLYESSMVEKHDEWMAKYEREYKDEIEKAERFKVFKQNFEYI  69

Query  267   ESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPH-ECSSNTPFRYENVSSVPTTVDW  443
             ES NK G++ YKLGIN FAD   +EF + RNGYK+        T F+YEN SS P  VDW
Sbjct  70    ESINKNGSRSYKLGINEFADRRKEEFKSIRNGYKISSXRNKKKTSFQYENASS-PFMVDW  128

Query  444   RKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEG  623
             RKKGAVT +KDQGQCGCCWAFSAVAA+EG+ K+ TG LISLSEQELVDCD+ G ++GCEG
Sbjct  129   RKKGAVTRIKDQGQCGCCWAFSAVAAIEGLNKIKTGKLISLSEQELVDCDL-GSNEGCEG  187

Query  624   GLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKA  803
             GLMD AF FII N G+T+E++YPY+G + +C K K  N  AKI  YEDVP+NSESAL KA
Sbjct  188   GLMDYAFKFIIKNNGITSENSYPYKGINSTCNKKKLFNQIAKIYRYEDVPSNSESALVKA  247

Query  804   VANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGT  983
             +ANQP+SVAIDAGGSDFQFYSSGVFTG CG ELDHGVTAVGYG+   GTKYWLVKNSWGT
Sbjct  248   IANQPISVAIDAGGSDFQFYSSGVFTGHCGNELDHGVTAVGYGVTIGGTKYWLVKNSWGT  307

Query  984   SWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             SWGE GYI+M +D+  K GLCGIAMQ+SYP A
Sbjct  308   SWGENGYIKMLRDVNVKGGLCGIAMQASYPIA  339



>emb|CBI21977.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   434 bits (1115),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 213/299 (71%), Positives = 250/299 (84%), Gaps = 2/299 (1%)
 Frame = +3

Query  183   MAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNG  362
             MA+YGR+YK+  EK KR+ IFK+NV  IESFNKA  K YKL IN FADLTN+EF + RN 
Sbjct  1     MARYGRMYKDANEKEKRFKIFKDNVARIESFNKAMDKTYKLSINEFADLTNEEFRSLRNR  60

Query  363   YKLPHECSSNTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKL  542
             +K  H CS  T F+YENV++VP+T+DWRKKGAVTP+KDQ QCGCCWAFSAVAA EGIT++
Sbjct  61    FK-AHICSEATTFKYENVTAVPSTIDWRKKGAVTPIKDQQQCGCCWAFSAVAATEGITQI  119

Query  543   STGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckk  722
             +TG LISLSEQELVDCD  G +QGC GGLMDDAF FI    GL +E+ YPY+G DG+C  
Sbjct  120   TTGKLISLSEQELVDCDTGGENQGCSGGLMDDAFRFI-KIHGLASEATYPYEGDDGTCNS  178

Query  723   skssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTEL  902
              K ++ AAKI GYEDVPAN+E AL+KAVA+QPV+VAIDAGG +FQFY+SGVFTG+CGTEL
Sbjct  179   KKEAHPAAKIKGYEDVPANNEKALQKAVAHQPVAVAIDAGGFEFQFYTSGVFTGQCGTEL  238

Query  903   DHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             DHGV AVGYGI +DG  YWLVKNSWGT WGE+GYIRMQ+D+ AKEGLCGIAMQ+SYP+A
Sbjct  239   DHGVAAVGYGIGDDGMMYWLVKNSWGTGWGEEGYIRMQRDVTAKEGLCGIAMQASYPTA  297



>sp|Q7XWK5.2|SAG39_ORYSJ RecName: Full=Senescence-specific cysteine protease SAG39; AltName: 
Full=Cysteine proteinase SAG39; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 39; Flags: Precursor [Oryza sativa 
Japonica Group]
 emb|CAD40026.2| OSJNBa0052O21.11 [Oryza sativa Japonica Group]
 gb|EAZ29764.1| hypothetical protein OsJ_13822 [Oryza sativa Japonica Group]
Length=339

 Score =   435 bits (1118),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 220/343 (64%), Positives = 255/343 (74%), Gaps = 8/343 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             MA     L   L  +   SA LA      D+ MA RHE+WMAQYGRVY+++ EK +R+ +
Sbjct  1     MAMAKALLFAILGCLCLCSAVLAARELSDDAAMAARHERWMAQYGRVYRDDAEKARRFEV  60

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEF--IASRNGYKLPHECSSNTPFRYENV  416
             FK NV +IESFN AG   + LG+N FADLTN EF  + +  G+ +P      T FRYENV
Sbjct  61    FKANVAFIESFN-AGNHNFWLGVNQFADLTNDEFRWMKTNKGF-IPSTTRVPTGFRYENV  118

Query  417   S--SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDC  590
             +  ++P TVDWR KGAVTP+KDQGQCGCCWAFSAVAAMEGI KLSTG LISLSEQELVDC
Sbjct  119   NIDALPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDC  178

Query  591   DVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDV  770
             DV G DQGCEGGLMDDAF FII N GLTTESNYPY   D   K    SNS A I GYEDV
Sbjct  179   DVHGEDQGCEGGLMDDAFKFIIKNGGLTTESNYPYAAAD--DKCKSVSNSVASIKGYEDV  236

Query  771   PANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGT  950
             PAN+E+AL KAVANQPVSVA+D G   FQFY  GV TG CGT+LDHG+ A+GYG A DGT
Sbjct  237   PANNEAALMKAVANQPVSVAVDGGDMTFQFYKGGVMTGSCGTDLDHGIVAIGYGKASDGT  296

Query  951   KYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             KYWL+KNSWGT+WGE G++RM+KDI  K G+CG+AM+ SYP+A
Sbjct  297   KYWLLKNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPTA  339



>ref|XP_011005485.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=339

 Score =   435 bits (1118),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 211/336 (63%), Positives = 261/336 (78%), Gaps = 4/336 (1%)
 Frame = +3

Query  75    SLKLLIALALVFATSAYLATSRTLLDS-LMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKE  251
             S+ + +   L+ AT       R L +   M  RHE+WMAQ+GRVY++  EK KRY IFKE
Sbjct  7     SIHIFLPFLLILATKI---VCRPLDEQEYMLKRHEEWMAQHGRVYEDMKEKEKRYLIFKE  63

Query  252   NVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSSVPT  431
             N+E IE+FN    + YKLG+N FADLTN+EF A  +GYK       ++ FR+EN+S++P 
Sbjct  64    NIERIEAFNSGSDRGYKLGVNKFADLTNEEFRAMHHGYKRQSSKLMSSSFRHENLSAIPP  123

Query  432   TVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQ  611
             ++DWRK GAVTPVKDQG CGCCWAFSAVAA+EGI KL TG LISL+EQ+LVDCDV+G+DQ
Sbjct  124   SMDWRKAGAVTPVKDQGSCGCCWAFSAVAAIEGIIKLKTGKLISLTEQQLVDCDVEGLDQ  183

Query  612   GCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESA  791
             GC GGLMD+AF FI+ N GLT+E+ YPYQG DG+CK  K+++  AKI+GYEDVP N+E+A
Sbjct  184   GCGGGLMDNAFQFILRNGGLTSEATYPYQGVDGTCKSKKTASIEAKITGYEDVPVNNENA  243

Query  792   LEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKN  971
             L +AVA QPVSVA++ GG DFQFY SGVF G+CGT LDH VTA+GYG   DGT YWLVKN
Sbjct  244   LLQAVAKQPVSVAVEGGGYDFQFYKSGVFKGDCGTYLDHAVTAIGYGTNSDGTNYWLVKN  303

Query  972   SWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             SWGTSWGE GY+RMQ+ I A+EGLCG+AM +SYP+A
Sbjct  304   SWGTSWGESGYMRMQRGIGAREGLCGVAMDASYPTA  339



>sp|A2XQE8.1|SAG39_ORYSI RecName: Full=Senescence-specific cysteine protease SAG39; AltName: 
Full=Cysteine proteinase SAG39; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 39; Flags: Precursor [Oryza sativa 
Indica Group]
 gb|EAY93058.1| hypothetical protein OsI_14861 [Oryza sativa Indica Group]
Length=339

 Score =   434 bits (1117),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 220/342 (64%), Positives = 254/342 (74%), Gaps = 6/342 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             MA     L   L  +   SA LA      D+ MA RHE+WMAQYGRVY+++ EK +R+ +
Sbjct  1     MAMAKALLFAILGCLCLCSAVLAARELSDDAAMAARHERWMAQYGRVYRDDAEKARRFEV  60

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASR-NGYKLPHECSSNTPFRYENVS  419
             FK NV +IESFN AG   + LG+N FADLTN EF  ++ N   +P      T FRYENV+
Sbjct  61    FKANVAFIESFN-AGNHNFWLGVNQFADLTNDEFRWTKTNKGFIPSTTRVPTGFRYENVN  119

Query  420   --SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
               ++P TVDWR KGAVTP+KDQGQCGCCWAFSAVAAMEGI KLSTG LISLSEQELVDCD
Sbjct  120   IDALPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCD  179

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
             V G DQGCEGGLMDDAF FII N GLTTESNYPY   D   K    SNS A I GYEDVP
Sbjct  180   VHGEDQGCEGGLMDDAFKFIIKNGGLTTESNYPYAAAD--DKCKSVSNSVASIKGYEDVP  237

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E+AL KAVANQPVSVA+D G   FQFY  GV TG CGT+LDHG+ A+GYG A DGTK
Sbjct  238   ANNEAALMKAVANQPVSVAVDGGDMTFQFYKGGVMTGSCGTDLDHGIVAIGYGKASDGTK  297

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWL+KNSWGT+WGE G++RM+KDI  K G+CG+AM+ SYP+A
Sbjct  298   YWLLKNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPTA  339



>ref|XP_004975180.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score =   434 bits (1117),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 210/320 (66%), Positives = 246/320 (77%), Gaps = 5/320 (2%)
 Frame = +3

Query  126   LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKL  305
             LA      DS M  RHEQWMAQ+GR+YK++ EK +R+ +FK NV++IE+FN AG + + L
Sbjct  22    LAARELSDDSAMVARHEQWMAQHGRLYKDDAEKARRFEVFKTNVKFIETFNAAGNRKFWL  81

Query  306   GINAFADLTNKEFIASRNGYKL-PHECSSNTPFRYENVSS--VPTTVDWRKKGAVTPVKD  476
             G+N FADLTN EF A++      P+     T FRY NVS+  +P TVDWR KGAVTP+KD
Sbjct  82    GVNQFADLTNDEFRATKTNKGFNPNAVKVPTGFRYANVSTDALPATVDWRTKGAVTPIKD  141

Query  477   QGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFII  656
             QGQCGCCWAFSAVAAMEGI K+STG LISLSEQELVDCDV G DQGC GG MDDAFTFII
Sbjct  142   QGQCGCCWAFSAVAAMEGIVKISTGKLISLSEQELVDCDVHGEDQGCNGGEMDDAFTFII  201

Query  657   NNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAID  836
              N GLTTES+YPY   DG CK   +S +  K  GYEDVPAN E+AL KAVANQPVSVA+D
Sbjct  202   KNGGLTTESSYPYAAQDGQCKAGSNSAATIK--GYEDVPANDEAALMKAVANQPVSVAVD  259

Query  837   AGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQ  1016
              G   FQFYS GV TG CGT+LDHG+ A+GYG A DGTKYWL+KNSWGT+WGE G++RM+
Sbjct  260   GGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGTASDGTKYWLLKNSWGTTWGENGFLRME  319

Query  1017  KDIEAKEGLCGIAMQSSYPS  1076
             KDI  K G+CG+AMQ SYP+
Sbjct  320   KDISDKRGMCGLAMQPSYPT  339



>ref|XP_008803660.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
 ref|XP_008812192.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=338

 Score =   434 bits (1116),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 218/340 (64%), Positives = 261/340 (77%), Gaps = 3/340 (1%)
 Frame = +3

Query  63    MASNSLKLL-IALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYN  239
             MAS + + L + LAL F   +    SRT+ DSLMA RHE+WM QYGRVYK+  EK  R+ 
Sbjct  1     MASTTHQCLWLILALFFMGFSPRDASRTIGDSLMAARHERWMVQYGRVYKDAAEKEHRFQ  60

Query  240   IFKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVS  419
             IFK NV+YIES N+AG + YKL IN FADLT +EF AS  G+K     ++   FRY NV+
Sbjct  61    IFKANVDYIESTNQAGHRKYKLNINQFADLTTEEFRASYTGFKPKPMRATGQNFRYANVT  120

Query  420   SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVK  599
              VP +VDWR KGAVTP+KDQGQCGCCWAFSAV A EGI ++STG L SLSEQ+LVDCD  
Sbjct  121   DVPPSVDWRSKGAVTPIKDQGQCGCCWAFSAVVATEGIAQISTGKLTSLSEQQLVDCD--  178

Query  600   GIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPAN  779
              ++ GC GG+MDDAF +II+NKG+TTE+NYPY   +G+C  +KSS+ AA ISGYEDVP N
Sbjct  179   KVNGGCGGGIMDDAFKYIISNKGITTEANYPYVAKEGTCDTNKSSSVAATISGYEDVPRN  238

Query  780   SESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYW  959
             SES+L +AVA QPVSVAI+  G DFQFYS  VF G CGT+LDH VT VGYG A DGTKYW
Sbjct  239   SESSLLQAVAKQPVSVAIEGSGKDFQFYSGDVFMGNCGTDLDHAVTVVGYGTATDGTKYW  298

Query  960   LVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             L+KNSWGT+WGEKGY+R+ +DI+  EGLCGIAMQ SYP+A
Sbjct  299   LLKNSWGTTWGEKGYMRLLRDIDDAEGLCGIAMQPSYPTA  338



>emb|CAH66275.1| OSIGBa0147O06.5 [Oryza sativa Indica Group]
Length=339

 Score =   434 bits (1115),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 219/342 (64%), Positives = 257/342 (75%), Gaps = 13/342 (4%)
 Frame = +3

Query  84    LLIALALVFAT-------SAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             + +A AL+FA        SA LA      D+ MA RHE+WMAQYGR+YK++ EK +R+ +
Sbjct  1     MAMAKALLFAILGCLCLCSAVLAARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEV  60

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASR-NGYKLPHECSSNTPFRYENVS  419
             FK NV +IESFN AG   + LG+N FADLTN EF +++ N   +P      T FRYENV+
Sbjct  61    FKANVAFIESFN-AGNHKFWLGVNQFADLTNDEFRSTKTNKGFIPSTTRVPTGFRYENVN  119

Query  420   --SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCD  593
               ++P T+DWR KG VTP+KDQGQCGCCWAFSAVAAMEGI KLSTG LISLSEQELVDCD
Sbjct  120   IDALPATMDWRTKGVVTPIKDQGQCGCCWAFSAVAAMEGIVKLSTGKLISLSEQELVDCD  179

Query  594   VKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVP  773
             V G DQGCEGGLMDDAF FII N GLTTESNYPY   D   K    SNS A I GYEDVP
Sbjct  180   VHGEDQGCEGGLMDDAFKFIIKNGGLTTESNYPYAAAD--DKCKSVSNSVASIKGYEDVP  237

Query  774   ANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTK  953
             AN+E+AL KAVANQPVSVA+D G   FQFY  GV TG CGT+LDHG+ A+GYG A DGTK
Sbjct  238   ANNEAALMKAVANQPVSVAVDGGDMTFQFYKGGVMTGSCGTDLDHGIVAIGYGKASDGTK  297

Query  954   YWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             YWL+KNSWGT+WGE G++RM+KDI  K G+CG+AM+ SYP+A
Sbjct  298   YWLLKNSWGTTWGENGFLRMEKDISDKRGMCGLAMEPSYPTA  339



>ref|XP_003599736.1| Cysteine proteinase [Medicago truncatula]
 ref|XP_003607644.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89841.1| papain family cysteine protease [Medicago truncatula]
Length=340

 Score =   434 bits (1115),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 210/316 (66%), Positives = 251/316 (79%), Gaps = 3/316 (1%)
 Frame = +3

Query  135   SRTLLDSL-MAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGI  311
             SR L +SL +  RHEQWM ++G+VY++ +EK KR+ IFK+NVE+IESFN A  +PYKL +
Sbjct  27    SRKLYESLSLQERHEQWMTEHGKVYEDAIEKEKRFMIFKDNVEFIESFNAADNQPYKLSV  86

Query  312   NAFADLTNKEFIASRNGYKLPHECSSNTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCG  491
             N  ADLT  EF ASRNGYK      + T F+YENV+++P  VDWR KGAVTP+KDQGQCG
Sbjct  87    NHLADLTLDEFKASRNGYKKIDREFTTTSFKYENVTAIPAAVDWRVKGAVTPIKDQGQCG  146

Query  492   CCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGL  671
              CWAFS VAA EGI +++TG L+SLSEQELVDCD KG DQGCEGGLM+D F FII N G+
Sbjct  147   SCWAFSTVAATEGINQITTGKLVSLSEQELVDCDTKGEDQGCEGGLMEDGFEFIIKNGGI  206

Query  672   TTESNYPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSD  851
             T+E+NYPY+  DG    + ++   AKI+GYE VP NSE +L KAVANQP+SV+IDA  S 
Sbjct  207   TSETNYPYKAADG-SCNTATTTPVAKITGYEKVPVNSEKSLLKAVANQPISVSIDASDSS  265

Query  852   FQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEA  1031
             F FYSSG++TGECGTELDHGVTAVGYG A +GT YW+VKNSWGT WGEKGYIRMQ+ I A
Sbjct  266   FMFYSSGIYTGECGTELDHGVTAVGYGSA-NGTDYWIVKNSWGTVWGEKGYIRMQRGIAA  324

Query  1032  KEGLCGIAMQSSYPSA  1079
             KEGLCGIAM SSYP+A
Sbjct  325   KEGLCGIAMDSSYPTA  340



>ref|XP_008659446.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=340

 Score =   434 bits (1115),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 214/344 (62%), Positives = 253/344 (74%), Gaps = 11/344 (3%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             MA+    +   +   F   A +A      DS+M  RHEQWMAQY RVYK+  EK +R+ +
Sbjct  1     MATLKASISAIIGFAFFCGAAMAARDLSDDSVMVARHEQWMAQYSRVYKDASEKARRFEV  60

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN----TPFRYE  410
             FK NV++IESFN  G   + LG+N FADLTN EF +++    L    SSN    T FRYE
Sbjct  61    FKANVQFIESFNAGGNNKFWLGVNQFADLTNDEFRSTKTNKGLK---SSNMKIPTGFRYE  117

Query  411   NVSS--VPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELV  584
             NVS+  +PTT+DWR KGAVTP+KDQGQCGCCWAFSAVAA EGI K+STG L+SL+EQELV
Sbjct  118   NVSADALPTTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTGKLVSLAEQELV  177

Query  585   DCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYE  764
             DCDV G DQGCEGGLMDDAF FII N GLTTES+YPY   DG CK   +S +  K  GYE
Sbjct  178   DCDVHGEDQGCEGGLMDDAFKFIIKNGGLTTESSYPYTAADGKCKSGSNSAATIK--GYE  235

Query  765   DVPANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAED  944
             DVPAN E+AL KAVANQPVSVA+D G   FQFYS GV TG CGT+LDHG+ A+GYG   D
Sbjct  236   DVPANDEAALMKAVANQPVSVAVDGGDMTFQFYSGGVMTGSCGTDLDHGIAAIGYGKTSD  295

Query  945   GTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  1076
             GTKYWL+KNSWGT+WGE GY+RM+KDI  K G+CG+AM+ SYP+
Sbjct  296   GTKYWLMKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



>emb|CBI30671.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   433 bits (1113),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 227/341 (67%), Positives = 258/341 (76%), Gaps = 23/341 (7%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             MA  S  + I L L+    A  A SRTL +  M+ RHE WM  YGR YK+  EK +R+ I
Sbjct  1     MALESKIICITL-LIMGVWASQALSRTLHEVSMSERHEDWMGLYGRTYKDIAEKERRFKI  59

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSN--TPFRYENV  416
             FKENVEYIES NK                    F ASRNGY +     S+  T FRYENV
Sbjct  60    FKENVEYIESVNK--------------------FKASRNGYNMSSRPRSSEITSFRYENV  99

Query  417   SSVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDV  596
             ++VP+++DWRKKGAVTP+KDQGQCGCCWAFSAVAAMEG+T+L TG LISLSEQELVDCD 
Sbjct  100   AAVPSSMDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGVTQLKTGELISLSEQELVDCDT  159

Query  597   KGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPA  776
              G DQGC GGLMD AF FII N GLTTE+NYPY+G D +C K K+++SAAKI  YEDVPA
Sbjct  160   SGEDQGCGGGLMDSAFEFIIGNGGLTTEANYPYKGVDATCNKKKAASSAAKIKNYEDVPA  219

Query  777   NSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKY  956
             NSE+AL KAVA  PVSVAIDAGGSDFQFYSSGVFTG+CGTELDHGVTAVGYG  +DGTKY
Sbjct  220   NSEAALLKAVAQHPVSVAIDAGGSDFQFYSSGVFTGQCGTELDHGVTAVGYGKTDDGTKY  279

Query  957   WLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             WLVKNSWGT WGE GYI M++DI A EGLCGIAM++SYP+A
Sbjct  280   WLVKNSWGTGWGEDGYIWMERDIGADEGLCGIAMEASYPTA  320



>ref|XP_010035848.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW47319.1| hypothetical protein EUGRSUZ_K01106 [Eucalyptus grandis]
Length=336

 Score =   433 bits (1113),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 217/338 (64%), Positives = 260/338 (77%), Gaps = 9/338 (3%)
 Frame = +3

Query  72    NSLKLLIALALVFATSAYLATSRTL-LDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFK  248
             N   +L+ L  +    A+ A  RTL  D  M   H QWMA+YGRVYK+  EK  R+ IFK
Sbjct  6     NQYFILVPLVFLLGAWAHQAAGRTLQRDDPMYEMHGQWMARYGRVYKDVEEKQSRFEIFK  65

Query  249   ENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRNGYKLPHECSSNTP-FRYENVSSV  425
              NV  IE FN+A  KPYKLG+N F DLT +EF A RN ++  H CS+    F+YEN+++V
Sbjct  66    VNVRGIELFNQANDKPYKLGVNQFVDLTIEEFKA-RNRFE-SHMCSTEAASFKYENITAV  123

Query  426   PTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDCDVKGI  605
             P+++DWR+KGAVTPVK+QGQCGCCWAFSAVAA+EGI +++TG LISLSEQELVDCDV G 
Sbjct  124   PSSMDWREKGAVTPVKNQGQCGCCWAFSAVAAVEGINEITTGKLISLSEQELVDCDVGGQ  183

Query  606   DQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDVPANSE  785
             DQGCEGG M+ AF F+    GLTTE+ YPY+GTDG C    +        GYEDVPANSE
Sbjct  184   DQGCEGGWMNGAFQFV-EKHGLTTETYYPYKGTDGKCNVEGAVIIK----GYEDVPANSE  238

Query  786   SALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGTKYWLV  965
              AL KAVANQPVSVA+DAGG +FQFYSSGVFTG CGTELDHGVTAVGYG ++DGTK+WLV
Sbjct  239   EALLKAVANQPVSVAVDAGGFEFQFYSSGVFTGACGTELDHGVTAVGYGTSDDGTKFWLV  298

Query  966   KNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPSA  1079
             KN+WG  WGE+GYIRMQ+D+ AKEGLCGIAM++SYP+A
Sbjct  299   KNTWGEEWGEEGYIRMQRDVSAKEGLCGIAMKASYPTA  336



>gb|KDP45355.1| hypothetical protein JCGZ_09604 [Jatropha curcas]
Length=311

 Score =   432 bits (1110),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 212/311 (68%), Positives = 249/311 (80%), Gaps = 4/311 (1%)
 Frame = +3

Query  159   MAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKLGINAFADLTNK  338
             M  RHE+W AQ+GRVYK+  EK K+Y +FK+N+E IESFN    + YKLG+N FADLT++
Sbjct  1     MLKRHEEWRAQHGRVYKDTAEKQKKYLVFKDNLERIESFNNGVDRGYKLGLNKFADLTDE  60

Query  339   EFIASRNGYKLP----HECSSNTPFRYENVSSVPTTVDWRKKGAVTPVKDQGQCGCCWAF  506
             EF A   GYK P       S +  FRY NV+SVPTT+DWRK GAVTPVKDQG CG CWAF
Sbjct  61    EFQAMHLGYKSPPSKLMSTSKSRSFRYRNVTSVPTTIDWRKAGAVTPVKDQGSCGSCWAF  120

Query  507   SAVAAMEGITKLSTGNLISLSEQELVDCDVKGIDQGCEGGLMDDAFTFIINNKGLTTESN  686
             SAVAAMEGITKL TGNLISLSEQELVDCDV G D GC+GG MD AF +I+ N GLT+E+N
Sbjct  121   SAVAAMEGITKLKTGNLISLSEQELVDCDVAGEDYGCDGGFMDTAFQYILKNGGLTSEAN  180

Query  687   YPYQGTDGsckkskssnsaakisGYEDVPANSESALEKAVANQPVSVAIDAGGSDFQFYS  866
             YPYQG DG C K K++ S AKI+GYEDVP+NSE AL +AVANQPVSVAIDA G DF+FYS
Sbjct  181   YPYQGEDGICSKKKTATSMAKITGYEDVPSNSEKALLQAVANQPVSVAIDASGYDFRFYS  240

Query  867   SGVFTGECGTELDHGVTAVGYGIAEDGTKYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLC  1046
             SGVF G+C T+L+H VT +GYG + DGTKYWL+KNSWGT WGE GY+RMQ++I A EGLC
Sbjct  241   SGVFKGDCPTDLNHAVTVIGYGSSSDGTKYWLLKNSWGTGWGENGYMRMQREISANEGLC  300

Query  1047  GIAMQSSYPSA  1079
             GIAM++SYP+A
Sbjct  301   GIAMKASYPTA  311



>ref|XP_002446222.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
 gb|EES10550.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
Length=340

 Score =   432 bits (1112),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 215/342 (63%), Positives = 252/342 (74%), Gaps = 7/342 (2%)
 Frame = +3

Query  63    MASNSLKLLIALALVFATSAYLATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNI  242
             MA+    +L  L L     A LA      DS M  RHEQWMAQY RVYK+  EK +R+ +
Sbjct  1     MATLKGSILAILGLALFCGAALAARDLNDDSAMVARHEQWMAQYNRVYKDATEKAQRFEV  60

Query  243   FKENVEYIESFNKAGTKPYKLGINAFADLTNKEFIASRN--GYKLPHECSSNTPFRYENV  416
             FK NV++IESFN  G + + LG+N FADLTN EF A++   G+K P      T FRYENV
Sbjct  61    FKANVKFIESFNAGGNRKFWLGVNQFADLTNDEFRATKTNKGFK-PSPVKVPTGFRYENV  119

Query  417   S--SVPTTVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGITKLSTGNLISLSEQELVDC  590
             S  ++P ++DWR KGAVTP+KDQGQCGCCWAFSAVAA EGI K+ST  LISLSEQELVDC
Sbjct  120   SVDALPASIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGIVKISTDKLISLSEQELVDC  179

Query  591   DVKGIDQGCEGGLMDDAFTFIINNKGLTTESNYPYQGTDGsckkskssnsaakisGYEDV  770
             DV G DQGCEGGLMDDAF FII N GLTTES+YPY  TDG CK   +S +  K  G+EDV
Sbjct  180   DVHGEDQGCEGGLMDDAFKFIIKNGGLTTESSYPYTATDGKCKSGTNSAANIK--GFEDV  237

Query  771   PANSESALEKAVANQPVSVAIDAGGSDFQFYSSGVFTGECGTELDHGVTAVGYGIAEDGT  950
             PAN E+AL KAVANQPVSVA+D G   FQ YS GV TG CGT+LDHG+ A+GYG   DGT
Sbjct  238   PANDEAALMKAVANQPVSVAVDGGDMTFQLYSGGVMTGSCGTDLDHGIAAIGYGQTSDGT  297

Query  951   KYWLVKNSWGTSWGEKGYIRMQKDIEAKEGLCGIAMQSSYPS  1076
             KYWL+KNSWGT+WGE GY+RM+KDI  K G+CG+AM+ SYP+
Sbjct  298   KYWLLKNSWGTTWGENGYLRMEKDISDKRGMCGLAMEPSYPT  339



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3249488224448