BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25386_g1_i1 len=1079 path=[1057:0-178 1236:179-295 1353:296-303
1361:304-542 1600:543-559 1617:560-689 1747:690-692 3523:693-713
1771:714-742 1800:743-743 1801:744-765 3568:766-780 1838:781-783
1841:784-946 2004:947-964 3670:965-968 3674:969-969 2027:970-987
2045:988-1078]

Length=1079
                                                                      Score     E

ref|XP_009631729.1|  PREDICTED: uncharacterized protein LOC104121434    144   1e-37   
ref|XP_009770902.1|  PREDICTED: uncharacterized protein LOC104221534    142   7e-37   
gb|AAD02549.1|  PGPS/D7                                                 141   4e-36   Petunia x hybrida [garden petunia]
ref|XP_009757756.1|  PREDICTED: uncharacterized protein LOC104210532    136   1e-34   
ref|XP_009770899.1|  PREDICTED: uncharacterized protein LOC104221531    136   2e-34   
ref|XP_006339331.1|  PREDICTED: uncharacterized protein LOC102590924    135   3e-34   
ref|XP_009607505.1|  PREDICTED: uncharacterized protein LOC104101715    135   4e-34   
ref|XP_009631731.1|  PREDICTED: uncharacterized serine-rich prote...    135   4e-34   
ref|XP_004249388.1|  PREDICTED: uncharacterized protein LOC101268155    126   6e-31   
ref|XP_009774319.1|  PREDICTED: uncharacterized protein LOC104224387    125   2e-30   
ref|XP_009599569.1|  PREDICTED: uncharacterized protein LOC104095199    123   1e-29   
ref|XP_006348424.1|  PREDICTED: uncharacterized protein LOC102593013    105   3e-23   
ref|XP_010315854.1|  PREDICTED: uncharacterized protein LOC104645662    100   2e-21   
ref|XP_004228732.1|  PREDICTED: pectinesterase inhibitor-like         85.9    1e-16   
ref|XP_010058175.1|  PREDICTED: putative invertase inhibitor          58.9    6e-07   
ref|XP_011095483.1|  PREDICTED: uncharacterized protein LOC105174925  55.1    8e-06   
ref|XP_010934890.1|  PREDICTED: putative invertase inhibitor isof...  53.5    4e-05   
ref|XP_010934889.1|  PREDICTED: putative invertase inhibitor isof...  53.5    4e-05   
ref|XP_008229513.1|  PREDICTED: putative invertase inhibitor          50.8    3e-04   
ref|XP_010673974.1|  PREDICTED: uncharacterized protein LOC104890254  51.6    5e-04   
emb|CDY43633.1|  BnaC02g32990D                                        49.3    6e-04   
ref|XP_008356460.1|  PREDICTED: putative invertase inhibitor          49.7    7e-04   
ref|XP_010315440.1|  PREDICTED: putative invertase inhibitor          49.3    7e-04   
ref|XP_008788715.1|  PREDICTED: putative invertase inhibitor          49.7    7e-04   



>ref|XP_009631729.1| PREDICTED: uncharacterized protein LOC104121434 [Nicotiana tomentosiformis]
Length=186

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = -3

Query  552  SVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCKEVYEDSKDAMKKTL  373
            SVN +V S M+ + +KT++F+DTV+EKRL+DP    FTKDCL  CKEVYE++ DAMKKT+
Sbjct  65   SVNHYVDSLMEKSVSKTEDFLDTVVEKRLSDPAADPFTKDCLLVCKEVYENAVDAMKKTI  124

Query  372  EDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNTWVDGVIDQCLTMITGY  193
            EDVD G+YY AN+D+SA+++D ETC +C+K +YG DQE   F+ W + + +  L  I G+
Sbjct  125  EDVDRGSYYSANVDLSALTTDLETCMDCIKEIYGDDQEFMSFDDWAEKITEDALEKIVGF  184

Query  192  KA  187
             +
Sbjct  185  SS  186



>ref|XP_009770902.1| PREDICTED: uncharacterized protein LOC104221534 [Nicotiana sylvestris]
Length=184

 Score =   142 bits (358),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = -3

Query  552  SVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCKEVYEDSKDAMKKTL  373
            +VN +V S M+ T +KT+NFID+V+EKRL+DP    F KDCL  CKEVYE++ DAMKKT+
Sbjct  63   AVNHYVDSLMEKTVSKTENFIDSVVEKRLSDPAADPFAKDCLLVCKEVYENAVDAMKKTI  122

Query  372  EDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNTWVDGVIDQCLTMITGY  193
            EDV+ G+YY AN+D+SA+++D ETC +C+K +YG DQE   F+ W   + +  L  I G+
Sbjct  123  EDVNRGSYYSANVDLSALTTDLETCMDCIKEIYGDDQEFMSFDDWAGKITEDALEKIVGF  182

Query  192  KA  187
             +
Sbjct  183  SS  184



>gb|AAD02549.1| PGPS/D7 [Petunia x hybrida]
Length=209

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 90/133 (68%), Gaps = 4/133 (3%)
 Frame = -3

Query  582  SYDVPKDKQKS----VNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCK  415
            ++++PK+   +    V++FV++TM  T AKT  FI  VI+KRL DP++  + KDCL TCK
Sbjct  74   TFEIPKNIAIASTGDVSIFVKATMDATMAKTDEFITKVIDKRLADPKLDIYAKDCLETCK  133

Query  414  EVYEDSKDAMKKTLEDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNTWV  235
             V+ED+ DAMK+T EDV  GNYYKAN+DVSA+S++ +TC EC   +YG D    KF  W 
Sbjct  134  YVFEDAVDAMKRTEEDVKAGNYYKANVDVSAMSTNIDTCNECATSIYGDDPVFTKFENWA  193

Query  234  DGVIDQCLTMITG  196
             G+   CL  ITG
Sbjct  194  QGIASDCLAKITG  206



>ref|XP_009757756.1| PREDICTED: uncharacterized protein LOC104210532 [Nicotiana sylvestris]
Length=182

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 86/119 (72%), Gaps = 1/119 (1%)
 Frame = -3

Query  552  SVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCKEVYEDSKDAMKKTL  373
            SV   V S M  + +KT++F++ V+EKRL    +  + KDCL TCKEVYED+ DAMK+TL
Sbjct  62   SVKNLVGSLMVSSISKTEDFVNKVVEKRLARI-VDAYKKDCLETCKEVYEDAVDAMKETL  120

Query  372  EDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNTWVDGVIDQCLTMITG  196
            EDV+ GNYYKAN+DVSA+SS+ ETCKECV  +YG+D E  KF+ W   +I+  LT IT 
Sbjct  121  EDVNEGNYYKANVDVSAMSSNMETCKECVNAIYGQDPEFTKFDNWAQAIIEDALTRITS  179



>ref|XP_009770899.1| PREDICTED: uncharacterized protein LOC104221531 [Nicotiana sylvestris]
Length=206

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 89/133 (67%), Gaps = 4/133 (3%)
 Frame = -3

Query  582  SYDVPKD----KQKSVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCK  415
            ++++PK+      + V++FV++ M  T +KT  FI  VI+KRL +P    + KDCL TCK
Sbjct  71   TFEIPKNIPVISTEDVSIFVKAIMDATMSKTDEFISKVIDKRLAEPNTDIYAKDCLETCK  130

Query  414  EVYEDSKDAMKKTLEDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNTWV  235
             V+ED+KDAMK+T EDV  GN YKAN+DVSA+S++ +TC EC   +YG D E  KF+ W 
Sbjct  131  SVFEDAKDAMKRTEEDVKAGNMYKANVDVSAMSTNIDTCNECATSIYGFDPEFKKFDNWA  190

Query  234  DGVIDQCLTMITG  196
             G+   CL  ITG
Sbjct  191  QGIASDCLDKITG  203



>ref|XP_006339331.1| PREDICTED: uncharacterized protein LOC102590924 [Solanum tuberosum]
Length=190

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -3

Query  576  DVPKDKQKSVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCKEVYEDS  397
            +V    ++SVN +V S M  T  KT+ F++ V+EKRL DP    F KDCL  CKEVYE++
Sbjct  61   NVQLGNKESVNNYVDSLMVTTVTKTEQFLNNVVEKRLIDPSADAFVKDCLLVCKEVYENA  120

Query  396  KDAMKKTLEDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNTWVDGVIDQ  217
             DAMKKT+ DVD G YY AN+D+SA+S+D ETC +CVK +YG DQE  KF+ W   V   
Sbjct  121  VDAMKKTMVDVDSGAYYSANVDLSALSTDLETCMDCVKEIYGDDQEFIKFDDWAGKVTVD  180

Query  216  CLTMITGYKA  187
             +  I G+ +
Sbjct  181  AMEKIVGFSS  190



>ref|XP_009607505.1| PREDICTED: uncharacterized protein LOC104101715 [Nicotiana tomentosiformis]
Length=179

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 86/127 (68%), Gaps = 1/127 (1%)
 Frame = -3

Query  576  DVPKDKQKSVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCKEVYEDS  397
            D       SV   V S M  + +KT++F++ V+EKRL    +  + KDCL TC+EVYED+
Sbjct  51   DASNSNGASVKNLVGSLMVSSISKTEDFVNKVVEKRLA-KIVDAYKKDCLETCREVYEDA  109

Query  396  KDAMKKTLEDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNTWVDGVIDQ  217
             DAMK+TLEDV+ GNYYKAN+DVS +SS+ ETCKECV  +YG+D E  KF+ W   +I+ 
Sbjct  110  VDAMKETLEDVNEGNYYKANVDVSTMSSNMETCKECVNAIYGQDPEFTKFDNWAHAIIED  169

Query  216  CLTMITG  196
             LT IT 
Sbjct  170  ALTRITS  176



>ref|XP_009631731.1| PREDICTED: uncharacterized serine-rich protein C1E8.05-like [Nicotiana 
tomentosiformis]
Length=213

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 88/133 (66%), Gaps = 4/133 (3%)
 Frame = -3

Query  582  SYDVPKD----KQKSVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCK  415
            ++++PK+        V++FV++ M  T +KT  FI  VI+KRL +P    + KDCL TCK
Sbjct  78   TFEIPKNIPVVSTGDVSIFVKAIMDATMSKTDEFITKVIDKRLAEPNTDIYAKDCLETCK  137

Query  414  EVYEDSKDAMKKTLEDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNTWV  235
             V+ED+KDAMK+T EDV  GN YKAN+DVSA+S++ +TC EC   +YG D E  KF+ W 
Sbjct  138  SVFEDAKDAMKRTEEDVKAGNMYKANVDVSAMSTNIDTCNECATSIYGFDPEFKKFDNWA  197

Query  234  DGVIDQCLTMITG  196
             G+   CL  ITG
Sbjct  198  QGIASDCLDKITG  210



>ref|XP_004249388.1| PREDICTED: uncharacterized protein LOC101268155 [Solanum lycopersicum]
Length=190

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = -3

Query  555  KSVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCKEVYEDSKDAMKKT  376
            + V++F+ S M+ T  KT+ FI  VIE+RL +P    +  DCL TCK VY+D+ DAMKK 
Sbjct  68   RDVSVFINSMMEATMGKTEEFIVNVIEQRLEEPDTDIYATDCLETCKSVYQDAVDAMKKA  127

Query  375  LEDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNTWVDGVIDQCLTMITG  196
             EDV    YYKA++D+SAI++D +TC EC   +YG+D E  +F+ W+ GV  +CL  I+ 
Sbjct  128  EEDVKSKEYYKADLDISAITTDIDTCNECAVSIYGEDTEFRQFDNWIQGVATECLDKISA  187



>ref|XP_009774319.1| PREDICTED: uncharacterized protein LOC104224387 [Nicotiana sylvestris]
Length=192

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 85/132 (64%), Gaps = 4/132 (3%)
 Frame = -3

Query  579  YDVPKD----KQKSVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCKE  412
            +D+P      K   +  FV+++M  T  KT+ FI  VI+KRL + ++ ++ KDCL TCKE
Sbjct  58   FDIPTKPLVAKASDIPSFVKASMVGTMTKTEEFIKNVIDKRLANKKMDSYQKDCLETCKE  117

Query  411  VYEDSKDAMKKTLEDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNTWVD  232
            VYED+ D+M K  EDV+ GNY+KAN+D+SA++S  ETCK+C   +YG D    KF  W +
Sbjct  118  VYEDAMDSMTKATEDVNLGNYFKANVDISAMTSFIETCKDCAAEMYGDDPAFQKFQNWAE  177

Query  231  GVIDQCLTMITG  196
            G+   CL  + G
Sbjct  178  GIASDCLDKVAG  189



>ref|XP_009599569.1| PREDICTED: uncharacterized protein LOC104095199 [Nicotiana tomentosiformis]
Length=192

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 85/135 (63%), Gaps = 4/135 (3%)
 Frame = -3

Query  588  IMSYDVPKD----KQKSVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRT  421
            I  +D+P      K   +   V+++M  T  KT+ FI  VI+KRL + ++ ++ KDCL T
Sbjct  55   IQIFDIPTKPLVAKASDIPSLVKASMVGTMTKTEEFIKNVIDKRLANKKMDSYHKDCLET  114

Query  420  CKEVYEDSKDAMKKTLEDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNT  241
            CKEVYED+ D+M K  EDV+ GNY+KAN+D+SA++S  ETCK+C   +YG D    KF  
Sbjct  115  CKEVYEDAMDSMTKATEDVNLGNYFKANVDISAMTSFIETCKDCAAEMYGDDPAFQKFQN  174

Query  240  WVDGVIDQCLTMITG  196
            W +G+   CL  + G
Sbjct  175  WAEGIASDCLDKVAG  189



>ref|XP_006348424.1| PREDICTED: uncharacterized protein LOC102593013 [Solanum tuberosum]
Length=190

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 68/111 (61%), Gaps = 1/111 (1%)
 Frame = -3

Query  540  FVQSTMQVTEAKTQNFIDTVIEKRLN-DPQIGTFTKDCLRTCKEVYEDSKDAMKKTLEDV  364
            FV++TM  T +KTQ FI  VIEKRL    ++  + KDCL TCKEVY D+ DAMKK  +DV
Sbjct  70   FVKATMVGTMSKTQEFIKNVIEKRLALSAKMDHYRKDCLETCKEVYGDAIDAMKKASQDV  129

Query  363  DGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNTWVDGVIDQCL  211
               N+YKAN+D+SA+ S  ETC +CV      D     F  W  GV   CL
Sbjct  130  KAQNFYKANMDLSAMYSYIETCHDCVVETKENDLAFQNFEKWAKGVASDCL  180



>ref|XP_010315854.1| PREDICTED: uncharacterized protein LOC104645662 [Solanum lycopersicum]
 gb|AGN92796.1| petin methylesterase inhibitor [Solanum lycopersicum]
Length=184

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 77/120 (64%), Gaps = 1/120 (1%)
 Frame = -3

Query  555  KSVNMFVQSTMQVTEAKTQNFIDTVIEKRL-NDPQIGTFTKDCLRTCKEVYEDSKDAMKK  379
            ++V  FV++++  T AKTQ+FI  VI+KRL +   I  + KDC +TCKEVYED+ D+MKK
Sbjct  59   QNVPAFVKASLVSTMAKTQDFIKNVIDKRLASSAPIDHYKKDCFKTCKEVYEDAIDSMKK  118

Query  378  TLEDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNTWVDGVIDQCLTMIT  199
              +DV   NYYKAN+D+ A  +  +TC++C+      +   ++F+ W   +   CL+ ++
Sbjct  119  ATQDVKELNYYKANMDIGASYTYLDTCRDCIVDTKDNEPAFEQFDRWAKAIASDCLSKVS  178



>ref|XP_004228732.1| PREDICTED: pectinesterase inhibitor-like [Solanum lycopersicum]
Length=156

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 73/130 (56%), Gaps = 10/130 (8%)
 Frame = -3

Query  570  PKDKQKSVNMFVQSTMQVTEAKTQNFIDTVIEKRL----NDPQIGTFTKDCLRTCKEVYE  403
            P   + +V   V   M  T AKT+ F+ T I  RL     +P      KDCL TCKEVYE
Sbjct  29   PNVDKANVKNLVTPLMVSTIAKTEEFVKTNIITRLATVKENPN-----KDCLDTCKEVYE  83

Query  402  DSKDAMKKTLEDVDGGNYYKANIDVSAISSDAETCKECVKMVY-GKDQELDKFNTWVDGV  226
            D+ DAMKKT++ VD GNY +A + VSA+ S   TCK+ ++ ++   + E+ KF  W +GV
Sbjct  84   DAVDAMKKTIKSVDEGNYVEALVHVSAVGSFMGTCKDSIEEIHCDVNPEMTKFEDWSNGV  143

Query  225  IDQCLTMITG  196
            I    T I  
Sbjct  144  ISDATTKIAS  153



>ref|XP_010058175.1| PREDICTED: putative invertase inhibitor [Eucalyptus grandis]
 gb|KCW71839.1| hypothetical protein EUGRSUZ_E00321 [Eucalyptus grandis]
Length=180

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -3

Query  492  IDTVIEKRLNDPQIGTFTKDCLRTCKEVYEDSKDAMKKTLEDVDGGNYYKANIDVSAISS  313
            + + I K L +  +  F +DCL TC E+Y D+   ++  ++D+   +YYKAN+DVSA   
Sbjct  80   VSSCISKLLQNKTLDHFARDCLTTCLELYSDAYSTLRGVVDDLGSRDYYKANVDVSAAMD  139

Query  312  DAETCKE  292
             A TC++
Sbjct  140  AAVTCED  146



>ref|XP_011095483.1| PREDICTED: uncharacterized protein LOC105174925 [Sesamum indicum]
Length=165

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 58/136 (43%), Gaps = 7/136 (5%)
 Frame = -3

Query  600  DNEPIMSYDVPKDKQKSVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRT  421
            D+   +   VPK++Q     ++   M     + + F  T + KRL DP      K  L  
Sbjct  36   DHFRFLHSIVPKEEQAKDCQYLTEQMTAAVKQVEQFSATAVAKRLKDPPTDDCAKKALLL  95

Query  420  CKEVYEDSKDAMKKTLEDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNT  241
            C+E Y+ + + +KK +E V  G++ +A  +     +    C +     +G   E   F  
Sbjct  96   CEEAYKKAVEMLKKGVESVSAGDFVQAKKNSRTFINYINACDDS----FG---EFRNFGD  148

Query  240  WVDGVIDQCLTMITGY  193
            W  GV D CL  I  Y
Sbjct  149  WARGVGDDCLGKIVKY  164



>ref|XP_010934890.1| PREDICTED: putative invertase inhibitor isoform X2 [Elaeis guineensis]
Length=188

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 47/84 (56%), Gaps = 1/84 (1%)
 Frame = -3

Query  573  VPKDKQKSVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCKEVYEDSK  394
            VPK     V       +++++AK ++   ++++K L    +G + K+CL TCK++Y DS 
Sbjct  63   VPKSHHSDVRGLAIVAVKLSKAKMKHA-KSMVKKLLKAKPMGRYMKNCLLTCKDIYSDSI  121

Query  393  DAMKKTLEDVDGGNYYKANIDVSA  322
              +K +L+ +  G Y  ANI +S 
Sbjct  122  SNLKDSLKAIKSGQYKDANIQISG  145



>ref|XP_010934889.1| PREDICTED: putative invertase inhibitor isoform X1 [Elaeis guineensis]
Length=206

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 47/84 (56%), Gaps = 1/84 (1%)
 Frame = -3

Query  573  VPKDKQKSVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCKEVYEDSK  394
            VPK     V       +++++AK ++   ++++K L    +G + K+CL TCK++Y DS 
Sbjct  63   VPKSHHSDVRGLAIVAVKLSKAKMKH-AKSMVKKLLKAKPMGRYMKNCLLTCKDIYSDSI  121

Query  393  DAMKKTLEDVDGGNYYKANIDVSA  322
              +K +L+ +  G Y  ANI +S 
Sbjct  122  SNLKDSLKAIKSGQYKDANIQISG  145



>ref|XP_008229513.1| PREDICTED: putative invertase inhibitor [Prunus mume]
Length=183

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (52%), Gaps = 1/99 (1%)
 Frame = -3

Query  540  FVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCKEVYEDSKDAMKKTLEDVD  361
             V  ++ +T A   N I++ I K L D     F K+CLR C E+Y D+   +++ L    
Sbjct  66   LVVISLNLTVANATN-INSTISKLLKDKAFDKFAKECLRGCSELYADAIPTLQEALCAFQ  124

Query  360  GGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFN  244
              ++ KANI+VS+    + TC++  K   G+   L K N
Sbjct  125  SKDFAKANIEVSSAMDASSTCEDGFKEKKGEVSPLRKEN  163



>ref|XP_010673974.1| PREDICTED: uncharacterized protein LOC104890254 [Beta vulgaris 
subsp. vulgaris]
Length=384

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 61/127 (48%), Gaps = 1/127 (1%)
 Frame = -3

Query  570  PKDKQKSVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCKEVYEDSKD  391
            P+    S++  V+ +  ++ +K  + I T I + L DP+   F K  L+ C E+Y D+ D
Sbjct  258  PRSSNTSIDGLVEISFNLSSSKAIS-ISTTIAQLLKDPKFDPFGKSALQACYEIYSDAPD  316

Query  390  AMKKTLEDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNTWVDGVIDQCL  211
             ++  LE +  G++  AN+ VS     A  C++  +   G+   L K N+    ++D  L
Sbjct  317  DLQAGLEALKRGDFSTANVRVSGALDIAPDCEDSFQDKQGEVSPLTKDNSEFFQLVDISL  376

Query  210  TMITGYK  190
                  K
Sbjct  377  AFTVLLK  383



>emb|CDY43633.1| BnaC02g32990D [Brassica napus]
Length=154

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 61/116 (53%), Gaps = 5/116 (4%)
 Frame = -3

Query  567  KDKQKSVNMFVQSTMQVTEAKTQN-FIDTVIEKRLNDPQIGTFTKDCLRTCKEVYEDSKD  391
            KD     +  VQS  Q  ++KT    ++T+++ +   P     T+  LRTC E+Y+D+ +
Sbjct  34   KDPTLKYDFCVQSLEQDPQSKTATRIVETILKSKTYPPG----TEPALRTCVELYDDANN  89

Query  390  AMKKTLEDVDGGNYYKANIDVSAISSDAETCKECVKMVYGKDQELDKFNTWVDGVI  223
            ++ + L +V  G+Y  AN+D+SA   +  TC++  K  + K    ++ N     ++
Sbjct  90   SLNEALMNVKSGDYKSANVDLSAALDEPGTCEDGFKEKHAKSPVTNENNVLFQKIL  145



>ref|XP_008356460.1| PREDICTED: putative invertase inhibitor [Malus domestica]
Length=190

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = -3

Query  540  FVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCKEVYEDSKDAMKKTLEDVD  361
             V  ++ +T +   N I+++I K L D Q   + +DCL+ C E+Y D+   +++ L    
Sbjct  74   LVLXSLNLTISNATN-INSIISKLLKDKQFDKYARDCLKGCSELYSDAIPTLQEALCXFR  132

Query  360  GGNYYKANIDVSAISSDAETCKECVK  283
              ++ KAN++VS+    + TC++  K
Sbjct  133  SKDFPKANVEVSSAMDASSTCEDGFK  158



>ref|XP_010315440.1| PREDICTED: putative invertase inhibitor [Solanum lycopersicum]
Length=174

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -3

Query  468  LNDPQIGTFTKDCLRTCKEVYEDSKDAMKKTLEDVDGGNYYKANIDVSAISSDAETCKE  292
            L D Q+ +    CL+ C EVY ++  ++K   +  +   YY ANI +SA+ +DA TC++
Sbjct  71   LKDKQLDSHNTSCLKACLEVYSNAIASIKHATKSYNTKQYYDANIQISAVIADATTCED  129



>ref|XP_008788715.1| PREDICTED: putative invertase inhibitor [Phoenix dactylifera]
Length=188

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 47/84 (56%), Gaps = 1/84 (1%)
 Frame = -3

Query  573  VPKDKQKSVNMFVQSTMQVTEAKTQNFIDTVIEKRLNDPQIGTFTKDCLRTCKEVYEDSK  394
            VPK     V       +++++AKT +   ++++K L    +  + K+CL TCK+VY DS 
Sbjct  63   VPKSHHSDVRGLAIVAVKLSKAKTMHA-KSMVKKLLKAKPMEGYMKNCLLTCKDVYSDSI  121

Query  393  DAMKKTLEDVDGGNYYKANIDVSA  322
              +K +++ +  G Y  ANI +S+
Sbjct  122  SDLKDSMKAIKSGQYKDANIRISS  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2521031146656