BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25382_g8_i1 len=877 path=[899:0-268 1168:269-291 1191:292-315
1215:316-332 1232:333-368 1268:369-388 1288:389-800 1700:801-876]

Length=877
                                                                      Score     E

ref|XP_009605493.1|  PREDICTED: protein YLS9-like                       138   1e-35   
ref|XP_011088967.1|  PREDICTED: protein YLS9-like                       137   1e-35   
ref|XP_009776256.1|  PREDICTED: protein YLS9-like                       138   1e-35   
ref|XP_006361098.1|  PREDICTED: uncharacterized protein At1g08160...    137   3e-35   
ref|XP_009606939.1|  PREDICTED: protein YLS9                            137   3e-35   
ref|XP_009802139.1|  PREDICTED: protein YLS9-like                       136   8e-35   
ref|XP_004241341.1|  PREDICTED: protein YLS9                            135   9e-35   
ref|XP_011090312.1|  PREDICTED: protein YLS9                            134   5e-34   
ref|XP_010685425.1|  PREDICTED: protein YLS9-like                       133   1e-33   
ref|XP_006404481.1|  hypothetical protein EUTSA_v10010725mg             132   2e-33   
emb|CDP06858.1|  unnamed protein product                                132   2e-33   
emb|CDY08687.1|  BnaC03g54950D                                          131   3e-33   
ref|XP_009123302.1|  PREDICTED: protein YLS9                            131   4e-33   
gb|KFK33871.1|  hypothetical protein AALP_AA5G071100                    131   4e-33   
ref|XP_010425840.1|  PREDICTED: protein YLS9-like                       131   4e-33   
ref|XP_006291857.1|  hypothetical protein CARUB_v10018033mg             130   8e-33   
ref|XP_004251093.1|  PREDICTED: protein YLS9-like                       130   1e-32   
ref|XP_002523871.1|  conserved hypothetical protein                     130   1e-32   Ricinus communis
ref|XP_006362852.1|  PREDICTED: uncharacterized protein LOC102591975    130   2e-32   
ref|XP_010514763.1|  PREDICTED: protein YLS9-like                       129   2e-32   
ref|XP_010503078.1|  PREDICTED: protein YLS9-like                       129   2e-32   
gb|EYU36038.1|  hypothetical protein MIMGU_mgv1a022940mg                129   3e-32   
ref|NP_190008.1|  late embryogenesis abundant hydroxyproline-rich...    128   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006424128.1|  hypothetical protein CICLE_v10029271mg             128   6e-32   
ref|XP_006481531.1|  PREDICTED: uncharacterized protein LOC102607257    128   6e-32   
ref|XP_002875648.1|  harpin-induced family protein                      127   1e-31   
ref|NP_680206.1|  late embryogenesis abundant hydroxyproline-rich...    124   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KDP35478.1|  hypothetical protein JCGZ_10871                         122   5e-30   
ref|XP_009349115.1|  PREDICTED: protein YLS9-like                       123   6e-30   
ref|XP_011046867.1|  PREDICTED: protein YLS9-like                       122   9e-30   
ref|XP_010426862.1|  PREDICTED: protein YLS9-like                       122   1e-29   
gb|ABY88538.1|  NHL1                                                    121   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515712.1|  PREDICTED: protein YLS9-like                       121   2e-29   
ref|XP_002871993.1|  harpin-induced family protein                      121   2e-29   
ref|XP_008391966.1|  PREDICTED: protein YLS9                            121   2e-29   
ref|XP_010520462.1|  PREDICTED: protein YLS9-like                       121   2e-29   
ref|XP_011012388.1|  PREDICTED: protein YLS9-like                       121   2e-29   
gb|ABY88526.1|  NHL1                                                    120   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010246827.1|  PREDICTED: protein YLS9-like                       121   2e-29   
ref|XP_010262976.1|  PREDICTED: protein YLS9-like                       121   3e-29   
gb|ABY88500.1|  NHL1                                                    120   3e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABY88551.1|  NHL1                                                    120   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABY88488.1|  NHL1                                                    120   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABY88541.1|  NHL1                                                    120   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABY88583.1|  NHL1                                                    120   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABY88494.1|  NHL1                                                    120   4e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CDX98590.1|  BnaC05g37850D                                          120   5e-29   
ref|XP_009120680.1|  PREDICTED: protein YLS9-like                       120   5e-29   
gb|ABY88506.1|  NHL1                                                    119   6e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABY88492.1|  NHL1                                                    119   6e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004136510.1|  PREDICTED: protein NDR1-like                       120   6e-29   
ref|XP_011042605.1|  PREDICTED: protein YLS9-like                       120   6e-29   
ref|XP_004170854.1|  PREDICTED: protein NDR1-like                       120   7e-29   
gb|ABY88497.1|  NHL1                                                    119   7e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABY88572.1|  NHL1                                                    119   7e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566396.1|  NDR1/HIN1-Like protein 1                              120   8e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABY88504.1|  NHL1                                                    119   8e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABY88498.1|  NHL1                                                    119   8e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABY88493.1|  NHL1                                                    119   8e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABY88553.1|  NHL1                                                    119   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403801.1|  hypothetical protein EUTSA_v10010723mg             119   1e-28   
ref|XP_002322794.1|  harpin-induced family protein                      119   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_008449594.1|  PREDICTED: protein YLS9-like                       119   1e-28   
gb|AAO41900.1|  putative VAMP protein SEC22                             119   2e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92375.1|  BnaA10g14140D                                          119   2e-28   
ref|XP_010454483.1|  PREDICTED: protein YLS9-like                       119   2e-28   
emb|CDX90600.1|  BnaA03g41810D                                          118   3e-28   
ref|XP_010534393.1|  PREDICTED: protein YLS9-like                       118   3e-28   
ref|XP_008442910.1|  PREDICTED: protein YLS9-like                       120   3e-28   
ref|XP_009136681.1|  PREDICTED: protein YLS9-like                       118   4e-28   
gb|ABY88578.1|  NHL1                                                    117   4e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288666.1|  hypothetical protein CARUB_v10001972mg             117   6e-28   
ref|XP_002313488.1|  harpin-induced family protein                      117   6e-28   Populus trichocarpa [western balsam poplar]
gb|ABY88581.1|  NHL1                                                    117   7e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004140168.1|  PREDICTED: uncharacterized protein LOC101220278    117   9e-28   
ref|XP_006400726.1|  hypothetical protein EUTSA_v10015904mg             117   9e-28   
ref|NP_001146876.1|  VAMP protein SEC22                                 117   1e-27   Zea mays [maize]
ref|XP_010493295.1|  PREDICTED: protein YLS9-like                       117   1e-27   
ref|XP_006381955.1|  hypothetical protein POPTR_0006s22060g             117   1e-27   
ref|XP_011077802.1|  PREDICTED: protein YLS9                            116   2e-27   
ref|XP_010556416.1|  PREDICTED: protein YLS9-like                       116   2e-27   
ref|XP_010486834.1|  PREDICTED: protein YLS9-like                       116   2e-27   
ref|XP_007027946.1|  NDR1/HIN1-like 1                                   116   2e-27   
ref|XP_002876147.1|  hypothetical protein ARALYDRAFT_485614             116   2e-27   
ref|XP_010464906.1|  PREDICTED: uncharacterized protein LOC104745392    115   3e-27   
ref|XP_006294991.1|  hypothetical protein CARUB_v10024063mg             115   3e-27   
ref|XP_004303497.1|  PREDICTED: uncharacterized protein LOC101309947    115   4e-27   
gb|KFK26335.1|  hypothetical protein AALP_AA8G234500                    115   4e-27   
emb|CAN79940.1|  hypothetical protein VITISV_027779                     115   5e-27   Vitis vinifera
gb|ABB36604.1|  hairpin-induced 1-like protein NHL18B                   115   5e-27   Brassica napus [oilseed rape]
ref|XP_010497727.1|  PREDICTED: protein YLS9-like                       115   5e-27   
ref|XP_002884856.1|  predicted protein                                  115   5e-27   
ref|XP_008243456.1|  PREDICTED: protein YLS9-like                       115   6e-27   
emb|CDX95339.1|  BnaC04g28190D                                          117   6e-27   
gb|EYU28513.1|  hypothetical protein MIMGU_mgv1a013735mg                115   6e-27   
ref|XP_011046866.1|  PREDICTED: protein YLS9-like                       115   7e-27   
ref|XP_008462618.1|  PREDICTED: protein YLS9-like                       114   7e-27   
ref|XP_002873250.1|  hypothetical protein ARALYDRAFT_908558             115   7e-27   
ref|NP_181140.1|  NDR1/HIN1-like 12 protein                             114   7e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010031556.1|  PREDICTED: protein YLS9                            114   7e-27   
ref|NP_190815.1|  late embryogenesis abundant hydroxyproline-rich...    114   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002270691.1|  PREDICTED: protein YLS9                            114   8e-27   Vitis vinifera
ref|XP_009372581.1|  PREDICTED: protein YLS9-like                       114   8e-27   
emb|CDY69198.1|  BnaCnng62320D                                          114   9e-27   
emb|CDY68967.1|  BnaA09g54700D                                          114   9e-27   
ref|XP_009115947.1|  PREDICTED: protein YLS9-like                       114   1e-26   
ref|XP_010421009.1|  PREDICTED: protein YLS9                            114   1e-26   
ref|XP_010037312.1|  PREDICTED: protein YLS9-like                       114   1e-26   
ref|XP_008379701.1|  PREDICTED: protein YLS9-like                       114   1e-26   
ref|XP_009139451.1|  PREDICTED: protein YLS9-like                       114   1e-26   
ref|XP_009593207.1|  PREDICTED: protein YLS9-like                       114   1e-26   
ref|XP_009769111.1|  PREDICTED: protein YLS9-like                       114   1e-26   
ref|XP_006291851.1|  hypothetical protein CARUB_v10018026mg             113   2e-26   
ref|XP_010516804.1|  PREDICTED: protein YLS9-like                       113   2e-26   
gb|KFK34493.1|  hypothetical protein AALP_AA5G152700                    113   3e-26   
ref|XP_002879584.1|  hypothetical protein ARALYDRAFT_482567             113   3e-26   
ref|XP_008463636.1|  PREDICTED: protein YLS9-like                       112   4e-26   
gb|EPS70325.1|  harpin-induced family protein                           112   5e-26   
ref|XP_010509529.1|  PREDICTED: protein YLS9-like                       112   6e-26   
emb|CDY08506.1|  BnaA05g27420D                                          112   6e-26   
ref|XP_010512764.1|  PREDICTED: protein YLS9-like                       112   7e-26   
emb|CDY35671.1|  BnaC02g09370D                                          112   7e-26   
gb|KFK36489.1|  hypothetical protein AALP_AA4G131300                    112   7e-26   
ref|XP_007132484.1|  hypothetical protein PHAVU_011G097900g             111   1e-25   
ref|NP_196251.1|  late embryogenesis abundant hydroxyproline-rich...    111   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KDP36127.1|  hypothetical protein JCGZ_08771                         111   1e-25   
ref|XP_003538094.1|  PREDICTED: uncharacterized protein LOC100819285    111   1e-25   
ref|XP_004139592.1|  PREDICTED: uncharacterized protein LOC101212136    111   2e-25   
ref|XP_006407425.1|  hypothetical protein EUTSA_v10021920mg             110   2e-25   
emb|CDP10610.1|  unnamed protein product                                110   2e-25   
ref|XP_008813459.1|  PREDICTED: protein YLS9-like                       110   3e-25   
ref|XP_009146694.1|  PREDICTED: protein YLS9-like                       110   3e-25   
ref|XP_010543826.1|  PREDICTED: protein YLS9-like                       110   4e-25   
emb|CDY09123.1|  BnaA02g05490D                                          110   4e-25   
ref|XP_003535809.1|  PREDICTED: protein YLS9-like                       109   5e-25   
ref|XP_004159233.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    109   5e-25   
ref|XP_004143336.1|  PREDICTED: uncharacterized protein LOC101216889    109   5e-25   
gb|EYU38693.1|  hypothetical protein MIMGU_mgv1a011472mg                111   5e-25   
gb|EPS58106.1|  hypothetical protein M569_16710                         109   8e-25   
ref|XP_009141538.1|  PREDICTED: uncharacterized protein LOC103865501    108   1e-24   
ref|NP_001066211.1|  Os12g0159600                                       108   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007162963.1|  hypothetical protein PHAVU_001G195000g             108   1e-24   
gb|AFK45355.1|  unknown                                                 108   1e-24   
ref|XP_009388241.1|  PREDICTED: protein YLS9-like                       108   1e-24   
emb|CDY01043.1|  BnaC05g41570D                                          108   1e-24   
emb|CDY32068.1|  BnaC04g44980D                                          108   1e-24   
ref|XP_010491191.1|  PREDICTED: protein YLS9-like                       108   2e-24   
ref|XP_004494245.1|  PREDICTED: uncharacterized protein LOC101501355    108   2e-24   
ref|XP_004506216.1|  PREDICTED: protein NDR1-like                       108   2e-24   
ref|XP_004228587.1|  PREDICTED: protein YLS9-like                       107   3e-24   
ref|XP_006481585.1|  PREDICTED: protein YLS9-like                       107   3e-24   
gb|KFK38532.1|  hypothetical protein AALP_AA3G126200                    107   3e-24   
ref|XP_003606085.1|  NHL1                                               107   4e-24   
ref|XP_010909818.1|  PREDICTED: protein YLS9-like                       107   5e-24   
ref|XP_002532541.1|  conserved hypothetical protein                     107   5e-24   Ricinus communis
ref|XP_010104769.1|  hypothetical protein L484_018821                   107   5e-24   
ref|XP_007145796.1|  hypothetical protein PHAVU_007G268600g             107   5e-24   
gb|KHN33158.1|  hypothetical protein glysoja_039474                     107   6e-24   
gb|KDO70596.1|  hypothetical protein CISIN_1g028399mg                   106   6e-24   
ref|XP_004249410.1|  PREDICTED: protein YLS9-like                       106   7e-24   
ref|XP_007015709.1|  Late embryogenesis abundant (LEA) hydroxypro...    106   7e-24   
gb|ACU24209.1|  unknown                                                 106   8e-24   Glycine max [soybeans]
ref|XP_010683607.1|  PREDICTED: uncharacterized protein LOC104898254    106   8e-24   
ref|XP_007202566.1|  hypothetical protein PRUPE_ppa011438mg             106   9e-24   
ref|XP_009126867.1|  PREDICTED: uncharacterized protein LOC103851746    106   9e-24   
ref|XP_004977335.1|  PREDICTED: uncharacterized protein LOC101786529    106   1e-23   
gb|EMT21365.1|  hypothetical protein F775_29179                         105   1e-23   
ref|XP_006399104.1|  hypothetical protein EUTSA_v10015955mg             106   1e-23   
ref|XP_006577095.1|  PREDICTED: protein YLS9-like                       107   1e-23   
ref|XP_009408284.1|  PREDICTED: protein YLS9-like                       106   1e-23   
ref|XP_006430080.1|  hypothetical protein CICLE_v10012768mg             105   1e-23   
gb|KEH24226.1|  late embryogenesis abundant hydroxyproline-rich g...    105   1e-23   
ref|XP_011021994.1|  PREDICTED: protein YLS9-like                       105   1e-23   
ref|XP_002307147.1|  harpin-induced family protein                      105   2e-23   Populus trichocarpa [western balsam poplar]
gb|KFK25035.1|  hypothetical protein AALP_AA8G058200                    105   2e-23   
emb|CDY29084.1|  BnaC07g32900D                                          104   2e-23   
gb|KHN19916.1|  hypothetical protein glysoja_032396                     105   2e-23   
gb|KHN02173.1|  hypothetical protein glysoja_002197                     105   2e-23   
ref|XP_008376811.1|  PREDICTED: protein YLS9                            105   2e-23   
gb|EMS49822.1|  hypothetical protein TRIUR3_30722                       105   2e-23   
ref|XP_006662749.1|  PREDICTED: protein YLS9-like                       105   2e-23   
ref|XP_006299502.1|  hypothetical protein CARUB_v10015672mg             105   3e-23   
gb|EMS52142.1|  hypothetical protein TRIUR3_06942                       104   4e-23   
gb|ABY88510.1|  NHL1                                                    103   5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150038.1|  hypothetical protein PHAVU_005G120900g             105   5e-23   
gb|ACU15564.1|  unknown                                                 104   6e-23   Glycine max [soybeans]
ref|XP_007218403.1|  hypothetical protein PRUPE_ppa011423mg             103   6e-23   
ref|XP_003539845.1|  PREDICTED: protein YLS9-like                       103   7e-23   
ref|XP_009361278.1|  PREDICTED: protein YLS9-like                       103   9e-23   
ref|XP_004497664.1|  PREDICTED: uncharacterized protein At1g08160...    103   1e-22   
ref|XP_010423353.1|  PREDICTED: protein YLS9-like                       103   1e-22   
ref|XP_003519121.1|  PREDICTED: protein YLS9-like                       103   1e-22   
ref|NP_181141.1|  late embryogenesis abundant hydroxyproline-rich...    103   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456417.1|  PREDICTED: protein YLS9-like                       103   1e-22   
ref|XP_009121251.1|  PREDICTED: protein YLS9                            103   1e-22   
gb|AFK46782.1|  unknown                                                 103   1e-22   
ref|XP_010099421.1|  hypothetical protein L484_003245                   103   1e-22   
gb|AFK48051.1|  unknown                                                 103   1e-22   
ref|XP_011094229.1|  PREDICTED: protein YLS9-like                       102   2e-22   
ref|XP_006854676.1|  hypothetical protein AMTR_s00030p00212910          102   2e-22   
ref|XP_010912374.1|  PREDICTED: protein YLS9-like                       102   2e-22   
ref|XP_009414386.1|  PREDICTED: protein YLS9-like                       102   2e-22   
gb|ACJ86101.1|  unknown                                                 102   2e-22   Medicago truncatula
ref|XP_009419417.1|  PREDICTED: protein YLS9-like                       102   3e-22   
ref|XP_003596851.1|  NHL1                                               102   3e-22   
ref|NP_192697.1|  protein NDR1/HIN1-like 22                             102   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009416877.1|  PREDICTED: protein YLS9-like                       102   3e-22   
gb|EYU18128.1|  hypothetical protein MIMGU_mgv1a013838mg                102   4e-22   
ref|NP_001065799.1|  Os11g0157200                                       101   5e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002442844.1|  hypothetical protein SORBIDRAFT_08g003720          101   5e-22   Sorghum bicolor [broomcorn]
ref|XP_008234641.1|  PREDICTED: protein YLS9                            101   6e-22   
ref|XP_009407337.1|  PREDICTED: protein YLS9-like                       101   6e-22   
ref|XP_010059120.1|  PREDICTED: protein YLS9-like                       101   7e-22   
ref|XP_010931078.1|  PREDICTED: protein YLS9-like                       101   7e-22   
ref|XP_010554841.1|  PREDICTED: protein YLS9                            100   1e-21   
gb|EPS74359.1|  hypothetical protein M569_00401                         100   1e-21   
gb|EMT22065.1|  hypothetical protein F775_30726                         100   1e-21   
ref|XP_002280566.1|  PREDICTED: protein YLS9                            100   1e-21   Vitis vinifera
gb|EMT25294.1|  hypothetical protein F775_27232                         100   2e-21   
dbj|BAJ88510.1|  predicted protein                                    99.8    3e-21   
ref|XP_004307931.1|  PREDICTED: uncharacterized protein LOC101292938  99.4    3e-21   
ref|XP_009768005.1|  PREDICTED: protein YLS9-like                     99.4    3e-21   
ref|XP_002872124.1|  hypothetical protein ARALYDRAFT_910523           99.0    4e-21   
ref|XP_002318501.1|  hypothetical protein POPTR_0012s00610g           99.0    4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_003577812.2|  PREDICTED: protein YLS9-like                       100   4e-21   
dbj|BAK04669.1|  predicted protein                                    99.0    5e-21   
ref|XP_010942404.1|  PREDICTED: protein YLS9-like                     98.6    5e-21   
ref|XP_009405462.1|  PREDICTED: protein YLS9-like                     98.6    5e-21   
ref|XP_006339162.1|  PREDICTED: uncharacterized protein LOC102584448  98.6    6e-21   
gb|EMS65943.1|  hypothetical protein TRIUR3_34190                     99.4    6e-21   
ref|XP_006348478.1|  PREDICTED: uncharacterized protein LOC102581750  98.6    6e-21   
ref|XP_008778135.1|  PREDICTED: protein YLS9-like                     98.2    7e-21   
ref|XP_010030183.1|  PREDICTED: protein YLS9-like                     97.8    1e-20   
ref|XP_009627579.1|  PREDICTED: protein YLS9-like                     97.8    1e-20   
ref|XP_004978732.1|  PREDICTED: uncharacterized protein LOC101768882  97.4    2e-20   
ref|XP_003573252.1|  PREDICTED: uncharacterized protein LOC100823490  97.8    2e-20   
ref|XP_004235025.1|  PREDICTED: protein YLS9                          97.4    2e-20   
ref|XP_010096843.1|  hypothetical protein L484_001752                 97.4    2e-20   
ref|XP_008437662.1|  PREDICTED: protein YLS9                          97.1    2e-20   
ref|XP_009371535.1|  PREDICTED: uncharacterized protein LOC103960777  96.7    2e-20   
ref|XP_011005351.1|  PREDICTED: protein YLS9-like                     96.7    3e-20   
ref|XP_009600653.1|  PREDICTED: protein YLS9                          96.3    4e-20   
ref|XP_004160389.1|  PREDICTED: uncharacterized protein LOC101231816  95.9    5e-20   
ref|XP_004145957.1|  PREDICTED: uncharacterized protein LOC101209545  95.9    5e-20   
ref|NP_001151328.1|  VAMP protein SEC22                               95.9    5e-20   Zea mays [maize]
ref|XP_006653383.1|  PREDICTED: uncharacterized protein LOC102711063  95.9    6e-20   
ref|XP_006347517.1|  PREDICTED: uncharacterized protein LOC102589328  95.9    6e-20   
ref|NP_001060767.1|  Os08g0102700                                     95.9    6e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004289007.1|  PREDICTED: uncharacterized protein LOC101296146  95.9    6e-20   
ref|XP_008799695.1|  PREDICTED: protein YLS9                          95.5    6e-20   
gb|EMT08333.1|  hypothetical protein F775_09585                       95.9    6e-20   
ref|XP_008784105.1|  PREDICTED: protein YLS9-like                     95.9    7e-20   
ref|XP_008381512.1|  PREDICTED: protein YLS9-like                     95.5    8e-20   
ref|XP_009802781.1|  PREDICTED: protein YLS9                          95.5    8e-20   
gb|KFK26993.1|  hypothetical protein AALP_AA8G320300                  95.1    9e-20   
ref|NP_001267966.1|  NDR1/HIN1-like protein                           94.7    1e-19   
ref|NP_001052766.1|  Os04g0416700                                     94.7    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010910265.1|  PREDICTED: protein YLS9-like                     94.4    2e-19   
ref|XP_006401669.1|  hypothetical protein EUTSA_v10014657mg           94.4    2e-19   
ref|XP_009420193.1|  PREDICTED: protein YLS9-like                     94.4    2e-19   
gb|ACG27431.1|  VAMP protein SEC22                                    94.4    2e-19   Zea mays [maize]
ref|NP_001141118.1|  uncharacterized protein LOC100273203             94.4    2e-19   Zea mays [maize]
gb|EPS59594.1|  hypothetical protein M569_15210                       94.0    2e-19   
dbj|BAK00992.1|  predicted protein                                    94.4    2e-19   
ref|XP_006829201.1|  hypothetical protein AMTR_s00001p00271680        94.0    2e-19   
ref|XP_010912373.1|  PREDICTED: protein YLS9-like                     94.0    3e-19   
ref|XP_010912372.1|  PREDICTED: protein YLS9-like                     93.6    3e-19   
emb|CDP04987.1|  unnamed protein product                              93.6    4e-19   
ref|NP_001131747.1|  uncharacterized protein LOC100193113             93.2    4e-19   Zea mays [maize]
ref|XP_009119916.1|  PREDICTED: protein YLS9-like                     93.2    4e-19   
ref|XP_010251416.1|  PREDICTED: protein YLS9                          94.0    5e-19   
ref|XP_002449025.1|  hypothetical protein SORBIDRAFT_05g003630        93.2    5e-19   Sorghum bicolor [broomcorn]
ref|XP_009132214.1|  PREDICTED: uncharacterized protein LOC103856834  92.8    6e-19   
ref|XP_010912560.1|  PREDICTED: protein YLS9-like                     92.4    7e-19   
ref|XP_006592772.1|  PREDICTED: protein YLS9-like                     92.8    8e-19   
ref|XP_003578883.1|  PREDICTED: protein YLS9-like                     92.4    8e-19   
ref|XP_003575086.1|  PREDICTED: protein YLS9-like                     92.4    9e-19   
gb|EAZ05283.1|  hypothetical protein OsI_27486                        92.0    1e-18   Oryza sativa Indica Group [Indian rice]
emb|CDY20226.1|  BnaC09g30130D                                        92.0    1e-18   
gb|EMS46035.1|  hypothetical protein TRIUR3_25648                     91.7    1e-18   
ref|XP_011094231.1|  PREDICTED: protein YLS9-like                     91.7    1e-18   
ref|XP_006282207.1|  hypothetical protein CARUB_v10028473mg           92.0    1e-18   
ref|XP_002321350.2|  hypothetical protein POPTR_0015s00450g           92.4    1e-18   
ref|NP_001151603.1|  VAMP protein SEC22                               92.4    2e-18   
tpg|DAA37876.1|  TPA: VAMP protein SEC22                              92.0    2e-18   
ref|NP_001150617.1|  VAMP protein SEC22                               91.7    2e-18   
gb|ACN30757.1|  unknown                                               91.7    2e-18   
ref|XP_010034908.1|  PREDICTED: protein YLS9-like                     91.7    2e-18   
ref|XP_010042959.1|  PREDICTED: protein YLS9-like                     91.3    2e-18   
emb|CDY55755.1|  BnaA03g55330D                                        91.3    2e-18   
ref|NP_001150642.1|  LOC100284275                                     91.3    2e-18   
gb|KCW46113.1|  hypothetical protein EUGRSUZ_K00036                   91.7    2e-18   
ref|XP_009396992.1|  PREDICTED: protein YLS9-like                     90.9    3e-18   
ref|XP_010442945.1|  PREDICTED: protein YLS9                          90.5    4e-18   
ref|XP_010520936.1|  PREDICTED: protein YLS9                          90.5    4e-18   
ref|XP_002865988.1|  harpin-induced family protein                    90.5    5e-18   
ref|XP_008779632.1|  PREDICTED: protein YLS9-like                     90.5    5e-18   
gb|EEE57140.1|  hypothetical protein OsJ_07042                        90.5    5e-18   
ref|NP_001047054.1|  Os02g0538700                                     90.5    5e-18   
ref|XP_006648706.1|  PREDICTED: uncharacterized protein LOC102712059  91.3    6e-18   
ref|XP_006659018.1|  PREDICTED: uncharacterized protein LOC102706028  90.1    7e-18   
ref|XP_004972403.1|  PREDICTED: uncharacterized protein LOC101777486  89.7    8e-18   
ref|XP_009127146.1|  PREDICTED: protein YLS9                          89.7    8e-18   
ref|NP_001149555.1|  VAMP protein SEC22                               89.7    9e-18   
ref|XP_010445999.1|  PREDICTED: protein YLS9-like                     89.4    9e-18   
gb|EMT12205.1|  hypothetical protein F775_26181                       89.4    1e-17   
ref|XP_002524430.1|  conserved hypothetical protein                   89.0    2e-17   
ref|NP_001149809.1|  VAMP protein SEC22                               89.0    2e-17   
ref|XP_004975595.1|  PREDICTED: uncharacterized protein LOC101776142  89.0    2e-17   
emb|CDX81001.1|  BnaC03g02550D                                        88.6    2e-17   
ref|XP_010909857.1|  PREDICTED: protein YLS9                          88.6    2e-17   
ref|XP_004487461.1|  PREDICTED: uncharacterized protein LOC101495590  88.6    2e-17   
ref|XP_002447810.1|  hypothetical protein SORBIDRAFT_06g016230        88.6    2e-17   
ref|NP_200184.1|  late embryogenesis abundant hydroxyproline-rich...  88.2    2e-17   
ref|XP_002453945.1|  hypothetical protein SORBIDRAFT_04g022010        88.2    2e-17   
ref|NP_001149222.1|  LOC100282844                                     88.2    3e-17   
ref|XP_006410767.1|  hypothetical protein EUTSA_v10017629mg           87.8    3e-17   
ref|XP_003579716.1|  PREDICTED: protein YLS9-like                     87.8    3e-17   
ref|XP_006286762.1|  hypothetical protein CARUB_v10003261mg           87.4    4e-17   
dbj|BAE94402.1|  Hairpin-induced family protein                       87.4    5e-17   
ref|XP_009400798.1|  PREDICTED: protein YLS9-like                     86.7    7e-17   
gb|ACG36059.1|  VAMP protein SEC22                                    86.7    7e-17   
ref|XP_002444858.1|  hypothetical protein SORBIDRAFT_07g000370        87.0    7e-17   
ref|XP_009351919.1|  PREDICTED: protein YLS9-like                     86.7    7e-17   
ref|XP_008775638.1|  PREDICTED: protein YLS9                          86.7    8e-17   
gb|KHN19565.1|  Protein NDR1                                          86.3    1e-16   
ref|XP_004952672.1|  PREDICTED: uncharacterized protein LOC101757999  86.3    1e-16   
ref|XP_003523316.1|  PREDICTED: protein YLS9-like                     85.5    2e-16   
gb|KHN23299.1|  hypothetical protein glysoja_015601                   85.5    2e-16   
gb|EMS63412.1|  hypothetical protein TRIUR3_26859                     86.3    2e-16   
ref|XP_009382950.1|  PREDICTED: protein YLS9-like                     85.1    2e-16   
ref|NP_001235714.1|  uncharacterized protein LOC100306229             85.1    3e-16   
gb|EMT12397.1|  hypothetical protein F775_09149                       85.1    3e-16   
gb|KHN37436.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...  86.7    3e-16   
ref|NP_001136809.1|  VAMP protein SEC22                               85.1    3e-16   
gb|ACG40896.1|  VAMP protein SEC22                                    85.1    4e-16   
ref|XP_006653056.1|  PREDICTED: uncharacterized protein LOC102703676  84.7    4e-16   
ref|XP_003580846.1|  PREDICTED: uncharacterized protein LOC100830896  84.7    4e-16   
emb|CAJ86171.1|  H0913C04.12                                          84.7    4e-16   
ref|XP_010482776.1|  PREDICTED: protein YLS9-like                     84.3    5e-16   
ref|NP_001054318.1|  Os04g0685400                                     84.7    5e-16   
ref|XP_004959999.1|  PREDICTED: uncharacterized protein LOC101775359  84.0    8e-16   
gb|AEH76902.1|  NHL-like protein                                      83.6    9e-16   
ref|XP_008663184.1|  PREDICTED: uncharacterized protein LOC103641626  83.6    1e-15   
ref|XP_011003294.1|  PREDICTED: protein YLS9-like                     83.2    1e-15   
ref|XP_011022267.1|  PREDICTED: protein YLS9-like                     83.2    1e-15   
ref|XP_007136433.1|  hypothetical protein PHAVU_009G044900g           82.8    2e-15   
gb|EAZ32477.1|  hypothetical protein OsJ_16694                        82.8    2e-15   
ref|XP_007039207.1|  Late embryogenesis abundant hydroxyproline-r...  82.8    2e-15   
gb|AFK35623.1|  unknown                                               82.4    2e-15   
ref|XP_010246839.1|  PREDICTED: uncharacterized protein LOC104590026  82.4    2e-15   
dbj|BAJ85354.1|  predicted protein                                    82.4    3e-15   
gb|ABR16330.1|  unknown                                               82.0    3e-15   
ref|XP_002448804.1|  hypothetical protein SORBIDRAFT_06g033580        81.6    4e-15   
ref|XP_008245880.1|  PREDICTED: protein YLS9-like                     81.3    6e-15   
ref|XP_008245711.1|  PREDICTED: protein YLS9-like                     81.3    6e-15   
ref|XP_006478093.1|  PREDICTED: protein YLS9-like                     80.9    7e-15   
gb|KCW90469.1|  hypothetical protein EUGRSUZ_A02596                   80.1    1e-14   
ref|XP_006441257.1|  hypothetical protein CICLE_v10022226mg           80.1    1e-14   
gb|EMS62497.1|  hypothetical protein TRIUR3_09712                     80.1    1e-14   
ref|XP_003602388.1|  NDR1/HIN1-like protein                           80.1    2e-14   
ref|XP_004502763.1|  PREDICTED: uncharacterized protein LOC101515350  79.7    2e-14   
ref|XP_007207577.1|  hypothetical protein PRUPE_ppa018456mg           79.3    3e-14   
ref|XP_003543420.1|  PREDICTED: protein YLS9-like                     78.2    7e-14   
ref|XP_011075890.1|  PREDICTED: protein YLS9-like                     77.4    1e-13   
ref|XP_010456160.1|  PREDICTED: protein YLS9-like isoform X1          77.0    2e-13   
gb|EAZ17501.1|  hypothetical protein OsJ_33033                        75.9    3e-13   
ref|XP_002307148.2|  hypothetical protein POPTR_0005s09030g           75.5    3e-13   
ref|XP_010428281.1|  PREDICTED: protein YLS9-like                     76.3    3e-13   
gb|KDP45526.1|  hypothetical protein JCGZ_17079                       75.9    5e-13   
gb|ABK22753.1|  unknown                                               75.5    6e-13   
ref|XP_010497184.1|  PREDICTED: protein YLS9-like                     73.2    7e-13   
gb|EYU45317.1|  hypothetical protein MIMGU_mgv1a024194mg              75.1    7e-13   
ref|XP_006580926.1|  PREDICTED: uncharacterized protein LOC100306...  75.5    7e-13   
dbj|BAJ93415.1|  predicted protein                                    74.3    1e-12   
gb|ABR25940.1|  vamp protein sec22                                    72.8    1e-12   
ref|XP_006396341.1|  hypothetical protein EUTSA_v10029297mg           73.6    3e-12   
ref|XP_006288590.1|  hypothetical protein CARUB_v10001885mg           73.6    3e-12   
ref|XP_010048475.1|  PREDICTED: protein YLS9-like                     72.8    5e-12   
ref|XP_011084574.1|  PREDICTED: protein YLS9-like                     72.0    1e-11   
ref|XP_002874985.1|  harpin-induced family protein                    71.6    2e-11   
gb|AAC19293.1|  contains similarity to Nicotiana tabacum hin1 (GB...  70.9    2e-11   
ref|NP_192050.1|  late embryogenesis abundant hydroxyproline-rich...  71.6    2e-11   
emb|CDY07145.1|  BnaCnng01600D                                        70.9    3e-11   
ref|XP_009111383.1|  PREDICTED: protein NDR1                          70.9    3e-11   
gb|EPS67217.1|  hypothetical protein M569_07563                       69.7    6e-11   
emb|CDX91852.1|  BnaC03g31540D                                        70.1    7e-11   
gb|KFK30720.1|  hypothetical protein AALP_AA6G018700                  69.3    1e-10   
ref|XP_009134485.1|  PREDICTED: protein YLS9-like                     68.6    3e-10   
gb|ABR18270.1|  unknown                                               67.8    4e-10   
gb|ABR17849.1|  unknown                                               67.4    4e-10   
ref|XP_010246801.1|  PREDICTED: protein YLS9-like                     67.4    5e-10   
ref|XP_006829200.1|  hypothetical protein AMTR_s00001p00271600        66.2    1e-09   
gb|EYU19698.1|  hypothetical protein MIMGU_mgv1a013755mg              65.5    2e-09   
ref|XP_002266229.1|  PREDICTED: protein YLS9                          65.9    2e-09   
ref|XP_010558833.1|  PREDICTED: protein YLS9-like                     65.1    3e-09   
emb|CBI38717.3|  unnamed protein product                              65.5    3e-09   
gb|EPS62888.1|  hypothetical protein M569_11901                       63.2    4e-09   
ref|XP_010251430.1|  PREDICTED: protein YLS9                          64.7    4e-09   
gb|KDP42899.1|  hypothetical protein JCGZ_23841                       65.1    7e-09   
ref|NP_850776.2|  uncharacterized protein                             62.8    7e-09   
ref|XP_008245646.1|  PREDICTED: protein YLS9                          63.9    1e-08   
ref|XP_007218377.1|  hypothetical protein PRUPE_ppa011309mg           63.5    1e-08   
ref|XP_010030943.1|  PREDICTED: uncharacterized protein LOC104420870  64.3    1e-08   
ref|XP_009366593.1|  PREDICTED: protein YLS9                          63.2    2e-08   
emb|CBI30381.3|  unnamed protein product                              62.4    2e-08   
emb|CAN72415.1|  hypothetical protein VITISV_027904                   64.7    3e-08   
emb|CDY72163.1|  BnaCnng76260D                                        62.4    4e-08   
ref|XP_008347190.1|  PREDICTED: protein YLS9-like                     61.6    5e-08   
ref|XP_007051424.1|  Late embryogenesis abundant hydroxyproline-r...  61.2    1e-07   
ref|XP_010057469.1|  PREDICTED: protein YLS9                          60.5    1e-07   
ref|XP_009127449.1|  PREDICTED: protein YLS9                          61.2    1e-07   
ref|XP_003521826.1|  PREDICTED: protein YLS9-like                     60.1    2e-07   
gb|KCW57128.1|  hypothetical protein EUGRSUZ_I02772                   60.1    2e-07   
ref|XP_006854680.1|  hypothetical protein AMTR_s00030p00215650        59.7    3e-07   
emb|CDY16419.1|  BnaA02g12230D                                        60.1    3e-07   
ref|XP_008810415.1|  PREDICTED: uncharacterized protein LOC103721836  59.3    3e-07   
ref|XP_010271387.1|  PREDICTED: protein YLS9-like                     57.8    4e-07   
gb|KCW90470.1|  hypothetical protein EUGRSUZ_A02597                   58.5    4e-07   
emb|CDP08617.1|  unnamed protein product                              58.5    6e-07   
ref|XP_010059131.1|  PREDICTED: protein YLS9                          58.5    6e-07   
emb|CDX79648.1|  BnaC03g19840D                                        58.5    8e-07   
ref|XP_006854681.1|  hypothetical protein AMTR_s00030p00216100        58.5    9e-07   
ref|XP_010934418.1|  PREDICTED: uncharacterized protein LOC105054578  58.2    9e-07   
ref|XP_007139022.1|  hypothetical protein PHAVU_009G258400g           57.8    1e-06   
ref|XP_002894589.1|  hypothetical protein ARALYDRAFT_892695           58.2    1e-06   
gb|ABZ03374.1|  NHL3                                                  56.6    2e-06   
ref|XP_002301444.1|  harpin-induced family protein                    57.0    2e-06   
gb|EPS72487.1|  hypothetical protein M569_02275                       57.0    2e-06   
ref|XP_002313615.1|  harpin-induced family protein                    57.8    3e-06   
gb|ABZ03375.1|  NHL3                                                  55.8    3e-06   
gb|ABZ03312.1|  NHL3                                                  55.8    3e-06   
gb|ABZ03284.1|  NHL3                                                  55.8    3e-06   
gb|ABZ03287.1|  NHL3                                                  55.8    3e-06   
ref|XP_004168046.1|  PREDICTED: putative syntaxin-24-like             57.0    3e-06   
ref|XP_008809836.1|  PREDICTED: protein YLS9-like                     57.0    3e-06   
gb|ABZ03283.1|  NHL3                                                  55.8    3e-06   
gb|ABZ03306.1|  NHL3                                                  55.8    3e-06   
ref|XP_010267377.1|  PREDICTED: protein YLS9-like                     56.2    4e-06   
gb|ABZ03286.1|  NHL3                                                  55.5    4e-06   
gb|KDP28408.1|  hypothetical protein JCGZ_14179                       55.8    5e-06   
gb|ABZ03289.1|  NHL3                                                  55.5    5e-06   
ref|XP_006836205.1|  hypothetical protein AMTR_s00101p00083450        57.0    5e-06   
ref|XP_003554787.1|  PREDICTED: protein YLS9-like                     55.8    5e-06   
ref|XP_008392357.1|  PREDICTED: protein YLS9-like                     55.8    5e-06   
ref|XP_003528989.1|  PREDICTED: protein YLS9-like                     55.8    6e-06   
gb|KHN45252.1|  Putative syntaxin-24                                  55.8    6e-06   
ref|XP_011025368.1|  PREDICTED: protein YLS9-like                     55.5    7e-06   
ref|XP_008437747.1|  PREDICTED: protein YLS9-like                     55.5    8e-06   
ref|XP_008339474.1|  PREDICTED: protein YLS9-like                     55.8    8e-06   
gb|KEH24227.1|  late embryogenesis abundant hydroxyproline-rich g...  53.9    9e-06   
ref|XP_004133755.1|  PREDICTED: uncharacterized protein LOC101215966  55.5    9e-06   
ref|XP_011039412.1|  PREDICTED: protein YLS9-like                     55.1    1e-05   
ref|XP_004305344.1|  PREDICTED: putative syntaxin-24-like             54.7    1e-05   
gb|KGN59198.1|  hypothetical protein Csa_3G779020                     54.7    1e-05   
emb|CDY66436.1|  BnaA01g37340D                                        55.1    2e-05   
ref|XP_009386180.1|  PREDICTED: protein YLS9-like                     53.9    2e-05   
ref|XP_002515080.1|  conserved hypothetical protein                   54.3    3e-05   
gb|ABK22201.1|  unknown                                               54.3    3e-05   
gb|KHN34285.1|  hypothetical protein glysoja_046323                   53.5    3e-05   
ref|XP_004303498.1|  PREDICTED: putative syntaxin-24-like             53.5    5e-05   
gb|KHN02175.1|  Putative syntaxin-24                                  53.1    5e-05   
ref|XP_011046869.1|  PREDICTED: protein YLS9-like                     53.1    5e-05   
ref|XP_010558918.1|  PREDICTED: protein YLS9-like                     53.1    5e-05   
ref|XP_008243457.1|  PREDICTED: protein YLS9                          53.1    6e-05   
ref|XP_010037311.1|  PREDICTED: protein YLS9-like                     53.1    6e-05   
ref|XP_004248419.1|  PREDICTED: protein YLS9                          53.1    6e-05   
gb|KFK36490.1|  hypothetical protein AALP_AA4G131400                  53.1    7e-05   
ref|XP_010104776.1|  hypothetical protein L484_018829                 53.5    7e-05   
ref|XP_002308441.2|  syringolide-induced protein B13-1-9              52.8    8e-05   
ref|XP_002862711.1|  hypothetical protein ARALYDRAFT_920349           50.8    8e-05   
ref|XP_007202513.1|  hypothetical protein PRUPE_ppa010862mg           52.8    8e-05   
ref|XP_002879585.1|  yellow-leaf-specific gene 9                      52.4    1e-04   
ref|XP_010037307.1|  PREDICTED: protein YLS9-like                     52.4    1e-04   
ref|XP_003545799.1|  PREDICTED: uncharacterized protein At1g08160     52.0    1e-04   
ref|XP_011043555.1|  PREDICTED: protein YLS9-like                     52.8    1e-04   
ref|XP_009413744.1|  PREDICTED: uncharacterized protein LOC103994985  52.0    1e-04   
ref|XP_009349105.1|  PREDICTED: protein YLS9-like                     52.4    1e-04   
ref|XP_010414901.1|  PREDICTED: protein YLS9-like                     52.4    1e-04   
ref|XP_009121266.1|  PREDICTED: protein YLS9-like                     52.4    1e-04   
ref|XP_007146942.1|  hypothetical protein PHAVU_006G083600g           52.4    1e-04   
ref|NP_181142.1|  protein NDR1/HIN1-like 10                           52.0    1e-04   
ref|XP_009113430.1|  PREDICTED: protein YLS9                          52.4    1e-04   
ref|XP_010037309.1|  PREDICTED: protein YLS9-like                     52.0    2e-04   
ref|XP_002320233.1|  harpin-induced family protein                    51.6    2e-04   
ref|XP_010511195.1|  PREDICTED: protein YLS9-like                     52.0    2e-04   
gb|EYU18129.1|  hypothetical protein MIMGU_mgv1a012715mg              52.0    2e-04   
ref|XP_010505123.1|  PREDICTED: protein YLS9-like                     51.6    2e-04   
ref|XP_007203437.1|  hypothetical protein PRUPE_ppa021757mg           51.2    2e-04   
ref|XP_004303501.1|  PREDICTED: putative syntaxin-24-like             51.6    2e-04   
ref|XP_010107143.1|  hypothetical protein L484_019625                 51.2    2e-04   
ref|XP_004303500.1|  PREDICTED: putative syntaxin-24-like             51.2    2e-04   
ref|XP_003533319.1|  PREDICTED: protein YLS9-like                     50.4    3e-04   
ref|XP_002873248.1|  hypothetical protein ARALYDRAFT_908556           51.2    3e-04   
ref|XP_002280591.1|  PREDICTED: protein YLS9                          50.8    3e-04   
gb|KFK41014.1|  hypothetical protein AALP_AA2G074000                  51.2    3e-04   
emb|CDP20320.1|  unnamed protein product                              50.8    4e-04   
ref|XP_011094228.1|  PREDICTED: protein YLS9-like                     50.8    4e-04   
ref|XP_009372580.1|  PREDICTED: protein YLS9-like                     50.4    4e-04   
ref|XP_006294947.1|  hypothetical protein CARUB_v10024001mg           50.4    5e-04   



>ref|XP_009605493.1| PREDICTED: protein YLS9-like [Nicotiana tomentosiformis]
Length=211

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 115/206 (56%), Gaps = 23/206 (11%)
 Frame = +3

Query  117  EMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGN  296
            E +  L ++ F    VL      LF I L   +   +  T+P F L  AT++ FN+++ N
Sbjct  11   EERHKLHRRLF--AAVLGFIILVLFIIFLIWLI---LRPTKPSFILHDATIYAFNVSSPN  65

Query  297  L-LTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAF  473
            + LTTNI + LA+  P    GIYYD+L VYA YR+Q +TLP  LP++YQG+KDV +WS F
Sbjct  66   IFLTTNIQITLASRNPNNKIGIYYDKLDVYATYRSQQITLPTLLPSTYQGHKDVTIWSPF  125

Query  474  LSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG  632
            + GNSVPV P +        MAG VL+NI VDG IR        G   L  NCPA++  G
Sbjct  126  VYGNSVPVAPFLSESLNQDQMAGTVLINIKVDGRIRWKVGTFISGKYHLYVNCPAYVGVG  185

Query  633  STSISSSP----------VQSCHVEV  680
               I +S           VQ+CHV+V
Sbjct  186  GKVIGNSIAVGSAMKYQLVQNCHVDV  211



>ref|XP_011088967.1| PREDICTED: protein YLS9-like [Sesamum indicum]
Length=204

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 99/161 (61%), Gaps = 12/161 (7%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P F L+ AT++ FNL++ N+LT+N+ + L++  P    GIYYD++ VYA Y  Q +TL
Sbjct  44   TKPHFVLQDATVYAFNLSSTNILTSNLQITLSSRNPNDRIGIYYDKVDVYAAYHGQQITL  103

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFW  572
            P  LP +YQG+KD+ VWS FL GN VPV P VG       +AG VLVN+ VDG IR    
Sbjct  104  PTLLPPTYQGHKDITVWSPFLYGNQVPVAPYVGVSLSEDQIAGTVLVNVRVDGRIRWKVG  163

Query  573  NLEVGPCRLSANCPAFLDF-----GSTSISSSPVQSCHVEV  680
                G   L  NCPA+++F     G+ +I    +  CHV+V
Sbjct  164  TFISGRYHLHVNCPAYINFGGRNNGAAAIKFELIMDCHVDV  204



>ref|XP_009776256.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
Length=211

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 114/206 (55%), Gaps = 23/206 (11%)
 Frame = +3

Query  117  EMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGN  296
            E +  L ++ F    VL      LF I L   +   +  T+P F L  AT++ FN+++ N
Sbjct  11   EERHKLHRRLF--VAVLAFVILVLFIIFLIWLI---LRPTKPSFILHAATIYAFNVSSPN  65

Query  297  L-LTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAF  473
            + LTTNI + LA+  P    GIYYD+L VYA YR Q +TLP  LP++YQG+KDV +WS F
Sbjct  66   IFLTTNIQITLASRNPNNKIGIYYDKLDVYATYRGQQITLPTLLPSTYQGHKDVTIWSPF  125

Query  474  LSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG  632
            + GNSVPV P +        MAG VL+NI VDG IR        G   L  NCPA++  G
Sbjct  126  VYGNSVPVAPFLSESLNQDQMAGTVLINIKVDGRIRWKVGTFISGKYHLYVNCPAYVGVG  185

Query  633  STSISSSP----------VQSCHVEV  680
               I +S           VQ+CHV+V
Sbjct  186  GKMIGNSIAVGSAMKYQLVQNCHVDV  211



>ref|XP_006361098.1| PREDICTED: uncharacterized protein At1g08160-like [Solanum tuberosum]
Length=208

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 100/166 (60%), Gaps = 19/166 (11%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P F L+ AT+++FN+++ NLLTTN  + LA+  P    GIYYD+L VYA YR Q +TL
Sbjct  45   TKPHFILQDATIYSFNISSPNLLTTNFQITLASRNPNDKIGIYYDKLDVYATYRGQQITL  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFW  572
            P  LP SYQG+KD  +WS F+ GNSVPV P +        MAG VL+N+ VDG +R    
Sbjct  105  PTLLPQSYQGHKDFTIWSPFVYGNSVPVAPYLSESLSEDQMAGTVLINVKVDGRVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDFGSTSISSSP----------VQSCHVEV  680
                G   L+ NCPA++  G   I +S           VQ+CHV+V
Sbjct  165  TFVSGKYHLNVNCPAYV--GGKMIGNSIAVGSAMKYQLVQNCHVDV  208



>ref|XP_009606939.1| PREDICTED: protein YLS9 [Nicotiana tomentosiformis]
Length=212

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 101/167 (60%), Gaps = 18/167 (11%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P F L+ AT++ FN++  + LTTNI + +A+  P    GIYYD+L VYA YR Q +TL
Sbjct  46   TKPHFILQDATVYAFNVSTPSFLTTNIQITVASRNPNAKIGIYYDKLDVYATYRGQQITL  105

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFW  572
            P  LP +YQG+KDVA+WS F+ GNSVPV P +G       M G VL+NI +DG +R    
Sbjct  106  PTLLPPTYQGHKDVAIWSPFVYGNSVPVAPYLGNALSQDQMVGTVLLNIKIDGRVRWKVG  165

Query  573  NLEVGPCRLSANCPAF-----------LDFGSTSISSSPVQSCHVEV  680
            +   G   L  NCPA+           +  GS++I    VQ+CHV+V
Sbjct  166  SFISGRYHLYVNCPAYVGVGGKIIGNSVSVGSSAIKYQLVQNCHVDV  212



>ref|XP_009802139.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
Length=212

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 101/167 (60%), Gaps = 18/167 (11%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P F L+ AT++ FN++  + LTTNI + +A+  P    GIYYD+L VYA YR Q +TL
Sbjct  46   TKPHFILQDATVYAFNVSTPSFLTTNIQITVASRNPNDKIGIYYDKLDVYATYRGQQITL  105

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFW  572
            P  LP +YQG+KDV++WS F+ GNSVPV P +G       M G VL+NI +DG +R    
Sbjct  106  PTLLPPTYQGHKDVSIWSPFVYGNSVPVAPYLGNALSQDQMVGTVLLNIKIDGRVRWKVG  165

Query  573  NLEVGPCRLSANCPAFLD-----------FGSTSISSSPVQSCHVEV  680
            +   G   L  NCPA++             GS++I    VQ+CHV+V
Sbjct  166  SFISGRYHLYVNCPAYVGVGGKMIGNSFAVGSSAIKYQLVQNCHVDV  212



>ref|XP_004241341.1| PREDICTED: protein YLS9 [Solanum lycopersicum]
Length=208

 Score =   135 bits (341),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 100/166 (60%), Gaps = 19/166 (11%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P F L+ AT+++FN+++ NLLTTN  + LA+  P    GIYYDRL VYA YR Q +TL
Sbjct  45   TKPHFILQDATIYSFNISSPNLLTTNFQITLASRNPNDKIGIYYDRLDVYATYRGQQITL  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFW  572
            P  +P +YQG+KD  +WS F+ GNSVPV P +        MAG VL+N+ VDG +R    
Sbjct  105  PTLVPQTYQGHKDFTIWSPFVYGNSVPVAPYLSESLREDQMAGTVLINVKVDGRVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDFGSTSISSSP----------VQSCHVEV  680
                G   L+ NCPA++  G   I +S           VQ+CHV+V
Sbjct  165  TFVSGKYHLNVNCPAYV--GGKMIGNSIAVGSAMKYQLVQNCHVDV  208



>ref|XP_011090312.1| PREDICTED: protein YLS9 [Sesamum indicum]
Length=208

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 106/204 (52%), Gaps = 17/204 (8%)
 Frame = +3

Query  114  GEMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAG  293
            G  +DD  K         L F   +  I L V +   +  T+P F L+  T++ FN+T  
Sbjct  7    GHHEDDRRKLYRRLFAAFLGFVVAVLFIILLVWLI--LRPTKPHFVLQDVTVYAFNVTPP  64

Query  294  NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAF  473
            N LT+N  + L+A  P    GIYYD+L VYA Y +Q +TL   LP SYQG+KD+ VWS F
Sbjct  65   NFLTSNFQMTLSARNPNDRIGIYYDKLDVYASYHSQQITLATQLPTSYQGHKDITVWSPF  124

Query  474  LSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG  632
            L GN+VPV P +        MAG VLV I VDG IR        G   L  NCPA+++FG
Sbjct  125  LYGNTVPVAPYLAVSLNQDQMAGTVLVYIRVDGRIRWKVGTFISGKYHLYVNCPAYINFG  184

Query  633  STS--------ISSSPVQSCHVEV  680
              S        I    +  CHV+V
Sbjct  185  DRSNAVVVGSAIKYQLIMDCHVDV  208



>ref|XP_010685425.1| PREDICTED: protein YLS9-like [Beta vulgaris subsp. vulgaris]
Length=216

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 94/148 (64%), Gaps = 7/148 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+  T++ FN+TA NLLT    V L++  P    G+YY+RL VYA Y NQ +TL
Sbjct  45   TKPRFILQDTTIYAFNVTAPNLLTATFQVTLSSRNPNGRIGVYYERLDVYASYHNQQITL  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHFW  572
            P  LP +YQG+KD+ +WS FL GNSVP+ P +GM       AG VL+NI ++G ++    
Sbjct  105  PTRLPFTYQGHKDITIWSPFLYGNSVPIAPYLGMSLQQDQNAGLVLMNIKINGRVKWKVG  164

Query  573  NLEVGPCRLSANCPAFLDFGSTSISSSP  656
                G    +ANCPA++ FG+   S++P
Sbjct  165  TWISGKYHFNANCPAYITFGNKGNSNNP  192



>ref|XP_006404481.1| hypothetical protein EUTSA_v10010725mg [Eutrema salsugineum]
 gb|ESQ45934.1| hypothetical protein EUTSA_v10010725mg [Eutrema salsugineum]
Length=206

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 107/199 (54%), Gaps = 17/199 (9%)
 Frame = +3

Query  123  KDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLL  302
            +D+  +K      VL L  + LF + L  A+   +    PRF L+ AT++ FN++  N L
Sbjct  12   EDEKTRKRLGAA-VLGLLAAILFVVFLVWAI---LHPHGPRFVLQDATIYAFNVSQPNFL  67

Query  303  TTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSG  482
            T+N+ V L++  P    GI+YDRL +YA YRNQ VTL   LPA+YQG+ DV VWS FL G
Sbjct  68   TSNLQVTLSSRNPNDKIGIFYDRLDIYASYRNQQVTLATLLPATYQGHLDVTVWSPFLYG  127

Query  483  NSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             SVPV P           AG VL+NI +DGW+R        G  RL  NCPA++      
Sbjct  128  TSVPVAPYFSPALSQDLTAGMVLLNIKIDGWVRWKVGTWISGRYRLHVNCPAYITLAGHF  187

Query  642  ISSSP------VQSCHVEV  680
                P      VQ C V+V
Sbjct  188  SGDGPAVKYQLVQRCGVDV  206



>emb|CDP06858.1| unnamed protein product [Coffea canephora]
Length=208

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 97/164 (59%), Gaps = 15/164 (9%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P F L+ AT++ FN++A NLLT+N  + L++  P    GI YDRL  YA YR Q +TL
Sbjct  45   TKPHFLLQDATVYAFNVSAPNLLTSNFQITLSSRNPNDRIGISYDRLDAYASYRGQQITL  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEP-------GVGMAGRVLVNIIVDGWIRKHFW  572
            P  LP++YQG+KD+ VWS FL GNSVP+ P           AG VL+NI V+G +R    
Sbjct  105  PTLLPSTYQGHKDITVWSPFLYGNSVPIAPYYTDALTQDQFAGTVLINIKVNGRVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDFGST--------SISSSPVQSCHVEV  680
                G   L  NCPA+++ G+         +I    VQSCHV+V
Sbjct  165  TFISGRYHLYVNCPAYINLGNRNSGIMVGPAIKYQLVQSCHVDV  208



>emb|CDY08687.1| BnaC03g54950D [Brassica napus]
Length=206

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 105/199 (53%), Gaps = 16/199 (8%)
 Frame = +3

Query  123  KDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLL  302
             +D   +      VL L  + LF + L  A+   +    PRF L+ AT++ FN++  N L
Sbjct  11   DEDEKMRRRIGAAVLSLLAAGLFVVFLVWAI---LHPHGPRFVLQDATIYAFNISEPNFL  67

Query  303  TTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSG  482
            T+N+ V L++  P    GI+YDRL +YA YRNQ VTL   LPA+YQG+ DV VWS FL G
Sbjct  68   TSNLQVTLSSRNPNDKIGIFYDRLDIYASYRNQQVTLATLLPATYQGHLDVTVWSPFLYG  127

Query  483  NSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             SVPV P           AG VL+NI +DGW+R        G  RL  NCPA++      
Sbjct  128  TSVPVAPYFSPALSQDLTAGMVLLNIKIDGWVRWKVGTWISGRYRLHVNCPAYITLAGHF  187

Query  642  ISSSP------VQSCHVEV  680
                P      VQ C V+V
Sbjct  188  SGEGPAVKYQLVQRCGVDV  206



>ref|XP_009123302.1| PREDICTED: protein YLS9 [Brassica rapa]
 emb|CDY69513.1| BnaAnng30660D [Brassica napus]
Length=206

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 105/199 (53%), Gaps = 16/199 (8%)
 Frame = +3

Query  123  KDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLL  302
             +D   +      VL L  + LF + L  A+   +    PRF L+ AT++ FN++  N L
Sbjct  11   DEDEKMRRRIGAAVLGLLAAGLFVVFLVWAI---LHPHGPRFVLQDATIYAFNISEPNFL  67

Query  303  TTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSG  482
            T+N+ V L++  P    GI+YDRL +YA YRNQ VTL   LPA+YQG+ DV VWS FL G
Sbjct  68   TSNLQVTLSSRNPNDKIGIFYDRLDIYASYRNQQVTLATLLPATYQGHLDVTVWSPFLYG  127

Query  483  NSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             SVPV P           AG VL+NI +DGW+R        G  RL  NCPA++      
Sbjct  128  TSVPVAPYFSPALSQDLTAGMVLLNIKIDGWVRWKVGTWISGRYRLHVNCPAYITLAGHF  187

Query  642  ISSSP------VQSCHVEV  680
                P      VQ C V+V
Sbjct  188  SGEGPAVKYQLVQRCGVDV  206



>gb|KFK33871.1| hypothetical protein AALP_AA5G071100 [Arabis alpina]
Length=206

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 104/199 (52%), Gaps = 16/199 (8%)
 Frame = +3

Query  123  KDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLL  302
             +D   +      VL    + LF + L  A+   +    PRF L+ AT++ FN++  N L
Sbjct  11   DEDEKTRRLIGGAVLGFLAAVLFVVFLVWAI---LHPHGPRFILQDATIYAFNVSQPNFL  67

Query  303  TTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSG  482
            T+N+ V L++  P    GI+YDRL +YA YRNQ VTL   LPA+YQG+ DV VWS FL G
Sbjct  68   TSNLQVTLSSRNPNDKIGIFYDRLDIYASYRNQQVTLATLLPATYQGHLDVTVWSPFLYG  127

Query  483  NSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
              VPV P          MAG VL+NI +DGW+R        G  RL  NCPA++      
Sbjct  128  TMVPVAPYFSPALSQDLMAGMVLLNIKIDGWVRWKVGTWISGRYRLHVNCPAYITLAGHF  187

Query  642  ISSSP------VQSCHVEV  680
                P      VQ C V+V
Sbjct  188  SGDGPAVKYQLVQRCGVDV  206



>ref|XP_010425840.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=206

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 107/199 (54%), Gaps = 17/199 (9%)
 Frame = +3

Query  126  DDLPKKSFNCCCVLLLFFS-TLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLL  302
            D+  K       V+L F +  LF + L  A+   +    PRF L+ AT++ FN++  N L
Sbjct  11   DEDEKMRKRIGAVVLGFLAAVLFVVFLVWAI---LHPHGPRFVLQDATIYAFNISQPNYL  67

Query  303  TTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSG  482
            T+NI V L++  P    GI+YDRL +YA YRNQ VTL   LPA+YQG+ DV VWS FL G
Sbjct  68   TSNIQVTLSSRNPNDKIGIFYDRLDIYASYRNQQVTLATLLPATYQGHLDVTVWSPFLYG  127

Query  483  NSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             +VPV P +         AG VL+NI +DGW+R        G  RL  NCPA++      
Sbjct  128  TTVPVAPYLSPALSQDLTAGMVLLNIKIDGWVRWKVGTWISGRYRLHVNCPAYITVAGQF  187

Query  642  ISSSP------VQSCHVEV  680
                P      VQ C V+V
Sbjct  188  SGEGPGVKYQLVQRCAVDV  206



>ref|XP_006291857.1| hypothetical protein CARUB_v10018033mg [Capsella rubella]
 gb|EOA24755.1| hypothetical protein CARUB_v10018033mg [Capsella rubella]
Length=206

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 107/199 (54%), Gaps = 17/199 (9%)
 Frame = +3

Query  126  DDLPKKSFNCCCVLLLFFS-TLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLL  302
            D+  K       V+L F +  LF + L  A+   +    PRF L+ AT++ FN++  N L
Sbjct  11   DEDEKMRKRIGAVVLGFLAAVLFVVFLVWAI---LHPHGPRFVLQDATIYAFNISQPNYL  67

Query  303  TTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSG  482
            T+N+ V L++  P    GI+YDRL +YA YRNQ VTL   LPASYQG+ DV VWS FL G
Sbjct  68   TSNLQVTLSSRNPNDKIGIFYDRLDIYASYRNQQVTLATLLPASYQGHLDVTVWSPFLYG  127

Query  483  NSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             +VPV P +         AG VL+NI +DGW+R        G  RL  NCPA++      
Sbjct  128  TTVPVAPYLSPALSQDLTAGMVLLNIKIDGWVRWKVGTWISGRYRLHINCPAYITLAGHF  187

Query  642  ISSSP------VQSCHVEV  680
                P      VQ C V+V
Sbjct  188  SGDGPAVKYQLVQRCAVDV  206



>ref|XP_004251093.1| PREDICTED: protein YLS9-like [Solanum lycopersicum]
Length=209

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 107/186 (58%), Gaps = 16/186 (9%)
 Frame = +3

Query  168  LLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNL-TAGNLLTTNISVALAAHIPY  344
            L+ F TL   ++ +     +  T+P F L+ AT++ FN  T  N LTTNI + +A+  P 
Sbjct  25   LIVFVTLILFTILLIFLI-LRPTKPHFILQDATVYAFNTSTPFNFLTTNIQITIASRNPN  83

Query  345  RHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG----  512
               GIYYDRL VYA YR Q VTLP  +P +YQG+KDV++WS F+ GN+VP+ P +G    
Sbjct  84   DKIGIYYDRLDVYATYRGQQVTLPTLMPQTYQGHKDVSIWSPFVYGNNVPIAPYLGNEIS  143

Query  513  ---MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTSISSSP-------VQ  662
               + G +L+N+ +DG +R    N       L  NCPA++  G   + +S        VQ
Sbjct  144  QDIIFGTILLNVRIDGRVRWKVGNFISSKYHLDVNCPAYVGIGGKFLGNSVVVGKYQLVQ  203

Query  663  SCHVEV  680
            SC+V+V
Sbjct  204  SCNVDV  209



>ref|XP_002523871.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38597.1| conserved hypothetical protein [Ricinus communis]
Length=210

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 102/183 (56%), Gaps = 17/183 (9%)
 Frame = +3

Query  183  TLFCISLCVAMSAQISLT--QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRG  356
            TL  I L V     + L   +PRF L+ AT++    +  N LT+NI V L+   P    G
Sbjct  25   TLAVIVLVVIFFIWLILQPHKPRFILQDATVNALTFSGTNFLTSNIQVTLSTKNPNERIG  84

Query  357  IYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------  515
            IYY++L +YA YRNQ +TL   LP SYQG+KD+ +WS FL GNSVP+ P +         
Sbjct  85   IYYEKLDIYASYRNQQMTLGTQLPRSYQGHKDITIWSPFLYGNSVPMSPYLASALNEDLD  144

Query  516  AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGS--------TSISSSPVQSCH  671
            AG VLVNI VDG+++    +   G  R++ NCPA++ FG+          I    VQ C 
Sbjct  145  AGAVLVNIKVDGYLKWKVGSWISGRYRINVNCPAYMTFGNRNHGIADGVGIKYQFVQGCS  204

Query  672  VEV  680
            VEV
Sbjct  205  VEV  207



>ref|XP_006362852.1| PREDICTED: uncharacterized protein LOC102591975 [Solanum tuberosum]
Length=209

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 112/204 (55%), Gaps = 16/204 (8%)
 Frame = +3

Query  114  GEMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNL-TA  290
            G   DD            L+ F TL  +++ +     +  T+P F L+ AT++ FN  T 
Sbjct  7    GHHVDDERHNLQRRLITALIAFVTLILVTILLIFLI-LRPTKPHFILQDATVYAFNTSTP  65

Query  291  GNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSA  470
             N LTTNI + +A+  P    GIYYD+L+VYA YR Q VTLP  LP +YQG+KDV++WS 
Sbjct  66   FNFLTTNIQITIASRNPNDKIGIYYDKLNVYARYRGQQVTLPTLLPQTYQGHKDVSIWSP  125

Query  471  FLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDF  629
            F+ GN+VP+ P +G       M G +L+N+ +DG +R    +       L  NCPA++  
Sbjct  126  FVYGNNVPIAPYLGNAISQDIMFGTILLNVRIDGRVRWKVGSFISSKYHLYVNCPAYVGI  185

Query  630  GSTSISSSP-------VQSCHVEV  680
            G   + +S        VQ+CHV+V
Sbjct  186  GGKFLGNSVVVGKYQLVQNCHVDV  209



>ref|XP_010514763.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=206

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 106/199 (53%), Gaps = 17/199 (9%)
 Frame = +3

Query  126  DDLPKKSFNCCCVLLLFFS-TLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLL  302
            D+  K       V+L F +  LF + L  A+   +    PRF L+ AT++ FN++  N L
Sbjct  11   DEDEKMRRRIGAVVLGFLAAVLFVVFLVWAI---LHPHGPRFVLQDATIYAFNISQPNYL  67

Query  303  TTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSG  482
            T+NI V L++  P    GI+YDRL +YA YRNQ VTL   LP +YQG+ DV VWS FL G
Sbjct  68   TSNIQVTLSSRNPNDKIGIFYDRLDIYASYRNQQVTLATLLPVTYQGHLDVTVWSPFLYG  127

Query  483  NSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             +VPV P +         AG VL+NI +DGW+R        G  RL  NCPA++      
Sbjct  128  TTVPVAPYLSPALSQDLTAGMVLLNIKIDGWVRWKVGTWISGRYRLHVNCPAYITVAGQF  187

Query  642  ISSSP------VQSCHVEV  680
                P      VQ C V+V
Sbjct  188  SGEGPGVKYQLVQRCAVDV  206



>ref|XP_010503078.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=206

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 106/199 (53%), Gaps = 17/199 (9%)
 Frame = +3

Query  126  DDLPKKSFNCCCVLLLFFS-TLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLL  302
            D+  K       V+L F +  LF + L  A+   +    PRF L+ AT++ FN +  N L
Sbjct  11   DEDEKMRKRIGAVVLGFLAAVLFVVFLVWAI---LHPHGPRFVLQDATIYAFNNSQPNYL  67

Query  303  TTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSG  482
            T+NI V L++  P    GI+YDRL +YA YRNQ VTL   LPA+YQG+ DV VWS FL G
Sbjct  68   TSNIQVTLSSRNPNDKIGIFYDRLDIYASYRNQQVTLATLLPATYQGHLDVTVWSPFLYG  127

Query  483  NSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             +VPV P +         AG VL+NI +DGW+R        G  RL  NCPA++      
Sbjct  128  TTVPVAPYLSPALSQDLTAGMVLLNIKIDGWVRWKVGTWISGRYRLHVNCPAYITVAGQF  187

Query  642  ISSSP------VQSCHVEV  680
                P      VQ C V+V
Sbjct  188  SGEGPGVKYQLVQRCAVDV  206



>gb|EYU36038.1| hypothetical protein MIMGU_mgv1a022940mg [Erythranthe guttata]
Length=210

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 97/165 (59%), Gaps = 17/165 (10%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +P F L+ AT++ FNLTA NLLT +  + L++  P    GIYYD++ VYA YR+Q +T+P
Sbjct  46   KPHFILQDATVYAFNLTATNLLTASFQITLSSRNPNGRIGIYYDKIDVYAAYRSQQITIP  105

Query  417  APLPASYQGYKDVAVWSAFLSGN-SVPVEPGVGM--------AGRVLVNIIVDGWIRKHF  569
              LP SYQG+KD  VWS FL G  +VPV P +          AG V+VN+ VDG IR   
Sbjct  106  TLLPPSYQGHKDTTVWSPFLGGGAAVPVAPYLAASLKEDGSSAGTVMVNVRVDGRIRWKV  165

Query  570  WNLEVGPCRLSANCPAFLDFGS--------TSISSSPVQSCHVEV  680
             +   G  RL+ NCPA+++FG          +I    +  C+V+V
Sbjct  166  GSFVSGKYRLNVNCPAYINFGEKKNAAAVGAAIKRQLIMDCNVDV  210



>ref|NP_190008.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 emb|CAB88990.1| putative protein [Arabidopsis thaliana]
 gb|AAT41789.1| At3g44220 [Arabidopsis thaliana]
 gb|AAT70476.1| At3g44220 [Arabidopsis thaliana]
 gb|AEE77877.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
Length=206

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 106/199 (53%), Gaps = 17/199 (9%)
 Frame = +3

Query  123  KDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLL  302
            +D+  +K      VL    + LF + L  A+   +    PRF L+ AT++ FN++  N L
Sbjct  12   EDEKMRKRIGAL-VLGFLAAVLFVVFLVWAI---LHPHGPRFVLQDATIYAFNVSQPNYL  67

Query  303  TTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSG  482
            T+N+ V L++  P    GI+YDRL +YA YRNQ VTL   LPA+YQG+ DV +WS FL G
Sbjct  68   TSNLQVTLSSRNPNDKIGIFYDRLDIYASYRNQQVTLATLLPATYQGHLDVTIWSPFLYG  127

Query  483  NSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             +VPV P           AG VL+NI +DGW+R        G  RL  NCPA++      
Sbjct  128  TTVPVAPYFSPALSQDLTAGMVLLNIKIDGWVRWKVGTWVSGRYRLHVNCPAYITLAGHF  187

Query  642  ISSSP------VQSCHVEV  680
                P      VQ C V+V
Sbjct  188  SGDGPAVKYQLVQRCAVDV  206



>ref|XP_006424128.1| hypothetical protein CICLE_v10029271mg [Citrus clementina]
 gb|ESR37368.1| hypothetical protein CICLE_v10029271mg [Citrus clementina]
Length=212

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 94/168 (56%), Gaps = 19/168 (11%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG----NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQ  401
            ++P F L+ ATL+ FNL+ G    N LTTN+ V +    P    GIYY +  VYA YRNQ
Sbjct  45   SKPSFILQDATLYAFNLSTGPSPPNALTTNLQVTITTRNPNDKIGIYYQKADVYASYRNQ  104

Query  402  TVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIR  560
             ++L   LPA+YQG+KDV VWS FL GNSVPV P V         AG V+VNI VDG I+
Sbjct  105  QISLATLLPATYQGHKDVIVWSPFLYGNSVPVSPFVAEALGQDLNAGMVMVNIKVDGRIK  164

Query  561  KHFWNLEVGPCRLSANCPAFLDFGS--------TSISSSPVQSCHVEV  680
                    G   L  NCPA++ FG          S+    VQSC V+V
Sbjct  165  WKVGTWISGRYHLHVNCPAYITFGDKSKGIASGASVKFQLVQSCSVDV  212



>ref|XP_006481531.1| PREDICTED: uncharacterized protein LOC102607257 [Citrus sinensis]
 gb|KDO58254.1| hypothetical protein CISIN_1g028208mg [Citrus sinensis]
Length=212

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 96/168 (57%), Gaps = 19/168 (11%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG----NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQ  401
            ++P F L+ ATL+ FNL+ G    N LTTN+ V +    P    GIYY +  VYA YRNQ
Sbjct  45   SKPSFILQDATLYAFNLSTGPSPPNALTTNLQVTITTRNPNDQIGIYYQKADVYASYRNQ  104

Query  402  TVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIR  560
             ++L   LPA+YQG+KDV VWS FL GNSVPV P V         AG V+VNI VDG I+
Sbjct  105  QISLATLLPATYQGHKDVIVWSPFLCGNSVPVSPFVAEALGQDLNAGMVMVNIKVDGRIK  164

Query  561  KHFWNLEVGPCRLSANCPAFLDFGSTS--ISSSP------VQSCHVEV  680
                    G   L  NCPA++ FG  S  I+S        VQSC V+V
Sbjct  165  WKVGTWISGRYHLHVNCPAYITFGDKSKGIASGASLKFQLVQSCSVDV  212



>ref|XP_002875648.1| harpin-induced family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51907.1| harpin-induced family protein [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 91/160 (57%), Gaps = 13/160 (8%)
 Frame = +3

Query  240  PRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPA  419
            PRF L+ AT++ FN++  N LT+N+ V L++  P    GI+YDRL +YA YRNQ VTL  
Sbjct  47   PRFVLQDATIYAFNVSQPNYLTSNLQVTLSSRNPNDKIGIFYDRLDIYASYRNQQVTLAT  106

Query  420  PLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNL  578
             LPA+YQG+ DV VWS FL G +VPV P           AG VL+NI +DGW+R      
Sbjct  107  LLPATYQGHLDVTVWSPFLYGTTVPVAPYFSPALSQDLTAGMVLLNIKIDGWVRWKVGTW  166

Query  579  EVGPCRLSANCPAFLDFGSTSISSSP------VQSCHVEV  680
              G  RL  NCPA++          P      VQ C V+V
Sbjct  167  ISGRYRLHVNCPAYITLAGHFSGDGPAVKYQLVQRCAVDV  206



>ref|NP_680206.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 emb|CAC34513.1| NDR1/HIN1-like protein [Arabidopsis thaliana]
 gb|AED92995.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
Length=210

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 94/160 (59%), Gaps = 13/160 (8%)
 Frame = +3

Query  240  PRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPA  419
            PRF L+  T+++FN++  N L++N+ V +++  P    GI+YDRL +Y  YRNQ VTL  
Sbjct  51   PRFVLQDVTINDFNVSQPNFLSSNLQVTVSSRNPNDKIGIFYDRLDIYVTYRNQEVTLAR  110

Query  420  PLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNL  578
             LP++YQG+ +V VWS FL G++VPV P +         AG VL+NI +DGW+R    + 
Sbjct  111  LLPSTYQGHLEVTVWSPFLIGSAVPVAPYLSSALNEDLFAGLVLLNIKIDGWVRWKVGSW  170

Query  579  EVGPCRLSANCPAFLDFGSTSISSSP------VQSCHVEV  680
              G  RL  NCPAF+        + P      VQ C V+V
Sbjct  171  VSGSYRLHVNCPAFITVTGKLTGTGPAIKYQLVQRCAVDV  210



>gb|KDP35478.1| hypothetical protein JCGZ_10871 [Jatropha curcas]
Length=173

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 93/163 (57%), Gaps = 15/163 (9%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +P F L  AT++  +L+  N LT+N+ V ++   P    GIYY++L +YA YRNQ +T+ 
Sbjct  8    KPTFVLEDATVNALSLSGSNFLTSNVQVTVSTRNPNERIGIYYEKLDIYASYRNQQITIA  67

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHFWN  575
              LP SYQG+KD+ +WS F+ GNSVP+ P +         AG VLVNI +DG ++    +
Sbjct  68   TQLPRSYQGHKDITIWSPFVYGNSVPMWPFLAASLGQDLNAGAVLVNIKIDGTLKWKVGS  127

Query  576  LEVGPCRLSANCPAFLDFGSTS--------ISSSPVQSCHVEV  680
               G  R++ NCPAFL+F   +        I     Q+C  EV
Sbjct  128  WISGKYRVNVNCPAFLNFARNAHGIADGVGIKYQFAQACSAEV  170



>ref|XP_009349115.1| PREDICTED: protein YLS9-like [Pyrus x bretschneideri]
Length=210

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 107/205 (52%), Gaps = 17/205 (8%)
 Frame = +3

Query  114  GEMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAG  293
            G  + +  +  F  CC  LL F+ +  +++ +   A +  ++PRF L+  T+ NFN +A 
Sbjct  7    GLHRQNKRRMMFRRCCAGLLIFNFILLVTILIVW-AVLQPSKPRFVLQDVTVFNFNTSAS  65

Query  294  NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAF  473
            N+ +++  V +++  P    GIYYDRL+VYA YR Q +T P  +P  YQG+KDV +WS F
Sbjct  66   NVFSSSFQVTISSRNPNDKIGIYYDRLNVYATYRAQQITFPTLIPPVYQGHKDVNIWSPF  125

Query  474  LSGNSVPVEP----GVGM---AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG  632
            + G  VP+ P     +G    AG VL+ I +DG +R        G   L   CPAF+  G
Sbjct  126  IYGTDVPIAPYNSIALGQDQNAGSVLLLIKMDGRVRWKVGTFISGRYHLYIRCPAFIALG  185

Query  633  S---------TSISSSPVQSCHVEV  680
            S          ++    VQ C V V
Sbjct  186  SRTTGVEVGNNAVKYQLVQRCKVTV  210



>ref|XP_011046867.1| PREDICTED: protein YLS9-like [Populus euphratica]
 ref|XP_011046868.1| PREDICTED: protein YLS9-like [Populus euphratica]
Length=208

 Score =   122 bits (307),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 102/189 (54%), Gaps = 19/189 (10%)
 Frame = +3

Query  162  VLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIP  341
            +L   F  L  I L  A+   +  ++P+F L+ AT++ FN++  N +T+N  V +++  P
Sbjct  23   ILTFLFIVLIVILLVWAI---LRPSKPKFILQDATVYAFNVSYPNYITSNFQVTVSSRNP  79

Query  342  YRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM--  515
                GIYYDRL +YA YRNQ +TL   +PASYQG+K++ VWS F+SGNSVPV P      
Sbjct  80   DDRVGIYYDRLDIYATYRNQQITLRTSIPASYQGHKEINVWSPFISGNSVPVSPYNSAAL  139

Query  516  -----AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS---------ISSS  653
                 AG V++ I +DG +R            L   CPA++ FGS +         +   
Sbjct  140  SQDQGAGLVMLMIKIDGRVRFKVGTFISAKYNLHVRCPAYIQFGSRTNGIMVGDNVVKYQ  199

Query  654  PVQSCHVEV  680
               SCHV +
Sbjct  200  LATSCHVSL  208



>ref|XP_010426862.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=208

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 96/170 (56%), Gaps = 10/170 (6%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  V+      L  I L   +   +  T+PRF L+ AT++ FNL+  NLLT+N  V LA+
Sbjct  20   CAAVIAFILIALITIFLVWVI---LRPTKPRFVLQDATVYAFNLSQPNLLTSNFQVTLAS  76

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG  512
              P    GIYYDRLHVYA YRNQ +TL   +P +YQG+KD  VWS F+ G +VP+ P   
Sbjct  77   RNPNSKIGIYYDRLHVYATYRNQQITLRTAIPPTYQGHKDDDVWSPFVYGTAVPIAPYNS  136

Query  513  MA-----GRVLVNIIV--DGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
            +A     GR  V +++  DG +R     L  G   +   CPA+++ G+ +
Sbjct  137  VALGEEQGRGFVQLLIRADGRVRWKVGTLITGKYHIHVRCPAYINLGNKA  186



>gb|ABY88538.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 105/186 (56%), Gaps = 16/186 (9%)
 Frame = +3

Query  114  GEMKDDLPKKSF-NCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTA  290
            G  + +L ++ F +   VL + F T+  I       A +  ++PRF L+ AT++ FN++ 
Sbjct  1    GHSRRELIRRIFWSIIFVLFIIFLTILLIW------AILQPSKPRFILQDATVYAFNVSG  54

Query  291  G--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVW  464
               NLLT+N  + L++  P    GIYYDRL VYA YR+Q +T P  +P +YQG+KDV +W
Sbjct  55   NPPNLLTSNFQITLSSRNPNNKIGIYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIW  114

Query  465  SAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL  623
            S F+ G SVP+ P  G++       G VL+ I  DG +R        G   L   CPA++
Sbjct  115  SPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYI  174

Query  624  DFGSTS  641
            +FG+ +
Sbjct  175  NFGNKA  180



>ref|XP_010515712.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=208

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 96/170 (56%), Gaps = 10/170 (6%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  V+      L  I L   +   +  T+PRF L+ AT++ FNL+  NLLT+N  V LA+
Sbjct  20   CAAVIAFILIVLITIFLVWVI---LRPTKPRFVLQDATVYAFNLSQPNLLTSNFQVTLAS  76

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG  512
              P    GIYYDRLHVYA YRNQ +TL   +P +YQG+KD  VWS F+ G +VP+ P   
Sbjct  77   RNPNAKIGIYYDRLHVYATYRNQQITLRTAIPPTYQGHKDDDVWSPFVYGTAVPIAPYNS  136

Query  513  MA-----GRVLVNIIV--DGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
            +A     GR  V +++  DG +R     L  G   +   CPA+++ G+ +
Sbjct  137  VALGEEQGRGFVQLLIRADGRVRWKVGTLITGKYHIHVRCPAYINLGNKA  186



>ref|XP_002871993.1| harpin-induced family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48252.1| harpin-induced family protein [Arabidopsis lyrata subsp. lyrata]
Length=208

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 95/160 (59%), Gaps = 13/160 (8%)
 Frame = +3

Query  240  PRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPA  419
            PRF L+  T+++FN++  N L++N+ V L++  P    GI+YDRL +YA YRNQ VT+  
Sbjct  48   PRFVLQDVTINDFNISQPNFLSSNLQVTLSSRNPNDKIGIFYDRLDIYATYRNQEVTVAR  107

Query  420  PLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNL  578
             LP++YQG+ +  VWS FL G++VPV P +        +AG VL+NI +DGW+R    + 
Sbjct  108  LLPSTYQGHLEATVWSPFLIGSNVPVAPYLSPALNEDLIAGMVLLNIKIDGWVRWKVGSW  167

Query  579  EVGPCRLSANCPAFLDFGSTSISSSP------VQSCHVEV  680
              G   L  NCPAF+      + + P      VQ C V++
Sbjct  168  VSGGYHLHVNCPAFITVTGKLVGAGPAIKYQLVQRCAVDL  207



>ref|XP_008391966.1| PREDICTED: protein YLS9 [Malus domestica]
 ref|XP_008351502.1| PREDICTED: protein YLS9-like [Malus domestica]
Length=210

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 107/205 (52%), Gaps = 17/205 (8%)
 Frame = +3

Query  114  GEMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAG  293
            G  + +  ++ F  CC  LL F+ +  +++ +   A +  ++PRF L+  T+ NFN +A 
Sbjct  7    GLHRQNKRRRMFRRCCAGLLIFNFILLVTILIVW-AILQPSKPRFVLQDVTVFNFNTSAS  65

Query  294  NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAF  473
            N+ +++  V +++  P    GIYYDRL++YA YR Q +T P  +P  YQG+KDV +WS F
Sbjct  66   NVFSSSFQVTISSRNPNDKIGIYYDRLNIYATYRAQQITFPTLIPPVYQGHKDVNIWSPF  125

Query  474  LSGNSVPVEP----GVGM---AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG  632
            + G  VP+ P     +G    AG VL+ I +DG +R            L   CPAF+  G
Sbjct  126  IYGTDVPIAPYNSIALGQDQNAGSVLLLIKMDGRVRWKVGTFISSRYHLYIRCPAFITLG  185

Query  633  STS---------ISSSPVQSCHVEV  680
            S +         +    VQ C V V
Sbjct  186  SKTTGVEVGNNAVKYQLVQRCKVTV  210



>ref|XP_010520462.1| PREDICTED: protein YLS9-like [Tarenaya hassleriana]
Length=209

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 85/137 (62%), Gaps = 7/137 (5%)
 Frame = +3

Query  240  PRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPA  419
            PRF L+ AT++ FN++  N LT+N+ V +++  P    GI+YD L +YA YRNQ VTL  
Sbjct  47   PRFVLQDATIYAFNVSQPNFLTSNLQVTVSSRNPNDKIGIFYDHLDIYASYRNQQVTLAT  106

Query  420  PLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNL  578
             LPA+YQG+ D+ VWS FL G +VPV P +  A       G +L+N+ +DGW+R      
Sbjct  107  ILPATYQGHLDMTVWSPFLYGTTVPVAPYLTAAMMQDLNTGMILLNVKIDGWVRWKVGTW  166

Query  579  EVGPCRLSANCPAFLDF  629
              G  RL  NCPA++ F
Sbjct  167  ISGRYRLHVNCPAYITF  183



>ref|XP_011012388.1| PREDICTED: protein YLS9-like [Populus euphratica]
Length=209

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 107/200 (54%), Gaps = 17/200 (9%)
 Frame = +3

Query  126  DDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLT  305
            DD  K   +    +L F  T+  +   V +  Q    +PRF L+  T++  NL+  N L+
Sbjct  12   DDENKHHRHIFIGILAFIITVLVVIFLVWIVLQPH--KPRFILQDTTIYGLNLSDPNFLS  69

Query  306  TNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGN  485
            +N+ V ++   P    GIYY++L +YA Y NQ +TL   LP +YQG+ DV+VWS FL G+
Sbjct  70   SNMQVTISTKNPNDKIGIYYEKLDIYASYHNQQITLATELPPTYQGHNDVSVWSPFLYGD  129

Query  486  SVPVEPGVGM-------AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGS---  635
            +VPV P + +       AG +L NI ++G ++    +   G  R+  NCPA++  GS   
Sbjct  130  AVPVSPFLAVSIDQDVNAGVLLFNIKINGKLKWKVGSWLSGRYRIFVNCPAYITLGSRSN  189

Query  636  -----TSISSSPVQSCHVEV  680
                 T I    VQ CHV+V
Sbjct  190  GINVGTGIKYQIVQHCHVDV  209



>gb|ABY88526.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 104/186 (56%), Gaps = 16/186 (9%)
 Frame = +3

Query  114  GEMKDDLPKKSF-NCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTA  290
            G  +  L ++ F +   VL + F T+  I       A +  ++PRF L+ AT++ FN++ 
Sbjct  1    GHSRQKLIRRIFWSIIFVLFIIFLTILLIW------AILQPSKPRFILQDATVYAFNVSG  54

Query  291  G--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVW  464
               NLLT+N  + L++  P    GIYYDRL VYA YR+Q +T P  +P +YQG+KDV +W
Sbjct  55   NPPNLLTSNFQITLSSRNPNNKIGIYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIW  114

Query  465  SAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL  623
            S F+ G SVP+ P  G++       G VL+ I  DG +R        G   L   CPA++
Sbjct  115  SPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYI  174

Query  624  DFGSTS  641
            +FG+ +
Sbjct  175  NFGNKA  180



>ref|XP_010246827.1| PREDICTED: protein YLS9-like [Nelumbo nucifera]
Length=211

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 102/180 (57%), Gaps = 18/180 (10%)
 Frame = +3

Query  186  LFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYY  365
            LF I L  A+   +  ++P+F L+ AT++  N++ GN LT+N  V +++  P  + GIYY
Sbjct  35   LFAIFLVWAI---LRPSKPQFTLQDATVYQLNISDGNYLTSNFQVTVSSRNPNGNIGIYY  91

Query  366  DRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GR  524
            DRL VYA Y NQ +TLP  LP +YQG+KD+ VWS F+ G SVP+ P +  +       G 
Sbjct  92   DRLDVYATYGNQQITLPTRLPPTYQGHKDINVWSPFVYGMSVPIAPYLAASFYQQHNFGT  151

Query  525  VLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGS--------TSISSSPVQSCHVEV  680
            V + I ++G IR        G   +  NCPA++ FGS        T+     VQSC V+V
Sbjct  152  VFIKIKINGHIRWKVGTWISGGYHIYINCPAYITFGSRNTGIPVGTAFKYQLVQSCGVDV  211



>ref|XP_010262976.1| PREDICTED: protein YLS9-like [Nelumbo nucifera]
Length=210

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 94/164 (57%), Gaps = 15/164 (9%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P+F L+  T+  FN+T  NLL +N+ + L++  P    GIYYDRL V+A Y NQ +TL
Sbjct  47   TKPKFTLQDVTVFQFNVTGSNLLNSNMQITLSSRNPNDKIGIYYDRLDVFAEYSNQQITL  106

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
            P  LP +Y+G+KD+ +WS F+ G++VP+ P +  +       G VL+ I VDG +R    
Sbjct  107  PTRLPPTYEGHKDINIWSPFVYGSNVPIAPYLAASLSQDQNIGMVLIKIKVDGRVRWKVG  166

Query  573  NLEVGPCRLSANCPAFLDFGS--------TSISSSPVQSCHVEV  680
                G   +  NCPA++ FGS        T+     VQ C V+V
Sbjct  167  TWISGNYHIHVNCPAYITFGSRNTGIQVGTAFKYQLVQPCGVDV  210



>gb|ABY88500.1| NHL1, partial [Arabidopsis thaliana]
Length=168

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 96/162 (59%), Gaps = 10/162 (6%)
 Frame = +3

Query  186  LFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRG  356
            LF I L + +  A +  ++PRF L+ AT++ FN++    NLLT+N  + L++  P    G
Sbjct  6    LFIIFLTILLIWAILQPSKPRFILQDATVYAFNVSGNPPNLLTSNFQITLSSRNPNNKIG  65

Query  357  IYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA------  518
            IYYDRL VYA YR+Q +T P  +P +YQG+KDV +WS F+ G SVP+ P  G++      
Sbjct  66   IYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIWSPFVYGTSVPIAPFNGVSLDTDKD  125

Query  519  -GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             G VL+ I  DG +R        G   L   CPA+++FG+ +
Sbjct  126  NGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYINFGNKA  167



>gb|ABY88551.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 104/186 (56%), Gaps = 16/186 (9%)
 Frame = +3

Query  114  GEMKDDLPKKSF-NCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTA  290
            G  +  L ++ F +   VL + F T+  I       A +  ++PRF L+ AT++ FN++ 
Sbjct  1    GHSRXKLIRRIFWSIIFVLFIIFLTILLIW------AILQPSKPRFILQDATVYAFNVSG  54

Query  291  G--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVW  464
               NLLT+N  + L++  P    GIYYDRL VYA YR+Q +T P  +P +YQG+KDV +W
Sbjct  55   NPPNLLTSNFQITLSSRNPNNKIGIYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIW  114

Query  465  SAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL  623
            S F+ G SVP+ P  G++       G VL+ I  DG +R        G   L   CPA++
Sbjct  115  SPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYI  174

Query  624  DFGSTS  641
            +FG+ +
Sbjct  175  NFGNKA  180



>gb|ABY88488.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88489.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88490.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88491.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88496.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88499.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88501.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88502.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88503.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88505.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88507.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88508.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88509.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88511.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88512.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88513.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88515.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88516.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88517.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88518.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88519.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88520.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88521.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88522.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88523.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88524.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88525.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88527.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88528.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88529.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88530.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88531.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88532.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88533.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88534.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88535.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88536.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88537.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88539.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88542.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88543.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88544.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88545.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88546.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88547.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88548.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88549.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88550.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88552.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88554.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88555.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88556.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88557.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88558.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88559.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88561.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88562.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88563.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88564.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88565.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88566.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88567.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88568.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88569.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88570.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88571.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88574.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88575.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88576.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88577.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88579.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88580.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88582.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 104/186 (56%), Gaps = 16/186 (9%)
 Frame = +3

Query  114  GEMKDDLPKKSF-NCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTA  290
            G  +  L ++ F +   VL + F T+  I       A +  ++PRF L+ AT++ FN++ 
Sbjct  1    GHSRRKLIRRIFWSIIFVLFIIFLTILLIW------AILQPSKPRFILQDATVYAFNVSG  54

Query  291  G--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVW  464
               NLLT+N  + L++  P    GIYYDRL VYA YR+Q +T P  +P +YQG+KDV +W
Sbjct  55   NPPNLLTSNFQITLSSRNPNNKIGIYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIW  114

Query  465  SAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL  623
            S F+ G SVP+ P  G++       G VL+ I  DG +R        G   L   CPA++
Sbjct  115  SPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYI  174

Query  624  DFGSTS  641
            +FG+ +
Sbjct  175  NFGNKA  180



>gb|ABY88541.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 103/186 (55%), Gaps = 16/186 (9%)
 Frame = +3

Query  114  GEMKDDLPKKSF-NCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTA  290
            G  +  L ++ F +   VL + F T+  I       A +  ++PRF L+ AT++ FN++ 
Sbjct  1    GHSRRKLIRRIFWSIIFVLFIIFLTILLIW------AILQPSKPRFILQDATVYAFNVSG  54

Query  291  G--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVW  464
               NLLT+N  + L++  P    GIYYDRL VYA YR+Q +T P  +P +YQG+KDV +W
Sbjct  55   NPPNLLTSNFQITLSSRNPNNKIGIYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIW  114

Query  465  SAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL  623
            S F+ G SVP+ P  G++       G VL+ I  DG +R        G   L   CPA++
Sbjct  115  SPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYI  174

Query  624  DFGSTS  641
            +FG  +
Sbjct  175  NFGDKA  180



>gb|ABY88583.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 104/186 (56%), Gaps = 16/186 (9%)
 Frame = +3

Query  114  GEMKDDLPKKSF-NCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTA  290
            G  +  L ++ F +   VL + F T+  I       A +  ++PRF L+ AT++ FN++ 
Sbjct  1    GXSRRKLIRRIFWSIIFVLFIIFLTILLIW------AILQPSKPRFILQDATVYAFNVSG  54

Query  291  G--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVW  464
               NLLT+N  + L++  P    GIYYDRL VYA YR+Q +T P  +P +YQG+KDV +W
Sbjct  55   NPPNLLTSNFQITLSSRNPNNKIGIYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIW  114

Query  465  SAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL  623
            S F+ G SVP+ P  G++       G VL+ I  DG +R        G   L   CPA++
Sbjct  115  SPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYI  174

Query  624  DFGSTS  641
            +FG+ +
Sbjct  175  NFGNKA  180



>gb|ABY88494.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88540.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88560.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 104/186 (56%), Gaps = 16/186 (9%)
 Frame = +3

Query  114  GEMKDDLPKKSF-NCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTA  290
            G  +  L ++ F +   VL + F T+  I       A +  ++PRF L+ AT++ FN++ 
Sbjct  1    GHSRRKLIRRIFWSLIFVLFIIFLTILLIW------AILQPSKPRFILQDATVYAFNVSG  54

Query  291  G--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVW  464
               NLLT+N  + L++  P    GIYYDRL VYA YR+Q +T P  +P +YQG+KDV +W
Sbjct  55   NPPNLLTSNFQITLSSRNPNNKIGIYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIW  114

Query  465  SAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL  623
            S F+ G SVP+ P  G++       G VL+ I  DG +R        G   L   CPA++
Sbjct  115  SPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYI  174

Query  624  DFGSTS  641
            +FG+ +
Sbjct  175  NFGNKA  180



>emb|CDX98590.1| BnaC05g37850D [Brassica napus]
Length=207

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 95/161 (59%), Gaps = 13/161 (8%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF L+  T++ FN++  NLL++N+ V L++  P    G++YDRL +YA YRNQ VTL 
Sbjct  47   KPRFVLQDVTIYEFNISQPNLLSSNLQVTLSSRNPNDKIGVFYDRLDIYASYRNQEVTLA  106

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWN  575
              LP +YQG+ +V VWS  L G++VPV+P +         AG VL+NI +DG ++    +
Sbjct  107  NLLPETYQGHLEVTVWSPVLIGSAVPVDPYLTPALKEDINAGMVLLNIKIDGCVKWKVSS  166

Query  576  LEVGPCRLSANCPAFLDFGSTSISSSP------VQSCHVEV  680
               G  RL  NCPAF+ F    + + P       Q C V+V
Sbjct  167  WVSGCYRLLVNCPAFIPFSGQVVGAGPAIKDQLAQQCAVDV  207



>ref|XP_009120680.1| PREDICTED: protein YLS9-like [Brassica rapa]
Length=207

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 95/161 (59%), Gaps = 13/161 (8%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF L+  T++ FN++  NLL++N+ V L++  P    G++YDRL +YA YRNQ VTL 
Sbjct  47   KPRFVLQDVTIYEFNISQPNLLSSNLQVTLSSRNPNDKIGVFYDRLDIYASYRNQEVTLA  106

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWN  575
              LP +YQG+ +V VWS  L G++VPV+P +         AG VL+NI +DG ++    +
Sbjct  107  NLLPETYQGHLEVTVWSPVLIGSAVPVDPYLTPALKEDINAGMVLLNIKIDGCVKWKVGS  166

Query  576  LEVGPCRLSANCPAFLDF------GSTSISSSPVQSCHVEV  680
               G  RL  NCPAF+ F      G  +I     Q C V+V
Sbjct  167  WVSGCYRLLVNCPAFIPFSGQVVGGGPAIKDQLAQQCAVDV  207



>gb|ABY88506.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 104/186 (56%), Gaps = 16/186 (9%)
 Frame = +3

Query  114  GEMKDDLPKKSF-NCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTA  290
            G  +  L ++ F +   VL + F T+  I       A +  ++PRF L+ AT++ FN++ 
Sbjct  1    GHSRRXLIRRIFWSIIFVLFIIFLTILLIW------AILQPSKPRFILQDATVYAFNVSG  54

Query  291  G--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVW  464
               NLLT+N  + L++  P    GIYYDRL VYA YR+Q +T P  +P +YQG+KDV +W
Sbjct  55   NPPNLLTSNFQITLSSRNPNNKIGIYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIW  114

Query  465  SAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL  623
            S F+ G SVP+ P  G++       G VL+ I  DG +R        G   L   CPA++
Sbjct  115  SPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYI  174

Query  624  DFGSTS  641
            +FG+ +
Sbjct  175  NFGNKA  180



>gb|ABY88492.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88514.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88573.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 96/162 (59%), Gaps = 10/162 (6%)
 Frame = +3

Query  186  LFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRG  356
            LF I L + +  A +  ++PRF L+ AT++ FN++    NLLT+N  + L++  P    G
Sbjct  19   LFIIFLTILLIWAILQPSKPRFILQDATVYAFNVSGNPPNLLTSNFQITLSSRNPNNKIG  78

Query  357  IYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA------  518
            IYYDRL VYA YR+Q +T P  +P +YQG+KDV +WS F+ G SVP+ P  G++      
Sbjct  79   IYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIWSPFVYGTSVPIAPFNGVSLDTDKD  138

Query  519  -GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             G VL+ I  DG +R        G   L   CPA+++FG+ +
Sbjct  139  NGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYINFGNKA  180



>ref|XP_004136510.1| PREDICTED: protein NDR1-like [Cucumis sativus]
 gb|KGN59200.1| hypothetical protein Csa_3G779770 [Cucumis sativus]
Length=211

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 94/167 (56%), Gaps = 18/167 (11%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P FFL+  T++ FN T  + LT+N  + +++  P R  GIYYD LHVYA+YRNQ +TL
Sbjct  45   TKPTFFLQDVTVYAFNATVPSFLTSNFLLTVSSRNPNRRIGIYYDELHVYAIYRNQQITL  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHFW  572
               +P  YQG+KDV VWS F+SG SVPV P +         AG +++ + +DG +R    
Sbjct  105  RTIIPRFYQGHKDVNVWSPFVSGTSVPVAPFISSELNQDRNAGALMLLVKIDGKVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDFGS-----------TSISSSPVQSCHVEV  680
            +   G  +  ANCP  ++FG+            ++    VQ C V V
Sbjct  165  SFITGRYQFHANCPVVINFGAYPANGDGSIVQYNVKYQVVQKCDVSV  211



>ref|XP_011042605.1| PREDICTED: protein YLS9-like [Populus euphratica]
 ref|XP_011011640.1| PREDICTED: protein YLS9-like [Populus euphratica]
Length=209

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 90/143 (63%), Gaps = 7/143 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            ++P+F L+ AT++ FN+++ N+LT+N  V +++  P    GIYYD+L VYA YRNQ +TL
Sbjct  45   SKPKFILQDATVYAFNVSSPNVLTSNFQVTISSRNPNDKVGIYYDKLDVYATYRNQQITL  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
               +P SYQG+K++ VWS F+ G++VPV P   +A       G VL+ I +DG +R    
Sbjct  105  RTSIPTSYQGHKEIDVWSPFVYGSAVPVAPYNSVALSQDQATGTVLLMIKIDGRVRFKVG  164

Query  573  NLEVGPCRLSANCPAFLDFGSTS  641
                G   L+  CPA++ FGS +
Sbjct  165  TFISGKYHLNVRCPAYIQFGSRT  187



>ref|XP_004170854.1| PREDICTED: protein NDR1-like [Cucumis sativus]
Length=211

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 94/167 (56%), Gaps = 18/167 (11%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P FFL+  T++ FN T  + LT+N  + +++  P R  GIYYD LHVYA+YRNQ +TL
Sbjct  45   TKPTFFLQDVTVYAFNATVPSFLTSNFLLTVSSRNPNRRIGIYYDELHVYAIYRNQQITL  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHFW  572
               +P  YQG+KDV VWS F+SG SVPV P +         AG +++ + +DG +R    
Sbjct  105  RTIIPRFYQGHKDVNVWSPFVSGTSVPVAPFISSELNQDRNAGALMLLVKIDGKVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDFGS-----------TSISSSPVQSCHVEV  680
            +   G  +  ANCP  ++FG+            ++    VQ C V V
Sbjct  165  SFITGRYQFHANCPVVINFGAYPANGDGSIVQYNVKYQVVQKCDVSV  211



>gb|ABY88497.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 104/186 (56%), Gaps = 16/186 (9%)
 Frame = +3

Query  114  GEMKDDLPKKSF-NCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTA  290
            G  +  L ++ F +   VL + F T+  I       A +  ++PRF L+ AT++ FN++ 
Sbjct  1    GXSRXXLIRRIFWSIIFVLFIIFLTILLIW------AILQPSKPRFILQDATVYAFNVSG  54

Query  291  G--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVW  464
               NLLT+N  + L++  P    GIYYDRL VYA YR+Q +T P  +P +YQG+KDV +W
Sbjct  55   NPPNLLTSNFQITLSSRNPNNKIGIYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIW  114

Query  465  SAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL  623
            S F+ G SVP+ P  G++       G VL+ I  DG +R        G   L   CPA++
Sbjct  115  SPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYI  174

Query  624  DFGSTS  641
            +FG+ +
Sbjct  175  NFGNKA  180



>gb|ABY88572.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   119 bits (298),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 96/162 (59%), Gaps = 10/162 (6%)
 Frame = +3

Query  186  LFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRG  356
            LF I L + +  A +  ++PRF L+ AT++ FN++    NLLT+N  + L++  P    G
Sbjct  19   LFIIFLTILLIWAILQPSKPRFILQDATVYAFNVSGNPPNLLTSNFQITLSSRNPNNKIG  78

Query  357  IYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA------  518
            IYYDRL VYA YR+Q +T P  +P +YQG+KDV +WS F+ G SVP+ P  G++      
Sbjct  79   IYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIWSPFVYGTSVPIAPFNGVSLDTDKD  138

Query  519  -GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             G VL+ I  DG +R        G   L   CPA+++FG+ +
Sbjct  139  NGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYINFGNKA  180



>ref|NP_566396.1| NDR1/HIN1-Like protein 1 [Arabidopsis thaliana]
 gb|AAF02134.1|AC009918_6 unknown protein [Arabidopsis thaliana]
 gb|AAF88021.1|AF264697_1 NDR1/HIN1-Like protein 1 [Arabidopsis thaliana]
 gb|AAM66116.1| harpin-induced protein-like [Arabidopsis thaliana]
 gb|AAV85674.1| At3g11660 [Arabidopsis thaliana]
 gb|AAW70397.1| At3g11660 [Arabidopsis thaliana]
 gb|AEE75080.1| NDR1/HIN1-Like protein 1 [Arabidopsis thaliana]
Length=209

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 104/186 (56%), Gaps = 16/186 (9%)
 Frame = +3

Query  114  GEMKDDLPKKSF-NCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTA  290
            G  +  L ++ F +   VL + F T+  I       A +  ++PRF L+ AT++ FN++ 
Sbjct  8    GHSRRKLIRRIFWSIIFVLFIIFLTILLIW------AILQPSKPRFILQDATVYAFNVSG  61

Query  291  G--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVW  464
               NLLT+N  + L++  P    GIYYDRL VYA YR+Q +T P  +P +YQG+KDV +W
Sbjct  62   NPPNLLTSNFQITLSSRNPNNKIGIYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIW  121

Query  465  SAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL  623
            S F+ G SVP+ P  G++       G VL+ I  DG +R        G   L   CPA++
Sbjct  122  SPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYI  181

Query  624  DFGSTS  641
            +FG+ +
Sbjct  182  NFGNKA  187



>gb|ABY88504.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 96/162 (59%), Gaps = 10/162 (6%)
 Frame = +3

Query  186  LFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRG  356
            LF I L + +  A +  ++PRF L+ AT++ FN++    NLLT+N  + L++  P    G
Sbjct  19   LFIIFLTILLIWAILQPSKPRFILQDATVYAFNVSGNPPNLLTSNFQITLSSRNPNNKIG  78

Query  357  IYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA------  518
            IYYDRL VYA YR+Q +T P  +P +YQG+KDV +WS F+ G SVP+ P  G++      
Sbjct  79   IYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIWSPFVYGTSVPIAPFNGVSLDTDKD  138

Query  519  -GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             G VL+ I  DG +R        G   L   CPA+++FG+ +
Sbjct  139  NGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYINFGNKA  180



>gb|ABY88498.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 96/162 (59%), Gaps = 10/162 (6%)
 Frame = +3

Query  186  LFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRG  356
            LF I L + +  A +  ++PRF L+ AT++ FN++    NLLT+N  + L++  P    G
Sbjct  19   LFIIFLTILLIWAILQPSKPRFILQDATVYAFNVSGNPPNLLTSNFQITLSSRNPNNKIG  78

Query  357  IYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA------  518
            IYYDRL VYA YR+Q +T P  +P +YQG+KDV +WS F+ G SVP+ P  G++      
Sbjct  79   IYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIWSPFVYGTSVPIAPFNGVSLDTDKD  138

Query  519  -GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             G VL+ I  DG +R        G   L   CPA+++FG+ +
Sbjct  139  NGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYINFGNKA  180



>gb|ABY88493.1| NHL1, partial [Arabidopsis thaliana]
 gb|ABY88495.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 96/162 (59%), Gaps = 10/162 (6%)
 Frame = +3

Query  186  LFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRG  356
            LF I L + +  A +  ++PRF L+ AT++ FN++    NLLT+N  + L++  P    G
Sbjct  19   LFIIFLTILLIWAILQPSKPRFILQDATVYAFNVSGNPPNLLTSNFQITLSSRNPNNKIG  78

Query  357  IYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA------  518
            IYYDRL VYA YR+Q +T P  +P +YQG+KDV +WS F+ G SVP+ P  G++      
Sbjct  79   IYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIWSPFVYGTSVPIAPFNGVSLDTDKD  138

Query  519  -GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             G VL+ I  DG +R        G   L   CPA+++FG+ +
Sbjct  139  NGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYINFGNKA  180



>gb|ABY88553.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 96/162 (59%), Gaps = 10/162 (6%)
 Frame = +3

Query  186  LFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRG  356
            LF I L + +  A +  ++PRF L+ AT++ FN++    NLLT+N  + L++  P    G
Sbjct  19   LFIIFLTILLIWAILQPSKPRFILQDATVYAFNVSGNPPNLLTSNFQITLSSRNPNNKIG  78

Query  357  IYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA------  518
            IYYDRL VYA YR+Q +T P  +P +YQG+KDV +WS F+ G SVP+ P  G++      
Sbjct  79   IYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIWSPFVYGTSVPIAPFNGVSLDTDKD  138

Query  519  -GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             G VL+ I  DG +R        G   L   CPA+++FG+ +
Sbjct  139  NGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYINFGNKA  180



>ref|XP_006403801.1| hypothetical protein EUTSA_v10010723mg [Eutrema salsugineum]
 dbj|BAJ34290.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45254.1| hypothetical protein EUTSA_v10010723mg [Eutrema salsugineum]
Length=208

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 94/170 (55%), Gaps = 10/170 (6%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  V+      L  I L   +   +  T+PRF L+ AT+  FNL+  NLLT+N  +  A+
Sbjct  20   CGAVIAFIIIVLITIFLVWVI---LRPTKPRFILQDATVFAFNLSQPNLLTSNFQITFAS  76

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG  512
              P    GIYYDRLHVYA YRNQ +TL   +P +YQG+K+  VWS F+ G SVP+ P   
Sbjct  77   RNPNSKIGIYYDRLHVYATYRNQQITLRTAIPPTYQGHKEDNVWSPFVYGTSVPIAPYNS  136

Query  513  MA-----GRVLVNIIV--DGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
            +A     GR  V +++  DG +R     L  G   L   CPAF++ G+ +
Sbjct  137  VALGDEQGRGFVQLMIRADGRVRWKVGTLITGKYHLHVRCPAFINLGNKA  186



>ref|XP_002322794.1| harpin-induced family protein [Populus trichocarpa]
 gb|EEF04555.1| harpin-induced family protein [Populus trichocarpa]
Length=209

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 88/141 (62%), Gaps = 7/141 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            ++P+F L+ AT++ FN+++ N+LT+N  V L++  P    GIYYD+L VYA YRNQ +TL
Sbjct  45   SKPKFILQDATVYAFNVSSPNVLTSNFQVTLSSRNPNDKVGIYYDKLDVYATYRNQQITL  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
               +P SYQG+K++ VWS F+ G++VPV P   +A       G VL+ I +DG +R    
Sbjct  105  RTSIPTSYQGHKEIDVWSPFIYGSAVPVSPYNSVALSQDQATGTVLLMIKIDGRVRFKVG  164

Query  573  NLEVGPCRLSANCPAFLDFGS  635
                    L+  CPA++ FGS
Sbjct  165  TFISAKYHLNVRCPAYIQFGS  185



>ref|XP_008449594.1| PREDICTED: protein YLS9-like [Cucumis melo]
Length=211

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 95/165 (58%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG-NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVT  410
            ++P F L+  T+   N +   NLL+ N+ V +++  P    GIYY  + VY  YR Q VT
Sbjct  47   SKPHFILQDVTVFGLNASVSPNLLSLNLQVTISSRNPNDRIGIYYLTMDVYGAYRGQQVT  106

Query  411  LPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHF  569
            LP  LP++YQG++DV VWS FLSG++VPV P V M+       G VL N+ +DG ++   
Sbjct  107  LPTLLPSTYQGHRDVVVWSPFLSGDAVPVAPDVAMSLQQDRNVGAVLFNVKIDGQVKWKV  166

Query  570  WNLEVGPCRLSANCPAFLDFGS--------TSISSSPVQSCHVEV  680
                 G   L+ NCPAF+ FG+        +++    VQSC+VEV
Sbjct  167  GTWISGRYHLNVNCPAFIKFGNPDRAIAIGSAMKFQIVQSCNVEV  211



>gb|AAO41900.1| putative VAMP protein SEC22 [Arabidopsis thaliana]
Length=209

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 104/186 (56%), Gaps = 16/186 (9%)
 Frame = +3

Query  114  GEMKDDLPKKSF-NCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTA  290
            G  +  L ++ F +   VL + F T+  I       A +  ++PRF L+ AT++ FN++ 
Sbjct  8    GHSRRKLIRRIFWSIIFVLFIIFLTILLIW------AILQPSKPRFILQDATVYAFNVSG  61

Query  291  G--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVW  464
               N+LT+N  + L++  P    GIYYDRL VYA YR+Q +T P  +P +YQG+KDV +W
Sbjct  62   NPPNILTSNFQITLSSRNPNNKIGIYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIW  121

Query  465  SAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL  623
            S F+ G SVP+ P  G++       G VL+ I  DG +R        G   L   CPA++
Sbjct  122  SPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAYI  181

Query  624  DFGSTS  641
            +FG+ +
Sbjct  182  NFGNKA  187



>emb|CDX92375.1| BnaA10g14140D [Brassica napus]
Length=207

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 94/161 (58%), Gaps = 13/161 (8%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF L+  T++ FN++  NLL++N+ V L++  P    G++YDRL +Y  YRNQ VTL 
Sbjct  47   KPRFVLQDVTIYEFNISQPNLLSSNLQVTLSSRNPNDKIGVFYDRLDIYVSYRNQEVTLA  106

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWN  575
              LP +YQG+ +V VWS  L G++VPV+P +         AG VL+NI +DG ++    +
Sbjct  107  NLLPETYQGHLEVTVWSPVLIGSAVPVDPYLTPALKEDINAGMVLLNIKIDGCVKWKVGS  166

Query  576  LEVGPCRLSANCPAFLDF------GSTSISSSPVQSCHVEV  680
               G  RL  NCPAF+ F      G  +I     Q C V+V
Sbjct  167  WVSGCYRLLVNCPAFIPFSGQVVGGGPAIKDQLAQQCAVDV  207



>ref|XP_010454483.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=207

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 93/161 (58%), Gaps = 14/161 (9%)
 Frame = +3

Query  240  PRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPA  419
            PRF L+  T+++FN++  N LT+N+ V L++  P    GI+YDRL +YA YRNQ VT+  
Sbjct  47   PRFVLQDVTINDFNVSQPNYLTSNLQVTLSSRNPNDKIGIFYDRLDIYASYRNQEVTIAR  106

Query  420  PLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNL  578
             LP +YQG+ +V VWS  L G +V V P +        MAG VL+NI +DGW+R    + 
Sbjct  107  LLPTTYQGHLEVTVWSPVLIGTAVSVSPYLSPALEEDLMAGLVLLNIKIDGWVRWKVGSW  166

Query  579  EVGPCRLSANCPAFLDF-------GSTSISSSPVQSCHVEV  680
              G  RL  NCPA+++           ++    VQ C V+V
Sbjct  167  VSGGYRLHVNCPAYINVPRQLVGGAGPAMKYQLVQRCAVDV  207



>emb|CDX90600.1| BnaA03g41810D [Brassica napus]
Length=208

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 94/170 (55%), Gaps = 10/170 (6%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  V+      L  I L   +   +  T+PRF L+ AT+  FNL+  NLLTTN  V  A+
Sbjct  20   CAAVIAFIIIVLITIFLVWVI---LRPTKPRFILQDATVFAFNLSQPNLLTTNFQVTFAS  76

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG  512
              P    GIYYDRLHVYA YRNQ +TL   +P +YQG+K+  VWS F+ G +VP+ P   
Sbjct  77   RNPNSKIGIYYDRLHVYATYRNQQITLRTAIPPTYQGHKEDNVWSPFVYGTAVPIAPYNS  136

Query  513  MA-----GRVLVNIIV--DGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
            +A     GR  V +++  DG +R     L  G   +   CPA+++ G+ +
Sbjct  137  VALGDEQGRGFVGLMIRADGRVRWKVGTLITGKYHIHVRCPAYINLGNKA  186



>ref|XP_010534393.1| PREDICTED: protein YLS9-like [Tarenaya hassleriana]
Length=204

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 101/185 (55%), Gaps = 16/185 (9%)
 Frame = +3

Query  162  VLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIP  341
            ++   F  L  I L  A+   +  ++PRF L+ AT+  FN++ GN+LT+N  + L++  P
Sbjct  24   IIFFLFIVLLAILLVWAI---LQPSKPRFVLQDATVFAFNVS-GNVLTSNFQITLSSRNP  79

Query  342  YRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGM  515
                G+YYDRL VYA YRNQ +T P  +P +YQG+K++ VWS ++ G +VPV P   VG+
Sbjct  80   NDKIGVYYDRLDVYATYRNQQITFPTAIPPTYQGHKEINVWSPYVYGTAVPVAPYNAVGL  139

Query  516  A-----GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDF-----GSTSISSSPVQS  665
                  G V V I  DG +R        G   L   CPA+++F     G  ++  +   S
Sbjct  140  EEDKDHGAVTVTIRADGRVRWKVGTFVTGKYHLYVRCPAYINFADKPAGVNAVKYTFTSS  199

Query  666  CHVEV  680
            C V V
Sbjct  200  CSVSV  204



>ref|XP_008442910.1| PREDICTED: protein YLS9-like [Cucumis melo]
Length=279

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 87/141 (62%), Gaps = 7/141 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P FFL+  T++ FN T  + LT+N  + +++  P R  GIYYD LHVYA+YRNQ +TL
Sbjct  113  TKPTFFLQDVTVYAFNATVPSFLTSNFLLTISSRNPNRRIGIYYDELHVYAIYRNQQITL  172

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHFW  572
               +P  YQG+KDV VWS F+SG SVPV P +         AG +++ + +DG +R    
Sbjct  173  RTIIPRFYQGHKDVNVWSPFVSGTSVPVAPFISSALNQDRNAGALMILVKIDGKVRWKVG  232

Query  573  NLEVGPCRLSANCPAFLDFGS  635
            +   G  +  ANCP  ++FG+
Sbjct  233  SFITGRYQFHANCPVVINFGA  253



>ref|XP_009136681.1| PREDICTED: protein YLS9-like [Brassica rapa]
Length=208

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 94/170 (55%), Gaps = 10/170 (6%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  V+      L  I L   +   +  T+PRF L+ AT+  FNL+  NLLTTN  +  A+
Sbjct  20   CAAVIAFIIIVLITIFLVWVI---LRPTKPRFILQDATVFAFNLSQPNLLTTNFQITFAS  76

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG  512
              P    GIYYDRLHVYA YRNQ +TL   +P +YQG+K+  VWS F+ G +VP+ P   
Sbjct  77   RNPNSKIGIYYDRLHVYATYRNQQITLRTAIPPTYQGHKEDNVWSPFVYGTAVPIAPYNS  136

Query  513  MA-----GRVLVNIIV--DGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
            +A     GR  V +++  DG +R     L  G   +   CPA+++ G+ +
Sbjct  137  VALGDEQGRGFVGLMIRADGRVRWKVGTLITGKYHIHVRCPAYINLGNKA  186



>gb|ABY88578.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 103/186 (55%), Gaps = 16/186 (9%)
 Frame = +3

Query  114  GEMKDDLPKKSF-NCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTA  290
            G  +  L ++ F +   VL + F T+  I       A +  ++PRF L+ AT++ FN++ 
Sbjct  1    GHSRRKLIRRIFWSIIFVLFIIFLTILLIW------AILQPSKPRFILQDATVYAFNVSG  54

Query  291  G--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVW  464
               NLLT+N  + L++  P    GIYYDRL VYA YR+Q +T P  +P +YQG+KDV +W
Sbjct  55   NPPNLLTSNFQITLSSRNPNNKIGIYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIW  114

Query  465  SAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL  623
            S F+ G SVP+ P  G++       G VL+ I  DG +         G   L   CPA++
Sbjct  115  SPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRADGRVXWKVGTFITGKYHLHVKCPAYI  174

Query  624  DFGSTS  641
            +FG+ +
Sbjct  175  NFGNKA  180



>ref|XP_006288666.1| hypothetical protein CARUB_v10001972mg [Capsella rubella]
 gb|EOA21564.1| hypothetical protein CARUB_v10001972mg [Capsella rubella]
Length=207

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 92/161 (57%), Gaps = 14/161 (9%)
 Frame = +3

Query  240  PRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPA  419
            PRF L+  T++ FN+T  N LT N+ V +++  P    GI+YDRL +YA YR Q VT+  
Sbjct  47   PRFVLQDVTINEFNITQPNYLTLNLQVTVSSRNPNDKIGIFYDRLDIYASYRYQEVTIAR  106

Query  420  PLPASYQGYKDVAVWSAFLSGNSVPVEPGV-------GMAGRVLVNIIVDGWIRKHFWNL  578
             LP +YQG+K+V VWS  L G +VPV P +       G+AG VL+NI +DG +R    + 
Sbjct  107  LLPTTYQGHKEVTVWSPVLIGTAVPVAPYLSPSLNEDGIAGLVLLNIKIDGRVRWKVGSW  166

Query  579  EVGPCRLSANCPAFLDF-------GSTSISSSPVQSCHVEV  680
              G  RL  NCPAF+ +          ++    VQ C V+V
Sbjct  167  VSGGYRLHVNCPAFISYPRQLVGGAGPAMKYQLVQRCAVDV  207



>ref|XP_002313488.1| harpin-induced family protein [Populus trichocarpa]
 gb|EEE87443.1| harpin-induced family protein [Populus trichocarpa]
Length=209

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 93/162 (57%), Gaps = 15/162 (9%)
 Frame = +3

Query  240  PRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPA  419
            PRF L+  T++  NL+  N L++N+ V ++   P    GIYY++L +YA Y NQ +TL  
Sbjct  48   PRFILQDTTIYGLNLSDPNFLSSNMQVTISTKNPNDKIGIYYEKLDIYASYHNQQITLAT  107

Query  420  PLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHFWNL  578
             LP +YQG+ DV+VWS FL G++VPV P + +       AG +L NI ++G ++    + 
Sbjct  108  ELPPTYQGHNDVSVWSPFLYGDAVPVSPYLAVSINQDVNAGVLLFNIKINGKLKWKVGSW  167

Query  579  EVGPCRLSANCPAFLDFGS--------TSISSSPVQSCHVEV  680
              G  R+  NCPA++  GS        T I    VQ CHV+V
Sbjct  168  LSGRYRIFVNCPAYITLGSRSNGINVGTGIKYQIVQHCHVDV  209



>gb|ABY88581.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 95/162 (59%), Gaps = 10/162 (6%)
 Frame = +3

Query  186  LFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRG  356
            LF I L + +  A +  ++PRF L+ AT++ FN++    NLLT+N  + L++  P    G
Sbjct  19   LFIIFLTILLIWAILQPSKPRFILQDATVYAFNVSGNPPNLLTSNFQITLSSRNPNNKIG  78

Query  357  IYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA------  518
            IYYDRL VYA YR+Q +T P  +P +YQG+KDV +WS F+ G SVP+ P  G++      
Sbjct  79   IYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDIWSPFVYGTSVPIAPFNGVSLDTDKD  138

Query  519  -GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             G VL+ I  DG +         G   L   CPA+++FG+ +
Sbjct  139  NGVVLLIIRADGRVXWKVGTFITGKYHLHVKCPAYINFGNKA  180



>ref|XP_004140168.1| PREDICTED: uncharacterized protein LOC101220278 [Cucumis sativus]
 ref|XP_004172132.1| PREDICTED: uncharacterized LOC101220278 [Cucumis sativus]
 gb|KGN48047.1| hypothetical protein Csa_6G425840 [Cucumis sativus]
Length=212

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 95/165 (58%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG-NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVT  410
            ++P F L+  T+   N +   NLL+ ++ V +++  P    GIYY  + VY  YR Q VT
Sbjct  48   SKPHFILQDVTVFGLNASVTPNLLSLDLQVTISSRNPNDRIGIYYLTMDVYGAYRGQQVT  107

Query  411  LPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHF  569
            LP  LP++YQG++DV VWS FLSG++VPV P V M+       G VL N+ +DG ++   
Sbjct  108  LPTLLPSTYQGHRDVVVWSPFLSGDAVPVAPDVAMSLQQDRNVGAVLFNVKIDGQVKWKV  167

Query  570  WNLEVGPCRLSANCPAFLDFGS--------TSISSSPVQSCHVEV  680
                 G   L+ NCPAF+ FG+        +++    VQSC+VEV
Sbjct  168  GTWISGRYHLNVNCPAFIKFGNPDRAIAIGSAMKFQIVQSCNVEV  212



>ref|XP_006400726.1| hypothetical protein EUTSA_v10015904mg [Eutrema salsugineum]
 gb|ESQ42179.1| hypothetical protein EUTSA_v10015904mg [Eutrema salsugineum]
Length=208

 Score =   117 bits (292),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 96/164 (59%), Gaps = 19/164 (12%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF L+  T+++FN++  NLLT+N+ V L++  P    GI+YD L +YA YRNQ VT+ 
Sbjct  48   RPRFVLQDVTIYDFNISQPNLLTSNLQVTLSSRNPNDKIGIFYDHLDIYASYRNQEVTVA  107

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWN  575
              LPA+YQG+ DV VWS  L G +VPVE  +        +AG VL+NI VDG ++   W 
Sbjct  108  NLLPATYQGHLDVTVWSPVLIGTAVPVEAYLSQALREDLIAGMVLLNIKVDGCVK---WK  164

Query  576  LE--VGPC-RLSANCPAFLDF------GSTSISSSPVQSCHVEV  680
            +   V  C RL  NCPA++ F         +I     Q C V+V
Sbjct  165  VGSWVSECYRLLVNCPAYITFSGHFSGAGLAIKYQVAQGCAVDV  208



>ref|NP_001146876.1| VAMP protein SEC22 [Zea mays]
 gb|ABB36603.1| hairpin-induced 1-like protein NHL18A [Brassica napus]
 gb|ACG24117.1| VAMP protein SEC22 [Zea mays]
 emb|CDY72430.1| BnaAnng41110D [Brassica napus]
Length=208

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 91/170 (54%), Gaps = 10/170 (6%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  V+      L  I L   +   +  T+PRF L+ AT+  FNL+  NLLTTN  +  A+
Sbjct  20   CAAVIAFIIIVLITIFLVWVI---LRPTKPRFILQEATVFAFNLSQPNLLTTNFQITFAS  76

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG  512
              P    GIYYDRLHVYA YRNQ +TL   +P +YQG+K+  VWS F+ G +VP+ P   
Sbjct  77   RNPNSKIGIYYDRLHVYATYRNQQITLRTAIPPTYQGHKEDNVWSPFVYGTAVPIAPYNS  136

Query  513  MA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
            +A       G V + I  DG +R     L  G   +   CPA ++ G+ +
Sbjct  137  VALGDEQGHGLVQLMIRADGRVRWKVGTLITGKYHIHVRCPALINLGNKA  186



>ref|XP_010493295.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=207

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 93/161 (58%), Gaps = 14/161 (9%)
 Frame = +3

Query  240  PRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPA  419
            PRF L+  T+++FN++  N LT+N+ V +++  P    GI+YDRL +YA YRNQ VT+  
Sbjct  47   PRFVLQDVTINDFNVSQPNYLTSNLQVTVSSRNPNDKIGIFYDRLDIYASYRNQEVTIAR  106

Query  420  PLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNL  578
             LP +YQG+ +V VWS  L G +V V P +        MAG VL+NI +DGW+R    + 
Sbjct  107  LLPTTYQGHLEVTVWSPVLIGTAVSVAPYLSPALDEDFMAGLVLLNIKIDGWVRWKVGSW  166

Query  579  EVGPCRLSANCPAFLDFGST-------SISSSPVQSCHVEV  680
              G  RL  NCPA+++           ++    VQ C V+V
Sbjct  167  VSGSYRLHVNCPAYINVPRQLVVGVGPAMKYQLVQRCAVDV  207



>ref|XP_006381955.1| hypothetical protein POPTR_0006s22060g [Populus trichocarpa]
 gb|ERP59752.1| hypothetical protein POPTR_0006s22060g [Populus trichocarpa]
Length=210

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 91/165 (55%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            ++P+F L+ AT++ FN++  N +T+N  V +++  P    GIYYDRL +YA YRNQ +TL
Sbjct  46   SKPKFILQDATVYAFNVSYPNFITSNFQVTVSSRNPDDRVGIYYDRLDIYATYRNQQITL  105

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEP-------GVGMAGRVLVNIIVDGWIRKHFW  572
               +P SYQG+K++ VWS F+ GNSVPV P           AG V++ I +DG +R    
Sbjct  106  RTSIPTSYQGHKEINVWSPFIYGNSVPVSPYNSAALSQDQGAGVVMLMIKIDGRVRFKVG  165

Query  573  NLEVGPCRLSANCPAFLDFGSTS---------ISSSPVQSCHVEV  680
                    L   CPA++ FGS +         +      SCHV +
Sbjct  166  TFISAKYNLHVRCPAYIQFGSRTNGIMVGDNVVKYQLATSCHVSL  210



>ref|XP_011077802.1| PREDICTED: protein YLS9 [Sesamum indicum]
Length=209

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 106/197 (54%), Gaps = 17/197 (9%)
 Frame = +3

Query  138  KKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNIS  317
            +K    CC  LL FS +F + + +  S  +   +PRF L+ AT+ N N++A N+++T + 
Sbjct  14   RKIARRCCAGLLIFSFIFLVIILLIWSI-LQPRKPRFTLQDATIFNLNVSAPNVISTTVQ  72

Query  318  VALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPV  497
            V + +  P    GIYYDR++VYA Y NQ +T    +P  YQG+KDV VWS F+ GN+VPV
Sbjct  73   VTVNSRNPNSKIGIYYDRMNVYATYHNQQITYYTVIPPVYQGHKDVNVWSPFIYGNNVPV  132

Query  498  EPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGST------  638
             P  G+A       G + + I ++G +R    +   G   L   CPA++  G++      
Sbjct  133  APYNGVALGQDKSNGAISLTIKINGRVRWKVGSFISGRYHLHITCPAYIPLGNSKNTGIV  192

Query  639  ---SISSSPVQSCHVEV  680
               ++     QSC V V
Sbjct  193  IGNAVKYQLSQSCSVNV  209



>ref|XP_010556416.1| PREDICTED: protein YLS9-like [Tarenaya hassleriana]
Length=208

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 102/201 (51%), Gaps = 19/201 (9%)
 Frame = +3

Query  126  DDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLT  305
            D+  K    C  ++ L     F + L  A+   +  T+PRF L+  T+  FN+++ NLLT
Sbjct  11   DNEAKLRRICGGIVFLVVILGFTVLLVWAI---LRPTKPRFILQDVTVFAFNVSSPNLLT  67

Query  306  TNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGN  485
            TN  +  AA  P    GIYYDRLHVYA YRNQ +TL   +P +YQG+K+  VWS F+ G 
Sbjct  68   TNFQITAAARNPNSKIGIYYDRLHVYATYRNQQITLRTAIPPTYQGHKEDDVWSPFVYGT  127

Query  486  SVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDF-----  629
            SVP+ P   +A       G V++ +  DG +R        G   +   CPA+++      
Sbjct  128  SVPIAPYNAVALSDEQSRGFVMLTVRADGRVRWKVGTFITGRYHIHVRCPAYINLWNKAA  187

Query  630  ----GSTSISSSPVQSCHVEV  680
                G  ++  + V  C V V
Sbjct  188  GTAVGDNAVKYTLVTKCSVNV  208



>ref|XP_010486834.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=211

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 89/145 (61%), Gaps = 9/145 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            ++PRF L+ AT++ FN++    NLLT+N  + L++  P    GIYYDRL VYA YR+Q +
Sbjct  45   SKPRFLLQDATVYAFNVSGNPPNLLTSNFQITLSSRNPNDKIGIYYDRLDVYATYRSQQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMA-----GRVLVNIIVDGWIRKH  566
            T    +P++YQG+K++ +WS F+ G SVPV P  G+G+      G V++ I  DG +R  
Sbjct  105  TFRTSIPSTYQGHKEINIWSPFVYGTSVPVAPFNGLGLDQDQDNGSVMLIIRADGRVRWK  164

Query  567  FWNLEVGPCRLSANCPAFLDFGSTS  641
                  G   L   CPA++DFG+ +
Sbjct  165  VGTFITGKYHLYVKCPAYIDFGNKA  189



>ref|XP_007027946.1| NDR1/HIN1-like 1 [Theobroma cacao]
 gb|EOY08448.1| NDR1/HIN1-like 1 [Theobroma cacao]
Length=209

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 82/143 (57%), Gaps = 7/143 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            ++P+F L+  T+  FN +  N LT+N  V +++  P    GIYYDRL +YA YRNQ +TL
Sbjct  45   SKPKFILQDTTVFAFNASTPNFLTSNFQVTVSSRNPNDKIGIYYDRLDIYATYRNQQITL  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHFW  572
               +P +YQG+K+V VWS F+ GN VP+ P   M       AG V + I +DG +R    
Sbjct  105  RTAIPPTYQGHKEVNVWSPFIFGNMVPIAPDFFMALNSEQAAGSVFLMIKIDGRVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDFGSTS  641
                G   L   CPA++ FGS S
Sbjct  165  TFVSGRYHLYVRCPAYITFGSKS  187



>ref|XP_002876147.1| hypothetical protein ARALYDRAFT_485614 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52406.1| hypothetical protein ARALYDRAFT_485614 [Arabidopsis lyrata subsp. 
lyrata]
Length=208

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 87/143 (61%), Gaps = 7/143 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT+  FNL+  NLLT+N  + +A+  P    GIYYDRLHVYA YRNQ +TL
Sbjct  44   TKPRFVLQDATVFAFNLSQPNLLTSNFQITIASRNPNSKIGIYYDRLHVYATYRNQQITL  103

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-----GRVLVNIIV--DGWIRKHFW  572
               +P +YQG+K+  VWS F+ G +VP+ P   +A     GR  V +++  DG +R    
Sbjct  104  RTAIPPTYQGHKEDNVWSPFVYGTAVPIAPYNSVALGDEQGRGFVGLMIRADGRVRWKVG  163

Query  573  NLEVGPCRLSANCPAFLDFGSTS  641
             L  G   +   CPA+++ G+ +
Sbjct  164  TLITGKYHIHVRCPAYINLGNKA  186



>ref|XP_010464906.1| PREDICTED: uncharacterized protein LOC104745392 [Camelina sativa]
Length=211

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 95/167 (57%), Gaps = 18/167 (11%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            ++PRF L+ AT++ FN++    NLLT+N+ + L++       GIYYDRL VYA YRNQ +
Sbjct  45   SKPRFLLQDATVYAFNVSGNPPNLLTSNLQITLSSRNTNDKIGIYYDRLDVYATYRNQQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMA-----GRVLVNIIVDGWIRKH  566
            T    +P++YQG+K+V +WS F+ G SVPV P  G+G+      G V++ I  DG +R  
Sbjct  105  TFRTSIPSTYQGHKEVNIWSPFVYGTSVPVAPFNGLGLDQDQDNGSVMLIIRADGRVRWK  164

Query  567  FWNLEVGPCRLSANCPAFLDF---------GSTSISSSPVQSCHVEV  680
                  G   L   CPA++DF         G+ ++  +   SC V V
Sbjct  165  VGTFITGKYHLYVKCPAYIDFNNKAAGVIVGNNAVKYTFTSSCSVSV  211



>ref|XP_006294991.1| hypothetical protein CARUB_v10024063mg [Capsella rubella]
 gb|EOA27889.1| hypothetical protein CARUB_v10024063mg [Capsella rubella]
Length=209

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 84/143 (59%), Gaps = 7/143 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT++ FNL+  NLL++N  V LA+  P    GIYYDRLHVYA YRNQ +TL
Sbjct  44   TKPRFILQDATVYAFNLSQPNLLSSNFQVTLASRNPNSKIGIYYDRLHVYATYRNQQITL  103

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
               +P +YQG+K+  VWS F+ G++V V P   MA       G V + I  DG +R    
Sbjct  104  RTAIPPTYQGHKEGNVWSPFIYGDAVSVAPFNAMALDDEQNGGLVSLIIRADGRVRWKVG  163

Query  573  NLEVGPCRLSANCPAFLDFGSTS  641
             L  G   L   CPA+++    +
Sbjct  164  TLITGKYHLHVRCPAYINLNDKA  186



>ref|XP_004303497.1| PREDICTED: uncharacterized protein LOC101309947 [Fragaria vesca 
subsp. vesca]
Length=210

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 105/205 (51%), Gaps = 17/205 (8%)
 Frame = +3

Query  114  GEMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAG  293
            G+   +  +K    CC  LL F+    +   + + A +  ++PRF L+  T+ NFN T  
Sbjct  7    GQHGHNKRRKRIRHCCAGLLIFN-FILLITILIIWAILQPSKPRFILQDVTVFNFNNTVP  65

Query  294  NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAF  473
            N+ +++  V +++  P    GIYYDRL VYAVYR+Q +T    +P +YQG+KDV +WS F
Sbjct  66   NVFSSSFQVTISSRNPNDKLGIYYDRLDVYAVYRSQQITFSTLIPPTYQGHKDVNIWSPF  125

Query  474  LSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG  632
            + G +VP+ P   +A       G VL+ I +DG +R        G   L   CPAF+  G
Sbjct  126  VYGTNVPIAPYNSLALAQDQASGSVLLLIKIDGRVRWKIGTFITGKYHLYVRCPAFITLG  185

Query  633  STS---------ISSSPVQSCHVEV  680
            + +         +    VQ C V +
Sbjct  186  AKTTGIVVGENAVKYQLVQRCKVSI  210



>gb|KFK26335.1| hypothetical protein AALP_AA8G234500 [Arabis alpina]
Length=205

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 90/160 (56%), Gaps = 13/160 (8%)
 Frame = +3

Query  240  PRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPA  419
            PRF L+  T+ +FN +   LLT+ + V L++  P    GI+YD L +YA YRNQ VT   
Sbjct  46   PRFVLQDVTISDFNFSQPYLLTSKLQVTLSSRNPNDKIGIFYDHLDIYASYRNQEVTSAI  105

Query  420  PLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHFWNL  578
             LP +YQG+ D+ VWS  LSG +VPV P + +       AG VL+NI +DGW+R    + 
Sbjct  106  ILPVTYQGHLDMTVWSPVLSGCAVPVSPYLSLALNQDLIAGMVLLNIKIDGWVRWKVGSW  165

Query  579  EVGPCRLSANCPAFLDFG------STSISSSPVQSCHVEV  680
              G   L  NCPA+L          T+I +  V+ C V+V
Sbjct  166  VSGSYHLHVNCPAYLSCSGQFSGTGTAIKNQLVEQCAVDV  205



>emb|CAN79940.1| hypothetical protein VITISV_027779 [Vitis vinifera]
Length=208

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 107/204 (52%), Gaps = 21/204 (10%)
 Frame = +3

Query  117  EMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLT-AG  293
            E +  L ++ F  C VL   F  LF I L   +   +  ++P F L+  T+   N + A 
Sbjct  10   EERRKLKRRIF--CSVLAFIFLVLFVIFLIYVI---LRPSKPHFVLQDVTVLALNTSSAP  64

Query  294  NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAF  473
              LTTNI V + +  P    G+YY+ L ++A YR+Q +TLPA LP +YQG+KDV VWS F
Sbjct  65   GFLTTNIQVTVFSRNPNGRIGVYYENLDIFATYRSQQITLPALLPTTYQGHKDVIVWSPF  124

Query  474  LSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG  632
            L GNSVP+ P +        M G VL+N+ +DG ++        G   +  NCPA++ F 
Sbjct  125  LYGNSVPLAPYLCDMLNQDLMTGMVLLNVKIDGRVKWKVGTWISGSYHIHVNCPAYISFC  184

Query  633  ST--------SISSSPVQSCHVEV  680
                      ++    V+SC V+V
Sbjct  185  ERKDCIGFGPTVKYQLVKSCTVDV  208



>gb|ABB36604.1| hairpin-induced 1-like protein NHL18B [Brassica napus]
Length=208

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 91/170 (54%), Gaps = 10/170 (6%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  V+      L  I L   +   +  T+PRF L+ AT+  FNL+  NLLT+N  +  A+
Sbjct  20   CAAVIAFIIIVLITIFLVWVI---LRPTKPRFILQDATVFAFNLSQPNLLTSNFQITFAS  76

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG  512
              P    GIYYDRLHVYA YRNQ +TL   +P +YQG+K+  VWS F+ G +VP+ P   
Sbjct  77   RNPNSKIGIYYDRLHVYATYRNQQITLRTAIPPTYQGHKEDNVWSPFVYGTAVPIAPYNS  136

Query  513  MA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
            +A       G V + I  DG +R     L  G   +   CPA ++ G+ +
Sbjct  137  VALGDEQGHGLVQLMIRADGRVRWKVGTLITGKYHIHVRCPALINLGNKA  186



>ref|XP_010497727.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=211

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 96/167 (57%), Gaps = 18/167 (11%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            ++PRF L+ AT++ FN++    NLLT+NI + L++  P    GIYYDRL VYA YR+Q +
Sbjct  45   SKPRFLLQDATVYAFNVSGNPPNLLTSNIQITLSSRNPNDKIGIYYDRLDVYATYRSQQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMA-----GRVLVNIIVDGWIRKH  566
            T    +P++YQG+K++ +WS F+ G SVPV P  G+G+      G V++ I  DG +R  
Sbjct  105  TFRTSIPSTYQGHKEINIWSPFVYGTSVPVAPFNGLGLDQDQDNGSVMLIIRADGRVRWK  164

Query  567  FWNLEVGPCRLSANCPAFLDF---------GSTSISSSPVQSCHVEV  680
                  G   L   CPA+++F         G+ ++  +   SC V V
Sbjct  165  VGTFITGKYHLYVKCPAYINFNNKAAGVIVGNNAVKYTFTSSCSVSV  211



>ref|XP_002884856.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61115.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=202

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 100/173 (58%), Gaps = 12/173 (7%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVA  323
               V  +FF  LF I L + +  A +  ++PRF L+ AT++ FN++    NL+T+N  + 
Sbjct  10   AISVRRIFF--LFIIFLTILLIWAILQPSKPRFLLQDATVYAFNVSGNPPNLITSNFQIT  67

Query  324  LAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP  503
            L++  P    G+YYDRL VYA YR+Q +T    +P +YQG+K+V +WS F+ G SVP+ P
Sbjct  68   LSSRNPNDKIGVYYDRLDVYATYRSQQITFRTSIPPTYQGHKEVNIWSPFVYGTSVPIAP  127

Query  504  --GVGMA-----GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
              GVG+      G +++ I  DG +R        G   L   CPA+++FG+ +
Sbjct  128  FNGVGLDDDKDNGAIMLIIRADGRVRWKVGTFITGKYHLYVKCPAYINFGNKA  180



>ref|XP_008243456.1| PREDICTED: protein YLS9-like [Prunus mume]
Length=210

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 105/205 (51%), Gaps = 17/205 (8%)
 Frame = +3

Query  114  GEMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAG  293
            G+ + +  +K F  CC  LL F+ +  +++ +   A +  ++PRF L+  T+ NFN +  
Sbjct  7    GQHRHNKWRKRFRRCCAGLLIFNFILLVTILIVW-AILQPSKPRFILQDVTVFNFNNSVP  65

Query  294  NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAF  473
            N+ +++  V +++  P    GIYYD+L++YA YRNQ +T    +P  YQG+KDV VWS F
Sbjct  66   NVFSSSFQVTVSSRNPNDKIGIYYDKLNIYATYRNQQITFITLIPPVYQGHKDVNVWSPF  125

Query  474  LSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDF-  629
            + G  VP+ P   +       AG V + + +DG +R        G       CPAF+   
Sbjct  126  IYGTEVPIAPYNSLALDQDKNAGSVFLLLKMDGRVRWKVGTFISGRYHFYVRCPAFIPLG  185

Query  630  --------GSTSISSSPVQSCHVEV  680
                    G+ +I    +Q C V V
Sbjct  186  PKNNGVVVGNNAIKYQLLQHCKVSV  210



>emb|CDX95339.1| BnaC04g28190D [Brassica napus]
Length=298

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 91/170 (54%), Gaps = 10/170 (6%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  V+      L  I L   +   +  T+PRF L+ AT+  FNL+  NLLTTN  +  A+
Sbjct  20   CAAVIAFIIIVLITIFLVWVI---LRPTKPRFILQDATVFAFNLSQPNLLTTNFQITFAS  76

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG  512
              P    GIYYDRLHVYA YRNQ +TL   +P +YQG+K+  VWS F+ G +VP+ P   
Sbjct  77   RNPNSKIGIYYDRLHVYATYRNQQITLRTAIPPTYQGHKEDNVWSPFVYGTAVPIAPYNS  136

Query  513  MA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
            +A       G V + I  DG +R     L  G   +   CPA ++ G+ +
Sbjct  137  VALGDEQGHGLVQLMIRADGRVRWKVGTLITGKYHIHVRCPALINLGNKA  186



>gb|EYU28513.1| hypothetical protein MIMGU_mgv1a013735mg [Erythranthe guttata]
Length=211

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 93/166 (56%), Gaps = 17/166 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNI-SVALAAHIPYRHRGIYYDRLHVYAVYRNQTVT  410
            T+P F L+ AT++ FNL++     T    + +++  P    GIYYD++ VYA Y  Q +T
Sbjct  46   TKPHFILQDATVYAFNLSSAATTLTTTLQITISSRNPNDRIGIYYDKIDVYAAYHGQQIT  105

Query  411  LPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHF  569
            LP  LPA+YQG+KDV VWS FL GN+VPV P  G       +AG VLVNI +DG +R   
Sbjct  106  LPTLLPANYQGHKDVTVWSPFLYGNAVPVAPYTGVSLTQDQIAGTVLVNIKIDGRVRWKV  165

Query  570  WNLEVGPCRLSANCPAFLDFGSTS---------ISSSPVQSCHVEV  680
                 G   L  NCPA++++G  +         I    +  CHV+V
Sbjct  166  GTFISGKYHLYVNCPAYINYGGRNNGVAVGPAVIKYQLILDCHVDV  211



>ref|XP_011046866.1| PREDICTED: protein YLS9-like [Populus euphratica]
Length=208

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 98/181 (54%), Gaps = 16/181 (9%)
 Frame = +3

Query  186  LFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYY  365
            L  ++  +++ A +  ++P+F L+ AT++ FN++  N +T+N  V +++  P    GIYY
Sbjct  28   LIVLTGSLSVWAILRPSKPKFILQDATVYAFNVSYPNYITSNFQVTVSSRNPDDRVGIYY  87

Query  366  DRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP-------GVGMAGR  524
            DRL +YA YR+Q +TL    P SYQG+K++ VWS F+ GNSVPV P           AG 
Sbjct  88   DRLDIYATYRDQQITLQTSTPTSYQGHKEITVWSPFICGNSVPVSPYNSAALSQDQGAGL  147

Query  525  VLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS---------ISSSPVQSCHVE  677
            V++ I +DG +R            L   CPA++ FGS +         +      SCHV 
Sbjct  148  VMLMIKIDGRVRFKVGTFISAKYNLHVRCPAYIQFGSRTNGIMVGDNVVKYQLATSCHVS  207

Query  678  V  680
            +
Sbjct  208  L  208



>ref|XP_008462618.1| PREDICTED: protein YLS9-like [Cucumis melo]
Length=208

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 88/141 (62%), Gaps = 7/141 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P+F ++ AT++ FN+TA N ++++I V +++  P    G+YYDRL VYAVYRNQ +TL
Sbjct  44   TKPKFVIQDATVYLFNITAANFISSSIQVTVSSRNPNDKIGVYYDRLDVYAVYRNQQITL  103

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
               +  +YQG+ D+ +WS FL GNSVP+ P  G A       G V ++I +DG +R    
Sbjct  104  RTGIQPTYQGHNDLNIWSPFLVGNSVPISPYNGAALNQDQAVGTVQLSIKLDGRVRFKVG  163

Query  573  NLEVGPCRLSANCPAFLDFGS  635
                G   L+ +CPA + FG+
Sbjct  164  TFISGRYHLNVDCPAAIMFGN  184



>ref|XP_002873250.1| hypothetical protein ARALYDRAFT_908558 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49509.1| hypothetical protein ARALYDRAFT_908558 [Arabidopsis lyrata subsp. 
lyrata]
Length=215

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 89/145 (61%), Gaps = 9/145 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            ++PRF L+ AT+ NFN++    NLLT+N  + L++  P    GIYYDRL VYA YR+Q +
Sbjct  49   SKPRFILQDATVFNFNVSGNPPNLLTSNFQMTLSSRNPNDKIGIYYDRLDVYASYRSQQI  108

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKH  566
            T P  +P +YQG+K+V VWS F+ G SVPV P   +        G +++ + +DG +R  
Sbjct  109  TFPTSMPTTYQGHKEVNVWSPFVGGYSVPVAPYNALYLDQDHTRGTIMLVLHLDGRVRWK  168

Query  567  FWNLEVGPCRLSANCPAFLDFGSTS  641
              +   G   L   CPAF++FG+++
Sbjct  169  VGSFITGKYHLHVRCPAFINFGNSA  193



>ref|NP_181140.1| NDR1/HIN1-like 12 protein [Arabidopsis thaliana]
 gb|AAD21461.1| putative harpin-induced protein [Arabidopsis thaliana]
 gb|AAM63109.1| putative harpin-induced protein [Arabidopsis thaliana]
 dbj|BAD43642.1| putative harpin-induced protein [Arabidopsis thaliana]
 gb|ABF83671.1| At2g35960 [Arabidopsis thaliana]
 gb|AEC09183.1| NDR1/HIN1-like 12 protein [Arabidopsis thaliana]
Length=210

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 90/165 (55%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT++ FNL+  NLLT+N  + +A+       GIYYDRLHVYA YRNQ +TL
Sbjct  46   TKPRFILQDATVYAFNLSQPNLLTSNFQITIASRNRNSRIGIYYDRLHVYATYRNQQITL  105

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-----GRVLVNIIV--DGWIRKHFW  572
               +P +YQG+K+  VWS F+ GNSVP+ P   +A      R  V +I+  DG +R    
Sbjct  106  RTAIPPTYQGHKEDNVWSPFVYGNSVPIAPFNAVALGDEQNRGFVTLIIRADGRVRWKVG  165

Query  573  NLEVGPCRLSANCPAFLDF---------GSTSISSSPVQSCHVEV  680
             L  G   L   C AF++          G  ++    +  C V V
Sbjct  166  TLITGKYHLHVRCQAFINLADKAAGVHVGENAVKYMLINKCSVNV  210



>ref|XP_010031556.1| PREDICTED: protein YLS9 [Eucalyptus grandis]
 gb|KCW50898.1| hypothetical protein EUGRSUZ_J00542 [Eucalyptus grandis]
Length=209

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 90/159 (57%), Gaps = 10/159 (6%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAG-NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            +P F LR AT++ FN ++  +LLTTN+ V L++  P    GIYY +L +YA YR Q +TL
Sbjct  46   KPAFVLRDATIYQFNASSMPSLLTTNMQVTLSSRNPNERIGIYYQKLDIYASYRGQQITL  105

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
            P  LP SYQG+K+V  WS FL G++VPV P +  A       G VLVNI VDG ++    
Sbjct  106  PTLLPESYQGHKEVIDWSPFLYGSAVPVSPFLTGALEQDQNTGSVLVNIKVDGNVKWKVG  165

Query  573  NLEVGPCRLSANCPAFLDFG--STSISSSPVQSCHVEVH  683
                G   L  NCPA L F   +  I++ P     +  H
Sbjct  166  TWISGKYHLHVNCPALLVFKEPTGGIAAGPSMKIQITQH  204



>ref|NP_190815.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 emb|CAB43430.1| putative protein [Arabidopsis thaliana]
 gb|AAL87268.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45089.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67015.1| putative harpin-induced protein [Arabidopsis thaliana]
 gb|AEE78949.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
Length=208

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 85/143 (59%), Gaps = 7/143 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT++ FNL+  NLLT+N  V +A+  P    GIYYDRLHVYA Y NQ +TL
Sbjct  44   TKPRFVLQDATVYAFNLSQPNLLTSNFQVTIASRNPNSKIGIYYDRLHVYATYMNQQITL  103

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
               +P +YQG+K+V VWS F+ G +VP+ P   +A       G V + I  DG +R    
Sbjct  104  RTAIPPTYQGHKEVNVWSPFVYGTAVPIAPYNSVALGEEKDRGFVGLMIRADGTVRWKVR  163

Query  573  NLEVGPCRLSANCPAFLDFGSTS  641
             L  G   +   C AF++ G+ +
Sbjct  164  TLITGKYHIHVRCQAFINLGNKA  186



>ref|XP_002270691.1| PREDICTED: protein YLS9 [Vitis vinifera]
 emb|CBI28263.3| unnamed protein product [Vitis vinifera]
Length=208

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 107/204 (52%), Gaps = 21/204 (10%)
 Frame = +3

Query  117  EMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLT-AG  293
            E +  L ++ F  C VL   F  LF I L   +   +  ++P F L+  T+   N + A 
Sbjct  10   EERRKLKRRIF--CSVLAFIFLVLFVIFLIYVI---LRPSKPHFVLQDVTVLALNTSSAP  64

Query  294  NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAF  473
              LTTN+ V + +  P    G+YY+ L ++A YR+Q +TLPA LP +YQG+KDV VWS F
Sbjct  65   GFLTTNVQVTVFSRNPNGRIGVYYENLDIFATYRSQQITLPALLPTTYQGHKDVIVWSPF  124

Query  474  LSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG  632
            L GNSVP+ P +        M G VL+N+ +DG ++        G   +  NCPA++ F 
Sbjct  125  LYGNSVPLAPYLCDMLNQDLMTGMVLLNVKIDGRVKWKVGTWISGSYHIHVNCPAYISFC  184

Query  633  ST--------SISSSPVQSCHVEV  680
                      ++    V+SC V+V
Sbjct  185  ERKDCIGFGPTVKYQLVKSCTVDV  208



>ref|XP_009372581.1| PREDICTED: protein YLS9-like [Pyrus x bretschneideri]
Length=210

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 101/197 (51%), Gaps = 17/197 (9%)
 Frame = +3

Query  138  KKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNIS  317
            KK     C  LL F+ +  +++ +   A +  ++PRF L+  T+ NFN +  N+ +++  
Sbjct  15   KKRIRRGCAGLLIFNFILLVTILIVW-AILQPSKPRFVLQDVTVFNFNTSVPNVFSSSFQ  73

Query  318  VALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPV  497
            V +++  P    GIYYD+L VYA YR+Q +T    +P  YQG+KDV +WS F+ G  VP+
Sbjct  74   VTISSRNPNDKLGIYYDKLDVYATYRSQQITFSTLIPPVYQGHKDVNIWSPFIYGTEVPI  133

Query  498  EP----GVGM---AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS-----  641
             P     +G    AG VL+ I +DG +R        G   L   CPAF+  GS +     
Sbjct  134  APYNSIALGQDQSAGSVLLLIKIDGRVRFKVGTFITGRYHLYVRCPAFIPLGSQTTGIVV  193

Query  642  ----ISSSPVQSCHVEV  680
                +    VQ C V V
Sbjct  194  GNNAVKYQLVQRCSVSV  210



>emb|CDY69198.1| BnaCnng62320D [Brassica napus]
Length=208

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 86/143 (60%), Gaps = 7/143 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT+  FNL+  +LLTTN  +  A+  P    GIYYDRLHVYA YRNQ +TL
Sbjct  44   TKPRFVLQDATVFAFNLSQPHLLTTNFQITFASRNPNSKIGIYYDRLHVYATYRNQQITL  103

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-----GRVLVNIIV--DGWIRKHFW  572
               +P +YQG+K+  +WS F+ G +VP+ P   +A     GR  V +++  DG +R    
Sbjct  104  RTAIPPTYQGHKEDNIWSPFVYGTAVPIAPYNSVALGEEQGRGFVGLMIRADGRVRWKVG  163

Query  573  NLEVGPCRLSANCPAFLDFGSTS  641
             L  G   +   CPA+++ G+ +
Sbjct  164  TLITGKYHIHVRCPAYINLGNKA  186



>emb|CDY68967.1| BnaA09g54700D [Brassica napus]
Length=208

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 86/143 (60%), Gaps = 7/143 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT+  FNL+  +LLTTN  +  A+  P    GIYYDRLHVYA YRNQ +TL
Sbjct  44   TKPRFVLQDATVFAFNLSQPHLLTTNFQITFASRNPNSKIGIYYDRLHVYATYRNQQITL  103

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-----GRVLVNIIV--DGWIRKHFW  572
               +P +YQG+K+  +WS F+ G +VP+ P   +A     GR  V +++  DG +R    
Sbjct  104  RTAIPPTYQGHKEDNIWSPFVYGTAVPIAPYNSVALGEEQGRGFVGLMIRADGRVRWKVG  163

Query  573  NLEVGPCRLSANCPAFLDFGSTS  641
             L  G   +   CPA+++ G+ +
Sbjct  164  TLITGKYHIHVRCPAYINLGNKA  186



>ref|XP_009115947.1| PREDICTED: protein YLS9-like [Brassica rapa]
Length=208

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 86/143 (60%), Gaps = 7/143 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT+  FNL+  +LLTTN  +  A+  P    GIYYDRLHVYA YRNQ +TL
Sbjct  44   TKPRFVLQDATVFAFNLSQPHLLTTNFQITFASRNPNSKIGIYYDRLHVYATYRNQQITL  103

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-----GRVLVNIIV--DGWIRKHFW  572
               +P +YQG+K+  +WS F+ G +VP+ P   +A     GR  V +++  DG +R    
Sbjct  104  RTAIPPTYQGHKEDNIWSPFVYGTAVPIAPYNSVALGEEQGRGFVGLMIRADGRVRWKVG  163

Query  573  NLEVGPCRLSANCPAFLDFGSTS  641
             L  G   +   CPA+++ G+ +
Sbjct  164  TLITGKYHIHVRCPAYINLGNKA  186



>ref|XP_010421009.1| PREDICTED: protein YLS9 [Camelina sativa]
Length=207

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 92/161 (57%), Gaps = 14/161 (9%)
 Frame = +3

Query  240  PRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPA  419
            PRF L+  T+++FN++  N LT+N+ V L++  P    GI+YDRL +YA YRNQ VT+  
Sbjct  47   PRFVLQDVTINDFNVSQPNYLTSNLQVTLSSRNPNDKIGIFYDRLDIYASYRNQEVTIAR  106

Query  420  PLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNL  578
             LP +YQG+ +V VWS  L G +V V P +        MAG VL+NI +DGW+R    + 
Sbjct  107  LLPTTYQGHLEVTVWSPVLIGTAVSVAPYLSPALDEDLMAGLVLLNIKIDGWVRWKVGSW  166

Query  579  EVGPCRLSANCPAFLDFGST-------SISSSPVQSCHVEV  680
                 RL  NCPA+++           ++    VQ C V+V
Sbjct  167  VSCSYRLHVNCPAYINVPRQLVGGVGPAMKYQLVQRCAVDV  207



>ref|XP_010037312.1| PREDICTED: protein YLS9-like [Eucalyptus grandis]
 gb|KCW49002.1| hypothetical protein EUGRSUZ_K02615 [Eucalyptus grandis]
Length=215

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 86/146 (59%), Gaps = 7/146 (5%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF L+  T++ FN +  N LTTNI V +++  P    G+YYD+L +YA+YRNQ +TL 
Sbjct  46   KPRFVLQDVTVYAFNASVPNFLTTNIHVTISSRNPNHRIGVYYDKLDIYAIYRNQQITLR  105

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHFWN  575
            + +P SYQG+K+V VWS F+ G  VPV P   M       AG + + + +DG +R     
Sbjct  106  SSIPPSYQGHKEVDVWSPFIYGTEVPVAPFNSMTLTQEQAAGTIFLMVKIDGRVRWKVGT  165

Query  576  LEVGPCRLSANCPAFLDFGSTSISSS  653
               G   L   CPA++ F  ++ +++
Sbjct  166  FTSGRYHLYVKCPAYIIFPKSTATAA  191



>ref|XP_008379701.1| PREDICTED: protein YLS9-like [Malus domestica]
Length=210

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 101/197 (51%), Gaps = 17/197 (9%)
 Frame = +3

Query  138  KKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNIS  317
            +K    CC  LL F+ +  +++ +   A +  ++PRF L+  T+ NFN +  N+ +++  
Sbjct  15   RKIIRRCCAGLLIFNFILLVTILIVW-AILQPSKPRFVLQDVTVFNFNTSVPNVFSSSFQ  73

Query  318  VALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPV  497
            V +++  P    GIYYD+L VYA YR+Q +T    +P  YQG+KDV +WS F+ G  VP+
Sbjct  74   VTISSRNPNDKLGIYYDKLDVYATYRSQQITFSTLIPPVYQGHKDVNIWSPFIYGTEVPI  133

Query  498  EP----GVGM---AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS-----  641
             P     +G    AG VL+ I +DG +R            L   CPAF+  GS +     
Sbjct  134  APYNSIALGQDQNAGSVLMLIKIDGRVRFKVGTFITSRYHLYVRCPAFIPLGSQTTGVVV  193

Query  642  ----ISSSPVQSCHVEV  680
                +    VQ C V V
Sbjct  194  GNNAVKYQLVQRCSVSV  210



>ref|XP_009139451.1| PREDICTED: protein YLS9-like [Brassica rapa]
Length=208

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 90/170 (53%), Gaps = 10/170 (6%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  V+      L  I L   +   +  T+PRF L+ AT+  FNL+  NLLTTN  +  A+
Sbjct  20   CAAVIAFIIIVLITIFLVWVI---LRPTKPRFILQEATVFAFNLSQPNLLTTNFQITFAS  76

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG  512
              P    GIYYDRLHVYA YRNQ +TL   +P +YQG+K+  VWS F+ G +VP+ P   
Sbjct  77   RNPNSKIGIYYDRLHVYATYRNQQITLRTAIPPTYQGHKEDNVWSPFVYGTAVPIAPYNS  136

Query  513  MA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
            +A       G V + I  DG +R     L      +   CPA ++ G+ +
Sbjct  137  VALGDEQGHGLVQLMIRADGRVRWKVGTLITRKYHIHVRCPALINLGNKA  186



>ref|XP_009593207.1| PREDICTED: protein YLS9-like [Nicotiana tomentosiformis]
Length=211

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 95/169 (56%), Gaps = 10/169 (6%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  +L+  F  L  I L  A+   +   +PRF L+ AT+ NFN++A N+ +T+I V + +
Sbjct  21   CAGILIFLFIVLLTILLIWAI---LQPKKPRFILQDATIFNFNVSAPNIFSTSIQVTIFS  77

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG  512
              P  + G+YY+++HVYA Y NQ +T    +P+ YQG+KDV +WS ++S N+VP+ P  G
Sbjct  78   RNPNDNIGVYYEKMHVYANYHNQQITYYTQIPSVYQGHKDVNIWSPYVSSNNVPIAPYNG  137

Query  513  -------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGST  638
                     G V ++  +DG ++        G   L   CPA++ FG+ 
Sbjct  138  PDLKQDQQNGGVWLDFKIDGRVKWKVGTFTSGHYHLHVRCPAYVPFGNN  186



>ref|XP_009769111.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
Length=211

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 95/168 (57%), Gaps = 10/168 (6%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  +L+  F  L  I L  A+   +   +PRF L+ AT+ NFN++A N+ +T+I V + +
Sbjct  21   CAGILIFLFIVLLTILLIWAI---LQPKKPRFILQDATIFNFNVSAPNIFSTSIQVTIFS  77

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG  512
              P  + G+YY+++HVYA Y NQ +T    +P+ YQG+KDV +WS ++S N+VP+ P  G
Sbjct  78   RNPNDNIGVYYEKMHVYANYHNQQITYYTQIPSVYQGHKDVNIWSPYVSSNNVPIAPYNG  137

Query  513  -------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGS  635
                     G V ++  +DG ++        G   L   CPA++ FG+
Sbjct  138  PDLKQDQQNGGVWLDFKIDGRVKWKVGTFTSGHYHLHVRCPAYVPFGN  185



>ref|XP_006291851.1| hypothetical protein CARUB_v10018026mg [Capsella rubella]
 gb|EOA24749.1| hypothetical protein CARUB_v10018026mg [Capsella rubella]
Length=208

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 92/170 (54%), Gaps = 10/170 (6%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  V+      L  I L   +   +  T+PRF L+ AT++ FNL+  NLLT+N  V LA+
Sbjct  20   CAAVIAFILIVLITIFLVWVI---LRPTKPRFVLQDATVYAFNLSQPNLLTSNFQVTLAS  76

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG  512
              P    GIYYDRLHVYA YRNQ +TL   +P +YQG+KD  +WS F+ G +VP+ P   
Sbjct  77   RNPNSKIGIYYDRLHVYATYRNQQITLRTAIPPTYQGHKDDNIWSPFIYGTAVPIAPYNS  136

Query  513  MA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
            +A       G V + I  DG +R     L  G   +   C A ++ G+ +
Sbjct  137  VALGNEQGSGFVPLVIRADGRVRWKVGTLITGKYHIHVRCQAPINLGNKA  186



>ref|XP_010516804.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=209

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 92/165 (56%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+  T++ FNL+  NLLT+N  + +++  P    GIYYDRLHVY  YR+Q +TL
Sbjct  45   TKPRFILQDTTVYAFNLSQPNLLTSNFQITISSRNPNSRIGIYYDRLHVYVTYRSQQITL  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-----GRVLVNIIV--DGWIRKHFW  572
               +P +YQG+K+  VWS F+ GN+VP+ P   +A      R LV++I+  DG +R    
Sbjct  105  RTAIPPTYQGHKEDNVWSPFVYGNAVPIAPFNALALGDEENRGLVSLIIRADGRVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDF---------GSTSISSSPVQSCHVEV  680
             L  G   L   C A+++          G T++  +    C V V
Sbjct  165  TLITGKYHLHVRCQAYMNLADKAAGIHVGETAVKYTMASRCSVNV  209



>gb|KFK34493.1| hypothetical protein AALP_AA5G152700 [Arabis alpina]
Length=210

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 89/170 (52%), Gaps = 10/170 (6%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  ++      L  I L   +   +  T+P+F L+ AT+  FNLT  NLLT+N  V +A 
Sbjct  20   CAAIIAFILIVLITIFLVWVI---LRPTKPKFILQDATVFAFNLTQPNLLTSNFQVTIAT  76

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG  512
              P    GIYYDRLHVYA YRNQ +TL   +P +YQG+K+  VWS F+ G +VPV P   
Sbjct  77   RNPNSKIGIYYDRLHVYATYRNQQITLRTAIPPTYQGHKEDNVWSPFIYGTAVPVAPYNA  136

Query  513  MA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
            +A       G V + I  DG +R     L  G   +   C A +  G+ +
Sbjct  137  VALGNEQGGGYVTLMIRADGRVRWKVGTLITGKYHIHVRCMALIKLGNKA  186



>ref|XP_002879584.1| hypothetical protein ARALYDRAFT_482567 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55843.1| hypothetical protein ARALYDRAFT_482567 [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 90/165 (55%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT++ FNL+  NLLT+N  + +A+       GIYYDRLHVYA YRNQ +TL
Sbjct  45   TKPRFILQDATVYAFNLSQPNLLTSNFQITIASRNRNSRIGIYYDRLHVYATYRNQQITL  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-----GRVLVNIIV--DGWIRKHFW  572
               +P +YQG+K+  VWS F+ GNSVP+ P   +A      R  V +I+  DG +R    
Sbjct  105  RTAIPPTYQGHKEDNVWSPFVYGNSVPIAPFNAVALGDEQNRGFVTLIIRADGRVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDF---------GSTSISSSPVQSCHVEV  680
             L  G   L   C A+++          G  ++    V  C V V
Sbjct  165  TLITGKYHLHVRCLAYINLADKAAGVHVGENAVKYMLVNKCSVNV  209



>ref|XP_008463636.1| PREDICTED: protein YLS9-like [Cucumis melo]
Length=213

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 102/188 (54%), Gaps = 18/188 (10%)
 Frame = +3

Query  171  LFFSTLFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTA--GNLLTTNISVALAAHIP  341
            + FS L  I L + +  A +  ++PR  L+  TL   N+++     ++T + + +++H P
Sbjct  26   VIFSLLLLIGLVIFLIWAILRPSKPRLILQDVTLLGLNVSSVPPAAISTTMQITISSHNP  85

Query  342  YRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-  518
                G+YY  + VYA YR Q VTLP  LP +YQG+ DV VWS FL G +VPV P    A 
Sbjct  86   NTRIGVYYQVMDVYAAYRGQQVTLPTLLPPTYQGHNDVTVWSPFLYGEAVPVAPEFAEAL  145

Query  519  ------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG--STSISSSP------  656
                  G +L NI V+G +R    +   G  RL+ANCPA++ FG     I+  P      
Sbjct  146  NEDNNVGAMLFNIKVNGQVRWKVGSWISGRYRLNANCPAYIKFGDPKNGIAFGPTMKFQF  205

Query  657  VQSCHVEV  680
            VQ C+V++
Sbjct  206  VQGCYVDI  213



>gb|EPS70325.1| harpin-induced family protein, partial [Genlisea aurea]
Length=204

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 81/144 (56%), Gaps = 7/144 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P+F L+   +  FNLTAGN LT  +   ++A  P    GIYYDRL +   Y +Q +T 
Sbjct  42   TKPQFVLQDLAVRAFNLTAGNFLTAAVQATVSARNPNGRLGIYYDRLDISLAYHSQQITP  101

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFW  572
               L   YQG+KD+ VWS  L G++VPV P +        +AG V +NI +DG IR    
Sbjct  102  GTQLSGGYQGHKDITVWSPLLYGSAVPVAPYLAAGLSQDLIAGAVAINIKLDGRIRWKLG  161

Query  573  NLEVGPCRLSANCPAFLDFGSTSI  644
                G   L  NCPA++DFG+ +I
Sbjct  162  TFITGKYHLYVNCPAYVDFGTKNI  185



>ref|XP_010509529.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=209

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 92/165 (56%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT++ FNL+  NLLT+N  + +++  P    G+YYDRLHVY  YR+Q +TL
Sbjct  45   TKPRFILQDATVYAFNLSQPNLLTSNFQITISSRNPNSKIGVYYDRLHVYVTYRSQQITL  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-----GRVLVNIIV--DGWIRKHFW  572
               +P +YQG+K+  VWS F+ GN+VP+ P   +A      R LV++I+  DG +R    
Sbjct  105  RTAIPPTYQGHKEDNVWSPFVYGNAVPIAPFNALALGDEENRGLVSLIIRADGRVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDF---------GSTSISSSPVQSCHVEV  680
             L  G   L   C A+++          G  ++  +    C V V
Sbjct  165  TLITGKYHLHVRCQAYMNLADKAAGIHVGENAVKYTMASRCSVNV  209



>emb|CDY08506.1| BnaA05g27420D [Brassica napus]
Length=212

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 92/168 (55%), Gaps = 19/168 (11%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            T+PRF L+ AT++ FN++    NLLT+N  V L++  P    G+YYDRL VYA Y+NQ +
Sbjct  45   TKPRFILQDATVYAFNVSGNPPNLLTSNFQVTLSSRNPNDKIGVYYDRLEVYAAYQNQQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKH  566
            T    +P +YQG+K+V +WS F+ GNSVP+ P  G++       G + ++I  DG +R  
Sbjct  105  TYRTSIPPTYQGHKEVNIWSPFVYGNSVPIAPFNGVSLDGDQENGVIRLDIRADGRVRWK  164

Query  567  FWNLEVGPCRLSANCPAFLDF----------GSTSISSSPVQSCHVEV  680
                  G   L   C AF++F          G  ++  +  Q C V V
Sbjct  165  VGAFITGKYHLYVRCQAFINFANKAAAGVIVGDNAVKYTYAQGCSVSV  212



>ref|XP_010512764.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=213

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 108/203 (53%), Gaps = 21/203 (10%)
 Frame = +3

Query  123  KDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAG--N  296
            +  LP   F    +LL+FF  L  I L   +   +  ++P F L+ AT+ NFN++    N
Sbjct  12   RKILPIIKFLFVTLLLIFFGILTAIFLVWVI---LQPSKPCFILQDATVFNFNVSRNPVN  68

Query  297  LLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFL  476
            LL +  ++ L++  P    GIYYDRL+VYA Y +Q +TL   +P +YQG+K+V VWS+ +
Sbjct  69   LLNSTFNITLSSQNPNDKIGIYYDRLNVYASYMSQQITLRTSIPPTYQGHKEVNVWSSIV  128

Query  477  SGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLD---  626
            +GN +PV P + +        G +++ + +DG IR  F  L  G   L A CPA++    
Sbjct  129  AGNFIPVAPDIALHLDQDQTTGAIMLMLHLDGQIRWKFGTLITGKYHLRAMCPAYIKVWK  188

Query  627  ------FGSTSISSSPVQSCHVE  677
                   G  ++    +++C  E
Sbjct  189  SAAGVIVGKNAVEYRLIRTCMYE  211



>emb|CDY35671.1| BnaC02g09370D [Brassica napus]
Length=209

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 97/183 (53%), Gaps = 20/183 (11%)
 Frame = +3

Query  192  CISLCVAMSAQISLT-------QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRH  350
            CI L + ++  + L        +  F L+  T++ FN++  NLLT+N+ V +++H P   
Sbjct  27   CIGLVITVAVVVFLVWAILHPHKMDFVLQDVTIYEFNISQPNLLTSNLQVTVSSHNPNDK  86

Query  351  RGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG------  512
             GI YDRL +YA YRNQ VTL   +P +YQG+ +V VWS  L+G +V VEP +       
Sbjct  87   IGILYDRLDIYASYRNQQVTLAHLMPETYQGHLEVTVWSPVLTGTAVSVEPYLTPALNED  146

Query  513  -MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTSISSSP------VQSCH  671
              AG VL+NI +DG ++        G  RL  NCPA + F      + P       Q C 
Sbjct  147  INAGMVLLNIKIDGCVKFKVGTWVSGCYRLLVNCPASIPFSGQFAGTGPAIKDQLAQQCA  206

Query  672  VEV  680
            V+V
Sbjct  207  VDV  209



>gb|KFK36489.1| hypothetical protein AALP_AA4G131300 [Arabis alpina]
Length=210

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 80/143 (56%), Gaps = 7/143 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT++ FNL+  NLLT+N  + +         GIYYDRLHVYA YRNQ +TL
Sbjct  46   TKPRFILQDATVYAFNLSQPNLLTSNFQITIVTRNRNSKIGIYYDRLHVYATYRNQQITL  105

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
               +P +YQG+K+  VWS F+ GN+VPV P   +A       G V + I  DG +R    
Sbjct  106  RTAIPPTYQGHKEDNVWSPFVYGNAVPVAPYNAVALGDESNRGSVTLMIRADGRVRWKVG  165

Query  573  NLEVGPCRLSANCPAFLDFGSTS  641
                G   L   CPA ++    +
Sbjct  166  TFITGKYHLHVRCPALINIADKT  188



>ref|XP_007132484.1| hypothetical protein PHAVU_011G097900g [Phaseolus vulgaris]
 gb|ESW04478.1| hypothetical protein PHAVU_011G097900g [Phaseolus vulgaris]
Length=207

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 94/163 (58%), Gaps = 14/163 (9%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            T+PRF L+ ATL NFNL++   N L+  + V L+AH P    G+YY  L ++A YR+Q +
Sbjct  45   TKPRFTLQDATLLNFNLSSPIPNTLSLTMQVTLSAHNPNARIGVYYHALRLHASYRSQQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGV-------GMAGRVLVNIIVDGWIRKH  566
            +LP  LP +YQG+ D  VWS FL GN+VPV P V         +G V+VN+ V+G ++  
Sbjct  105  SLPTALPDTYQGHHDFTVWSPFLYGNTVPVAPFVLASLQQDQSSGTVMVNVKVNGRVKWK  164

Query  567  FWNLEVGPCRLSANCPAFLDFGSTSISSSPV-----QSCHVEV  680
                  G   ++ NCPA++ F     ++  V     QSC V+V
Sbjct  165  VGTWVSGRYHININCPAYISFAGDRSNAEGVKFHLLQSCSVDV  207



>ref|NP_196251.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 dbj|BAB08955.1| harpin-induced protein-like [Arabidopsis thaliana]
 gb|AAR24713.1| At5g06330 [Arabidopsis thaliana]
 gb|AAS47650.1| At5g06330 [Arabidopsis thaliana]
 gb|AED91003.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
Length=207

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 88/145 (61%), Gaps = 9/145 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            ++PRF L+ AT+ NFN++    NLLT+N    L++  P    GIYYDRL VYA YR+Q +
Sbjct  45   SKPRFVLQDATVFNFNVSGNPPNLLTSNFQFTLSSRNPNDKIGIYYDRLDVYASYRSQQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKH  566
            TLP+P+  +YQG+K+V VWS F+ G SVPV P           +G +++ + +DG +R  
Sbjct  105  TLPSPMLTTYQGHKEVNVWSPFVGGYSVPVAPYNAFYLDQDHSSGAIMLMLHLDGRVRWK  164

Query  567  FWNLEVGPCRLSANCPAFLDFGSTS  641
              +   G   L   C A ++FGS++
Sbjct  165  VGSFITGKYHLHVRCHALINFGSSA  189



>gb|KDP36127.1| hypothetical protein JCGZ_08771 [Jatropha curcas]
Length=209

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 106/205 (52%), Gaps = 21/205 (10%)
 Frame = +3

Query  114  GEMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAG  293
            GE +  L ++ F    +L+  F  L  I +  A+   +  ++P F L+  T++ FN +  
Sbjct  10   GEKRRKLFRRIF--AGILIFLFLVLVTILIIWAV---LRPSKPSFVLQDVTVYAFNASVP  64

Query  294  NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAF  473
            N LT+N  V  ++  P    GIYYDRL +YA YR+Q +TL + +P +YQG+K++ VWS  
Sbjct  65   NFLTSNFQVTFSSRNPNDKIGIYYDRLDIYATYRSQQITLRSAIPPNYQGHKEINVWSPN  124

Query  474  LSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG  632
            + G ++PV P   +       AG VL+ I +DG +R        G   L   CPA++ FG
Sbjct  125  IYGTAIPVAPYNAIALNQDQSAGTVLLMIKMDGRVRFKVGTFISGKYHLYVRCPAYIQFG  184

Query  633  S---------TSISSSPVQSCHVEV  680
            S          S+  S + SC V +
Sbjct  185  SRTAGIIVGENSVKYSLLVSCSVSI  209



>ref|XP_003538094.1| PREDICTED: uncharacterized protein LOC100819285 [Glycine max]
Length=214

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 97/170 (57%), Gaps = 21/170 (12%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTN--ISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            T+PRF L+ ATL+ FNL+     T    + V L++H P    G+YY  LHVYA YR+Q +
Sbjct  45   TKPRFTLQDATLYAFNLSTPTPNTLTLTMQVTLSSHNPNARVGVYYHALHVYASYRSQQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGV--------GMAGRVLVNIIVDGWIRK  563
            +L   LP +YQG++D AVWS FL GN VPV P V          AG VLVN+ V+G ++ 
Sbjct  105  SLATALPDTYQGHRDFAVWSPFLFGNVVPVSPFVLSSLQQDQSAAGAVLVNVKVNGRVKW  164

Query  564  HFWNLEVGPCRLSANCPAFLDF-GSTSIS-----SSPV-----QSCHVEV  680
               +   G   +  NCPA++ F G  SI+     +SPV     QSC V+V
Sbjct  165  KVGSWVSGRYHIYVNCPAYISFAGDRSIAAGGLVASPVKFRLLQSCSVDV  214



>ref|XP_004139592.1| PREDICTED: uncharacterized protein LOC101212136 [Cucumis sativus]
 gb|KGN64967.1| hypothetical protein Csa_1G169420 [Cucumis sativus]
Length=213

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 102/188 (54%), Gaps = 18/188 (10%)
 Frame = +3

Query  171  LFFSTLFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTA--GNLLTTNISVALAAHIP  341
            + F+ +  I L + +  A +  ++PR  L+  TL   N+++     ++T + + +++H P
Sbjct  26   VIFTVVLLIGLVIFLIWAILRPSKPRLILQDVTLLGLNVSSVPPAAISTTMQITISSHNP  85

Query  342  YRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-  518
                G+YY  + VYA YR Q VTLP  LP +YQG+ DV VWS FL G +VPV P    A 
Sbjct  86   NNRIGVYYQVMDVYAAYRGQQVTLPTLLPPTYQGHNDVTVWSPFLYGEAVPVAPEFAEAL  145

Query  519  ------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG--STSISSSP------  656
                  G +L NI V+G +R    +   G  RL+ANCPA++ FG     I+  P      
Sbjct  146  NEDNNVGAMLFNIKVNGQVRWKVGSWISGRYRLNANCPAYIKFGDPKNGIAFGPAMKFQF  205

Query  657  VQSCHVEV  680
            VQ C+V++
Sbjct  206  VQGCYVDI  213



>ref|XP_006407425.1| hypothetical protein EUTSA_v10021920mg [Eutrema salsugineum]
 gb|ESQ48878.1| hypothetical protein EUTSA_v10021920mg [Eutrema salsugineum]
Length=211

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 95/162 (59%), Gaps = 10/162 (6%)
 Frame = +3

Query  186  LFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRG  356
            LF I L + +  A +  ++PRF L+ AT++ FN++    NLLT+N  + L++  P    G
Sbjct  28   LFVIFLTILLIWAILQPSKPRFLLQDATVYAFNVSGNPPNLLTSNFQITLSSRNPNDKIG  87

Query  357  IYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMA----  518
            +YYDRL VYA YR+Q +T    +P +YQG+K+V +WS F+ G SVPV P   VG+     
Sbjct  88   VYYDRLDVYATYRSQQITFRTSIPPTYQGHKEVNIWSPFVYGTSVPVAPFNAVGLDNDQD  147

Query  519  -GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             G V++ I  +G +R        G   L   CPA+++FG+ +
Sbjct  148  NGAVMLIIRAEGRVRWKVGTFITGKYHLYVRCPAYINFGNKA  189



>emb|CDP10610.1| unnamed protein product [Coffea canephora]
Length=208

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 90/163 (55%), Gaps = 15/163 (9%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF L+ AT+  FN++A N+L+TNI V + +  P    GIYYD+  VYA Y +Q +T  
Sbjct  46   KPRFILQDATIFIFNVSAPNILSTNIQVTVYSRNPNGKIGIYYDKFDVYATYHSQQITYY  105

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWN  575
              +P  YQG+KDV VWS F+ GN+VP+ P  G+A       G V + I ++G ++     
Sbjct  106  TTIPPVYQGHKDVNVWSPFIYGNNVPIAPYNGLALTQDQSNGAVQLMIKMNGRVKWKVGT  165

Query  576  LEVGPCRLSANCPAFLDFGS--------TSISSSPVQSCHVEV  680
            +  G   L   CPA++ FG+        T I     QSC V V
Sbjct  166  VTTGRYHLHVTCPAYIPFGNKNTGIVIGTGIKYQLSQSCSVSV  208



>ref|XP_008813459.1| PREDICTED: protein YLS9-like [Phoenix dactylifera]
Length=205

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 93/182 (51%), Gaps = 11/182 (6%)
 Frame = +3

Query  159  CVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHI  338
            C L L    LF I   + +   +  ++PRF L+ AT+ NFNL A NLL+  + + + +  
Sbjct  27   CFLCLIIVVLFAI---LVIWLVLRPSKPRFNLQDATVTNFNLAAPNLLSFTVQITIGSRN  83

Query  339  PYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-  515
            P    GIYYDRL VYA Y+ Q +T    LP  YQG+ D +VWS +L GN+VP+   + + 
Sbjct  84   PNDRIGIYYDRLDVYADYKGQQITAATALPTGYQGHDDFSVWSPYLYGNNVPLAQYLAVA  143

Query  516  ------AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGST-SISSSPVQSCHV  674
                  AG +L+   +DG +R        G   +  NCPAF    ST         SC V
Sbjct  144  VDQDESAGFILIYFKIDGRLRWKVGTWISGNYHIDVNCPAFFTVNSTKEFQFQKTTSCSV  203

Query  675  EV  680
            +V
Sbjct  204  DV  205



>ref|XP_009146694.1| PREDICTED: protein YLS9-like [Brassica rapa]
Length=212

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 86/145 (59%), Gaps = 9/145 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            T+PRF L+ AT++ FN++    NLLT+N  V L++  P    G+YYDRL VYA Y+NQ +
Sbjct  45   TKPRFILQDATVYAFNVSGNPPNLLTSNFQVTLSSRNPNDKIGVYYDRLEVYAAYQNQQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKH  566
            T    +P +YQG+K+V +WS F+ G SVP+ P  G++       G + ++I  DG +R  
Sbjct  105  TYRTSIPPTYQGHKEVNIWSPFVYGTSVPIAPFNGVSLDGDQENGVIRLDIRADGRVRWK  164

Query  567  FWNLEVGPCRLSANCPAFLDFGSTS  641
                  G   L   C AF++FG+ +
Sbjct  165  VGAFITGKYHLYVRCQAFINFGNKA  189



>ref|XP_010543826.1| PREDICTED: protein YLS9-like [Tarenaya hassleriana]
Length=211

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/192 (35%), Positives = 99/192 (52%), Gaps = 19/192 (10%)
 Frame = +3

Query  162  VLLLFFSTLFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAA  332
            +L      LF + L + +  A +  ++PRF L  AT+  FN++    N+LT+N  + +++
Sbjct  20   ILWSIIGFLFIVLLTILLIWAILQPSKPRFILEDATVFAFNVSGNPPNILTSNFQITISS  79

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP---  503
              P    GIYYDRL VYA YRNQ +T    +P +YQG+K+V +WS F+ G  VPV P   
Sbjct  80   RNPNDKIGIYYDRLDVYASYRNQQITFRTSIPPTYQGHKEVNIWSPFVYGTDVPVAPYNA  139

Query  504  -GVG---MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDF---------GSTSI  644
             G+G     G + + I  DG +R        G   L   CPAF+DF         G  ++
Sbjct  140  LGLGEDQERGAMFLMIRADGRVRWKVGTFISGKYHLYVRCPAFIDFADRSAGVIVGDNAV  199

Query  645  SSSPVQSCHVEV  680
              + + SC V V
Sbjct  200  KYTILTSCSVSV  211



>emb|CDY09123.1| BnaA02g05490D [Brassica napus]
Length=209

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 91/161 (57%), Gaps = 19/161 (12%)
 Frame = +3

Query  246  FFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPL  425
            F L+  T++ FN++  NLLT+N+ V L++H P    GI Y+RL +YA YRNQ VTL   L
Sbjct  52   FVLQDVTIYEFNISQPNLLTSNLQVTLSSHNPNDKIGILYERLDIYASYRNQEVTLAHLL  111

Query  426  PASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLE-  581
            P +YQG+ +V VWS  L+G +V VEP +         AG VL+NI +DG ++   W +  
Sbjct  112  PETYQGHLEVTVWSPVLTGTAVSVEPYLTPALNEDINAGMVLLNIKIDGCVK---WKVGT  168

Query  582  -VGPC-RLSANCPAFLDFGSTSISSSP------VQSCHVEV  680
             V  C RL  NCPA + F      + P       Q C V+V
Sbjct  169  WVSECYRLLVNCPASIPFSGQLAGTGPAIKDQLAQQCAVDV  209



>ref|XP_003535809.1| PREDICTED: protein YLS9-like [Glycine max]
Length=209

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 100/202 (50%), Gaps = 21/202 (10%)
 Frame = +3

Query  123  KDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLL  302
            K  + ++ F C  V L  F  L  I L  A+   +  T+P F L+  T++ FN T  N L
Sbjct  13   KRKIFRQVFWCLVVFL--FIVLVTILLIWAI---LRPTKPTFTLQDVTVYAFNATVANFL  67

Query  303  TTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSG  482
            T+N  V L +  P    G+YYDRL  +  YR+Q VT    +P +YQG+K++ VWS F+ G
Sbjct  68   TSNFQVTLISRNPNDRIGVYYDRLETFVTYRSQQVTYRTAIPPTYQGHKEINVWSPFVYG  127

Query  483  NSVPVEP--GVGMA-----GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             ++PV P   +G++     G VLV I  +G +R        G   L   CPAF+ FG  S
Sbjct  128  TNIPVAPFNFLGLSQDQSNGNVLVTIRAEGRVRWKVGTFISGRYHLYVRCPAFISFGPRS  187

Query  642  ---------ISSSPVQSCHVEV  680
                     I    +Q C V V
Sbjct  188  NGIVVGENAIKFQIIQRCSVSV  209



>ref|XP_004159233.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226654 
[Cucumis sativus]
Length=208

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 85/141 (60%), Gaps = 7/141 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P+F ++ AT++ FNLTA N ++++I V + +  P    G+YYDRL VYAVY NQ +TL
Sbjct  44   TKPKFVIQDATVYLFNLTAANFISSSIQVTVYSRNPNDKIGVYYDRLDVYAVYHNQQITL  103

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
               +  +YQG+ DV +WS FL GN+VP+ P  G         G V ++I +DG +R    
Sbjct  104  RTGIQPTYQGHNDVNIWSPFLIGNNVPISPYNGATLNQDQAVGTVQLSIKLDGRVRFKVG  163

Query  573  NLEVGPCRLSANCPAFLDFGS  635
                G   L+ +CPA + FG+
Sbjct  164  TFISGRYHLNVDCPAAIMFGN  184



>ref|XP_004143336.1| PREDICTED: uncharacterized protein LOC101216889 [Cucumis sativus]
 gb|KGN48300.1| hypothetical protein Csa_6G454475 [Cucumis sativus]
Length=208

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 85/141 (60%), Gaps = 7/141 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P+F ++ AT++ FNLTA N ++++I V + +  P    G+YYDRL VYAVY NQ +TL
Sbjct  44   TKPKFVIQDATVYLFNLTAANFISSSIQVTVYSRNPNDKIGVYYDRLDVYAVYHNQQITL  103

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
               +  +YQG+ DV +WS FL GN+VP+ P  G         G V ++I +DG +R    
Sbjct  104  RTGIQPTYQGHNDVNIWSPFLIGNNVPISPYNGATLNQDQAVGTVQLSIKLDGRVRFKVG  163

Query  573  NLEVGPCRLSANCPAFLDFGS  635
                G   L+ +CPA + FG+
Sbjct  164  TFISGRYHLNVDCPAAIMFGN  184



>gb|EYU38693.1| hypothetical protein MIMGU_mgv1a011472mg [Erythranthe guttata]
Length=280

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 115/224 (51%), Gaps = 24/224 (11%)
 Frame = +3

Query  78   KTSSDPPPHAP-SGEMKD------DLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLT  236
            KTSS PP  A  S   KD      D  +K    CC  LL F+ +  I + +  S  +   
Sbjct  58   KTSSTPPATAAVSMSEKDCNHSNKDHRRKLLRRCCGGLLIFNFIVLIIILLVWSI-LQPR  116

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF L+ AT+ N N++A N+++T I V + +H P    GIYYDR++VYA+Y +Q +T  
Sbjct  117  KPRFTLQDATIFNLNVSAPNVISTTIQVTVNSHNPNSKIGIYYDRMNVYAIYHSQQITYY  176

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWN  575
              +P  YQG K+  VWS F+ G++VPV P  G A       G + + I ++G ++    +
Sbjct  177  TAIPPVYQGTKEDNVWSPFIYGDNVPVAPYNGQALGEDQSDGAINMLIKINGRVKWKCGS  236

Query  576  LEVGPCRLSANCPAFLDFGSTSISSSPV---------QSCHVEV  680
               G   L   CPA++  G++  +   V         QSC V V
Sbjct  237  FISGRYHLHITCPAYIPLGNSKNTGIVVGNAVKYKLSQSCSVSV  280



>gb|EPS58106.1| hypothetical protein M569_16710, partial [Genlisea aurea]
Length=207

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 88/156 (56%), Gaps = 13/156 (8%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNL-TAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVT  410
            T+P F L+ A ++  N  ++ +LL T + + +A   P R  GIYY+RL   A YR + +T
Sbjct  43   TKPHFSLQSAAVYGLNFDSSASLLNTTLQIRVAFRNPNRRIGIYYERLRACAAYRGERIT  102

Query  411  LPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHF  569
             PA LPA+Y G+ DVAVWS FL G +VP+ P  G       +AG V+VNI +DG IR   
Sbjct  103  PPAVLPAAYLGHGDVAVWSPFLVGQNVPINPYDGVDFVRDQIAGTVMVNIEIDGRIRWKV  162

Query  570  WNLEVGPCRLSANCPAFLDF-----GSTSISSSPVQ  662
                 G  RL  NCPA++D      G  S+   PV+
Sbjct  163  GRFISGRHRLQVNCPAYVDSDKILNGGVSVRPVPVR  198



>ref|XP_009141538.1| PREDICTED: uncharacterized protein LOC103865501 [Brassica rapa]
 emb|CDY40419.1| BnaA04g20980D [Brassica napus]
Length=208

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 79/142 (56%), Gaps = 7/142 (5%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF L+ AT++ FNLT  NLLT+N  V L         GIYYDRLHVYA YRNQ +T P
Sbjct  45   KPRFILQDATVYAFNLTQPNLLTSNFQVTLVIRNRNSKIGIYYDRLHVYATYRNQQITFP  104

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWN  575
              +P +YQG+K+ +VWS  + GN+V V P   +A       G V + I  DG +R     
Sbjct  105  TAIPPTYQGHKEDSVWSPIIYGNAVSVAPYNAVALGDEQSRGFVELVIRADGRVRWKVGT  164

Query  576  LEVGPCRLSANCPAFLDFGSTS  641
            L  G   L   C A+++    S
Sbjct  165  LITGKYHLHVRCHAYINLADKS  186



>ref|NP_001066211.1| Os12g0159600 [Oryza sativa Japonica Group]
 gb|ABA96522.1| Harpin-induced protein 1 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29230.1| Os12g0159600 [Oryza sativa Japonica Group]
 gb|EAY82340.1| hypothetical protein OsI_37550 [Oryza sativa Indica Group]
 gb|EAZ19721.1| hypothetical protein OsJ_35298 [Oryza sativa Japonica Group]
 dbj|BAG96485.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91979.1| unnamed protein product [Oryza sativa Japonica Group]
Length=212

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 100/193 (52%), Gaps = 24/193 (12%)
 Frame = +3

Query  174  FFSTLFCISLCVAMSAQISL-----TQPRFFLRHATLHNFNL-----TAGNLLTTNISVA  323
            F + L  +++ V + A I       T PRF+L+ ATL   +L     TAG +L+T I V 
Sbjct  20   FITVLVVLAILVGIIALIVYLVLRPTHPRFYLQDATLRQLDLSNSSSTAGGVLSTTIQVT  79

Query  324  LAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP  503
            +A+  P    G+YYDRL VYA Y+ Q +T+ A LP  YQG+ DV VWS  L+G SVP  P
Sbjct  80   VASRNPNDRVGVYYDRLDVYASYKYQQITVAASLPPVYQGHGDVDVWSPVLAGPSVPFAP  139

Query  504  GVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL----DFGSTSISS  650
             +         AG +++ + +DG +R    +   G   L   CPAFL      GS   S 
Sbjct  140  YLADAISQDCQAGYLILQVKIDGRVRWKVGSWISGHYHLFVTCPAFLVTAGGNGSPGASG  199

Query  651  SPVQS---CHVEV  680
               Q+   CHVEV
Sbjct  200  FRFQTTTYCHVEV  212



>ref|XP_007162963.1| hypothetical protein PHAVU_001G195000g [Phaseolus vulgaris]
 gb|ESW34957.1| hypothetical protein PHAVU_001G195000g [Phaseolus vulgaris]
Length=209

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 100/192 (52%), Gaps = 19/192 (10%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  +++  F  L  + +  A+   +  T+P F L+  T+  FN T  NLLT++  V L++
Sbjct  21   CWWIVIFVFIVLLTVLIIWAI---LKPTKPTFILQDVTVFGFNATIPNLLTSSFQVTLSS  77

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPG--  506
              P    GIYYDRL  Y  YR+Q VT    +P SYQG+K+  VWS F+ G +VPV P   
Sbjct  78   RNPNDKIGIYYDRLSTYVTYRSQQVTYRTSIPPSYQGHKEEDVWSPFVYGTNVPVAPYNF  137

Query  507  VGMA-----GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG--STSISSSP---  656
            +G++     G VLV + VDG +R        G   L   CPAF+ FG  ST I+ S    
Sbjct  138  LGLSQDQTNGNVLVIVKVDGKVRWKVGAFISGHYNLYVRCPAFITFGPRSTGIALSNNAV  197

Query  657  ----VQSCHVEV  680
                VQ C V V
Sbjct  198  KYQLVQRCTVGV  209



>gb|AFK45355.1| unknown [Lotus japonicus]
Length=210

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 94/190 (49%), Gaps = 20/190 (11%)
 Frame = +3

Query  162  VLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIP  341
            +++  F  L  I +  A+   +   +P F L+  T++ FN T  N LT+N  V L+A  P
Sbjct  24   IVIFLFIVLVTILIIWAI---LKPNKPTFTLQDVTVYAFNATMANFLTSNFQVTLSARNP  80

Query  342  YRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP------  503
                G+YYDRL  Y  Y++Q VT    +P SYQG+K++ VWS F+ G +VPV P      
Sbjct  81   NDKIGVYYDRLDAYITYQSQQVTYRTAIPPSYQGHKEMDVWSPFVYGTNVPVAPYNFVTL  140

Query  504  -GVGMAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS----------ISS  650
                  G VLV + VDG +R        G   L+  CPAF+ FG+ S          +  
Sbjct  141  SQDQANGNVLVTVKVDGKVRWKVGAFVTGHYHLNVRCPAFITFGARSNGVAVGDSGAVKY  200

Query  651  SPVQSCHVEV  680
              VQ C V V
Sbjct  201  QLVQRCSVSV  210



>ref|XP_009388241.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=214

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 83/144 (58%), Gaps = 8/144 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLT-AGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVT  410
            T+P F+L+ AT++ FNL+ + N+L+T +   +++H P    G+ YDR  VY  Y+NQ +T
Sbjct  53   TKPIFYLKDATVYQFNLSLSDNILSTVLQATVSSHNPNSRIGVSYDRASVYVTYQNQQIT  112

Query  411  LPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGV-------GMAGRVLVNIIVDGWIRKHF  569
            LP  +P  YQG+ D+ VWS +L G SVPV P +         AG +L+ + +DG +R   
Sbjct  113  LPTSIPPLYQGHHDINVWSPYLYGASVPVAPSICGSLQQDEAAGYLLLYLKIDGMVRWKV  172

Query  570  WNLEVGPCRLSANCPAFLDFGSTS  641
                 G   L   CPAF  F STS
Sbjct  173  GTWTSGHYHLEVTCPAFFSFDSTS  196



>emb|CDY01043.1| BnaC05g41570D [Brassica napus]
Length=212

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 91/168 (54%), Gaps = 19/168 (11%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            ++PRF L+ AT++ FN++    NLLT+N  V L++  P    G+YYDRL VYA Y+NQ +
Sbjct  45   SKPRFILQDATVYAFNVSGNPPNLLTSNFQVTLSSRNPNDKIGVYYDRLEVYAAYQNQQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKH  566
            T    +P +YQG+K+V +WS F+ G SVP+ P  G++       G + ++I  DG +R  
Sbjct  105  TYRTSIPPTYQGHKEVNIWSPFVYGTSVPIAPFNGVSLDGDQENGVIRLDIRADGRVRWK  164

Query  567  FWNLEVGPCRLSANCPAFLDF----------GSTSISSSPVQSCHVEV  680
                  G   L   C AF++F          G  ++  +  Q C V V
Sbjct  165  VGAFITGKYHLYVRCQAFINFANKAAAGVIVGDNAVKYTYAQGCSVSV  212



>emb|CDY32068.1| BnaC04g44980D [Brassica napus]
Length=206

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 79/143 (55%), Gaps = 7/143 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT+  FNLT  NLLT+N  V L         GIYYDRLHVYA YRNQ +T 
Sbjct  42   TKPRFILQDATVFAFNLTQPNLLTSNFQVTLVIRNRNSKIGIYYDRLHVYATYRNQQITY  101

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
            P  +P +YQG+K+ +VWS  + GN+V V P   +A       G V + I  DG +R    
Sbjct  102  PTAIPPTYQGHKEDSVWSPLIYGNAVSVAPYNAVALGDEQSRGFVELVIRADGRVRWKVG  161

Query  573  NLEVGPCRLSANCPAFLDFGSTS  641
             L  G   L   C A+++    S
Sbjct  162  TLITGKYHLHVRCHAYINLADKS  184



>ref|XP_010491191.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=211

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 95/168 (57%), Gaps = 9/168 (5%)
 Frame = +3

Query  165  LLLFFSTLFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAH  335
            +++ F  LF I L V +    +  ++PRF L+ A + NFN++    N+L +N  V++++ 
Sbjct  22   VIILFVILFVIILAVFLVWVVLQPSKPRFHLQEAIVSNFNISGNPLNILNSNFQVSISSE  81

Query  336  IPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM  515
             P    GIYYDRL+VYA Y NQ +T    +  +YQG+K+  VWS  + GNSVPV   +G+
Sbjct  82   NPNDKIGIYYDRLNVYATYHNQQITWQTAISPTYQGHKETKVWSPIIGGNSVPVSSVIGL  141

Query  516  ------AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
                   G + + I + G IR    ++  G   L  NCPA ++ G+++
Sbjct  142  PVVEDQPGMIELKIYLFGQIRWKVGSMITGEYHLHVNCPASINVGNSA  189



>ref|XP_004494245.1| PREDICTED: uncharacterized protein LOC101501355 [Cicer arietinum]
Length=210

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 87/166 (52%), Gaps = 17/166 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            ++P F L+  T++ FN T  N LT+N  V +++  P    GIYYDRL  Y  YR+Q +T 
Sbjct  45   SKPSFILQDVTVYAFNATVPNFLTSNFQVTVSSRNPNDKIGIYYDRLDAYVTYRSQQITY  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPG--VGMA-----GRVLVNIIVDGWIRKHFW  572
               +P SYQG+KDV VWS F+ G +VPV P   VG++     G VLV + +DG +R    
Sbjct  105  RTAIPPSYQGHKDVDVWSPFVYGTNVPVAPYNFVGLSQDQTNGNVLVIVKLDGRVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDFGSTS----------ISSSPVQSCHVEV  680
                G   L   CPAF+ FG  S          +    VQ C V V
Sbjct  165  AFISGHYHLYVRCPAFITFGPQSNGIAIGDNGAVKYQLVQRCTVSV  210



>ref|XP_004506216.1| PREDICTED: protein NDR1-like [Cicer arietinum]
Length=219

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 102/200 (51%), Gaps = 31/200 (16%)
 Frame = +3

Query  156  CCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAG--------NLLTTN  311
              +++L   T+F I +       +  T+PRF ++ AT++ FN+++         N LT  
Sbjct  26   ASLIILILVTIFLIWII------LKPTKPRFTIQDATIYTFNISSPISSPFPTPNTLTLT  79

Query  312  ISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSV  491
            + V L+ H P    GIYY +LHVY  Y+NQ ++LP  +P +YQG+KD  VWS F+ G  V
Sbjct  80   MQVTLSIHNPNNRIGIYYQKLHVYGSYKNQQISLPTVIPDTYQGHKDFTVWSPFIYGVGV  139

Query  492  PVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGST----  638
            PV P    A       G VLVN+ V+G ++    +   G   +  NCPA++ F       
Sbjct  140  PVSPSRLSALVQDENNGMVLVNVKVNGRVKWKVGSWISGRYHIFVNCPAYVRFAGDRNNG  199

Query  639  ------SISSSPVQSCHVEV  680
                  ++    +QSC V+V
Sbjct  200  IGVVAPAVKFQLLQSCSVDV  219



>ref|XP_004228587.1| PREDICTED: protein YLS9-like [Solanum lycopersicum]
Length=211

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 91/168 (54%), Gaps = 10/168 (6%)
 Frame = +3

Query  153  CCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAA  332
            C  VL+  F  L  I +  A+   +   +PRF L+  T+  FN++A N+ +T+I   + A
Sbjct  21   CAGVLIFLFLALLTILIVWAV---LHPKKPRFILQDTTIFTFNVSAPNIFSTSIQTTIYA  77

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP--G  506
              P    GIYYD +HVYA Y NQ +T    +P  YQG+KDV +WS F+ GN++P+ P  G
Sbjct  78   RNPNSKIGIYYDSMHVYATYHNQQITYYTQIPQVYQGHKDVNIWSPFVYGNNIPIAPYNG  137

Query  507  VGMA-----GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGS  635
             G++     G V ++  +DG ++    ++  G   L   C A++  G 
Sbjct  138  PGLSEDQQNGGVWLDFKIDGRVKWKVGSITTGHYHLHVTCSAYVPLGD  185



>ref|XP_006481585.1| PREDICTED: protein YLS9-like [Citrus sinensis]
Length=209

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 93/165 (56%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT++ FN++  N+LT++  V +++  P    GIYYD+L +YA Y +Q +T 
Sbjct  45   TKPRFILQDATVYVFNVSNPNVLTSSFQVTISSRNPNDRIGIYYDKLDLYATYHSQQITY  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGM-----AGRVLVNIIVDGWIRKHFW  572
               LP +YQG+K+V VWS ++ GN+VPV P   V +     +G + +   +DG +R    
Sbjct  105  KTSLPTTYQGHKEVNVWSPYVYGNAVPVAPYNAVSLTQDQSSGIIPLTFKIDGRVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDF---------GSTSISSSPVQSCHVEV  680
                G   L   CPA+++F         G+ ++    VQSC V V
Sbjct  165  TFITGKYHLYVRCPAYINFGDRQAGTAVGNNAVKYQLVQSCSVSV  209



>gb|KFK38532.1| hypothetical protein AALP_AA3G126200 [Arabis alpina]
Length=214

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 87/150 (58%), Gaps = 9/150 (6%)
 Frame = +3

Query  219  AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVY  392
            A +  ++PRF L+ AT++ FN++    NLLT+N  + L++  P    GIYYDRL VYA Y
Sbjct  40   AILQPSKPRFLLQDATVYAFNVSGNPPNLLTSNFQITLSSRNPNDKIGIYYDRLDVYATY  99

Query  393  RNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMA-----GRVLVNIIVDG  551
            R+Q +T P  +P +YQG+K+V +WS F+ G SVPV P   VG+      G V + I  DG
Sbjct  100  RSQQITFPTSIPPTYQGHKEVNIWSPFVYGTSVPVAPYNAVGLDNDHDNGGVKLIIKADG  159

Query  552  WIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             +R        G   L   C A++ FG+ +
Sbjct  160  RVRWKVGTFITGKYHLYVRCDAYIYFGNKN  189



>ref|XP_003606085.1| NHL1 [Medicago truncatula]
 gb|AES88282.1| late embryogenesis abundant protein [Medicago truncatula]
Length=219

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 92/174 (53%), Gaps = 25/174 (14%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGN--------LLTTNISVALAAHIPYRHRGIYYDRLHVYAV  389
            T+PRF ++ AT++ FN+++ N         LT  + V L  H P +  GIYY +LHVYA 
Sbjct  46   TKPRFMIQDATIYTFNISSPNSNPFPIPNTLTLTMQVTLTTHNPNKRIGIYYQKLHVYAS  105

Query  390  YRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGV-------GMAGRVLVNIIVD  548
            Y++Q ++LP  +P +YQG+KD  +WS F+ G  VPV P            G VLVN+ V+
Sbjct  106  YKSQQISLPTSIPDTYQGHKDFTIWSPFIYGVGVPVSPFTLSNLQQDQNNGMVLVNLKVN  165

Query  549  GWIRKHFWNLEVGPCRLSANCPAFLDFGSTSISSSPV----------QSCHVEV  680
            G ++        G   +  NCPA++ F     + + V          Q+CHV+V
Sbjct  166  GRVKWKVGRWISGRYHIFVNCPAYVRFSGDRNNGAGVVAPAVKFQLLQNCHVDV  219



>ref|XP_010909818.1| PREDICTED: protein YLS9-like [Elaeis guineensis]
Length=204

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 88/157 (56%), Gaps = 8/157 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            ++P+F+L+ A++  FNL+  NLL++ I + +++  P    GIYYDRL VYA Y+ Q +T 
Sbjct  48   SKPKFYLQDASVGQFNLSDANLLSSIIQLTISSRNPNDRIGIYYDRLDVYADYKGQQITA  107

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHFW  572
               LP  YQG+ D  VWS +L GN+VP+ P + +       AG +L+ I +DG +R    
Sbjct  108  ATALPPGYQGHNDYNVWSPYLFGNAVPLAPYLAVAAGQEESAGFILIYIKIDGRLRWKVG  167

Query  573  NLEVGPCRLSANCPAFLDFGS-TSISSSPVQSCHVEV  680
                G   ++ NCPAF    S        + SC V+V
Sbjct  168  TWISGHYHINVNCPAFFTVDSGKEFRFQKITSCSVDV  204



>ref|XP_002532541.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29835.1| conserved hypothetical protein [Ricinus communis]
Length=209

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 96/183 (52%), Gaps = 12/183 (7%)
 Frame = +3

Query  114  GEMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAG  293
            G  +  L ++ F    +L+  F  L  I +  A+   +  ++P+F L+  T+  FN +  
Sbjct  10   GHKRRKLFRRIF--AGILIFLFLVLVTILIVWAV---LRPSKPKFVLQDVTVFAFNASTP  64

Query  294  NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAF  473
            N LT+N  +  +   P    GIYYD+L VYA YRNQ +TL + +P +YQG++++ VWS  
Sbjct  65   NYLTSNFQITFSTRNPNDKVGIYYDKLDVYATYRNQQITLRSAIPTNYQGHEEINVWSPN  124

Query  474  LSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG  632
            + G +VPV P           AG VL+ I +DG +R        G   L   CPA++ FG
Sbjct  125  IYGTAVPVAPYNAASLAQDQNAGAVLMMIKMDGRVRFKVGTFVSGRYHLYVKCPAYIQFG  184

Query  633  STS  641
            S +
Sbjct  185  SRT  187



>ref|XP_010104769.1| hypothetical protein L484_018821 [Morus notabilis]
 gb|EXC01910.1| hypothetical protein L484_018821 [Morus notabilis]
Length=209

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 86/165 (52%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            ++PRF L+  T++ FN +  N LT++  V +++  P    G+YYDRL V+AVY NQ +T 
Sbjct  45   SKPRFILQDVTVYAFNTSIPNFLTSSFQVTISSRNPNDKIGVYYDRLDVFAVYHNQQITF  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
            P  +P +YQG+KDV VWS F+ GN VPV P    A       G V++   +DG +R    
Sbjct  105  PTRIPPTYQGHKDVNVWSPFVYGNLVPVAPFNSDALIADQANGAVMILFKIDGRVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDFGS---------TSISSSPVQSCHVEV  680
                G   L   C AF+  G+          ++    VQ C V V
Sbjct  165  TFISGRYHLYVKCSAFISLGNRNSGIAVGENAVKYQLVQKCKVNV  209



>ref|XP_007145796.1| hypothetical protein PHAVU_007G268600g [Phaseolus vulgaris]
 gb|ESW17790.1| hypothetical protein PHAVU_007G268600g [Phaseolus vulgaris]
Length=209

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 79/143 (55%), Gaps = 7/143 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P F L+  T++ FN T  N LT+N  V L +  P  + G+YYDRL  Y  YR+Q VT 
Sbjct  45   TKPTFTLQDVTVYAFNATVANFLTSNFQVTLISRNPNDNIGVYYDRLETYVTYRSQQVTY  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMA-----GRVLVNIIVDGWIRKHFW  572
               +P  YQG+KDV VWS F+ G ++PV P   +G++     G VLV +  DG +R    
Sbjct  105  RTAIPPIYQGHKDVNVWSPFVYGTNIPVAPFNFLGLSQDQTEGTVLVTVKADGKVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDFGSTS  641
                G   L   CPAF+ FG  S
Sbjct  165  TFISGHYHLYVRCPAFISFGPRS  187



>gb|KHN33158.1| hypothetical protein glysoja_039474 [Glycine soja]
Length=209

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 98/187 (52%), Gaps = 17/187 (9%)
 Frame = +3

Query  168  LLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYR  347
            ++ F+ +  +++ + + A +  ++P F L+  T++ FN T  N LT++  V L++  P  
Sbjct  24   IVIFAFIVLLTVLI-IWAILKPSKPTFILQDVTVYGFNATIPNFLTSSFQVTLSSRNPND  82

Query  348  HRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMA-  518
              G+YYDRL  Y  YRNQ VT    +P SYQG+K+  VWS F+ G +VPV P   VG++ 
Sbjct  83   KIGVYYDRLDTYVTYRNQQVTYRTSIPPSYQGHKEEDVWSPFVYGTNVPVAPFNFVGLSQ  142

Query  519  ----GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS---------ISSSPV  659
                G VLV + +DG +R        G   L   CPAF+ FG  S         +    V
Sbjct  143  DQTNGNVLVLVKIDGKVRWKVGTFVSGHYNLYVRCPAFITFGPQSTGIALGKNAVKYQLV  202

Query  660  QSCHVEV  680
            Q C V V
Sbjct  203  QRCTVGV  209



>gb|KDO70596.1| hypothetical protein CISIN_1g028399mg [Citrus sinensis]
Length=209

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 91/165 (55%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT++ FN++  N+LT++  V +++  P    GIYYD+L +YA Y +Q +T 
Sbjct  45   TKPRFILQDATVYVFNVSNPNVLTSSFQVTISSRNPNDRIGIYYDKLDLYATYHSQQITY  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMAGRVLVNII-----VDGWIRKHFW  572
               LP +YQG+K++ VWS ++ GN+VPV P   V +       II     +DG +R    
Sbjct  105  KTSLPTTYQGHKEINVWSPYVYGNAVPVAPYNAVSLTQDQSSGIIPLMFKIDGRVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDF---------GSTSISSSPVQSCHVEV  680
                G   L   CPA+++F         G+ ++    VQSC V V
Sbjct  165  TFITGKYHLYVRCPAYINFGDRQAGTAVGNNAVKYQLVQSCSVSV  209



>ref|XP_004249410.1| PREDICTED: protein YLS9-like [Solanum lycopersicum]
Length=211

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 90/165 (55%), Gaps = 10/165 (6%)
 Frame = +3

Query  162  VLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIP  341
            +L+  F  L  I L  A+   +   +PRF L+ AT+ NFN++A N+ +T+I V + A  P
Sbjct  24   ILIFLFVVLLTILLVWAI---LQPKKPRFILQDATIFNFNVSAPNIFSTSIQVTIFARNP  80

Query  342  YRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG---  512
                G+YYD++  YA Y NQ +T    +P+ YQG+KDV +WS F+  N+VP+ P  G   
Sbjct  81   NDKVGVYYDKMKTYANYHNQQITYYTQIPSVYQGHKDVNIWSPFVFSNNVPISPYNGPDL  140

Query  513  ----MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGS  635
                  G V ++  +DG ++     +  G   L   C A++ FG+
Sbjct  141  KEDQQNGGVWLDFKIDGRVKWRVGTITTGHYHLHVTCTAYVPFGN  185



>ref|XP_007015709.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family, putative [Theobroma cacao]
 gb|EOY33328.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family, putative [Theobroma cacao]
Length=205

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 90/155 (58%), Gaps = 12/155 (8%)
 Frame = +3

Query  117  EMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGN  296
            + K  L K+        L+ F+ +  +   +   A+     PRF L+  T++ FNLTA N
Sbjct  10   DRKKQLVKRIVLAIVGFLIVFAIVVFLVWAILHPAK-----PRFILQDVTIYAFNLTAPN  64

Query  297  LLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFL  476
             LT+N+ + L++  P    GIYY +L +YA YRNQ +TLP  LP +YQG++D+ +WS FL
Sbjct  65   FLTSNMQITLSSRNPNDRIGIYYQKLDMYASYRNQQITLPTLLPRTYQGHQDLTIWSPFL  124

Query  477  SGNSVPVEP----GVGM---AGRVLVNIIVDGWIR  560
             G++VPV P    G+     AG VL+NI V G ++
Sbjct  125  YGDAVPVAPFLEAGLSQDMNAGLVLLNIKVFGQLK  159



>gb|ACU24209.1| unknown [Glycine max]
Length=209

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 86/165 (52%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            ++P F L+  T++ FN T  N LT++  V L++  P    G+YYDRL  Y  YRNQ VT 
Sbjct  45   SKPTFILQDVTVYGFNATIPNFLTSSFQVTLSSRNPNDKIGVYYDRLDTYVTYRNQQVTY  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMA-----GRVLVNIIVDGWIRKHFW  572
               +P SYQG+K+  VWS F+ G +VPV P   VG++     G VLV + +DG +R    
Sbjct  105  RTSIPPSYQGHKEEDVWSPFVFGTNVPVAPFNFVGLSQDQTNGNVLVLVKIDGKVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDFGSTS---------ISSSPVQSCHVEV  680
                G   L   CPAF+ FG  S         +    VQ C V V
Sbjct  165  TFVSGHYNLYVRCPAFITFGPQSTGIALGKNAVKYQLVQRCTVGV  209



>ref|XP_010683607.1| PREDICTED: uncharacterized protein LOC104898254 [Beta vulgaris 
subsp. vulgaris]
Length=209

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 86/165 (52%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            ++P F L+ AT +NFNLT+   LT+   V + A       GIYYD+L+ YA Y +Q +TL
Sbjct  45   SKPSFILQDATQYNFNLTSPAQLTSIFQVTIQARNSNDKIGIYYDKLNTYATYHDQQITL  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
            P  +P +YQ    + +WS FL G SVP+ P +G         G V + I +DG +R    
Sbjct  105  PTSIPPTYQDSNGMNIWSPFLQGQSVPIAPYIGSQINQEMEMGSVRLVIKMDGRVRWRVG  164

Query  573  NLEVGPCRLSANCPAFLDFGS---------TSISSSPVQSCHVEV  680
            +   GP R+  NC AF+ FG+          +I    +Q C V V
Sbjct  165  SFISGPYRIHVNCQAFIPFGNPNSGIYVGRNAIKYQLIQGCGVSV  209



>ref|XP_007202566.1| hypothetical protein PRUPE_ppa011438mg [Prunus persica]
 gb|EMJ03765.1| hypothetical protein PRUPE_ppa011438mg [Prunus persica]
Length=210

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 96/187 (51%), Gaps = 17/187 (9%)
 Frame = +3

Query  168  LLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYR  347
            LL F+ +  +++ +   A +  ++PRF L+  T+ NFN +  N+ +++  V +++  P  
Sbjct  25   LLIFNFILLVTILIVW-AILQPSKPRFILQDVTVFNFNNSVPNVFSSSFQVTVSSRNPND  83

Query  348  HRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM----  515
              GIYYDRL++YA YRNQ +T    +P  YQG+KDV VWS F+ G  VP+ P   +    
Sbjct  84   KIGIYYDRLNIYATYRNQQITFSTLIPPVYQGHKDVNVWSPFIYGTEVPIAPYNSLALDQ  143

Query  516  ---AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDF---------GSTSISSSPV  659
               AG V + + +DG +R        G       CPAF+           G+ +I    +
Sbjct  144  DKNAGSVFLLLKMDGRVRWKVGTFISGRYHFYVRCPAFIPLGPKNNGVVVGNNAIKYQLL  203

Query  660  QSCHVEV  680
            Q C V V
Sbjct  204  QHCKVSV  210



>ref|XP_009126867.1| PREDICTED: uncharacterized protein LOC103851746 [Brassica rapa]
Length=209

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 90/161 (56%), Gaps = 19/161 (12%)
 Frame = +3

Query  246  FFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPL  425
            F L+  T++ FN++  NLLT+N+ V L++H P    GI Y+RL +YA YRNQ VTL   L
Sbjct  52   FVLQDVTIYEFNISQPNLLTSNLQVTLSSHNPNDKIGILYERLDIYASYRNQEVTLAHLL  111

Query  426  PASYQGYKDVAVWSAFLSGNSVPVE----PGVGM---AGRVLVNIIVDGWIRKHFWNLE-  581
            P +YQG+ +V VWS  L+G +V VE    P +      G VL+NI +DG ++   W +  
Sbjct  112  PETYQGHLEVTVWSPVLTGTAVSVELYLTPALNEDINGGMVLLNIKIDGCVK---WKVGT  168

Query  582  -VGPC-RLSANCPAFLDFGSTSISSSP------VQSCHVEV  680
             V  C RL  NCPA + F      + P       Q C V+V
Sbjct  169  WVSECYRLLVNCPASIPFSGQLAGTGPAIKDQLAQQCAVDV  209



>ref|XP_004977335.1| PREDICTED: uncharacterized protein LOC101786529 [Setaria italica]
Length=209

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 89/165 (54%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            T PRFFL+ A+L   +L+ G  N+L+T + V +A+  P    G+YYDRL VYA Y+ Q +
Sbjct  45   THPRFFLQDASLRQLDLSNGSSNVLSTTLQVTVASRNPNDRVGVYYDRLDVYASYKYQQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKH  566
            T+ A LP  YQG+ DV VWS  L+G SVP  P +         AG +++ + +DG +R  
Sbjct  105  TVAASLPPVYQGHGDVDVWSPVLAGPSVPFAPYLADALSQDCQAGYLILQVKIDGRVRWK  164

Query  567  FWNLEVGPCRLSANCPAFLDF-------GSTSISSSPVQSCHVEV  680
              +   G   L   CPAFL         G++        +CHVEV
Sbjct  165  VGSWISGHYHLFVTCPAFLVTNGGNGAPGASGFKFQTTTTCHVEV  209



>gb|EMT21365.1| hypothetical protein F775_29179 [Aegilops tauschii]
Length=208

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 88/164 (54%), Gaps = 15/164 (9%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLT-AGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVT  410
            T PRFFL+ A+L   NL+ +  LL+T+I V +A+  P    G+YYDRL VYA Y+ Q +T
Sbjct  45   THPRFFLQDASLRQLNLSNSSGLLSTSIQVTVASRNPNDRVGVYYDRLDVYASYKYQQIT  104

Query  411  LPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHF  569
            + A LPA YQG+ DV VWS  L G +VP  P +         AG +++ + +DG +R   
Sbjct  105  VAASLPAVYQGHGDVDVWSPVLDGPNVPFAPYLASAISQDCQAGYLILQVKIDGRVRWKV  164

Query  570  WNLEVGPCRLSANCPAFLDF-------GSTSISSSPVQSCHVEV  680
             +   G   L   CPAFL         G++         CHVEV
Sbjct  165  GSWISGHYHLFVTCPAFLVTSGGNGAPGASGFKFQTTTYCHVEV  208



>ref|XP_006399104.1| hypothetical protein EUTSA_v10015955mg [Eutrema salsugineum]
 gb|ESQ40557.1| hypothetical protein EUTSA_v10015955mg [Eutrema salsugineum]
Length=213

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 103/196 (53%), Gaps = 15/196 (8%)
 Frame = +3

Query  81   TSSDPPPHAPSGEMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRH  260
            T+ D   H      +  + ++   C C + + F  L    +  A+   +  ++PRF L+ 
Sbjct  2    TTRDCSSHHSDASRRRKMIRR---CGCPIFILFVMLIIFLIAFAI---LKPSKPRFILQD  55

Query  261  ATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPAS  434
            AT+ +FN++    NLLT+N  + L +  P    GIYYDRL  YA Y++Q +T    +PA+
Sbjct  56   ATVFSFNVSGNPPNLLTSNFQITLNSRNPNGKIGIYYDRLDAYASYQSQQITYATSIPAT  115

Query  435  YQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPC  593
            YQ +++V VWS F+ G SVPV P   ++       G + + + +DG +R    +   G  
Sbjct  116  YQRHQEVNVWSPFVGGKSVPVAPYNALSLDQEQTRGAIKLVVHIDGRVRFKVGDYTTGTR  175

Query  594  RLSANCPAFLDFGSTS  641
             L   CPA+++ G+++
Sbjct  176  HLYVRCPAYINSGNSA  191



>ref|XP_006577095.1| PREDICTED: protein YLS9-like [Glycine max]
Length=252

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 86/165 (52%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            ++P F L+  T++ FN T  N LT++  V L++  P    G+YYDRL  Y  YRNQ VT 
Sbjct  88   SKPTFILQDVTVYGFNATIPNFLTSSFQVTLSSRNPNDKIGVYYDRLDTYVTYRNQQVTY  147

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMA-----GRVLVNIIVDGWIRKHFW  572
               +P SYQG+K+  VWS F+ G +VPV P   VG++     G VLV + +DG +R    
Sbjct  148  RTSIPPSYQGHKEEDVWSPFVFGTNVPVAPFNFVGLSQDQTNGNVLVLVKIDGKVRWKVG  207

Query  573  NLEVGPCRLSANCPAFLDFGSTS---------ISSSPVQSCHVEV  680
                G   L   CPAF+ FG  S         +    VQ C V V
Sbjct  208  TFVSGHYNLYVRCPAFITFGPQSTGIALGKNAVKYQLVQRCTVGV  252



>ref|XP_009408284.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=213

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 96/180 (53%), Gaps = 16/180 (9%)
 Frame = +3

Query  147  FNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAG-NLLTTNISVA  323
            F     ++L    +F I L +  S      +P F+L+ A++  FN TAG NLLT  + V 
Sbjct  26   FGALSFIILVLLAIFIIWLVLRPS------KPSFYLQDASIAQFNFTAGTNLLTAIMQVT  79

Query  324  LAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP  503
            +++  P    GIYYD+L  +AVY+ Q VT    LP  YQG+ DV VWS +L G +VPV P
Sbjct  80   VSSRNPNDRIGIYYDKLDAFAVYQEQRVTTSTELPTGYQGHNDVVVWSPYLYGAAVPVTP  139

Query  504  GVGM-------AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL--DFGSTSISSSP  656
             + +       AG +LV+I V+G +R        G   +  +CPAF+  D GS S   +P
Sbjct  140  YLSVALDQANAAGLLLVDINVEGRLRWKVGTWTSGHYHIHVSCPAFMAIDHGSGSNGDAP  199



>ref|XP_006430080.1| hypothetical protein CICLE_v10012768mg [Citrus clementina]
 gb|ESR43320.1| hypothetical protein CICLE_v10012768mg [Citrus clementina]
Length=209

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 90/165 (55%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT++ FN++  N+LT++  V +++  P    GIYYD+L +YA Y NQ +T 
Sbjct  45   TKPRFILQDATVYVFNVSNPNVLTSSFQVTISSRNPNDRIGIYYDKLDLYATYHNQQITY  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMAGRVLVNII-----VDGWIRKHFW  572
               LP +YQG+K++ VWS ++ GN+VPV P   V +       II     +DG +R    
Sbjct  105  KTSLPTTYQGHKEINVWSPYVYGNAVPVAPYNAVSLTQDQSSGIIPLMFKIDGRVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDF---------GSTSISSSPVQSCHVEV  680
                G   L   C A+++F         G+ ++    VQSC V V
Sbjct  165  TFITGKYHLYVRCSAYINFGDRQAGTAVGNNAVKYQLVQSCSVSV  209



>gb|KEH24226.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Medicago truncatula]
Length=210

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 95/190 (50%), Gaps = 20/190 (11%)
 Frame = +3

Query  162  VLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIP  341
            +++  F  L  I +  A+   +  ++P F L+  T++ FN T  N LT+N  V +++  P
Sbjct  24   IIIFLFIVLVTILIIWAV---LKPSKPSFILQDVTVYAFNATVPNFLTSNFQVTVSSRNP  80

Query  342  YRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-  518
                GIYYDRL  Y  YR+Q +T    +P SYQG+K+V VWS F+ G +VPV P   +A 
Sbjct  81   NDKIGIYYDRLDSYVTYRSQQITYRTAIPPSYQGHKEVDVWSPFVYGTNVPVAPYNSVAL  140

Query  519  ------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG----------STSISS  650
                  G VLV +  DG +R        G   +   CPAF+ FG          S ++  
Sbjct  141  SQDQDNGNVLVVVKFDGRVRWKVGAFISGHYHIFVRCPAFITFGPRSNGISVGDSGAVKY  200

Query  651  SPVQSCHVEV  680
              VQ C V V
Sbjct  201  QIVQRCTVSV  210



>ref|XP_011021994.1| PREDICTED: protein YLS9-like [Populus euphratica]
 ref|XP_011013566.1| PREDICTED: protein YLS9-like [Populus euphratica]
Length=203

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 93/161 (58%), Gaps = 12/161 (7%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF ++ AT++  N +  NLLT ++ V L+   P  H GIYY++L V+A+Y++Q +T  
Sbjct  43   KPRFIIQDATVYGLNFSNPNLLTCSMQVTLSTRNPNGHIGIYYEKLDVHAIYQHQRITQA  102

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWN  575
              LP +Y  +++V+VWS FL G  VP+ P V         +G V ++I V+G ++    +
Sbjct  103  TALPRTYLDHEEVSVWSPFLYGKDVPISPLVAAGLMEDLKSGCVSLDIKVNGRLKWKLGS  162

Query  576  LEVGPCRLSANCPAFLDFGSTSISSSP-----VQSCHVEVH  683
              +G  +L ANCPA++  G+ S   S      VQ C V+V 
Sbjct  163  SMIGKYQLIANCPAYIPLGNPSKMESAVKYEFVQLCKVKVE  203



>ref|XP_002307147.1| harpin-induced family protein [Populus trichocarpa]
 gb|EEE94143.1| harpin-induced family protein [Populus trichocarpa]
Length=203

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 103/199 (52%), Gaps = 12/199 (6%)
 Frame = +3

Query  123  KDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLL  302
            K+D P         LL   + +F     +    Q    +PRF ++ AT++  N +  NLL
Sbjct  5    KNDAPDGKTKGRFCLLASGALIFVGIAVLLYLTQFQPHKPRFIIQDATVYGLNFSNPNLL  64

Query  303  TTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSG  482
            T ++ V L+   P  H GIYY++L V+A+Y++Q +TL   LP +Y  +++V+VWS  L G
Sbjct  65   TCSMQVTLSTRNPNAHFGIYYEKLDVHAIYQHQQITLATALPGTYLDHEEVSVWSPVLYG  124

Query  483  NSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
              VP+ P V         +G V ++I V G ++    +  +G  +L ANCPA++  G+ S
Sbjct  125  KDVPISPLVAAGLMEDLQSGCVSLDIKVYGRLKWKLGSSMIGKYQLIANCPAYIPLGNPS  184

Query  642  ISSSP-----VQSCHVEVH  683
               S      VQ C V+V 
Sbjct  185  KMESAVKYEFVQLCKVKVE  203



>gb|KFK25035.1| hypothetical protein AALP_AA8G058200 [Arabis alpina]
Length=213

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 85/150 (57%), Gaps = 9/150 (6%)
 Frame = +3

Query  219  AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVY  392
            A +  ++P F L+ AT+  FN+T    NLLT+N    L++  P    GIYYDRL VYA Y
Sbjct  42   AVLKPSKPHFILQDATVFTFNVTGDPPNLLTSNFQFTLSSRNPNDKIGIYYDRLDVYASY  101

Query  393  RNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDG  551
            ++Q +T P  +P  YQG+K+V VWS F+ G SV V P   +A       G V + + +DG
Sbjct  102  QSQQITYPTSIPPVYQGHKEVNVWSPFVGGKSVSVAPYNALALNQDHTHGGVALLVRIDG  161

Query  552  WIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
             IR        G   L   CPA+++FG+++
Sbjct  162  RIRWKHGAFTTGKYHLYVRCPAYINFGNSA  191



>emb|CDY29084.1| BnaC07g32900D [Brassica napus]
Length=172

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 78/136 (57%), Gaps = 7/136 (5%)
 Frame = +3

Query  255  RHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPAS  434
            R   +  FNL+  NLLTTN  V  A+  P    GIYYDRLHVYA YRNQ +TL   +P +
Sbjct  15   RRHQIFAFNLSQPNLLTTNFQVTFASRNPNSKIGIYYDRLHVYATYRNQQITLRTAIPPT  74

Query  435  YQGYKDVAVWSAFLSGNSVPVEPGVGMA-----GRVLVNIIV--DGWIRKHFWNLEVGPC  593
            YQG+K+  VWS F+ G +VP+ P   +A     GR  V +++  DG +R     L  G  
Sbjct  75   YQGHKEDNVWSPFVYGTAVPIAPYNSVALGDEQGRGFVGLMIRADGRVRWKVGTLITGKY  134

Query  594  RLSANCPAFLDFGSTS  641
             +   CPA+++ G+ +
Sbjct  135  HIHVRCPAYINLGNKA  150



>gb|KHN19916.1| hypothetical protein glysoja_032396 [Glycine soja]
Length=199

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 93/162 (57%), Gaps = 20/162 (12%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTN--ISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            T+PRF L+ ATL  FNL+     T    + V L++H P    G+YY  LHVYA YR+Q +
Sbjct  45   TKPRFTLQDATLFTFNLSTPTPNTLTLTMQVTLSSHNPNARVGVYYHALHVYASYRSQQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMAGRVLVNIIVDGWIRKHFWNLEVG  587
            +L   LP +YQG++D AVWS FL GN VPV         V+VN+ V+G ++    +   G
Sbjct  105  SLATALPDTYQGHRDFAVWSPFLFGNVVPVSA-------VMVNVKVNGRVKWKVGSWVSG  157

Query  588  PCRLSANCPAFLDF-GSTSIS-----SSPV-----QSCHVEV  680
               +  NCPA++ F G  SI+     +SPV     QSC+V+V
Sbjct  158  RYHIYVNCPAYISFAGDRSIAAGGLVASPVKFRLLQSCNVDV  199



>gb|KHN02173.1| hypothetical protein glysoja_002197 [Glycine soja]
Length=210

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 99/187 (53%), Gaps = 17/187 (9%)
 Frame = +3

Query  168  LLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYR  347
            ++ F+ +  +++ + + A +  ++P F L+  T++ FN T  N LT++  V L++  P  
Sbjct  25   IVIFAFIVLLTVLI-IWAILKPSKPTFILQDVTVYGFNATIPNFLTSSFQVTLSSRNPND  83

Query  348  HRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPG--VGMA-  518
              G+YYDRL  Y  YRNQ VT    +P SYQG+K+  VWS F+ G +VPV P   VG++ 
Sbjct  84   KIGVYYDRLDTYVTYRNQQVTYRTSIPPSYQGHKEEDVWSPFVYGTNVPVAPYNFVGLSQ  143

Query  519  ----GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS---------ISSSPV  659
                G VLV + +DG +R    +       L+  CPAF+ FG  S         +    V
Sbjct  144  DQTNGNVLVLVKIDGKVRWKVGSFVSAHYNLNVRCPAFITFGPQSNGIALGNNAVKYQLV  203

Query  660  QSCHVEV  680
            Q C V V
Sbjct  204  QRCTVGV  210



>ref|XP_008376811.1| PREDICTED: protein YLS9 [Malus domestica]
Length=211

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 90/165 (55%), Gaps = 9/165 (5%)
 Frame = +3

Query  165  LLLFFSTLFCISLCVAMSAQISL--TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHI  338
            L L FST     L + +   + L  T+P F L+ A ++  NL+ G+LL  ++ + L +  
Sbjct  27   LFLLFSTFATTILSIILLVWLILRPTKPEFSLKEADIYQLNLSGGHLLNXSVQLTLLSKN  86

Query  339  PYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG--  512
            P +  GIYYD L VYAVY+ Q +TL   LP  YQG++D  V +A L G  +PV+P  G  
Sbjct  87   PNQKVGIYYDELKVYAVYKGQQITLYTSLPPFYQGHEDTNVLTASLVGIGLPVDPSFGYE  146

Query  513  -----MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG  632
                  AGR+++N+ V G IR        G  R++ +C A + FG
Sbjct  147  VGRDQTAGRLVLNLKVIGRIRWKVGTWVSGKYRVTVDCLAVMAFG  191



>gb|EMS49822.1| hypothetical protein TRIUR3_30722 [Triticum urartu]
Length=208

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 88/164 (54%), Gaps = 15/164 (9%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLT-AGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVT  410
            T PRFFL+ A+L   NL+ +  LL+T++ V +A+  P    G+YYDRL VYA Y+ Q +T
Sbjct  45   THPRFFLQDASLRQLNLSNSSGLLSTSLQVTVASRNPNDRVGVYYDRLDVYASYKYQQIT  104

Query  411  LPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHF  569
            + A LPA YQG+ DV VWS  L G +VP  P +         AG +++ + +DG +R   
Sbjct  105  VAASLPAVYQGHGDVDVWSPVLDGPNVPFAPYLASAISQDCQAGYLILQVKIDGRVRWKV  164

Query  570  WNLEVGPCRLSANCPAFLDF-------GSTSISSSPVQSCHVEV  680
             +   G   L   CPAFL         G++         CHVEV
Sbjct  165  GSWVSGHYHLFVTCPAFLVTSGGNGAPGASGFKFQTTTYCHVEV  208



>ref|XP_006662749.1| PREDICTED: protein YLS9-like [Oryza brachyantha]
Length=208

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 101/201 (50%), Gaps = 17/201 (8%)
 Frame = +3

Query  123  KDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLT-AGNL  299
             DD+ +       VLL     +  I+L V +   +  T PRFFL+ ATL   + + A  L
Sbjct  10   DDDVRQACRRLLAVLLGLAFVVAIIALIVYLV--LRPTHPRFFLQDATLRQLDGSNASAL  67

Query  300  LTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLS  479
            L+T+I V LA+  P    G+YYDRL VYA Y+ Q +TL A LP  YQG+ DV VWS  L+
Sbjct  68   LSTSIQVTLASRNPNDRVGVYYDRLDVYASYKYQQITLAASLPPVYQGHGDVDVWSPVLA  127

Query  480  GNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDF---  629
            G +VP  P +G A       G +++ + VDG +R    +   G   L   CPAF      
Sbjct  128  GPNVPFAPYLGDALAKDLASGYLILQVKVDGRVRWKVGSWISGHYHLFVTCPAFFITSGG  187

Query  630  ----GSTSISSSPVQSCHVEV  680
                G++ +       C VEV
Sbjct  188  NGYPGASGLKFQTATYCRVEV  208



>ref|XP_006299502.1| hypothetical protein CARUB_v10015672mg [Capsella rubella]
 gb|EOA32400.1| hypothetical protein CARUB_v10015672mg [Capsella rubella]
Length=213

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 85/145 (59%), Gaps = 9/145 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            ++PRF L+ AT++ FN++    NLLT+N  + L++  P    GIYYDRL VYA YR+Q +
Sbjct  45   SKPRFVLQDATVYAFNVSGNPPNLLTSNFQITLSSRNPNDKIGIYYDRLDVYATYRSQQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMA-----GRVLVNIIVDGWIRKH  566
            T    +P +YQG+K+V +WS F+ G SVPV P   VG+      G V++ I  DG +R  
Sbjct  105  TFRTSIPPTYQGHKEVNIWSPFVYGTSVPVAPFNAVGLDQDQDNGAVMLIIRADGRVRWK  164

Query  567  FWNLEVGPCRLSANCPAFLDFGSTS  641
                  G   L   C A+++F + +
Sbjct  165  VGTFITGKYHLYVKCRAYINFNNKA  189



>gb|EMS52142.1| hypothetical protein TRIUR3_06942 [Triticum urartu]
Length=208

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 99/194 (51%), Gaps = 17/194 (9%)
 Frame = +3

Query  150  NCCCVLLLFFSTLFCISLCVAMSAQISL--TQPRFFLRHATLHNFNLT-AGNLLTTNISV  320
            N C  LL     L  I   +A+   + L  T P FFL+ A+L   +L+ +  LL+T++ V
Sbjct  15   NGCRRLLKVLLGLAFIVAVIALIVYLVLRPTHPGFFLQDASLRQLDLSNSSGLLSTSLQV  74

Query  321  ALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVE  500
             +A+  P    G+YYDRL VYA Y++Q +T+ A LPA YQG+ DV VWS  L G +VP  
Sbjct  75   TVASRNPNDRVGVYYDRLDVYASYKDQQITVAASLPAVYQGHGDVDVWSPVLDGPNVPFA  134

Query  501  PGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDF-------GST  638
            P +         AG +++++ +DG +R    +   G   L   C A LD        G++
Sbjct  135  PYLASAISQDCQAGHLVLHVKIDGRVRWKVGSWISGHYHLFVTCQALLDTVSGNRAPGAS  194

Query  639  SISSSPVQSCHVEV  680
                     CHVEV
Sbjct  195  GFKFQKTTGCHVEV  208



>gb|ABY88510.1| NHL1, partial [Arabidopsis thaliana]
Length=181

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 80/145 (55%), Gaps = 9/145 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTN--ISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            ++PRF L+ AT++ FN+             + L++  P    GIYYDRL VYA YR+Q +
Sbjct  36   SKPRFILQDATVYAFNVXXXXXXXXXXXFQITLSSRNPNNKIGIYYDRLDVYATYRSQQI  95

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKH  566
            T P  +P +YQG+KDV +WS F+ G SVP+ P  G++       G VL+ I  DG +R  
Sbjct  96   TFPTSIPPTYQGHKDVDIWSPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRADGRVRWK  155

Query  567  FWNLEVGPCRLSANCPAFLDFGSTS  641
                  G   L   CPA+++FG  +
Sbjct  156  VGTFITGKYHLHVKCPAYINFGDKA  180



>ref|XP_007150038.1| hypothetical protein PHAVU_005G120900g [Phaseolus vulgaris]
 gb|ESW22032.1| hypothetical protein PHAVU_005G120900g [Phaseolus vulgaris]
Length=250

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 92/177 (52%), Gaps = 28/177 (16%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG-----------NLLTTNISVALAAHIPYRHRGIYYDRLHV  380
            T+PRF L+ AT++ FNL++            N LT  + V L+A  P    G+YY +L  
Sbjct  74   TKPRFLLQDATVYAFNLSSSGAIPSPTAPTPNTLTLTMQVTLSAFNPNHRIGVYYTKLDA  133

Query  381  YAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGV-------GMAGRVLVNI  539
            YA YR Q V+L   LP +YQG++D AVWS FL GN+VPV P +         +G VLVN+
Sbjct  134  YASYRGQQVSLATALPPTYQGHRDTAVWSPFLYGNAVPVSPFMLEILQQDKTSGGVLVNV  193

Query  540  IVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS----------ISSSPVQSCHVEV  680
             V+G ++        G   ++ NCPA++     S          +    +QSC V+V
Sbjct  194  KVNGRVKWKVGTWVSGRYHINVNCPAYIRLAGDSDDAIGVAAPAVKFQLLQSCIVDV  250



>gb|ACU15564.1| unknown [Glycine max]
Length=227

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 94/165 (57%), Gaps = 8/165 (5%)
 Frame = +3

Query  168  LLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYR  347
            ++ F+ +  +++ + + A +  ++P F L+  T++ FN T  N LT++  V L++  P  
Sbjct  25   IVIFAFIVLLTVLI-IWAILKPSKPTFILQDVTVYGFNATIPNFLTSSFQVTLSSRNPND  83

Query  348  HRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPG--VGMA-  518
              GIYYDRL+ Y  YR+Q VT    +P SYQG+K+  VWS F+ G +VPV P   VG++ 
Sbjct  84   KIGIYYDRLNTYVTYRSQQVTYRTSIPPSYQGHKEEDVWSPFVYGTNVPVAPYNFVGLSQ  143

Query  519  ----GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
                G VLV + +DG +R    +       L+  CPAF+ FG  S
Sbjct  144  DQTNGNVLVLVKIDGKVRWKVGSFVSAHYNLNVRCPAFITFGPQS  188



>ref|XP_007218403.1| hypothetical protein PRUPE_ppa011423mg [Prunus persica]
 gb|EMJ19602.1| hypothetical protein PRUPE_ppa011423mg [Prunus persica]
Length=211

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 96/176 (55%), Gaps = 10/176 (6%)
 Frame = +3

Query  165  LLLFFSTLFCISLCVAMSAQISL--TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHI  338
            L L FSTL    L + +   + L  T+P F L+ A ++  NL+ G+LL +++ + L +  
Sbjct  27   LFLVFSTLSTTILSIILLVWLILHPTKPEFSLKEADIYQLNLSGGHLLNSSVQLTLLSKN  86

Query  339  PYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG--  512
            P +  GIYYD L VYA Y+ Q +T+   LP  YQG++D  V +A L G  +PV P  G  
Sbjct  87   PNQKVGIYYDELKVYAAYKGQQITVYTSLPPFYQGHEDSNVLTASLVGTGLPVAPSFGYE  146

Query  513  -----MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTSISSSPVQS  665
                  AGR+++N+ V G +R        G  R++ +C A + FG  SI + P+ S
Sbjct  147  VGRDQTAGRLVLNLKVIGRLRWKVGTWVSGKYRVNVDCLAVMAFGP-SIPTGPLTS  201



>ref|XP_003539845.1| PREDICTED: protein YLS9-like [Glycine max]
Length=213

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 92/169 (54%), Gaps = 20/169 (12%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTN--ISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            T+P F L+ ATL+ FNL+     T    + V L++H P    G+YY  L VYA YR+Q +
Sbjct  45   TKPHFTLQDATLYAFNLSTPTPNTLTLTMQVTLSSHNPNARIGVYYHALRVYASYRSQQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGV--------GMAGRVLVNIIVDGWIRK  563
            +L   LP +YQG++D AVWS FL GN VPV P V          AG V+VN+ V+G ++ 
Sbjct  105  SLATALPDTYQGHRDFAVWSPFLFGNVVPVSPFVLTSLQQDQSAAGAVVVNVKVNGRVKW  164

Query  564  HFWNLEVGPCRLSANCPAFLDFGS-----TSISSSPV-----QSCHVEV  680
               +   G   +  NCPA++ F         + +SPV     QSC V+V
Sbjct  165  KVGSWVSGRYHIYVNCPAYISFAGDRSNVAGVVASPVKFRLLQSCSVDV  213



>ref|XP_009361278.1| PREDICTED: protein YLS9-like [Pyrus x bretschneideri]
Length=211

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 95/174 (55%), Gaps = 10/174 (6%)
 Frame = +3

Query  165  LLLFFSTLFCISLCVAMSAQISL--TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHI  338
            L L FST     L + +   + L  T+P F L+ A ++  NL+ G+LL +++ + L +  
Sbjct  27   LFLLFSTFATTILSIILLVWLILRPTKPEFSLKEADIYQLNLSGGHLLNSSVQLTLLSKN  86

Query  339  PYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG--  512
            P +  GIYYD L VYAVY+ Q +TL   LP  YQG++D  V +A L    +PV+P  G  
Sbjct  87   PNQKVGIYYDELKVYAVYKGQQITLYTSLPPFYQGHEDSNVLTASLVAIGLPVDPSFGYE  146

Query  513  -----MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTSISSSPV  659
                  AGR+++N+ V G IR        G  R++ +C A + FG  SI + P+
Sbjct  147  VGRDQTAGRLVLNLKVIGRIRWKVGTWVSGKYRVTVDCLAVMAFGP-SIPTGPL  199



>ref|XP_004497664.1| PREDICTED: uncharacterized protein At1g08160-like [Cicer arietinum]
Length=209

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 78/141 (55%), Gaps = 7/141 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P F L  AT++ FN +  N LT+N  + L++  P  H GIYYDRL  Y  YR+Q +T 
Sbjct  45   TKPTFILLDATVYAFNASQPNFLTSNFQITLSSRNPNDHIGIYYDRLDTYITYRSQQITY  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
               +P SYQG+K+  VWS F+ G +VPV P   +        G + V + +DG +R    
Sbjct  105  RTSIPPSYQGHKEFDVWSPFVYGTNVPVAPFNFLTLSQDQSNGNLYVTVKIDGRVRWKVG  164

Query  573  NLEVGPCRLSANCPAFLDFGS  635
             L  G   L  +CPAF+  G+
Sbjct  165  TLITGHYHLYVHCPAFIALGN  185



>ref|XP_010423353.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=211

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 94/168 (56%), Gaps = 9/168 (5%)
 Frame = +3

Query  165  LLLFFSTLFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAH  335
            +++ F  LF I L V +    +  ++PRF L  A + NFN++    N+L +N  V++++ 
Sbjct  22   VIILFVILFVIILAVFLVWVVLQPSKPRFSLEEAIVSNFNISGNPLNILNSNFQVSISSE  81

Query  336  IPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM  515
             P    GIYYDRL++YA Y NQ +T    +  +YQG+K+V +WS  + GNSVPV   +G+
Sbjct  82   NPNDKIGIYYDRLNLYASYHNQQITWQTAISPTYQGHKEVKMWSPIIGGNSVPVSSVIGL  141

Query  516  ------AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
                   G + + + + G IR    +   G   L  NCPA ++ G+++
Sbjct  142  PIVPDQPGTIELTLYLFGQIRWKVGSFITGEYHLHVNCPASINVGNSA  189



>ref|XP_003519121.1| PREDICTED: protein YLS9-like [Glycine max]
Length=207

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 83/165 (50%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P F L+  T++ FN T  N LT+N  V L +  P  + G+YYDRL +Y +YR+Q +T 
Sbjct  43   TKPTFTLQDVTVYAFNATIPNFLTSNFQVTLISRNPNDNIGVYYDRLEIYVIYRSQQITY  102

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
               +P +YQG+ ++ VWS F+ G ++PV P   +        G VLV I  DG +R    
Sbjct  103  RTAIPPTYQGHNEINVWSPFVYGTNIPVAPFNFLRLSQDQSDGNVLVTIRADGRVRWKVG  162

Query  573  NLEVGPCRLSANCPAFLDFGSTS---------ISSSPVQSCHVEV  680
                G       CPAF+ FG  S         I    +Q C V V
Sbjct  163  AFISGRYHFYVRCPAFISFGPRSNGIVVGENAIKFQIIQRCSVSV  207



>ref|NP_181141.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 gb|AAD21460.1| putative harpin-induced protein [Arabidopsis thaliana]
 gb|AEC09184.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
Length=211

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 94/186 (51%), Gaps = 22/186 (12%)
 Frame = +3

Query  165  LLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPY  344
            +++   T+F +S+       +   +P F L+  T++ FNL+  NLLT+   + +A+    
Sbjct  30   IIIVLMTIFLVSII------LQPKKPEFILQDTTVYAFNLSQPNLLTSKFQITIASRNRN  83

Query  345  RHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA--  518
             + GIYYD LH YA YRNQ +TL + LP +YQ +K+ +VWS  L GN VP+ P   +A  
Sbjct  84   SNIGIYYDHLHAYASYRNQQITLASDLPPTYQRHKENSVWSPLLYGNQVPIAPFNAVALG  143

Query  519  -----GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLD---------FGSTSISSSP  656
                 G   + I VDG +R     L +G   L   C AF++          G  ++  + 
Sbjct  144  DEQNSGVFTLTICVDGRVRWKVGTLTIGNYHLHVRCQAFINQADKAAGVHVGENTVKYTL  203

Query  657  VQSCHV  674
            +  C V
Sbjct  204  INKCSV  209



>ref|XP_010456417.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=211

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 93/168 (55%), Gaps = 9/168 (5%)
 Frame = +3

Query  165  LLLFFSTLFCISLCVAMS-AQISLTQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAH  335
            +++ F  LF I L V +    +  ++PRF L  A + NFN++    N+L +N  V++++ 
Sbjct  22   VIILFVILFVIILAVFLVWVVLQPSKPRFSLEEAIVSNFNISGNPLNILNSNFQVSISSE  81

Query  336  IPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM  515
             P    GIYYDRL+VYA Y NQ +T    +  +YQG+K+  +WS  + GNSVPV   +G+
Sbjct  82   NPNDKIGIYYDRLNVYASYHNQQITWQTAISPTYQGHKETKMWSPIIGGNSVPVSSVIGL  141

Query  516  ------AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS  641
                   G + + + + G IR    +   G   L  NCPA ++ G+++
Sbjct  142  PIVQDQPGTIELTLYLFGQIRWKVGSFITGEYHLHVNCPASINVGNSA  189



>ref|XP_009121251.1| PREDICTED: protein YLS9 [Brassica rapa]
Length=211

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 82/145 (57%), Gaps = 9/145 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG--NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            ++PRF L+ AT++ FN++    NLLT+N  + L++  P    GIYYDRL VYA Y +Q +
Sbjct  45   SKPRFILQDATVYAFNVSGNPPNLLTSNFQITLSSRNPNDKIGIYYDRLDVYATYHSQQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP-------GVGMAGRVLVNIIVDGWIRKH  566
            T    +P +YQG+K+V +WS F+ G SVPV P       G    G V + I  DG +R  
Sbjct  105  TFRTSIPPTYQGHKEVNIWSPFVYGTSVPVAPFNAVSLDGDQDNGAVTLIIRADGRVRWK  164

Query  567  FWNLEVGPCRLSANCPAFLDFGSTS  641
                  G   L   C A+++FG+ +
Sbjct  165  VGTFITGKYHLYVRCLAYINFGNKA  189



>gb|AFK46782.1| unknown [Medicago truncatula]
Length=221

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 107/218 (49%), Gaps = 34/218 (16%)
 Frame = +3

Query  114  GEMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAG  293
            G+ +  L ++ F    +L      LF I L   +   +  T+PRF L+ AT+  FNL++ 
Sbjct  9    GDERRQLIRRIF--AAILSFIILILFVIFLIWII---LRPTKPRFILQDATVFAFNLSST  63

Query  294  -----------NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQ  440
                       N +T  I V L++  P    GIYY +L  YA YR Q ++L   LP +YQ
Sbjct  64   GETPSSTTPTPNTITLTIQVTLSSFNPNSKIGIYYHKLDAYASYRGQQISLATELPQTYQ  123

Query  441  GYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRL  599
            G++DVAVWS  L G +VPV P +         +G VLVN+ V+G ++        G   +
Sbjct  124  GHRDVAVWSPILYGAAVPVSPYLSEILRQDQTSGGVLVNVKVNGRVKWKVGTWVSGRYHI  183

Query  600  SANCPAFL----DFGSTSIS-SSPV------QSCHVEV  680
              NCPAF+    D G      S+PV      QSC V+V
Sbjct  184  DVNCPAFIKVAGDKGDDGFGVSAPVVKFQFLQSCVVDV  221



>ref|XP_010099421.1| hypothetical protein L484_003245 [Morus notabilis]
 gb|EXB78383.1| hypothetical protein L484_003245 [Morus notabilis]
Length=210

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 103/200 (52%), Gaps = 18/200 (9%)
 Frame = +3

Query  96   PPH-APSGEMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISL--TQPRFFLRHAT  266
            P H    G   + L KK F       L FS LF   L + +   + L  T+P+F L+ A 
Sbjct  9    PKHCGKQGVNIEKLYKKVF-------LAFSALFTTILSIILLVWLILRPTKPQFSLKEAD  61

Query  267  LHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGY  446
            ++  NL+  +LL ++I + L +  P +  GIYYD L VYA Y+ Q +T+   LP  YQG+
Sbjct  62   IYQLNLSNSHLLNSSIQLTLLSKNPNQKIGIYYDELQVYAAYKGQQITVYTSLPPFYQGH  121

Query  447  KDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSA  605
            +D  + SA L G  +PV P  G         GR+++N+ V+G +R        G  RL+ 
Sbjct  122  EDSNLLSASLGGTGLPVAPSFGYQVVRDQTVGRLVLNLKVNGRLRWKVGTWVSGRYRLNV  181

Query  606  NCPAFLDFGSTSISSSPVQS  665
            NC A + FG  +I + P+ S
Sbjct  182  NCVAVVAFGP-AIPTGPLSS  200



>gb|AFK48051.1| unknown [Medicago truncatula]
Length=210

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 94/190 (49%), Gaps = 20/190 (11%)
 Frame = +3

Query  162  VLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIP  341
            +++  F  L  I +  A+   +  ++P F L+  T++ FN T  N LT+N  V +++  P
Sbjct  24   IIIFLFIVLVTILIIWAV---LKPSKPSFILQDVTVYAFNATVPNFLTSNFQVTVSSRNP  80

Query  342  YRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-  518
                GIYYDRL  Y  YR+Q +T    +P SYQ +K+V VWS F+ G +VPV P   +A 
Sbjct  81   NDKIGIYYDRLDSYVTYRSQQITYRTAIPPSYQEHKEVDVWSPFVYGTNVPVAPYNSVAL  140

Query  519  ------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG----------STSISS  650
                  G VLV +  DG +R        G   +   CPAF+ FG          S ++  
Sbjct  141  SQDQDNGNVLVVVKFDGRVRWKVGAFISGHYHIFVRCPAFITFGPRSNGISVGDSGAVKY  200

Query  651  SPVQSCHVEV  680
              VQ C V V
Sbjct  201  QIVQRCTVSV  210



>ref|XP_011094229.1| PREDICTED: protein YLS9-like [Sesamum indicum]
Length=209

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 89/164 (54%), Gaps = 16/164 (10%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF L+ AT+   N++A N+++T + V + +  P    G+YYD+L  YA Y NQ +T  
Sbjct  46   KPRFTLQDATIFTLNVSAPNVISTTVQVTINSRNPNSRIGVYYDKLDAYATYHNQQITYY  105

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWN  575
              +P  YQG+KDV VWS F+ GN+VPV P  G+A       G + + + +DG ++    +
Sbjct  106  TVIPPVYQGHKDVNVWSPFIYGNNVPVAPYNGLALSQDQSNGAIRLTVKLDGRVKWKVGS  165

Query  576  LEVGPCRLSANCPAFLDFGSTSISSSPV---------QSCHVEV  680
               G   L  +CPA++  G++  +   V         QSC V V
Sbjct  166  FISGRYHLHVSCPAYIPLGNSKNTGIVVGNAVKYQLSQSCSVSV  209



>ref|XP_006854676.1| hypothetical protein AMTR_s00030p00212910 [Amborella trichopoda]
 gb|ERN16143.1| hypothetical protein AMTR_s00030p00212910 [Amborella trichopoda]
Length=205

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 87/160 (54%), Gaps = 11/160 (7%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+ AT++ FN+T  NLL++N  + + +  P    GIYYDRL VYA YR+Q +T 
Sbjct  46   TKPRFSLQDATVNYFNVTTPNLLSSNFQITIVSQNPNDRIGIYYDRLEVYASYRSQQITF  105

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
               +P +YQG+ D +VWS FL+G+ VP+ P +          G   V++ +DG +R    
Sbjct  106  RTAIPPNYQGHNDYSVWSPFLTGDRVPIAPFLAADLSQEQNYGVAQVSVKMDGTVRWKVG  165

Query  573  NLEVGPCRLSANCPAFLDFGSTS----ISSSPVQSCHVEV  680
                G   +  +C A + F   +    +S  P   C+ +V
Sbjct  166  AWTSGNYHIYVSCNAIVAFSQGAVNGKVSMQPGARCYTDV  205



>ref|XP_010912374.1| PREDICTED: protein YLS9-like [Elaeis guineensis]
Length=213

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 91/164 (55%), Gaps = 15/164 (9%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTA-GNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVT  410
            T+P+F+L+ A+++ FN+++  NLL++ I V ++   P    GIYYDR+ V+A Y+ Q +T
Sbjct  50   TKPKFYLQDASVYAFNVSSPDNLLSSTIQVTISTRNPNDRVGIYYDRIDVFASYKYQQIT  109

Query  411  LPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHF  569
                +P  YQG+ DV +WS +L G SVPV P +  A       G +LV++ +DG IR   
Sbjct  110  PATAVPPFYQGHNDVDLWSPYLCGVSVPVAPYLAEAISQDQSSGFILVHVKIDGRIRWKV  169

Query  570  WNLEVGPCRLSANCPAFLDFGSTSISSSP-------VQSCHVEV  680
             +   G   L   CPAFL F S      P       + +C V+V
Sbjct  170  GSWVSGHYHLFVTCPAFLSFESGKGVGDPPVIKFQQISTCSVDV  213



>ref|XP_009414386.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=209

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 95/183 (52%), Gaps = 17/183 (9%)
 Frame = +3

Query  183  TLFCISLCVAMSAQISL--TQPRFFLRHATLHNFNLTAG-NLLTTNISVALAAHIPYRHR  353
            T   + L V +   + L  ++P+F+L+  ++   NLTAG NLLTT + V L +       
Sbjct  27   TFIIVVLIVILGVWLVLRPSKPKFYLKDTSIFQLNLTAGSNLLTTVMQVTLDSRNLNDRV  86

Query  354  GIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM------  515
            GIYYD+L  +A Y+ Q +T    LP  YQG+ DV VWS +L G +V V P + +      
Sbjct  87   GIYYDKLDAFAAYKGQRITASTALPTGYQGHDDVVVWSPYLYGAAVAVAPYLAVSLIQDR  146

Query  516  -AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL--DFGSTSISS-----SPVQSCH  671
             AG +LV I  +G +R        G   L ANCPAFL  D G  S S+       + SC 
Sbjct  147  EAGLLLVYIKAEGRLRWKVGTWVSGHYHLQANCPAFLAIDNGKGSGSAPSFHLQQISSCS  206

Query  672  VEV  680
            V+V
Sbjct  207  VDV  209



>gb|ACJ86101.1| unknown [Medicago truncatula]
 gb|AFK38311.1| unknown [Medicago truncatula]
 gb|KEH41916.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Medicago truncatula]
Length=209

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 83/165 (50%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P F L   TL+ FN +  N LT+N  V L++  P  + G+YYDRL  Y  YR+Q +TL
Sbjct  45   TKPTFILLDVTLYAFNASQPNFLTSNFQVTLSSRNPNDNIGVYYDRLDTYMTYRSQQITL  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMA-----GRVLVNIIVDGWIRKHFW  572
               +P SYQG+ +  VWS F+ GN +PV P   V ++     G + V + VDG +R    
Sbjct  105  RTAIPPSYQGHNEYDVWSPFVYGNDIPVAPFNSVSLSQDENNGNIFVTVRVDGRVRFKVG  164

Query  573  NLEVGPCRLSANCPAFL---------DFGSTSISSSPVQSCHVEV  680
                G   +   CPA++         D G  ++     Q C V V
Sbjct  165  AFISGRYHIHVRCPAYISLGNNGKGVDMGENAVKYQVDQRCSVNV  209



>ref|XP_009419417.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=210

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 79/139 (57%), Gaps = 9/139 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGN--LLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            T+PRF+L+ A L  FNLT G   LLT+ + V L++  P    G+YYDRL  + +Y +Q V
Sbjct  45   TKPRFYLQDADLLRFNLTPGAAPLLTSVVQVTLSSRNPNDRIGVYYDRLDAFVLYNSQQV  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKH  566
            T    LP+ YQG+ DV VWS +L G  VP+ P +         AG +L+ + VDG +R  
Sbjct  105  TAATALPSGYQGHNDVTVWSPYLYGADVPLAPYLADALSQDENAGYLLLYVRVDGLLRWK  164

Query  567  FWNLEVGPCRLSANCPAFL  623
                  G   L ANCPAFL
Sbjct  165  VGTWISGHYHLQANCPAFL  183



>ref|XP_003596851.1| NHL1 [Medicago truncatula]
 gb|AES67102.1| late embryogenesis abundant protein [Medicago truncatula]
 gb|AFK49557.1| unknown [Medicago truncatula]
Length=221

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 105/218 (48%), Gaps = 34/218 (16%)
 Frame = +3

Query  114  GEMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAG  293
            G+ +  L ++ F    +L      LF I L   +   +  T+PRF L+ AT+  FNL++ 
Sbjct  9    GDERRQLIRRIF--AAILSFIILILFVIFLIWII---LRPTKPRFILQDATVFAFNLSST  63

Query  294  -----------NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQ  440
                       N +T  I V L++  P    GIYY +L  YA YR Q ++L   LP +YQ
Sbjct  64   GETPSSTTPTPNTITLTIQVTLSSFNPNSKIGIYYHKLDAYASYRGQQISLATELPQTYQ  123

Query  441  GYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRL  599
            G++DVAVWS  L G +VPV P +         +G VLVN+ V+G ++        G   +
Sbjct  124  GHRDVAVWSPILYGAAVPVSPYLSEILRQDQTSGGVLVNVKVNGRVKWKVGTWVSGRYHI  183

Query  600  SANCPAFL----DFGSTSISSSP-------VQSCHVEV  680
              NCPAF+    D G      S        +QSC V+V
Sbjct  184  DVNCPAFIKVAGDKGDDGFGVSAPAVKFQFLQSCVVDV  221



>ref|NP_192697.1| protein NDR1/HIN1-like 22 [Arabidopsis thaliana]
 emb|CAB78082.1| putative protein [Arabidopsis thaliana]
 emb|CAB82126.1| putative protein [Arabidopsis thaliana]
 gb|AEE82769.1| protein NDR1/HIN1-like 22 [Arabidopsis thaliana]
Length=211

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 83/161 (52%), Gaps = 16/161 (10%)
 Frame = +3

Query  240  PRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPA  419
            P F L+  T++ FNL+  NLLT+   + +A+     + GIYYD LH YA YRNQ +TL +
Sbjct  49   PEFILQDTTVYAFNLSQPNLLTSKFQITIASRNRNSNIGIYYDHLHAYASYRNQQITLAS  108

Query  420  PLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNL  578
             LP +YQ +K+ +VWS  L GN VP+ P   +A       G   + I VDG +R     L
Sbjct  109  DLPPTYQRHKEDSVWSPLLYGNQVPIAPFNAVALGDEQNSGVFTLTICVDGQVRWKVGTL  168

Query  579  EVGPCRLSANCPAFLD---------FGSTSISSSPVQSCHV  674
             +G   L   C AF++          G  ++  + +  C V
Sbjct  169  TIGNYHLHVRCQAFINQADKAAGVHVGENTVKYTLINKCSV  209



>ref|XP_009416877.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=210

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 89/164 (54%), Gaps = 15/164 (9%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTA--GNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            T+PRF+L+ A +  FN T    NLL+T I V L++  P    GIYYDRL VYA Y+ Q +
Sbjct  47   TKPRFYLQDAVVLQFNYTGPPSNLLSTVIQVTLSSRNPNDRVGIYYDRLDVYAAYKYQQI  106

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGV-------GMAGRVLVNIIVDGWIRKH  566
            ++ + LP  YQG+ D+ VWS +L G  VPV P +         +G +L+++ +DG IR  
Sbjct  107  SVASALPPMYQGHNDIDVWSPYLYGPDVPVAPYLCDPLTQDESSGFLLLHVKIDGRIRWK  166

Query  567  FWNLEVGPCRLSANCPAFLDF------GSTSISSSPVQSCHVEV  680
              +   G   L  +CPA L F         ++    + SC VEV
Sbjct  167  VGSWISGHYHLFVSCPALLTFQNGRSGSGGTVKFQQMSSCSVEV  210



>gb|EYU18128.1| hypothetical protein MIMGU_mgv1a013838mg [Erythranthe guttata]
Length=209

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 82/142 (58%), Gaps = 7/142 (5%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF ++ AT+ N N++A N+++T + V + +H P    G+YYD+L VYA Y +Q +T  
Sbjct  46   KPRFTIQDATIFNLNVSAPNVISTTVQVTVNSHNPNSKIGVYYDKLDVYATYHSQQITYY  105

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWN  575
              +P  YQG+KDV VWS F+ G +VPV P  G+A       G + + + +DG ++     
Sbjct  106  TVIPPVYQGHKDVNVWSPFIYGVNVPVAPYNGIALAQDQTNGAIRITVKIDGRVKWKVGT  165

Query  576  LEVGPCRLSANCPAFLDFGSTS  641
               G   L  +CPA +  G++ 
Sbjct  166  FVSGRYHLHISCPANIPLGNSK  187



>ref|NP_001065799.1| Os11g0157200 [Oryza sativa Japonica Group]
 gb|AAX92937.1| Harpin-induced protein 1 (Hin1), putative [Oryza sativa Japonica 
Group]
 gb|ABA91552.1| Harpin-induced protein 1 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27644.1| Os11g0157200 [Oryza sativa Japonica Group]
 gb|EAY80020.1| hypothetical protein OsI_35187 [Oryza sativa Indica Group]
 dbj|BAG96513.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91887.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96707.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96718.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99786.1| unnamed protein product [Oryza sativa Japonica Group]
Length=210

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 94/191 (49%), Gaps = 22/191 (12%)
 Frame = +3

Query  174  FFSTLFCISLCVAMSAQISL-----TQPRFFLRHATLHNFNLT---AGNLLTTNISVALA  329
              + LF ++L VA+ A I       T PRFFL+ ATL   +L+      +L+T + V +A
Sbjct  20   LLTILFGLALIVAIIALIVYLVLRPTHPRFFLQDATLRQLDLSNSSTSGVLSTALQVTVA  79

Query  330  AHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGV  509
            +  P    G+YYDRL VYA Y+ Q +TL A LP  YQG+ DV VWS  LSG  VP  P +
Sbjct  80   SRNPNDRVGVYYDRLDVYASYKYQQITLAASLPPVYQGHGDVDVWSPVLSGPDVPFAPYL  139

Query  510  G-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDF-------GSTSIS  647
            G        A  +++ + +DG +R    +   G   L   CPAF          G+  + 
Sbjct  140  GDALAKDVAAEYLILQVKIDGRVRWKVGSWISGHYHLFVTCPAFFIASGGNGYPGANGLK  199

Query  648  SSPVQSCHVEV  680
                  C VEV
Sbjct  200  FQTATYCRVEV  210



>ref|XP_002442844.1| hypothetical protein SORBIDRAFT_08g003720 [Sorghum bicolor]
 gb|EES16682.1| hypothetical protein SORBIDRAFT_08g003720 [Sorghum bicolor]
Length=214

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 86/170 (51%), Gaps = 21/170 (12%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLT-------AGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVY  392
            T PRFFL+ A+L   +L+       A   L+T + V +A+  P    G+YYDRL VYA Y
Sbjct  45   THPRFFLQDASLRQLDLSNTTTTTSAAGALSTTLQVTVASRNPNDKVGVYYDRLDVYASY  104

Query  393  RNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDG  551
            + Q +T+ A LPA YQG+ DV VWS  LSG  VP  P +         AG +++ + +DG
Sbjct  105  KYQQITVAASLPAVYQGHGDVDVWSPVLSGPDVPFAPYLADALRQDCQAGYLILQVKIDG  164

Query  552  WIRKHFWNLEVGPCRLSANCPAFLDF-------GSTSISSSPVQSCHVEV  680
             +R    +   G   L   CPAFL         G++         CHVEV
Sbjct  165  RVRWKVGSWISGHYHLFVTCPAFLVTTGGNGAPGASGFKFQTTTYCHVEV  214



>ref|XP_008234641.1| PREDICTED: protein YLS9 [Prunus mume]
Length=211

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 95/176 (54%), Gaps = 10/176 (6%)
 Frame = +3

Query  165  LLLFFSTLFCISLCVAMSAQISL--TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHI  338
            L L FSTL    L + +   + L  T+P F L+ A ++  NL+  +LL +++ + L +  
Sbjct  27   LFLVFSTLSTTILSIILLVWLILHPTKPEFSLKEADIYQLNLSGSHLLNSSVQLTLLSKN  86

Query  339  PYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG--  512
            P +  GIYYD L VYA Y+ Q +T+   LP  YQG++D  V +A L G  +PV P  G  
Sbjct  87   PNQKVGIYYDELKVYAAYKGQQITVYTSLPPFYQGHEDSNVLTASLVGTGLPVAPSFGYE  146

Query  513  -----MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTSISSSPVQS  665
                  AGR+++N+ V G +R        G  R++ +C A + FG  SI + P+ S
Sbjct  147  VGRDQTAGRLVLNLKVIGRLRWKVGTWVSGKYRVNVDCLAVMAFGP-SIPTGPLTS  201



>ref|XP_009407337.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=210

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 89/164 (54%), Gaps = 15/164 (9%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTA--GNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            T+PRF+L+ A +  FN T    NLL+T   V +A+  P    GIYYDR+ VYA Y+NQ +
Sbjct  47   TKPRFYLQGAVVLQFNYTGPPSNLLSTVFQVTIASRNPNDRIGIYYDRIFVYAAYKNQQI  106

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGV-------GMAGRVLVNIIVDGWIRKH  566
            +L   LP  YQG+ DV +WS +L G +VPV P +         +G +++++ +DG IR  
Sbjct  107  SLATALPPMYQGHNDVVIWSPYLFGPNVPVAPYLCDALTQDKASGFLILHVKIDGRIRWK  166

Query  567  FWNLEVGPCRLSANCPAFLDF------GSTSISSSPVQSCHVEV  680
              +       L  +CPAFL F         ++    + +C VEV
Sbjct  167  VGSWTSDHYHLFVSCPAFLTFQNGRSGSGAAVRFQQMSACSVEV  210



>ref|XP_010059120.1| PREDICTED: protein YLS9-like [Eucalyptus grandis]
 gb|KCW90468.1| hypothetical protein EUGRSUZ_A02596 [Eucalyptus grandis]
Length=211

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 83/164 (51%), Gaps = 16/164 (10%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF L+  T++ FN +  +LLT N  V + +  P    GIYYDRL  YA Y +Q +T  
Sbjct  48   KPRFVLQDVTVYTFNASVPSLLTINFQVTIYSRNPNDKLGIYYDRLDTYATYHSQQITYR  107

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWN  575
            + +  SYQG+K+V VWS  + G  VPV P   +A       G V + I +DG +R     
Sbjct  108  SQIQPSYQGHKEVDVWSPLVYGTDVPVAPYNSLALAQDQSSGAVSLLIKMDGRVRWKLGT  167

Query  576  LEVGPCRLSANCPAFLDFGST---------SISSSPVQSCHVEV  680
               G   L   CPAF+ FGS          ++    VQ C V+V
Sbjct  168  FITGRYHLYVKCPAFITFGSKMNGITVGENAVKYQLVQRCSVDV  211



>ref|XP_010931078.1| PREDICTED: protein YLS9-like [Elaeis guineensis]
Length=219

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 93/164 (57%), Gaps = 15/164 (9%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTA-GNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVT  410
            T+P+F+L+ A+++ FN++   NL+++ + V ++   P    GIYYDR  V+A Y+ Q +T
Sbjct  56   TKPKFYLQDASVYVFNVSDPDNLVSSTLQVTISTRNPNDRIGIYYDRADVFASYKYQQIT  115

Query  411  LPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHF  569
            L   +P  YQG+KD+ VWS +L G ++PV P +         +G +L+++ VDG IR   
Sbjct  116  LATAVPPFYQGHKDIDVWSPYLYGLNIPVAPFLAQSLLQDKSSGFLLLHVKVDGRIRWKV  175

Query  570  WNLEVGPCRLSANCPAFLDFGS-------TSISSSPVQSCHVEV  680
             +   G   L   CPAFL F +       T+I    + +C V+V
Sbjct  176  GSWTSGHYHLFVTCPAFLSFETGQGIDDPTAIKFQQISTCSVDV  219



>ref|XP_010554841.1| PREDICTED: protein YLS9 [Tarenaya hassleriana]
Length=210

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 79/138 (57%), Gaps = 8/138 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+PRF L+  T+  FNL++ +LLTT   + ++A  P    GIYYD LHVYA Y +Q +T 
Sbjct  45   TRPRFILQDVTVFVFNLSSPHLLTTTFQITISARNPNPKTGIYYDYLHVYASYMDQQITF  104

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
            P  +P +YQ +K+  VWS F+ G SV + P  G A       G V + I  DG +R  FW
Sbjct  105  PTTIPPTYQEHKEHNVWSPFVYGTSVSIAPLNGAALSCEQNGGLVALMICADGRVRWKFW  164

Query  573  NLEVGPCRLSANCPAFLD  626
             +      LS  CPA+++
Sbjct  165  IVSRR-SHLSIRCPAYIN  181



>gb|EPS74359.1| hypothetical protein M569_00401, partial [Genlisea aurea]
Length=202

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 84/143 (59%), Gaps = 7/143 (5%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            T+P+F L+ AT+   N+++ N+++  + + + A  P    GIYYDRL  +A YRNQ VT 
Sbjct  38   TKPQFTLQDATIFTLNVSSPNVISIVVQITVTARNPNSRIGIYYDRLDAFADYRNQQVTY  97

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
             + +P  YQG+KD  VWS FL GN+VPV P  G+A       G V++ + ++G +R    
Sbjct  98   YSSIPPVYQGHKDFNVWSPFLYGNNVPVAPYNGLALNEDESTGAVILAVNLNGRVRWKVG  157

Query  573  NLEVGPCRLSANCPAFLDFGSTS  641
            ++  G   L   CPA++  G++ 
Sbjct  158  DVISGRYHLHVMCPAYIPIGNSK  180



>gb|EMT22065.1| hypothetical protein F775_30726 [Aegilops tauschii]
Length=208

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 99/194 (51%), Gaps = 17/194 (9%)
 Frame = +3

Query  150  NCCCVLLLFFSTLFCISLCVAMSAQISL--TQPRFFLRHATLHNFNLT-AGNLLTTNISV  320
            N C  LL     L  I   +A+   + L  T P FFL+ A+L   +L+ +  LL+T++ V
Sbjct  15   NGCRRLLKVLLGLAFILAVIALIVYLVLRPTHPGFFLQDASLRQLDLSNSTGLLSTSLQV  74

Query  321  ALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVE  500
             +A+  P    G YYDRL VYA Y++Q +T+ A LPA YQG+ DV VWS  L G +VP  
Sbjct  75   TVASRTPTDRGGFYYDRLDVYASYKDQQITVAASLPAVYQGHGDVDVWSPVLDGPNVPFA  134

Query  501  PGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDF----GSTSIS  647
            P +         AG +++++ +DG +R    +   G   L   C A L+     G+   S
Sbjct  135  PYLASAISQDCQAGHLVLHVKIDGRVRWKVGSWISGHYHLFVTCQALLETVSGNGAPEAS  194

Query  648  SSPVQ---SCHVEV  680
                Q    CHVEV
Sbjct  195  GFKFQKTTGCHVEV  208



>ref|XP_002280566.1| PREDICTED: protein YLS9 [Vitis vinifera]
 emb|CAN69174.1| hypothetical protein VITISV_023904 [Vitis vinifera]
Length=207

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 79/141 (56%), Gaps = 7/141 (5%)
 Frame = +3

Query  240  PRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPA  419
            PRF L+ AT++  N++  N+LT NI V +    P    GIYY++L  YA YR Q +TL  
Sbjct  46   PRFVLQDATIYALNVSTPNILTVNIQVTITTRNPNDKIGIYYEKLDTYATYRGQQITLAY  105

Query  420  PLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNL  578
             +P +YQG+K++  WS FLSG +VPV P   +A       G + + I +DG ++    + 
Sbjct  106  LIPPTYQGHKEIITWSPFLSGTAVPVAPYNAIALNQDQSYGALTLIIKIDGRVKWKVGSF  165

Query  579  EVGPCRLSANCPAFLDFGSTS  641
              G   L+  C A + FG+ S
Sbjct  166  TSGRYHLNVKCVAPITFGARS  186



>gb|EMT25294.1| hypothetical protein F775_27232 [Aegilops tauschii]
Length=216

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 96/184 (52%), Gaps = 10/184 (5%)
 Frame = +3

Query  150  NCCCVLLLFFSTLFCISLCVAMSAQISL--TQPRFFLRHATLHNFNLTAGNLLTTNISVA  323
             CC  +     TL  +   VA+   ++L  ++P F+L+   L + +L A   L+ ++ V 
Sbjct  14   RCCGSIAACILTLAVLVGFVALVIYLALHPSKPSFYLQDIQLRSIDL-ADPALSLDVQVT  72

Query  324  LAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP  503
            +A+  P    GIYY  LH +  YR++ VT+P  LPA YQG+KD +VWS  +SG+SVPV P
Sbjct  73   IASRNPNDRVGIYYKTLHAFTTYRDEPVTVPVSLPAIYQGHKDQSVWSPVMSGDSVPVAP  132

Query  504  GVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTSISSSPVQ  662
             V         AG VL+++ VDG ++    +   G   +  NCPA L     S+  +   
Sbjct  133  YVADAMKQDIAAGYVLLHVKVDGRVKWKVGSWVSGGYHIFVNCPALLSASGGSVGGAFAM  192

Query  663  SCHV  674
            S  V
Sbjct  193  SATV  196



>dbj|BAJ88510.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=216

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 76/139 (55%), Gaps = 9/139 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTA--GNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            T+PRF+L   T+   N T+   + LT  +   +AA  P    GIY+DR   YA Y+ Q V
Sbjct  45   TRPRFYLNDLTVACLNATSNPASYLTVTLQATIAARNPNTRVGIYFDRTDAYAEYKGQQV  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKH  566
            T+P  LP  YQG+ DV+VWS FL G++VP+ P + +       AG VL+ + VDGWIR  
Sbjct  105  TVPTALPVVYQGHLDVSVWSPFLVGSNVPLAPYLAVALAQDETAGYVLLTVRVDGWIRWK  164

Query  567  FWNLEVGPCRLSANCPAFL  623
                  G   L   CPA L
Sbjct  165  AGAFITGHYHLRVRCPALL  183



>ref|XP_004307931.1| PREDICTED: uncharacterized protein LOC101292938 [Fragaria vesca 
subsp. vesca]
Length=212

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 98/178 (55%), Gaps = 11/178 (6%)
 Frame = +3

Query  156  CCVLLLFFSTLFCISLCVAMSAQISL--TQPRFFLRHATLHNFNLT-AGNLLTTNISVAL  326
            C  L   FSTLF   LC+ +   + L  T+P+F L+ A ++  NL+ + NLL +++ + L
Sbjct  24   CKKLFAAFSTLFTTILCLILLVWLILHPTKPQFSLKEAGIYLLNLSGSNNLLNSSVQLTL  83

Query  327  AAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPG  506
             +  P +  GIYYD L VYA Y+ Q +T+   LP  YQG++D  + +  L GN +PV P 
Sbjct  84   LSKNPNQKVGIYYDELKVYAQYKGQQITVYTSLPPFYQGHEDSNLLTVSLIGNGLPVAPS  143

Query  507  VG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTSISSSPV  659
             G        AGR+++N+ V G +R        G  R++ +C A + FG  S+ S P+
Sbjct  144  FGYEVGRDQTAGRLVLNLKVLGRLRWKVGTWVSGRYRVNVDCVAVMAFGP-SLPSGPL  200



>ref|XP_009768005.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
Length=211

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 80/140 (57%), Gaps = 7/140 (5%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF L+  T+  FN++A N+ +T+I   + A  P  + GIYYD++ +YA Y NQ +T  
Sbjct  46   KPRFILQDTTIFTFNVSAPNIFSTSIQATVYARNPNSNIGIYYDKMDIYATYHNQQITYY  105

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMA-----GRVLVNIIVDGWIRKHFWN  575
              +P  YQG+KDV +WS F+ GN+VP+ P  G G+      G V ++  +DG ++    +
Sbjct  106  TQIPPVYQGHKDVNIWSPFVFGNNVPIAPYNGPGLTEDQQNGGVWLDFKIDGRVKWKVGS  165

Query  576  LEVGPCRLSANCPAFLDFGS  635
            +  G   L   C A++  G 
Sbjct  166  VTTGHYHLHVTCSAYVPLGD  185



>ref|XP_002872124.1| hypothetical protein ARALYDRAFT_910523 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48383.1| hypothetical protein ARALYDRAFT_910523 [Arabidopsis lyrata subsp. 
lyrata]
Length=207

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 84/141 (60%), Gaps = 6/141 (4%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGN--LLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            ++PRF LR AT+ NFN+  GN   LT++  + L++  P    GIYYDRL VYA Y NQ +
Sbjct  50   SKPRFILRDATVVNFNV-FGNPPHLTSSFKITLSSRNPNDKIGIYYDRLDVYASYGNQQI  108

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM---AGRVLVNIIVDGWIRKHFWNL  578
            T P  +P +YQG+K+V  WS F+ GNS+ + P   +    G +++ + ++G +R  F   
Sbjct  109  TSPTAMPTTYQGHKEVKDWSPFVGGNSIHLAPYNALNLEQGTIMLMLHLNGRVRWKFGTF  168

Query  579  EVGPCRLSANCPAFLDFGSTS  641
              G   L   C AF++ G+++
Sbjct  169  ITGKYHLYVRCRAFINIGNSA  189



>ref|XP_002318501.1| hypothetical protein POPTR_0012s00610g [Populus trichocarpa]
 gb|EEE96721.1| hypothetical protein POPTR_0012s00610g [Populus trichocarpa]
Length=210

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 82/141 (58%), Gaps = 7/141 (5%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +P F L+ A ++  +L+A NLL ++I + L +  P +  G+YYD L VYA YR Q +T+ 
Sbjct  52   KPEFSLKEADIYQLSLSAPNLLNSSIQLTLLSKNPNQKVGVYYDELQVYAAYRGQQITVD  111

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPG----VG---MAGRVLVNIIVDGWIRKHFWN  575
            +PLP  YQG++D  + +A L G  +PV P     VG    AG++++N+ V+G IR     
Sbjct  112  SPLPPFYQGHQDSNLLTASLVGTGLPVAPSFNYEVGRDQTAGKLVLNLRVNGRIRWKVGT  171

Query  576  LEVGPCRLSANCPAFLDFGST  638
               G  R++ NC A +  G T
Sbjct  172  WVSGRYRINVNCLAVMALGPT  192



>ref|XP_003577812.2| PREDICTED: protein YLS9-like [Brachypodium distachyon]
Length=289

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 93/181 (51%), Gaps = 16/181 (9%)
 Frame = +3

Query  123  KDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNL------  284
            +DDL +        +LL    +  I+L V +   +  T PRFFL+ A+L   +L      
Sbjct  85   EDDLRRTCRRLAAFILLLALVVAIIALIVYLV--LRPTHPRFFLQDASLRQLDLPQNSSN  142

Query  285  -TAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAV  461
              AG +L+T + V +A+  P    G+YYDRL VYA Y+ Q +TL A LP  YQG+ DV V
Sbjct  143  SGAGGVLSTTLQVTIASRNPNDRVGVYYDRLDVYASYKYQQITLAASLPQVYQGHGDVDV  202

Query  462  WSAFLSGNSVPVEP-------GVGMAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAF  620
            WS  LSG  +P  P       G   AG +++ + +DG +R    +   G   +   CPAF
Sbjct  203  WSPVLSGPGIPFAPYLATSLAGDVQAGYLVLQVKIDGRVRWKVGSWISGHYHIFVTCPAF  262

Query  621  L  623
            L
Sbjct  263  L  263



>dbj|BAK04669.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=216

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 96/184 (52%), Gaps = 10/184 (5%)
 Frame = +3

Query  150  NCCCVLLLFFSTLFCISLCVAMSAQISL--TQPRFFLRHATLHNFNLTAGNLLTTNISVA  323
             CC  +     TL  +   VA+   ++L  ++P F+L+   L + +L+    L+ ++ V 
Sbjct  14   RCCGSIAACILTLAVLVGFVALVIYLALHPSKPSFYLQDIQLRSIDLS-DPALSLDVQVT  72

Query  324  LAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP  503
            +A+  P    GIYY  LH +  YR++ VT+P  LPA YQG+KD +VWS  +SG+SVPV P
Sbjct  73   IASRNPNDRVGIYYKTLHAFTTYRDEPVTVPVSLPAIYQGHKDQSVWSPVMSGDSVPVAP  132

Query  504  GVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTSISSSPVQ  662
             V         AG VL+++ VDG ++    +   G   +  NCPA L     S+  +   
Sbjct  133  YVADAMKQDIAAGYVLLHVKVDGRVKWKVGSWVSGGYHIFVNCPALLSASGGSVGGAFAM  192

Query  663  SCHV  674
            S  V
Sbjct  193  SATV  196



>ref|XP_010942404.1| PREDICTED: protein YLS9-like [Elaeis guineensis]
Length=203

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 81/158 (51%), Gaps = 9/158 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            ++P F L+ AT+  F+L+  N L+T I + +++  P    GIYYDRL V+  YR Q +T 
Sbjct  46   SKPNFLLQDATITQFDLSEPNFLSTTIQITISSRNPNDRIGIYYDRLDVFVDYRGQRITD  105

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFW  572
               LP  YQG+ DV +WS +L G +VP+   +         AG  L+ I +DG +R    
Sbjct  106  ATALPPGYQGHDDVTIWSPYLYGAAVPIASYLADAVHQDQTAGFFLLYIKIDGNLRWKVG  165

Query  573  NLEVGPCRLSANCPAF--LDFGSTSISSSPVQSCHVEV  680
                G   +  NCPAF  +D          V SC V+V
Sbjct  166  TWISGHYHIHVNCPAFFTVDAAKGVFQFQKVTSCSVDV  203



>ref|XP_009405462.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=211

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 86/154 (56%), Gaps = 12/154 (8%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGN--LLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            T+P F+L+  +L  FN T G+  LLT+ + V L++  P    GIYYDRL  YA Y+ Q  
Sbjct  45   TKPMFYLQDFSLLQFNFTHGDAALLTSVLQVTLSSRNPNGRIGIYYDRLDAYAAYKGQQF  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKH  566
            T    LP  Y G+ DVA+WS +L G +VP+ P +         AG +L+ + VDG +R  
Sbjct  105  TAATFLPPGYLGHNDVAIWSPYLYGTAVPLAPYLADSISQDESAGYLLLYVRVDGRLRWK  164

Query  567  FWNLEVGPCRLSANCPAFL--DFG-STSISSSPV  659
                  G  RL ANCPAFL  D G S S + +P+
Sbjct  165  VGTWISGHYRLQANCPAFLIVDSGKSQSDAPAPI  198



>ref|XP_006339162.1| PREDICTED: uncharacterized protein LOC102584448 [Solanum tuberosum]
Length=211

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 79/140 (56%), Gaps = 7/140 (5%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF L+ AT+ NFN++A N+ +T+I + + +  P    G+YYD++  YA Y  Q +T  
Sbjct  46   KPRFILQDATIFNFNVSAPNIFSTSIQITIYSRNPNDKIGVYYDKMKTYANYHKQQITYY  105

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWN  575
              +P+ YQG+KDV +WS F+  N+VP+ P  G         G V ++  +DG ++     
Sbjct  106  TQIPSVYQGHKDVNIWSPFVFSNNVPISPLNGPDLKEDQQNGGVWLDFKIDGRVKWRVGT  165

Query  576  LEVGPCRLSANCPAFLDFGS  635
            +  G   L   C A++ FG+
Sbjct  166  ITTGHYHLHVTCTAYVPFGN  185



>gb|EMS65943.1| hypothetical protein TRIUR3_34190 [Triticum urartu]
Length=249

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 76/139 (55%), Gaps = 9/139 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTA--GNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            T+PRF+L   T+   N T+   + LT  +   +AA  P    GIY+DR   YA Y+ Q V
Sbjct  78   TRPRFYLNGLTVACLNATSSPASYLTVTLQATIAARNPNSRVGIYFDRTDAYAEYKGQQV  137

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKH  566
            T+P  LP  YQG+ DV+VWS FL G++VP+ P + +       AG VL+ + VDGWIR  
Sbjct  138  TVPTALPVVYQGHLDVSVWSPFLVGSNVPLAPYLAVALAQDETAGYVLLTVRVDGWIRWK  197

Query  567  FWNLEVGPCRLSANCPAFL  623
                  G   L   CPA L
Sbjct  198  AGAFITGHYHLRVRCPALL  216



>ref|XP_006348478.1| PREDICTED: uncharacterized protein LOC102581750 [Solanum tuberosum]
Length=211

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 80/140 (57%), Gaps = 7/140 (5%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF L+  T+  FN++A N+ +T+I   + A  P    GIYYD + +YA+Y NQ +T  
Sbjct  46   KPRFILQDTTIFTFNVSAPNIFSTSIQTTIYARNPNSKIGIYYDNMDIYAMYHNQQITYY  105

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMA-----GRVLVNIIVDGWIRKHFWN  575
              +P  YQG+KDV +WS F+ GN++P+ P  G G++     G V ++  +DG ++    +
Sbjct  106  TQIPPVYQGHKDVNIWSPFVYGNNIPIAPYNGPGLSEDQQNGGVWLDFKIDGRVKWKVGS  165

Query  576  LEVGPCRLSANCPAFLDFGS  635
            +  G   L   C A++  G 
Sbjct  166  VTTGHYHLHVTCSAYVPLGD  185



>ref|XP_008778135.1| PREDICTED: protein YLS9-like [Phoenix dactylifera]
Length=205

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 97/191 (51%), Gaps = 16/191 (8%)
 Frame = +3

Query  138  KKSFNC-CCVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGN-LLTTN  311
            ++ F C  C+++L    +  I L +  S      +P F L+ AT+  F+L+  N LL++ 
Sbjct  21   RRLFACFLCLIILVLFVILVIWLVLRPS------KPEFNLQDATVVKFDLSDPNSLLSSI  74

Query  312  ISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSV  491
            + + +++H P    GIYYD L VYA Y+ Q +T    LP  YQG+ D +VWS +L GN+V
Sbjct  75   VQITISSHNPNDRIGIYYDDLDVYADYKGQQITAATALPTGYQGHNDFSVWSPYLYGNAV  134

Query  492  PVEPGVGM-------AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGST-SIS  647
            P+   + +       AG +L+   +DG +R        G   +  NCPAF    ST    
Sbjct  135  PLAHYLAVAVDQDESAGFMLIYFKIDGRLRWKVGTWISGTYHIDVNCPAFFTVNSTKEFQ  194

Query  648  SSPVQSCHVEV  680
                 SC V+V
Sbjct  195  FQKTTSCSVDV  205



>ref|XP_010030183.1| PREDICTED: protein YLS9-like [Eucalyptus grandis]
 gb|KCW57130.1| hypothetical protein EUGRSUZ_I02774 [Eucalyptus grandis]
Length=210

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 81/143 (57%), Gaps = 8/143 (6%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAG-NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTL  413
            +PRF L+ AT++ FN +A  +LLT+   V +++  P  +  IYYDRL  YA Y++Q +TL
Sbjct  46   KPRFTLQDATVYAFNASANPSLLTSTFQVTISSRNPNDNIAIYYDRLDCYATYQDQQITL  105

Query  414  PAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFW  572
               LP +Y+    V VWS FLSG SVP+ P    A       G V++ I + G +R    
Sbjct  106  STGLPPTYEDTNSVNVWSPFLSGVSVPISPYYAAALSQDQNHGYVILTIKLSGRVRWRVG  165

Query  573  NLEVGPCRLSANCPAFLDFGSTS  641
            +   G   +  NCPA++ FGS S
Sbjct  166  SFTSGGYHIFVNCPAYITFGSKS  188



>ref|XP_009627579.1| PREDICTED: protein YLS9-like [Nicotiana tomentosiformis]
Length=211

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 80/140 (57%), Gaps = 7/140 (5%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +PRF L+  T+  FN++A N+ +T+I   + A  P  + GIYYD++ +YA Y NQ +T  
Sbjct  46   KPRFILQDTTIFIFNVSAPNIFSTSIQATVYARNPNSNIGIYYDKMDIYATYHNQQITYY  105

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGMA-----GRVLVNIIVDGWIRKHFWN  575
              +P  YQG+KDV +WS F+ GN+VP+ P  G G+      G V ++  +DG ++    +
Sbjct  106  TQIPPVYQGHKDVNIWSPFVLGNNVPIAPYNGPGLTEDQQNGGVWLDFKIDGRVKWKVGS  165

Query  576  LEVGPCRLSANCPAFLDFGS  635
            +  G   L   C A++  G 
Sbjct  166  VTTGHYHLHVTCSAYVPLGD  185



>ref|XP_004978732.1| PREDICTED: uncharacterized protein LOC101768882 [Setaria italica]
Length=209

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 101/188 (54%), Gaps = 13/188 (7%)
 Frame = +3

Query  114  GEMKDDLPKKSFNCCCVLLLFFSTLF-CISLCVAMSAQISLTQPRFFLRHATLHNFNLTA  290
            G   DD  K++     ++LL F+ L   I+L V +   +  T PRF L+ ATL   +L+ 
Sbjct  6    GNHGDDEFKQTCRRLLIILLGFALLAGVIALIVFLV--LHPTHPRFILQDATLRQLDLSN  63

Query  291  GN--LLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVW  464
            G+  LL+T   V +A+  P    G++YDRL VYA Y+ Q VTL + LP  YQG+ DV VW
Sbjct  64   GSAPLLSTAAQVTIASRNPNARVGVHYDRLDVYASYKYQQVTLASRLPTVYQGHGDVDVW  123

Query  465  SAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPA-F  620
            S  L+G +VP  P +  A       G +++ + +DG +R    +   G   +   CPA F
Sbjct  124  SPVLAGPNVPFAPFLADAMRKDVANGYLIMEVRIDGRVRWKVGSWTSGHYHIFVTCPAYF  183

Query  621  LDFGSTSI  644
            +  G+ S+
Sbjct  184  ISSGTYSV  191



>ref|XP_003573252.1| PREDICTED: uncharacterized protein LOC100823490 [Brachypodium 
distachyon]
Length=227

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 74/146 (51%), Gaps = 16/146 (11%)
 Frame = +3

Query  234  TQPRFFLRHATL---------HNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYA  386
            ++PRF+L    +           ++  AG  LT  +   LAA  P    GIYYDR   YA
Sbjct  46   SKPRFYLNGLQVLCLNASQGSSGYSGAAGAYLTVTLQATLAARNPNERVGIYYDRADAYA  105

Query  387  VYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEP--GVGM-----AGRVLVNIIV  545
             Y+   +T+P  LP  YQG+ D +VWS FLSG  VP+ P   V M     AG VL+ + V
Sbjct  106  EYKGAQLTVPTALPVVYQGHLDTSVWSPFLSGADVPLPPYLAVAMQQDKAAGYVLLTVRV  165

Query  546  DGWIRKHFWNLEVGPCRLSANCPAFL  623
            DGWIR        G  RL A CPA L
Sbjct  166  DGWIRWKAGAFITGHYRLRARCPALL  191



>ref|XP_004235025.1| PREDICTED: protein YLS9 [Solanum lycopersicum]
Length=213

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 98/200 (49%), Gaps = 19/200 (10%)
 Frame = +3

Query  96   PPHAPSGEMKDD--LPKKSFNCCCVLLLFFST--LFCISLCVAMSAQISLTQPRFFLRHA  263
            P H      K +   PKK    C      FST  L  +S    +   +  T+P F LR A
Sbjct  9    PKHCEEKGFKVEKLFPKKKLFFC------FSTISLSILSFIFLLYLTLHPTKPNFTLREA  62

Query  264  TLHNFNLTA-GNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQ  440
             ++  NL+    LL ++I + L +  P +  GIYYD L V+A Y+ Q +TL   LP  YQ
Sbjct  63   DIYQLNLSGPRQLLNSSIQLTLVSKNPNKKVGIYYDELQVFASYKGQQITLHTSLPPFYQ  122

Query  441  GYKDVAVWSAFLSGNSVPVEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRL  599
            G++D    SA L GN +PV+P  G       + G+++VN+   G +R        G  R 
Sbjct  123  GHEDSNFLSALLIGNGLPVDPYFGYEVQRDQIVGKLIVNLKGSGRLRWKVGTWVSGKYRF  182

Query  600  SANCPAFLDFGSTSISSSPV  659
            + +C A + FGS S+ S P+
Sbjct  183  NVDCVAIMPFGS-SLPSGPL  201



>ref|XP_010096843.1| hypothetical protein L484_001752 [Morus notabilis]
 gb|EXB66196.1| hypothetical protein L484_001752 [Morus notabilis]
Length=214

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 93/190 (49%), Gaps = 19/190 (10%)
 Frame = +3

Query  165  LLLFFSTLFCISLCVAMSAQISL--TQPRFFLRHATLHNFNLTAG--NLLTTNISVALAA  332
            +L+  +TL  I   V +     L  ++PRF L+  T++NF  +AG    LT  I   +++
Sbjct  21   ILIGLATLVVILAIVILLVWAILHPSKPRFVLQDVTVYNFTASAGPPYALTAVIQATISS  80

Query  333  HIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVG  512
              P    G+YY +L V+  YR Q +T    LPASYQGY DV VWS  L GN VP+ P + 
Sbjct  81   RNPNDRVGVYYHQLDVFPSYRGQQITAALLLPASYQGYNDVTVWSPMLLGNDVPISPYLQ  140

Query  513  M-------AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFGSTS--ISSSPVQS  665
                     G +LV+I + G ++    +   G      NCPA+L  G ++  I   P   
Sbjct  141  QLLSQDLNVGSMLVDIKIVGRVKWKVGSWVSGKYHFDVNCPAYLQLGGSTGIIPVGPAMK  200

Query  666  ------CHVE  677
                  CHVE
Sbjct  201  LQLLLRCHVE  210



>ref|XP_008437662.1| PREDICTED: protein YLS9 [Cucumis melo]
Length=212

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 80/141 (57%), Gaps = 8/141 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG-NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVT  410
            ++P F ++ A ++  NL    +LL ++I + L++  P    GIYYD L VYAVY+ Q +T
Sbjct  52   SKPEFRVKQADVYQLNLIDDLHLLNSSIQLTLSSKNPNHRLGIYYDNLQVYAVYKGQQIT  111

Query  411  LPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHF  569
            LP  LP  YQGY++  + +AFL+G+ VPV P  G        AGR ++N+   G +R   
Sbjct  112  LPTSLPPFYQGYQEANLLTAFLAGSRVPVAPSFGYEVGRDQSAGRFVLNLKAMGRLRWKV  171

Query  570  WNLEVGPCRLSANCPAFLDFG  632
             +   G  R + NC A + FG
Sbjct  172  GSWVSGGYRFNVNCVAVMPFG  192



>ref|XP_009371535.1| PREDICTED: uncharacterized protein LOC103960777 [Pyrus x bretschneideri]
 ref|XP_009374799.1| PREDICTED: uncharacterized protein LOC103963691 [Pyrus x bretschneideri]
Length=206

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 83/158 (53%), Gaps = 10/158 (6%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGN--LLTTNISVALAAHIPYRHRGIYYDR-LHVYAVYRNQTV  407
            +P F L+  T++NFN +      LTT + V L++  P    GI Y   + +YAVYR+Q +
Sbjct  47   RPSFILQDMTVYNFNASTAPPFALTTKMQVTLSSTNPNSRVGIAYQSGMDIYAVYRDQQI  106

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKH  566
            TL + LP +YQG+K+  VWS  L+G+SVP+ P  G        AG V++ I +DG +R  
Sbjct  107  TLASLLPGTYQGHKEPVVWSPLLNGDSVPISPLSGEAFAQDLNAGTVMIKIKLDGKVRWK  166

Query  567  FWNLEVGPCRLSANCPAFLDFGSTSISSSPVQSCHVEV  680
                  G   L+  C   + FG   I   P   C VE+
Sbjct  167  VGTWISGNYHLNVLCTGNIKFGDMIIKGMPTDPCIVEI  204



>ref|XP_011005351.1| PREDICTED: protein YLS9-like [Populus euphratica]
Length=210

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 81/141 (57%), Gaps = 7/141 (5%)
 Frame = +3

Query  237  QPRFFLRHATLHNFNLTAGNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLP  416
            +P F L+ A ++  +L+A NLL ++I + L +  P +  GIYYD L VYA Y+ Q +T+ 
Sbjct  52   KPEFSLKEADIYQLSLSAPNLLNSSIQLTLLSKNPNQKVGIYYDELQVYAAYKGQQITVD  111

Query  417  APLPASYQGYKDVAVWSAFLSGNSVPVEPG----VG---MAGRVLVNIIVDGWIRKHFWN  575
            +PLP  YQG++D  + +  L G  +PV P     VG    AG++++N+ V+G IR     
Sbjct  112  SPLPPFYQGHQDSNLLTTSLVGTGLPVAPSFNYEVGRDQTAGKLVLNLRVNGRIRWKVGT  171

Query  576  LEVGPCRLSANCPAFLDFGST  638
               G  R++ NC A +  G T
Sbjct  172  WVSGRYRINVNCLAVMALGPT  192



>ref|XP_009600653.1| PREDICTED: protein YLS9 [Nicotiana tomentosiformis]
Length=215

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 86/166 (52%), Gaps = 10/166 (6%)
 Frame = +3

Query  165  LLLFFSTLF--CISLCVAMSAQISLTQPRFFLRHATLHNFNLTA-GNLLTTNISVALAAH  335
            L   FST+F   +S    +   +  T+P F LR A ++  NL+    LL ++I + L + 
Sbjct  30   LFFGFSTIFLSILSFIFLLYLTLHPTKPNFTLREADIYQLNLSGPRRLLNSSIQLTLVSK  89

Query  336  IPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM  515
             P +  GIYYD L VYA Y+ Q +TL   LP  YQG++D    SA L GN +PV+P  G 
Sbjct  90   NPNKKVGIYYDELQVYASYKGQQITLYTSLPPFYQGHEDSNFLSASLIGNGLPVDPSFGY  149

Query  516  -------AGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLDFG  632
                   AG++++N+   G +R        G  R + +C A + FG
Sbjct  150  EVQRDQSAGKLVMNLKASGRLRWKVGTWVSGRYRFNVDCVAIMPFG  195



>ref|XP_004160389.1| PREDICTED: uncharacterized protein LOC101231816 [Cucumis sativus]
Length=212

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 80/141 (57%), Gaps = 8/141 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG-NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVT  410
            ++P F ++ A ++  NL    +LL ++I + L++  P    GIYYD L VYAVY+ Q +T
Sbjct  52   SKPEFRVKQADVYQLNLIDDLHLLNSSIQLTLSSKNPNHRLGIYYDNLQVYAVYKGQQIT  111

Query  411  LPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHF  569
            LP  LP  YQGY++  + +AFL+G+ VPV P  G        AGR ++N+   G +R   
Sbjct  112  LPTSLPPFYQGYQEGNLLTAFLAGSRVPVAPSFGYEVGRDQSAGRFVLNLKAMGRLRWKV  171

Query  570  WNLEVGPCRLSANCPAFLDFG  632
             +   G  R + NC A + FG
Sbjct  172  GSWVSGGYRFNVNCVAVMPFG  192



>ref|XP_004145957.1| PREDICTED: uncharacterized protein LOC101209545 [Cucumis sativus]
 gb|KGN49822.1| NDR1/HIN1-like protein [Cucumis sativus]
Length=212

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 80/141 (57%), Gaps = 8/141 (6%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG-NLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVT  410
            ++P F ++ A ++  NL    +LL ++I + L++  P    GIYYD L VYAVY+ Q +T
Sbjct  52   SKPEFRVKQADVYQLNLIDDLHLLNSSIQLTLSSKNPNHRLGIYYDNLQVYAVYKGQQIT  111

Query  411  LPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLVNIIVDGWIRKHF  569
            LP  LP  YQGY++  + +AFL+G+ VPV P  G        AGR ++N+   G +R   
Sbjct  112  LPTSLPPFYQGYQEGNLLTAFLAGSRVPVAPSFGYEVGRDQSAGRFVLNLKAMGRLRWKV  171

Query  570  WNLEVGPCRLSANCPAFLDFG  632
             +   G  R + NC A + FG
Sbjct  172  GSWVSGGYRFNVNCVAVMPFG  192



>ref|NP_001151328.1| VAMP protein SEC22 [Zea mays]
 gb|ACG42391.1| VAMP protein SEC22 [Zea mays]
 gb|AFW65081.1| VAMP protein SEC22 [Zea mays]
Length=213

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 94/181 (52%), Gaps = 14/181 (8%)
 Frame = +3

Query  114  GEMKDDLPKKSFNCCCVLLLFFSTLFCISLCVAMSAQISL--TQPRFFLRHATLHNFNLT  287
            G   DD  ++S   C  LL    T+  +   VA+   + L  T PRF+L+ A L   +L+
Sbjct  6    GNHGDDDFRQS---CRRLLAILLTMALLVGVVALIVYLVLRPTHPRFYLQDAALRQLDLS  62

Query  288  AGN--LLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAV  461
             G+  LL+T   V +A+  P    G+YYDRL VYA Y+ Q VTL + LPA YQG+ DV V
Sbjct  63   NGSAPLLSTAAQVTVASRNPNGRVGVYYDRLDVYATYKYQQVTLASRLPAVYQGHGDVDV  122

Query  462  WSAFLSGNSVPVEP-------GVGMAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAF  620
            WS  L+G +VP  P           AG +++ + +DG +R    +   G   +   CPA+
Sbjct  123  WSPVLAGPAVPFAPFLADALAKDLAAGYLVLQLRIDGRVRWKVGSWVSGHYHMFVTCPAY  182

Query  621  L  623
             
Sbjct  183  F  183



>ref|XP_006653383.1| PREDICTED: uncharacterized protein LOC102711063, partial [Oryza 
brachyantha]
Length=213

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 89/170 (52%), Gaps = 16/170 (9%)
 Frame = +3

Query  150  NCC-----CVLLLFFSTLFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTAGNLLTTNI  314
             CC     C+L L     F +   + +   I  ++P F+L+   L N +L+    ++ N+
Sbjct  7    RCCGSIAACILTLAVLVGFIV---LVIYLAIHPSKPSFYLQDVQLRNIDLS-DPAISLNL  62

Query  315  SVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVP  494
             V +A+  P    GIYY  LHV+  YR++ +T+P  LPA YQG+KDV+VWS  +SG SVP
Sbjct  63   QVTIASRNPNDRVGIYYKTLHVFTTYRDEPITVPVELPAIYQGHKDVSVWSPVMSGESVP  122

Query  495  VEPGVG-------MAGRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFL  623
            V   V         AG VL+++ VDG ++    +   G   L   CPA L
Sbjct  123  VGQYVADAMKQDISAGYVLLHVKVDGRVKWKVGSWVSGGYHLFVTCPALL  172



>ref|XP_006347517.1| PREDICTED: uncharacterized protein LOC102589328 [Solanum tuberosum]
Length=213

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 98/191 (51%), Gaps = 17/191 (9%)
 Frame = +3

Query  117  EMKDDLPKKSFNCCCVLLLFFST--LFCISLCVAMSAQISLTQPRFFLRHATLHNFNLTA  290
            ++++  PKK    C      FST  L  +S    +   +  T+P F LR A ++  NL+ 
Sbjct  18   KVENLFPKKKLFFC------FSTISLSILSFIFLLYLTLHPTKPNFTLREADIYQLNLSG  71

Query  291  -GNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVTLPAPLPASYQGYKDVAVWS  467
               LL ++I + L +  P +  GIYYD L V+A Y+ Q +TL   LP  YQG++D    S
Sbjct  72   PRQLLNSSIQLTLVSKNPNKKVGIYYDELQVFASYKGQQITLHTSLPPFYQGHEDSNFLS  131

Query  468  AFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHFWNLEVGPCRLSANCPAFLD  626
            A L GN +PV+P  G         G++++N+   G +R        G  R + +C A + 
Sbjct  132  ALLIGNGLPVDPYFGYEVQRDQSVGKLIMNLKGSGRLRWKVGTWVSGKYRFNVDCVAIMP  191

Query  627  FGSTSISSSPV  659
            FGS S+ S+P+
Sbjct  192  FGS-SLPSAPL  201



>ref|NP_001060767.1| Os08g0102700 [Oryza sativa Japonica Group]
 dbj|BAD33162.1| harpin-induced protein 1 family (HIN1)-like [Oryza sativa Japonica 
Group]
 dbj|BAF22681.1| Os08g0102700 [Oryza sativa Japonica Group]
 gb|EAZ41224.1| hypothetical protein OsJ_25729 [Oryza sativa Japonica Group]
 dbj|BAG87921.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87996.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG88107.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90460.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92781.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94013.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96723.1| unnamed protein product [Oryza sativa Japonica Group]
Length=227

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 75/150 (50%), Gaps = 20/150 (13%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAG-------------NLLTTNISVALAAHIPYRHRGIYYDRL  374
            T+PRF+L   T+   N+T G             + LT  +   LAA       GIYYDR 
Sbjct  46   TKPRFYLNDLTVVCLNVTTGGSYAGATASSGYFSFLTVTMQTTLAARNGNERVGIYYDRA  105

Query  375  HVYAVYRNQTVTLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGM-------AGRVLV  533
             VYA Y+   +T+P  LP  YQG+ D+ VWS FLSGN+V + P + +       AG +LV
Sbjct  106  DVYAEYKGLRITVPTSLPPVYQGHPDLTVWSPFLSGNNVQLPPYLAVSITQDETAGYLLV  165

Query  534  NIIVDGWIRKHFWNLEVGPCRLSANCPAFL  623
             I VDGWIR        G   L   CPA L
Sbjct  166  TIRVDGWIRYKAGAFITGHYHLRVRCPALL  195



>ref|XP_004289007.1| PREDICTED: uncharacterized protein LOC101296146 [Fragaria vesca 
subsp. vesca]
Length=213

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 87/169 (51%), Gaps = 20/169 (12%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTAGN--LLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTV  407
            ++P F L+  T+ +FN++     LL+TN+ V ++      H GI Y+++ +YA YR++ +
Sbjct  45   SKPSFTLQDITVSSFNVSTTQPYLLSTNMQVTISTQNSMPHVGIIYEKVELYATYRDEQI  104

Query  408  TLPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKH  566
            T    LP +YQ + +V VWS +L G++ P+ P  G         G VLV + +DG I+  
Sbjct  105  TFRYTLPKTYQEHSEVVVWSPYLEGHTTPISPISGPVLMQDLNYGAVLVMVKIDGRIKFR  164

Query  567  FWNLEVGPCRLSANCPAFLDFGSTSISS-----------SPVQSCHVEV  680
                  G  RL  +CPA +  G  +              + VQ+CHVE+
Sbjct  165  VAQWTSGIYRLYVHCPAMIQLGDMNTDKEFAASAKEFKFTLVQNCHVEI  213



>ref|XP_008799695.1| PREDICTED: protein YLS9 [Phoenix dactylifera]
Length=207

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 90/165 (55%), Gaps = 16/165 (10%)
 Frame = +3

Query  234  TQPRFFLRHATLHNFNLTA-GNLLTTNISVALAAHIPYRHRGIYYDRLHVYAVYRNQTVT  410
            T+P+ +L+ A++  FN+++  NLL++ + V ++   P    GIYYDR+ V+A Y+ Q +T
Sbjct  43   TKPKIYLQDASVSAFNVSSPENLLSSTLQVTISTRNPNDRIGIYYDRVDVFASYKYQQIT  102

Query  411  LPAPLPASYQGYKDVAVWSAFLSGNSVPVEPGVGMA-------GRVLVNIIVDGWIRKHF  569
            L A +P  YQG+ D+ VWS +L G  +PV P +  A       G +L++I +DG +R   
Sbjct  103  LAASVPPFYQGHNDIDVWSPYLYGVDIPVAPYLAEALVQDQSSGFLLLHIKIDGRVRWKV  162

Query  570  WNLEVGPCRLSANCPAFLDFGS-TSISSSP-------VQSCHVEV  680
                     L A CPAFL F +   +   P       + +C V+V
Sbjct  163  GTWISNHYHLYATCPAFLSFETGKGVDGDPPAVKFQQISTCSVDV  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1774205954430