BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25376_g4_i1 len=1276 path=[20270:0-378 608:379-434 9971:435-1275]

Length=1276
                                                                      Score     E

ref|XP_004239280.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    476   8e-164   
ref|XP_009766206.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    474   4e-163   
ref|XP_006338167.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    473   1e-162   
ref|XP_009368820.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    471   5e-162   
ref|XP_007202229.1|  hypothetical protein PRUPE_ppa008641mg             471   9e-162   
ref|XP_006450977.1|  hypothetical protein CICLE_v10008900mg             469   3e-161   
ref|XP_006475811.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    469   3e-161   
ref|XP_008242738.1|  PREDICTED: LOW QUALITY PROTEIN: NADH-cytochr...    467   3e-160   
gb|KHG22330.1|  hypothetical protein F383_00898                         466   7e-160   
ref|XP_002285073.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    465   2e-159   Vitis vinifera
ref|XP_011019319.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    458   9e-157   
ref|XP_011084136.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    457   1e-156   
ref|XP_010250026.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    456   1e-155   
ref|XP_007013383.1|  FAD/NAD(P)-binding oxidoreductase isoform 1        454   3e-155   
ref|XP_002309454.2|  hypothetical protein POPTR_0006s23520g             452   2e-154   Populus trichocarpa [western balsam poplar]
ref|XP_002524462.1|  NADH-cytochrome B5 reductase, putative             452   2e-154   Ricinus communis
gb|KDP32376.1|  hypothetical protein JCGZ_13301                         451   5e-154   
emb|CAN63505.1|  hypothetical protein VITISV_011680                     451   9e-154   Vitis vinifera
ref|XP_007154982.1|  hypothetical protein PHAVU_003G162900g             450   1e-153   
ref|XP_010321068.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    451   2e-153   
ref|XP_004287348.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    449   3e-153   
ref|XP_010688037.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    449   4e-153   
ref|XP_010047814.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    446   6e-152   
ref|XP_002871921.1|  hypothetical protein ARALYDRAFT_910048             443   6e-151   
ref|NP_568391.1|  NADH-cytochrome b5 reductase-like protein             443   8e-151   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010535871.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    442   2e-150   
ref|XP_010321069.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    442   6e-150   
ref|XP_010493103.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    440   9e-150   
gb|KHN27422.1|  NADH-cytochrome b5 reductase-like protein               440   1e-149   
ref|XP_006289228.1|  hypothetical protein CARUB_v10002684mg             440   2e-149   
ref|XP_010420842.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    439   3e-149   
ref|XP_010088329.1|  NADH-cytochrome b5 reductase-like protein          439   4e-149   
ref|NP_001242425.1|  uncharacterized protein LOC100781191               437   2e-148   
emb|CDP10379.1|  unnamed protein product                                437   3e-148   
ref|XP_010520587.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    437   3e-148   
emb|CDX70911.1|  BnaC03g09950D                                          436   3e-148   
ref|XP_004508521.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    436   5e-148   
ref|XP_010454305.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    435   9e-148   
ref|XP_003609284.1|  NADH-cytochrome b5 reductase-like protein          435   1e-147   
gb|KCW79798.1|  hypothetical protein EUGRSUZ_C011341                    432   1e-147   
ref|XP_009131771.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    434   2e-147   
gb|KFK26253.1|  hypothetical protein AALP_AA8G223100                    433   6e-147   
ref|NP_001239743.1|  uncharacterized protein LOC100819222               432   1e-146   
ref|XP_007013384.1|  FAD/NAD(P)-binding oxidoreductase isoform 2        432   1e-146   
ref|XP_004139319.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    429   3e-145   
ref|XP_011084137.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    427   4e-145   
gb|EPS65850.1|  hypothetical protein M569_08927                         424   1e-143   
ref|XP_010914901.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    424   4e-143   
ref|XP_008457751.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    422   2e-142   
ref|XP_006842829.1|  hypothetical protein AMTR_s00081p00094290          422   3e-142   
ref|XP_008673639.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    414   8e-140   
ref|XP_002455097.1|  hypothetical protein SORBIDRAFT_03g004270          414   2e-139   Sorghum bicolor [broomcorn]
gb|EEC70028.1|  hypothetical protein OsI_00602                          413   3e-139   Oryza sativa Indica Group [Indian rice]
ref|XP_006645552.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    412   5e-139   
emb|CDM81967.1|  unnamed protein product                                412   9e-139   
ref|XP_003569450.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    411   2e-138   
ref|NP_001042163.1|  Os01g0174300                                       410   4e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009380415.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    409   2e-137   
gb|EMT04682.1|  NADH-cytochrome b5 reductase-like protein               406   3e-137   
ref|XP_008792068.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    407   1e-136   
gb|EYU29785.1|  hypothetical protein MIMGU_mgv1a010756mg                404   1e-135   
emb|CDX88861.1|  BnaA03g07880D                                          432   7e-135   
ref|XP_004968383.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    400   2e-134   
ref|XP_009768340.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    397   5e-134   
gb|EMS59096.1|  NADH-cytochrome b5 reductase-like protein               382   2e-127   
ref|XP_009626072.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    363   1e-119   
gb|AAK69398.1|AF274589_1  cytochrome b5 reductase PP36                  351   6e-115   Cucurbita maxima [Boston marrow]
ref|XP_001754409.1|  predicted protein                                  343   9e-113   
gb|KGN60665.1|  hypothetical protein Csa_2G006110                       339   1e-110   
gb|AHI85717.1|  stress-induced protein 12                               337   5e-110   
ref|XP_008337406.1|  PREDICTED: LOW QUALITY PROTEIN: NADH-cytochr...    319   3e-103   
ref|XP_007013385.1|  FAD/NAD(P)-binding oxidoreductase isoform 3        318   4e-103   
gb|KCW79799.1|  hypothetical protein EUGRSUZ_C011341                    311   1e-100   
gb|KCW79800.1|  hypothetical protein EUGRSUZ_C011341                    311   1e-100   
ref|XP_004173389.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    311   4e-100   
ref|XP_005645756.1|  cytochrome-b5 reductase like protein               301   2e-95    
ref|XP_002957125.1|  hypothetical protein VOLCADRAFT_107549             281   6e-88    
ref|XP_006400575.1|  hypothetical protein EUTSA_v100141990mg            267   4e-84    
tpg|DAA53221.1|  TPA: hypothetical protein ZEAMMB73_223419              269   5e-84    
gb|EAY72732.1|  hypothetical protein OsI_00597                          263   6e-80    Oryza sativa Indica Group [Indian rice]
ref|XP_005791288.1|  putative cytochrome b5 reductase                   261   2e-79    
ref|XP_002900838.1|  NADH-cytochrome b5 reductase, putative             243   3e-73    
ref|XP_001754645.1|  predicted protein                                  241   8e-73    
ref|XP_009521628.1|  hypothetical protein PHYSODRAFT_297652             239   9e-72    
gb|AFK47499.1|  unknown                                                 235   2e-71    
emb|CDS07838.1|  hypothetical protein LRAMOSA01787                      238   7e-71    
gb|ETI36282.1|  hypothetical protein F443_17558                         238   8e-71    
ref|XP_008896046.1|  hypothetical protein PPTG_03992                    237   8e-71    
gb|ETK76501.1|  hypothetical protein L915_17091                         237   9e-71    
gb|AAR88781.1|  cytochrome b5 reductase                                 232   1e-70    Musa acuminata [banana]
ref|XP_008864775.1|  hypothetical protein H310_02881                    236   2e-70    
emb|CDH48899.1|  nadh-cytochrome b5 reductase                           237   3e-70    
gb|EXX63737.1|  Cbr1p                                                   232   3e-69    
ref|XP_005846927.1|  hypothetical protein CHLNCDRAFT_10756              231   4e-69    
ref|XP_003652250.1|  hypothetical protein THITE_2150123                 232   2e-68    
ref|XP_001269706.1|  NADH-cytochrome b5 reductase, putative             231   3e-68    Aspergillus clavatus NRRL 1
emb|CCA21618.1|  NADHcytochrome b5 reductase putative                   230   3e-68    
emb|CCI47508.1|  unnamed protein product                                230   4e-68    
gb|KEZ42260.1|  NADH-cytochrome b5 reductase 2                          231   4e-68    
ref|XP_003284619.1|  hypothetical protein DICPUDRAFT_91353              229   6e-68    
ref|XP_002484036.1|  NADH-cytochrome b5 reductase, putative             230   7e-68    Talaromyces stipitatus ATCC 10500
ref|XP_006675128.1|  hypothetical protein BATDEDRAFT_15558              231   8e-68    
ref|XP_001819999.1|  NADH-cytochrome b5 reductase 2                     229   1e-67    Aspergillus oryzae RIB40
ref|XP_003659338.1|  hypothetical protein MYCTH_2136940                 230   2e-67    
ref|XP_007287692.1|  nadh-cytochrome b5 reductase                       229   2e-67    
gb|ETP34222.1|  hypothetical protein F442_17413                         227   3e-67    
gb|EQB59292.1|  hypothetical protein CGLO_00344                         228   3e-67    
ref|XP_008614124.1|  hypothetical protein SDRG_09936                    227   8e-67    
ref|XP_009834721.1|  hypothetical protein H257_10006                    227   1e-66    
ref|XP_003852910.1|  hypothetical protein MYCGRDRAFT_70871              227   1e-66    
ref|XP_004337883.1|  oxidoreductase NADbinding domain containing ...    228   1e-66    
gb|KDO32645.1|  hypothetical protein SPRG_02346                         226   2e-66    
ref|XP_003348346.1|  hypothetical protein SMAC_02843                    226   3e-66    
tpg|DAA53222.1|  TPA: hypothetical protein ZEAMMB73_223419              220   5e-66    
ref|XP_964971.1|  hypothetical protein NCU03112                         225   7e-66    Neurospora crassa OR74A
ref|XP_008727164.1|  hypothetical protein G647_04601                    225   9e-66    
gb|EHK40361.1|  hypothetical protein TRIATDRAFT_302733                  224   1e-65    
gb|KFM28023.1|  NADH-cytochrome b5 reductase-like protein               224   1e-65    
emb|CDS10572.1|  hypothetical protein LRAMOSA11058                      224   2e-65    
gb|KFH45499.1|  NADH-cytochrome b5 reductase-like protein               224   2e-65    
emb|CDO68486.1|  hypothetical protein BN946_scf184499.g11               224   2e-65    
gb|KDN61616.1|  putative oxidoreductase NAD-binding domain-contai...    224   2e-65    
dbj|GAM38127.1|  hypothetical protein TCE0_033f08621                    223   2e-65    
emb|CCM00046.1|  predicted protein                                      224   2e-65    
gb|EGZ77533.1|  NADH-cytochrome b5 reductase 2                          224   2e-65    
ref|XP_007741886.1|  NADH-cytochrome b5 reductase 2                     224   2e-65    
gb|EHK25217.1|  hypothetical protein TRIVIDRAFT_85020                   223   3e-65    
ref|XP_007802205.1|  NADH-cytochrome b5 reductase 2                     223   3e-65    
emb|CCE35167.1|  probable cytochrome-b5 reductase, mitochondrial ...    223   4e-65    
ref|XP_002150236.1|  NADH-cytochrome b5 reductase, putative             221   4e-65    Talaromyces marneffei ATCC 18224
ref|XP_006696352.1|  putative cytochrome b5 protein                     224   4e-65    
ref|XP_003005835.1|  NADH-cytochrome b5 reductase                       223   5e-65    
ref|XP_009856344.1|  hypothetical protein NEUTE1DRAFT_118894            223   5e-65    
ref|XP_008032497.1|  ferredoxin reductase-like C-terminal NADP-li...    223   5e-65    
ref|XP_001220073.1|  hypothetical protein CHGG_00852                    223   5e-65    Chaetomium globosum CBS 148.51
ref|XP_009159077.1|  NADH-cytochrome b5 reductase 2                     223   5e-65    
ref|XP_002150235.1|  NADH-cytochrome b5 reductase, putative             222   7e-65    Talaromyces marneffei ATCC 18224
gb|EPB87581.1|  hypothetical protein HMPREF1544_05563                   222   8e-65    
ref|XP_002997509.1|  NADH-cytochrome b5 reductase, putative             221   1e-64    
ref|XP_006966653.1|  predicted protein                                  222   1e-64    
ref|XP_638259.1|  NADH-cytochrome b5 reductase                          220   1e-64    Dictyostelium discoideum AX4
ref|XP_381102.1|  hypothetical protein FG00926.1                        221   2e-64    Fusarium graminearum PH-1
ref|XP_009263433.1|  hypothetical protein FPSE_12041                    221   2e-64    
emb|CDH59467.1|  nadh-cytochrome b5 reductase 2                         221   2e-64    
ref|XP_009648197.1|  NADH-cytochrome b5 reductase                       221   2e-64    
ref|XP_001908827.1|  hypothetical protein                               221   3e-64    Podospora anserina S mat+
ref|XP_007599327.1|  oxidoreductase NAD-binding domain-containing...    221   3e-64    
gb|ENH80327.1|  nadh-cytochrome b5 reductase                            221   3e-64    
gb|EKC99052.1|  cytochrome-b5 reductase                                 221   4e-64    
gb|KDQ51129.1|  hypothetical protein JAAARDRAFT_41396                   221   4e-64    
gb|EJT48501.1|  cytochrome-b5 reductase                                 221   4e-64    
sp|Q0CRD8.2|MCR1_ASPTN  RecName: Full=NADH-cytochrome b5 reductas...    220   4e-64    Aspergillus terreus NIH2624
gb|ETO67670.1|  hypothetical protein F444_15412                         218   7e-64    
ref|XP_003319934.2|  hypothetical protein PGTG_00846                    220   7e-64    
gb|ETI38943.1|  hypothetical protein F443_15412                         218   7e-64    
ref|XP_001388787.1|  NADH-cytochrome b5 reductase 2                     219   8e-64    Aspergillus niger CBS 513.88
gb|EFQ27839.1|  oxidoreductase NAD-binding domain-containing protein    219   1e-63    
ref|XP_008894985.1|  hypothetical protein PPTG_04494                    218   1e-63    
gb|EMD30879.1|  hypothetical protein CERSUDRAFT_120279                  219   1e-63    
emb|CCF40904.1|  NADH-cytochrome b5 reductase 2                         219   1e-63    
gb|EYE94500.1|  NADH-cytochrome b5 reductase 2                          218   2e-63    
dbj|GAA88697.1|  NADH-cytochrome b5 reductase                           218   2e-63    
emb|CCT62674.1|  probable cytochrome-b5 reductase, mitochondrial ...    218   3e-63    
gb|KIH94306.1|  cytochrome-b5 reductase                                 218   3e-63    
gb|KFA78455.1|  hypothetical protein S40288_06912                       218   4e-63    
gb|ENH61392.1|  NADH-cytochrome b5 reductase 2                          218   4e-63    
gb|EGU79604.1|  hypothetical protein FOXB_09887                         218   5e-63    
gb|EWG36827.1|  NADH-cytochrome b5 reductase 2                          217   7e-63    
gb|EGD98623.1|  NADH-cytochrome b5 reductase                            216   9e-63    
gb|EPQ62420.1|  Mitochondrial NADH-cytochrome b5 reductase              215   9e-63    
emb|CCU78450.1|  NADH-cytochrome b5 reductase                           215   1e-62    
gb|KEY66507.1|  hypothetical protein S7711_04834                        217   1e-62    
emb|CDF90866.1|  ZYBA0S08-05006g1_1                                     215   1e-62    
ref|XP_007840466.1|  NADH-cytochrome b5 reductase 2                     216   2e-62    
ref|XP_007265099.1|  cytochrome-b5 reductase                            216   2e-62    
ref|XP_003233920.1|  NADH-cytochrome b5 reductase                       216   2e-62    
ref|XP_003022050.1|  hypothetical protein TRV_03791                     216   2e-62    
gb|EPY39717.1|  cytochrome-b5 reductase                                 215   2e-62    
gb|EMT61501.1|  NADH-cytochrome b5 reductase 2                          216   2e-62    
gb|EPS27970.1|  hypothetical protein PDE_02915                          215   3e-62    
gb|ERS99239.1|  hypothetical protein HMPREF1624_04437                   216   3e-62    
ref|XP_001464343.1|  putative cytochrome-b5 reductase                   214   4e-62    Leishmania infantum JPCM5
ref|XP_003716173.1|  NADH-cytochrome b5 reductase 2                     215   4e-62    
emb|CDH16881.1|  probable NADH-cytochrome b5 reductase 2-A              214   5e-62    
gb|KDQ18155.1|  hypothetical protein BOTBODRAFT_29492                   215   5e-62    
gb|EKG13870.1|  Oxidoreductase FAD/NAD(P)-binding protein               215   6e-62    
emb|CDH12382.1|  probable NADH-cytochrome b5 reductase 2-A              214   6e-62    
gb|EPY34376.1|  cytochrome-b5 reductase                                 215   7e-62    
ref|XP_009540573.1|  hypothetical protein HETIRDRAFT_437452             214   8e-62    
ref|XP_007588735.1|  putative nadh-cytochrome b5 reductase protein      214   1e-61    
ref|XP_007360878.1|  cytochrome-b5 reductase                            214   1e-61    
ref|XP_005703556.1|  cytochrome-b5 reductase                            214   2e-61    
ref|XP_007719963.1|  cytochrome-b5 reductase                            214   2e-61    
ref|XP_001212924.1|  conserved hypothetical protein                     213   2e-61    Aspergillus terreus NIH2624
ref|XP_007860321.1|  ferredoxin reductase-like protein                  213   2e-61    
ref|XP_007879830.1|  hypothetical protein PFL1_04115                    214   2e-61    
ref|XP_008712070.1|  hypothetical protein HMPREF1541_09173              213   3e-61    
ref|XP_001265210.1|  NADH-cytochrome b5 reductase, putative             212   4e-61    Aspergillus fischeri NRRL 181
ref|XP_006958608.1|  ferredoxin reductase-like protein                  212   5e-61    
ref|XP_002849495.1|  NADH-cytochrome b5 reductase 2                     212   6e-61    Arthroderma otae CBS 113480
ref|XP_502694.1|  YALI0D11330p                                          211   6e-61    Yarrowia lipolytica CLIB122
ref|XP_003197005.1|  cytochrome-b5 reductase                            213   6e-61    
ref|XP_001681919.1|  putative cytochrome-b5 reductase                   210   6e-61    Leishmania major strain Friedlin
ref|XP_007782407.1|  NADH-cytochrome b5 reductase 2                     213   7e-61    
ref|XP_003303374.1|  hypothetical protein PTT_15546                     212   7e-61    
gb|KFA67170.1|  hypothetical protein S40285_05255                       212   1e-60    
ref|XP_658036.1|  hypothetical protein AN0432.2                         211   1e-60    Aspergillus nidulans FGSC A4
ref|XP_007914401.1|  putative nadh-cytochrome b5 reductase protein      212   1e-60    
ref|XP_003054461.1|  predicted protein                                  211   1e-60    
ref|XP_003170191.1|  NADH-cytochrome b5 reductase 2                     211   1e-60    
gb|EEH38032.2|  NADH-cytochrome b5 reductase                            211   1e-60    Paracoccidioides lutzii Pb01
dbj|BAE94684.1|  NADH-cytochrome b5 reductase                           209   1e-60    Physarum polycephalum
gb|EMD86858.1|  hypothetical protein COCHEDRAFT_1023681                 211   1e-60    
ref|XP_007704621.1|  hypothetical protein COCSADRAFT_151944             211   1e-60    
ref|XP_007414895.1|  hypothetical protein MELLADRAFT_72914              211   1e-60    
ref|XP_007685644.1|  hypothetical protein COCMIDRAFT_3240               211   2e-60    
ref|XP_007714565.1|  hypothetical protein COCCADRAFT_102110             211   2e-60    
ref|XP_001593010.1|  hypothetical protein SS1G_05932                    211   2e-60    Sclerotinia sclerotiorum 1980 UF-70
ref|XP_009224456.1|  NADH-cytochrome b5 reductase 2                     212   2e-60    
pdb|2EIX|A  Chain A, The Structure Of Physarum Polycephalum Cytoc...    207   3e-60    
ref|XP_003015848.1|  hypothetical protein ARB_06160                     213   3e-60    
gb|KEQ94190.1|  hypothetical protein AUEXF2481DRAFT_89970               211   3e-60    
ref|XP_001934969.1|  NADH-cytochrome b5 reductase 3                     211   3e-60    Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_007731232.1|  cytochrome-b5 reductase                            211   3e-60    
gb|AFR98892.1|  cytochrome b5 reductase                                 211   3e-60    
gb|KFY31715.1|  hypothetical protein V493_00869                         210   3e-60    
ref|XP_002616102.1|  hypothetical protein CLUG_03343                    209   3e-60    Clavispora lusitaniae ATCC 42720
ref|XP_750202.1|  NADH-cytochrome b5 reductase                          210   4e-60    Aspergillus fumigatus Af293
gb|EGC46316.1|  NADH-cytochrome b5 reductase                            209   4e-60    
ref|XP_007762853.1|  cytochrome-b5 reductase                            209   5e-60    
gb|KGO43235.1|  Riboflavin synthase-like beta-barrel                    209   6e-60    
gb|KFY52174.1|  hypothetical protein V496_08634                         209   6e-60    
emb|CCF50539.1|  related to MCR1-cytochrome-b5 reductase                210   6e-60    
gb|KHN96823.1|  NADH-cytochrome b5 reductase                            209   6e-60    
ref|XP_001799967.1|  hypothetical protein SNOG_09680                    208   7e-60    Parastagonospora nodorum SN15
gb|EJU02531.1|  ferredoxin reductase-like C-terminal NADP-linked ...    209   7e-60    
emb|CCG84183.1|  protein of unknown function                            209   7e-60    
ref|XP_002561243.1|  Pc16g09250                                         209   8e-60    Penicillium rubens Wisconsin 54-1255
sp|A5DQE4.2|MCR1_PICGU  RecName: Full=NADH-cytochrome b5 reductas...    208   8e-60    Meyerozyma guilliermondii
gb|EKG07455.1|  NADH-cytochrome b5 reductase, putative                  207   9e-60    
ref|XP_819351.1|  NADH-cytochrome B5 reductase                          207   1e-59    Trypanosoma cruzi strain CL Brener
ref|XP_003841091.1|  hypothetical protein LEMA_P090210.1                209   1e-59    
gb|KFY84413.1|  hypothetical protein V500_09330                         209   1e-59    
ref|XP_011122701.1|  hypothetical protein AOL_s00080g24                 209   1e-59    
gb|KHJ32156.1|  putative nadh-cytochrome b5 reductase                   208   1e-59    
ref|XP_003071409.1|  Oxidoreductase NAD-binding domain containing...    208   1e-59    
gb|EIE83495.1|  hypothetical protein RO3G_08200                         209   1e-59    
gb|KGO67103.1|  Riboflavin synthase-like beta-barrel                    208   2e-59    
ref|XP_007816839.1|  NADH-cytochrome b5 reductase                       208   2e-59    
ref|XP_002583652.1|  conserved hypothetical protein                     208   2e-59    Uncinocarpus reesii 1704
gb|EFW14777.1|  NADH-cytochrome b5 reductase 2                          208   2e-59    
gb|EMS24227.1|  cytochrome-b5 reductase                                 207   2e-59    
gb|KFY33757.1|  hypothetical protein V494_07364                         208   2e-59    
gb|KFG82542.1|  NADH-cytochrome b5 reductase                            208   2e-59    
gb|KFY03879.1|  hypothetical protein O988_01140                         208   2e-59    
gb|KGY15669.1|  NADH-cytochrome b5 reductase 2                          208   2e-59    
ref|XP_001541497.1|  hypothetical protein HCAG_03595                    208   2e-59    Histoplasma capsulatum NAm1
gb|KID89728.1|  NADH-cytochrome b5 reductase                            207   2e-59    
ref|XP_007792994.1|  putative nadh-cytochrome b5 reductase protein      208   3e-59    
gb|EEQ86273.1|  NADH-cytochrome b5 reductase 2                          207   3e-59    Blastomyces dermatitidis ER-3
ref|XP_001482475.1|  hypothetical protein PGUG_05495                    207   3e-59    Meyerozyma guilliermondii ATCC 6260
gb|KID99193.1|  NADH-cytochrome b5 reductase                            207   3e-59    
gb|EPB82891.1|  hypothetical protein HMPREF1544_10362                   207   3e-59    
gb|KID75246.1|  NADH-cytochrome b5 reductase                            207   3e-59    
ref|XP_008593564.1|  oxidoreductase NAD-binding domain-containing...    208   4e-59    
emb|CEJ88846.1|  Putative NADH-cytochrome b5 reductase                  207   4e-59    
gb|KEQ74299.1|  ferredoxin reductase-like protein                       207   4e-59    
ref|XP_007393889.1|  hypothetical protein PHACADRAFT_253032             207   5e-59    
ref|XP_003038378.1|  hypothetical protein SCHCODRAFT_63960              207   5e-59    
ref|XP_003038372.1|  hypothetical protein SCHCODRAFT_72641              207   5e-59    
gb|EPS99323.1|  ferredoxin reductase-like C-terminal NADP-linked ...    207   5e-59    
gb|KFY75107.1|  hypothetical protein V499_04917                         207   5e-59    
gb|EKV11299.1|  NADH-cytochrome b5 reductase, putative                  207   5e-59    
gb|KFZ05830.1|  hypothetical protein V501_07984                         207   6e-59    
gb|EMR86221.1|  putative nadh-cytochrome b5 reductase protein           207   6e-59    
ref|XP_001549033.1|  NADH-cytochrome b5 reductase                       207   6e-59    Botrytis cinerea B05.10
ref|XP_009518646.1|  hypothetical protein PHYSODRAFT_284727             206   6e-59    
gb|ESS68638.1|  NADH-cytochrome b5 reductase                            206   6e-59    
ref|XP_010759633.1|  NADH-cytochrome b5 reductase 2                     206   7e-59    
emb|CCC48926.1|  putative NADH-cytochrome b5 reductase                  205   7e-59    
ref|XP_572314.1|  cytochrome-b5 reductase                               207   7e-59    
gb|KDB18084.1|  NADH-cytochrome b5 reductase                            206   8e-59    
gb|EEH11336.1|  NADH-cytochrome b5 reductase                            206   9e-59    
gb|KDD75841.1|  hypothetical protein H632_c475p1                        209   9e-59    
gb|KFX98769.1|  hypothetical protein V490_02126                         206   1e-58    
gb|EFA75848.1|  NADH-cytochrome b5 reductase                            205   1e-58    
ref|XP_772503.1|  hypothetical protein CNBL1180                         207   1e-58    
ref|XP_008029098.1|  hypothetical protein SETTUDRAFT_164779             204   1e-58    
ref|XP_006670705.1|  NADH-cytochrome b5 reductase                       207   1e-58    
ref|XP_007313108.1|  hypothetical protein SERLADRAFT_456050             206   1e-58    
ref|XP_007813758.1|  NADH-cytochrome b5 reductase                       206   1e-58    
gb|EFW99155.1|  NADH-cytochrome b5 reductase                            204   1e-58    
ref|XP_003873529.1|  putative cytochrome-b5 reductase                   204   1e-58    
ref|XP_003297897.1|  hypothetical protein PTT_08453                     204   2e-58    
ref|XP_002672567.1|  predicted protein                                  205   2e-58    
gb|ELR06541.1|  hypothetical protein GMDG_02175                         206   2e-58    
sp|Q1DXN1.2|MCR1_COCIM  RecName: Full=NADH-cytochrome b5 reductas...    205   2e-58    
ref|XP_008020567.1|  hypothetical protein SETTUDRAFT_177891             206   2e-58    
emb|CDM26452.1|  NADH-cytochrome b5 reductase 2                         205   2e-58    
gb|EKF39672.1|  NADH-cytochrome b5 reductase, putative                  204   3e-58    
gb|AAX49402.1|  NADH-cytochrome b5 reductase                            205   3e-58    
ref|XP_001275746.1|  NADH-cytochrome B5 reductase                       204   3e-58    
ref|XP_001524001.1|  hypothetical protein LELG_04814                    204   3e-58    
ref|XP_001930645.1|  NADH-cytochrome b5 reductase 3                     203   3e-58    
ref|XP_755738.2|  NADH-cytochrome b5 reductase                          204   3e-58    
gb|KDE04348.1|  hypothetical protein MVLG_05227                         205   4e-58    
ref|XP_001801691.1|  hypothetical protein SNOG_11449                    205   4e-58    
gb|KFY37866.1|  hypothetical protein V495_06895                         205   4e-58    
ref|XP_007809484.1|  nitrate reductase                                  204   4e-58    
gb|KEQ61431.1|  ferredoxin reductase-like protein                       205   5e-58    
sp|Q5AZB4.2|NCB5R_EMENI  RecName: Full=NADH-cytochrome b5 reducta...    204   5e-58    
ref|XP_001245491.1|  hypothetical protein CIMG_04932                    206   5e-58    
ref|XP_004197023.1|  Piso0_004258                                       203   6e-58    
emb|CDI54503.1|  related to MCR1-cytochrome-b5 reductase                205   6e-58    
gb|ESW97123.1|  NADH-cytochrome b5 reductase 2                          202   6e-58    
ref|XP_663970.1|  hypothetical protein AN6366.2                         204   6e-58    
ref|XP_001646095.1|  hypothetical protein Kpol_543p67                   203   7e-58    
ref|XP_001829397.2|  cytochrome-b5 reductase                            204   7e-58    
gb|KEF62242.1|  hypothetical protein A1O9_00214                         205   7e-58    
dbj|GAD96181.1|  hypothetical protein AN6366.2                          203   8e-58    
ref|XP_007844532.1|  cytochrome-b5 reductase                            204   8e-58    
gb|KDQ16711.1|  hypothetical protein BOTBODRAFT_43300                   202   8e-58    
sp|A1DHW1.2|NCB5R_NEOFI  RecName: Full=NADH-cytochrome b5 reducta...    203   1e-57    
dbj|GAM25286.1|  hypothetical protein SAMD00019534_084610               202   1e-57    
ref|XP_001563454.1|  putative cytochrome-b5 reductase                   202   1e-57    
gb|KFH72534.1|  hypothetical protein MVEG_02823                         203   1e-57    
ref|XP_007313808.1|  hypothetical protein SERLADRAFT_457499             205   1e-57    
gb|KID80038.1|  nitrate reductase                                       202   1e-57    
gb|KFH73743.1|  cytochrome-b5 reductase                                 201   2e-57    
ref|XP_010697383.1|  cytochrome-b5 reductase, putative                  201   2e-57    
ref|XP_002837116.1|  hypothetical protein                               203   2e-57    
gb|EPS31715.1|  hypothetical protein PDE_06672                          202   2e-57    
ref|XP_007390926.1|  hypothetical protein PHACADRAFT_248183             203   2e-57    
ref|XP_001260865.1|  NADH-cytochrome B5 reductase                       203   2e-57    
ref|XP_006339205.1|  PREDICTED: NADH--cytochrome b5 reductase 1-l...    201   2e-57    
ref|XP_007822002.1|  nitrate reductase                                  202   2e-57    
gb|EGO03701.1|  hypothetical protein SERLA73DRAFT_45789                 200   2e-57    
gb|KIE03030.1|  nitrate reductase                                       202   2e-57    
gb|ESZ98962.1|  NADH-cytochrome b5 reductase                            203   3e-57    
gb|KID91071.1|  nitrate reductase                                       202   3e-57    
ref|XP_007339495.1|  ferredoxin reductase-like protein                  200   3e-57    
ref|XP_002496113.1|  ZYRO0C10780p                                       201   3e-57    
ref|XP_003624753.1|  NADH cytochrome b5 reductase                       201   4e-57    
gb|KFG83094.1|  nitrate reductase                                       201   4e-57    
ref|XP_011114960.1|  hypothetical protein H072_9388                     202   4e-57    
gb|KHN95100.1|  nitrate reductase                                       201   4e-57    
ref|XP_003038376.1|  hypothetical protein SCHCODRAFT_231100             202   4e-57    
ref|XP_007700426.1|  hypothetical protein COCSADRAFT_37445              201   4e-57    
ref|XP_001465595.1|  putative NADH-cytochrome b5 reductase              201   5e-57    
ref|XP_007926128.1|  hypothetical protein MYCFIDRAFT_87623              202   5e-57    
gb|EMG50267.1|  NADH-cytochrome b5 reductase 2                          201   5e-57    
ref|XP_006686179.1|  ferredoxin reductase-like protein                  201   5e-57    
gb|KDR85519.1|  hypothetical protein GALMADRAFT_234435                  201   6e-57    
gb|KDB17464.1|  nitrate reductase                                       201   6e-57    
gb|EMF14432.1|  NADH-cytochrome b5 reductase 2                          202   7e-57    
dbj|BAE59632.1|  unnamed protein product                                199   7e-57    
ref|XP_001683229.1|  putative NADH-cytochrome b5 reductase              200   8e-57    
ref|XP_002379810.1|  NADH-cytochrome b5 reductase                       200   8e-57    
ref|XP_007763322.1|  NADH-cytochrome b5 reductase                       201   9e-57    
ref|XP_010041084.1|  PREDICTED: NADH--cytochrome b5 reductase 1-like    198   1e-56    
ref|XP_004493245.1|  PREDICTED: NADH--cytochrome b5 reductase 1-like    199   1e-56    
ref|XP_002420980.1|  NADH-cytochrome b5 reductase precursor, puta...    200   1e-56    
gb|EMT06434.1|  NADH-cytochrome b5 reductase 1                          199   1e-56    
gb|EXX68866.1|  Cbr1p                                                   200   1e-56    
gb|KFY29394.1|  hypothetical protein V491_00069                         211   1e-56    
gb|EIF47349.1|  nadh-cytochrome b5 reductase                            199   1e-56    
emb|CDM83910.1|  unnamed protein product                                199   1e-56    
ref|XP_003663350.1|  hypothetical protein MYCTH_2305189                 200   1e-56    
gb|EWG48498.1|  NADH-cytochrome b5 reductase 1                          200   1e-56    
ref|XP_009541344.1|  hypothetical protein HETIRDRAFT_378419             201   1e-56    
ref|XP_007291280.1|  NADH-cytochrome b5 reductase                       201   2e-56    
ref|XP_009267166.1|  NADH-cytochrome b5 reductase 2                     200   2e-56    
emb|CCA68189.1|  related to cytochrome-b5 reductase                     201   2e-56    
gb|EMD41808.1|  hypothetical protein CERSUDRAFT_120744                  201   2e-56    
ref|XP_004249368.1|  PREDICTED: NADH--cytochrome b5 reductase 1         199   2e-56    
ref|XP_009797743.1|  PREDICTED: NADH--cytochrome b5 reductase 1         198   2e-56    
ref|XP_003051770.1|  predicted protein                                  199   2e-56    
emb|CCE30903.1|  probable cytochrome-b5 reductase                       199   2e-56    
gb|KCW65146.1|  hypothetical protein EUGRSUZ_G02647                     197   2e-56    
gb|EMD92868.1|  hypothetical protein COCHEDRAFT_1193236                 199   2e-56    
dbj|GAC74181.1|  NADH-cytochrome b-5 reductase                          201   3e-56    
ref|XP_007707409.1|  hypothetical protein COCCADRAFT_83264              198   3e-56    
gb|EST08009.1|  NADH-cytochrome b-5 reductase                           201   3e-56    
dbj|GAK66082.1|  cytochrome-b5 reductase                                200   3e-56    
ref|XP_002846458.1|  NADH-cytochrome b5 reductase 1                     199   3e-56    
gb|KHC32118.1|  NADH-cytochrome b5 reductase 2                          199   3e-56    
ref|XP_011006183.1|  PREDICTED: NADH--cytochrome b5 reductase 1-like    198   3e-56    
ref|XP_008354377.1|  PREDICTED: NADH-cytochrome b5 reductase-like...    193   4e-56    
gb|KGR04947.1|  NADH-cytochrome b5 reductase 2                          199   4e-56    
ref|XP_001245838.1|  conserved hypothetical protein                     199   4e-56    
ref|XP_007673543.1|  hypothetical protein BAUCODRAFT_31232              200   4e-56    
ref|XP_009309597.1|  putative NADH-cytochrome b5 reductase              198   4e-56    
gb|EEQ46797.1|  NADH-cytochrome b5 reductase precursor                  199   4e-56    
ref|XP_759922.1|  hypothetical protein UM03775.1                        200   4e-56    
ref|XP_710845.1|  hypothetical protein CaO19.3507                       198   4e-56    
gb|EUN31789.1|  hypothetical protein COCVIDRAFT_86858                   197   5e-56    
ref|XP_010274919.1|  PREDICTED: NADH--cytochrome b5 reductase 1         197   6e-56    
ref|XP_002583386.1|  hypothetical protein UREG_06353                    198   6e-56    
gb|KDN50135.1|  hypothetical protein RSAG8_01471                        199   6e-56    
ref|XP_007917139.1|  putative nadh-cytochrome b5 reductase 1 protein    198   6e-56    
ref|XP_007842318.1|  nadh-cytochrome b5 reductase                       199   6e-56    
emb|CCO26926.1|  hypothetical protein BN14_00958                        199   7e-56    
ref|XP_007378467.1|  ferredoxin reductase-like C-terminal NADP-li...    199   7e-56    
gb|EPE02789.1|  nadh-cytochrome b5 reductase 2                          199   7e-56    
ref|XP_009256170.1|  hypothetical protein FPSE_04777                    198   7e-56    
ref|XP_006384726.1|  hypothetical protein POPTR_0004s20550g             197   7e-56    
emb|CDP17645.1|  unnamed protein product                                197   8e-56    
dbj|BAK02666.1|  predicted protein                                      197   8e-56    
ref|XP_459666.1|  DEHA2E08228p                                          197   8e-56    
ref|XP_001763831.1|  predicted protein                                  197   8e-56    
ref|XP_003236609.1|  NADH-cytochrome b5 reductase                       198   8e-56    
ref|XP_004961693.1|  PREDICTED: NADH--cytochrome b5 reductase 1-like    197   8e-56    
gb|KDE06112.1|  NADH-cytochrome b5 reductase 1                          197   8e-56    
ref|NP_001044612.1|  Os01g0814900                                       197   8e-56    
dbj|GAD92810.1|  hypothetical protein AN0432.2                          199   8e-56    
gb|KFY15584.1|  hypothetical protein V492_01877                         200   9e-56    
ref|XP_003022423.1|  flavohemoprotein, putative                         197   9e-56    
gb|EGD93816.1|  NADH-cytochrome b5 reductase                            198   9e-56    
gb|KDB31721.1|  NADH-cytochrome b5 reductase 1                          198   9e-56    
ref|XP_003016432.1|  flavohemoprotein, putative                         197   1e-55    
gb|EKV06585.1|  NADH-cytochrome b5 reductase                            197   1e-55    
ref|XP_006485567.1|  PREDICTED: NADH--cytochrome b5 reductase 1-like    197   1e-55    
ref|XP_387123.1|  hypothetical protein FG06947.1                        197   1e-55    
dbj|GAM25523.1|  hypothetical protein SAMD00019534_086980               197   1e-55    
ref|XP_002548604.1|  NADH-cytochrome b5 reductase precursor             197   1e-55    
ref|XP_009771295.1|  PREDICTED: NADH--cytochrome b5 reductase 1-like    196   1e-55    
emb|CEI93405.1|  hypothetical protein RMCBS344292_07639                 198   1e-55    
ref|XP_006379355.1|  hypothetical protein POPTR_0009s15880g             196   1e-55    
emb|CCT65930.1|  probable cytochrome-b5 reductase                       197   2e-55    
gb|EWY98679.1|  NADH-cytochrome b5 reductase 1                          197   2e-55    
ref|XP_007377405.1|  NADH-cytochrome b5 reductase 2                     197   2e-55    
gb|EWZ44760.1|  NADH-cytochrome b5 reductase 1                          197   2e-55    
gb|KEQ80058.1|  ferredoxin reductase-like protein                       198   2e-55    
gb|EGU78852.1|  hypothetical protein FOXB_10641                         197   2e-55    
gb|KIH91840.1|  cytochrome-b5 reductase                                 197   2e-55    
dbj|GAC92496.1|  NADH-cytochrome b5 reductase 3                         198   2e-55    
ref|XP_003174878.1|  NADH-cytochrome b5 reductase 1                     197   2e-55    
ref|XP_002797094.1|  NADH-cytochrome b5 reductase                       197   2e-55    
emb|CCE39760.1|  hypothetical protein CPAR2_601800                      196   2e-55    
gb|EYU30340.1|  hypothetical protein MIMGU_mgv1a011487mg                196   2e-55    
ref|NP_983457.1|  ACR054Cp                                              197   2e-55    
ref|XP_010519356.1|  PREDICTED: NADH--cytochrome b5 reductase 1-like    196   2e-55    
gb|KGQ11995.1|  NADH-cytochrome b5 reductase 2                          194   3e-55    
gb|KDQ63812.1|  hypothetical protein JAAARDRAFT_119693                  196   3e-55    
gb|EMS18312.1|  cytochrome-b5 reductase                                 198   3e-55    
gb|EPY26016.1|  cytochrome-b5 reductase                                 195   3e-55    
gb|KGO77539.1|  Riboflavin synthase-like beta-barrel                    196   3e-55    
gb|EIE81456.1|  hypothetical protein RO3G_06161                         194   4e-55    
ref|XP_011043759.1|  PREDICTED: NADH--cytochrome b5 reductase 1-like    195   4e-55    
emb|CEI99305.1|  hypothetical protein RMCBS344292_13396                 197   4e-55    
ref|XP_001564990.1|  putative NADH-cytochrome b5 reductase              196   4e-55    
ref|XP_003875534.1|  putative NADH-cytochrome b5 reductase              196   4e-55    
ref|XP_002558085.1|  Pc12g12740                                         196   4e-55    
gb|AHX42562.1|  cytochrome b5 reductase                                 195   5e-55    
ref|XP_002458672.1|  hypothetical protein SORBIDRAFT_03g037870          195   5e-55    
gb|ESL08924.1|  NADH-cytochrome B5 reductase                            195   5e-55    
ref|XP_010699070.1|  NADH-cytochrome b5 reductase, putative             194   6e-55    
gb|ERS99761.1|  NADH-cytochrome b5 reductase 1                          196   6e-55    
ref|XP_010699069.1|  NADH-cytochrome b5 reductase, putative             195   6e-55    
ref|XP_001208762.1|  hypothetical protein ATEG_01397                    195   6e-55    
ref|XP_002439983.1|  hypothetical protein SORBIDRAFT_09g023850          194   7e-55    
ref|XP_003875533.1|  putative NADH-cytochrome b5 reductase              195   8e-55    
ref|XP_001564991.1|  putative NADH-cytochrome b5 reductase              193   8e-55    
ref|XP_007379149.1|  cytochrome-b5 reductase                            196   8e-55    
gb|KDP39630.1|  hypothetical protein JCGZ_02650                         194   8e-55    
ref|XP_009225596.1|  NADH-cytochrome b5 reductase 1                     195   8e-55    
gb|EME46111.1|  hypothetical protein DOTSEDRAFT_70195                   196   8e-55    
gb|KGO39220.1|  Riboflavin synthase-like beta-barrel                    195   9e-55    
ref|XP_006644897.1|  PREDICTED: NADH--cytochrome b5 reductase 1-like    194   1e-54    
emb|CEG71792.1|  hypothetical protein RMATCC62417_07462                 196   1e-54    
ref|XP_002797612.1|  NADH-cytochrome b5 reductase                       195   1e-54    
ref|XP_001773674.1|  predicted protein                                  194   1e-54    
ref|XP_007280411.1|  nitrate reductase                                  195   1e-54    
ref|XP_007265763.1|  NADH-cytochrome b5 reductase                       196   1e-54    
ref|XP_003717298.1|  NADH-cytochrome b5 reductase 1                     194   2e-54    
ref|XP_004350565.1|  NADH-cytochrome b5 reductase                       195   2e-54    
gb|AAD17694.1|  cytochrome b5 reductase                                 194   2e-54    
ref|XP_011069956.1|  PREDICTED: NADH--cytochrome b5 reductase 1-like    193   2e-54    
gb|KDQ30617.1|  hypothetical protein PLEOSDRAFT_1070193                 194   2e-54    
ref|XP_007691420.1|  hypothetical protein COCMIDRAFT_104507             194   2e-54    
emb|CDO72313.1|  hypothetical protein BN946_scf184977.g10               196   2e-54    
ref|XP_002837277.1|  hypothetical protein                               194   2e-54    
gb|EPT04262.1|  hypothetical protein FOMPIDRAFT_1021945                 194   2e-54    
ref|XP_011046470.1|  PREDICTED: NADH--cytochrome b5 reductase 1-l...    193   2e-54    
ref|XP_007834800.1|  NADH-cytochrome b5 reductase 1                     194   2e-54    
ref|XP_009598651.1|  PREDICTED: NADH--cytochrome b5 reductase 1-l...    194   2e-54    
ref|XP_003867270.1|  Cbr1 cytochrome B5 reductase                       195   2e-54    
gb|EEC79435.1|  hypothetical protein OsI_20413                          193   2e-54    
gb|ENH64625.1|  NADH-cytochrome b5 reductase 1                          197   2e-54    
gb|KDN52564.1|  putative NADH-cytochrome b5 reductase 2                 196   2e-54    
dbj|BAK01889.1|  predicted protein                                      193   2e-54    
gb|KFH48032.1|  NADH-cytochrome b5 reductase-like protein               194   2e-54    
ref|XP_009598652.1|  PREDICTED: NADH--cytochrome b5 reductase 1-l...    193   2e-54    
ref|XP_001874137.1|  NADH-cytochrome b5 reductase                       193   2e-54    
ref|XP_003520929.1|  PREDICTED: NADH--cytochrome b5 reductase 1         193   2e-54    
ref|XP_004335027.1|  NADH cytochrome b reductase, putative              194   3e-54    
ref|NP_001055888.1|  Os05g0488900                                       193   3e-54    
ref|XP_001695724.1|  NADH-cytochrome b5 reductase                       193   3e-54    
ref|XP_008082103.1|  Ferredoxin reductase-like, C-terminal NADP-l...    195   3e-54    
ref|XP_008033072.1|  NADH-cytochrome b5 reductase                       195   3e-54    



>ref|XP_004239280.1| PREDICTED: NADH-cytochrome b5 reductase-like protein isoform 
X3 [Solanum lycopersicum]
Length=323

 Score =   476 bits (1225),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 258/328 (79%), Positives = 297/328 (91%), Gaps = 6/328 (2%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+ L ++LAKAAPIAF    RG+SKS FA  RFPFGA AAVAG  SY+Y  SS NLVYL+
Sbjct  1     MAALLRKLAKAAPIAF----RGDSKSNFADPRFPFGAIAAVAGCVSYYYCHSSANLVYLE  56

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
             QI+ED+ +K ALNP++WIEFKL+DRAPVSHN+HLFRFSFDPS+KLGLDIASCI+TRAP+G
Sbjct  57    QISEDSGKKVALNPDKWIEFKLQDRAPVSHNSHLFRFSFDPSSKLGLDIASCILTRAPMG  116

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             + +AEGKPKY IRPYTPISDP+AKG+FDLLIKVYPEGKMSQHFA LKPGD ++VKGPI+K
Sbjct  117   E-NAEGKPKYAIRPYTPISDPEAKGYFDLLIKVYPEGKMSQHFAKLKPGDILQVKGPIEK  175

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
             L Y  NMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQ+SL+YAN+SPDDILLKKKLDV
Sbjct  176   LHYSSNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQVSLVYANLSPDDILLKKKLDV  235

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             LAATHPNLKVFYTVD+PT +WRGG G++SK+M+VKGLPPP DDTLI VCGPPGM+ H+SG
Sbjct  236   LAATHPNLKVFYTVDNPTNDWRGGIGYVSKNMIVKGLPPPGDDTLILVCGPPGMIRHLSG  295

Query  935   EK-DKREQGELSGVLKEVGYTENMVYKF  1015
             EK + REQGEL+G+LK+VG+TENMVYKF
Sbjct  296   EKPNPREQGELTGLLKDVGFTENMVYKF  323



>ref|XP_009766206.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Nicotiana 
sylvestris]
Length=330

 Score =   474 bits (1221),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 236/277 (85%), Positives = 265/277 (96%), Gaps = 2/277 (1%)
 Frame = +2

Query  188   SSPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
             SSP+LVYL+QINED+ +K ALNP++WIEFKL+DRAPVSHN+HLFRFSFDPS+KLGLDIAS
Sbjct  55    SSPHLVYLEQINEDSGQKVALNPDKWIEFKLQDRAPVSHNSHLFRFSFDPSSKLGLDIAS  114

Query  368   CIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDK  547
             CI+ RAP+G+ +AEGKPKYVIRPYTPISDPD+KG+FDLLIKVYPEGKMSQHFASLKPGD 
Sbjct  115   CILMRAPMGE-NAEGKPKYVIRPYTPISDPDSKGYFDLLIKVYPEGKMSQHFASLKPGDV  173

Query  548   VEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPdd  727
             +EVKGPI+KL+Y PNMKKHIGMIAGGSGITPMLQVIEAILKNPDD+TQISL+YANVSPDD
Sbjct  174   LEVKGPIEKLRYSPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDHTQISLIYANVSPDD  233

Query  728   illkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGP  907
             ILLKKKLDVLAATHPNLKVFYTVDSPT +WRGG G++SKDM+VKGLPPPSDDTLI VCGP
Sbjct  234   ILLKKKLDVLAATHPNLKVFYTVDSPTNDWRGGIGYVSKDMIVKGLPPPSDDTLILVCGP  293

Query  908   PGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             PGMM H+SGEK K REQGEL+G+LK+VG+TENMVYKF
Sbjct  294   PGMMKHLSGEKPKPREQGELTGLLKDVGFTENMVYKF  330



>ref|XP_006338167.1| PREDICTED: NADH-cytochrome b5 reductase-like protein-like [Solanum 
tuberosum]
Length=323

 Score =   473 bits (1217),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 257/328 (78%), Positives = 295/328 (90%), Gaps = 6/328 (2%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+ L ++LAKAAP+AF    RG+SKS FA  RFPFGA AAVAG  SY+Y  SS NLVYL+
Sbjct  1     MTALLRKLAKAAPVAF----RGDSKSNFADPRFPFGAIAAVAGCVSYYYCHSSANLVYLE  56

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
             QINED+ +K ALNP++WIEFKL+DRAPVSHN+HLFRFSFDPS+KLGLDIASCI+TRAP+G
Sbjct  57    QINEDSGKKVALNPDKWIEFKLQDRAPVSHNSHLFRFSFDPSSKLGLDIASCILTRAPMG  116

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             + +AEGKPKY IRPYTPISDP+AKG+FDLLIKVYPEGKMSQHFA LKPGD +EVKGPI+K
Sbjct  117   E-NAEGKPKYAIRPYTPISDPEAKGYFDLLIKVYPEGKMSQHFARLKPGDVLEVKGPIEK  175

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
             L+Y  NMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQ+SL+YAN+SPDDILLKKKLDV
Sbjct  176   LRYSSNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQVSLVYANLSPDDILLKKKLDV  235

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             LA THPNLKVFYTVD+ T +WRGG G++SKDM+VKGLPPP DDTLI VCGPPGM+ H+SG
Sbjct  236   LADTHPNLKVFYTVDNSTNDWRGGIGYVSKDMIVKGLPPPGDDTLILVCGPPGMIRHLSG  295

Query  935   EK-DKREQGELSGVLKEVGYTENMVYKF  1015
             EK +  EQGEL+G+LK+VG+TENMVYKF
Sbjct  296   EKPNPHEQGELTGLLKDVGFTENMVYKF  323



>ref|XP_009368820.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Pyrus x 
bretschneideri]
Length=324

 Score =   471 bits (1213),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 242/328 (74%), Positives = 279/328 (85%), Gaps = 5/328 (2%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+  F+RL+KAAPIAFS +FRG+SK +F        A +       Y+   SSP+L YLD
Sbjct  1     MATFFQRLSKAAPIAFSSSFRGQSKPSFRIPFGAVAAVSGGISYLCYY---SSPDLAYLD  57

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
             ++ E    K ALNP++WIEFKL+D A VSHNT LFRF+FDP+AKLGLD+ASC+ITRAP+G
Sbjct  58    EVKEQAGPKVALNPDKWIEFKLQDTARVSHNTQLFRFTFDPTAKLGLDVASCLITRAPLG  117

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             Q DAEGKPKYVIRPYTPISDPD+KG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+K
Sbjct  118   Q-DAEGKPKYVIRPYTPISDPDSKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEK  176

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
             L+Y PNMKKHIGMIAGGSGITPMLQVIEAILKNPDD TQ+SLLYANVSPDDILLK+KLD+
Sbjct  177   LRYTPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDTTQVSLLYANVSPDDILLKQKLDI  236

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             LAA+HPNLKVFYTVD+PTK W+GG G+ISKD+ VKGLP P +DTLI VCGPPGMM H+SG
Sbjct  237   LAASHPNLKVFYTVDNPTKSWKGGKGYISKDIAVKGLPAPGEDTLILVCGPPGMMKHISG  296

Query  935   EKDKR-EQGELSGVLKEVGYTENMVYKF  1015
             +K K   QGEL+G+LKE+GYTE MVYKF
Sbjct  297   DKAKDWSQGELTGILKELGYTEEMVYKF  324



>ref|XP_007202229.1| hypothetical protein PRUPE_ppa008641mg [Prunus persica]
 gb|EMJ03428.1| hypothetical protein PRUPE_ppa008641mg [Prunus persica]
Length=324

 Score =   471 bits (1211),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 242/328 (74%), Positives = 280/328 (85%), Gaps = 5/328 (2%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+  F+RLAKAAPIAF+ +F G+SKS+F        A +       Y+   SSP+LVYLD
Sbjct  1     MTAFFQRLAKAAPIAFNNSFGGQSKSSFRIPFGALAAVSGGISYLCYY---SSPDLVYLD  57

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
             +I E    K ALNPN+WIEFKL+D A VSHNT LFRF+FDP+AKLGLD+ASC+ITRAPI 
Sbjct  58    EIKEQAGPKVALNPNKWIEFKLQDTARVSHNTQLFRFTFDPTAKLGLDVASCLITRAPI-  116

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             +QDAEGKPKYVIRPYTPISDPD+KG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+K
Sbjct  117   EQDAEGKPKYVIRPYTPISDPDSKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEK  176

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
              +Y PNMKKHIGMIAGGSGITPMLQVIEAI+KNPDD TQ+SLLYANVSPDDILLK+KLD+
Sbjct  177   FRYTPNMKKHIGMIAGGSGITPMLQVIEAIMKNPDDTTQVSLLYANVSPDDILLKQKLDI  236

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             LAA+HPNLKV+YTVD+PTK W+GG G+ISKDM VKGLP P++DTLI VCGPPG+M H+SG
Sbjct  237   LAASHPNLKVYYTVDNPTKSWKGGKGYISKDMAVKGLPGPAEDTLILVCGPPGLMKHISG  296

Query  935   EKDKR-EQGELSGVLKEVGYTENMVYKF  1015
             +K K   QGEL+G+LKE+GYTE MVYKF
Sbjct  297   DKAKDWSQGELTGILKELGYTEEMVYKF  324



>ref|XP_006450977.1| hypothetical protein CICLE_v10008900mg [Citrus clementina]
 gb|ESR64217.1| hypothetical protein CICLE_v10008900mg [Citrus clementina]
Length=328

 Score =   469 bits (1208),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 257/327 (79%), Positives = 290/327 (89%), Gaps = 2/327 (1%)
 Frame = +2

Query  38    SLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQ  217
             +  F+RLAKA PIAF++AF G+ KS F  FRFPFGA AAVAGG SY+ YFSSPNLV+LDQ
Sbjct  3     TTFFRRLAKATPIAFNEAFGGQPKSDFNKFRFPFGAIAAVAGGVSYYCYFSSPNLVHLDQ  62

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQ  397
             INE+T  K ALNP++WI FKL+D A VSHN+HLFRFSFDPSAKLGLD+ASCI+TRAP+GQ
Sbjct  63    INEETGPKIALNPDKWIGFKLQDTARVSHNSHLFRFSFDPSAKLGLDVASCILTRAPLGQ  122

Query  398   QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKL  577
              DAEG  KYV+RPYTPISD +AKGHFDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+KL
Sbjct  123   -DAEGNTKYVVRPYTPISDTEAKGHFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKL  181

Query  578   QYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVL  757
             +Y PNMKKHIGMIAGG+GITPMLQVIEAILKNPDDNTQ+SLLY N+SPDDILLK+KLD+L
Sbjct  182   RYSPNMKKHIGMIAGGTGITPMLQVIEAILKNPDDNTQVSLLYGNISPDDILLKQKLDIL  241

Query  758   AATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGE  937
             AA+HPNLKVFYTVD+PT+ W+GG G+ISKD  +KGLP PSDD LI VCGPPGMM HVSGE
Sbjct  242   AASHPNLKVFYTVDNPTQNWKGGVGYISKDTALKGLPRPSDDALILVCGPPGMMKHVSGE  301

Query  938   KDK-REQGELSGVLKEVGYTENMVYKF  1015
             K K   QGELSG+LK++GYTE MVYKF
Sbjct  302   KAKDYSQGELSGILKDLGYTEQMVYKF  328



>ref|XP_006475811.1| PREDICTED: NADH-cytochrome b5 reductase-like protein-like [Citrus 
sinensis]
 gb|KDO80295.1| hypothetical protein CISIN_1g020296mg [Citrus sinensis]
Length=328

 Score =   469 bits (1208),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 257/327 (79%), Positives = 289/327 (88%), Gaps = 2/327 (1%)
 Frame = +2

Query  38    SLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQ  217
             +  F+RL KA PIAF++AF G+ KS F  FRFPFGA AAVAGG SY+ YFSSPNLV+LDQ
Sbjct  3     TTFFRRLVKATPIAFNEAFGGQPKSDFNKFRFPFGAIAAVAGGVSYYCYFSSPNLVHLDQ  62

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQ  397
             INE+T  K ALNP++WI FKL+D A VSHN+HLFRFSFDPSAKLGLD+ASCI+TRAP+GQ
Sbjct  63    INEETDPKIALNPDKWIGFKLQDTARVSHNSHLFRFSFDPSAKLGLDVASCILTRAPLGQ  122

Query  398   QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKL  577
              DAEG  KYV+RPYTPISD +AKGHFDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+KL
Sbjct  123   -DAEGNTKYVVRPYTPISDTEAKGHFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKL  181

Query  578   QYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVL  757
             +Y PNMKKHIGMIAGG+GITPMLQVIEAILKNPDDNTQ+SLLY N+SPDDILLK+KLD+L
Sbjct  182   RYSPNMKKHIGMIAGGTGITPMLQVIEAILKNPDDNTQVSLLYGNISPDDILLKQKLDIL  241

Query  758   AATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGE  937
             AA+HPNLKVFYTVD+PTK W+GG G+ISKD  +KGLP PSDD LI VCGPPGMM HVSGE
Sbjct  242   AASHPNLKVFYTVDNPTKNWKGGVGYISKDTALKGLPSPSDDALILVCGPPGMMKHVSGE  301

Query  938   KDK-REQGELSGVLKEVGYTENMVYKF  1015
             K K   QGELSG+LK++GYTE MVYKF
Sbjct  302   KAKDYSQGELSGILKDLGYTEQMVYKF  328



>ref|XP_008242738.1| PREDICTED: LOW QUALITY PROTEIN: NADH-cytochrome b5 reductase-like 
protein [Prunus mume]
Length=324

 Score =   467 bits (1201),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 240/328 (73%), Positives = 278/328 (85%), Gaps = 5/328 (2%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+  F+RLAKAAPIAF+ +F G+SKS+F        A +       Y+   SSP+LVYLD
Sbjct  1     MTAFFQRLAKAAPIAFNNSFGGQSKSSFRIPFGALAAVSGGISYLCYY---SSPDLVYLD  57

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
             +  E    K ALNPN+WIEFKL+D A VSHNT LFRF+FDP+AKLGLD+ASC+ITRAPI 
Sbjct  58    ETKEQAGPKVALNPNKWIEFKLQDTARVSHNTQLFRFTFDPTAKLGLDVASCLITRAPI-  116

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             +QDAEGKPKYVIRPYTPISDPD+KG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+K
Sbjct  117   EQDAEGKPKYVIRPYTPISDPDSKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEK  176

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
              +Y PNMKKHIGMIAGGSGITPMLQVIEAI+KNPDD TQ+SLLYANVSPDDILLK+KLD+
Sbjct  177   FRYTPNMKKHIGMIAGGSGITPMLQVIEAIMKNPDDTTQVSLLYANVSPDDILLKQKLDI  236

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             LAA+HPNLKV+YTVD+PTK W+GG G+ISKDM VKGLP  ++DTLI VCGPPG+M H+SG
Sbjct  237   LAASHPNLKVYYTVDNPTKSWKGGKGYISKDMAVKGLPXAAEDTLILVCGPPGLMKHISG  296

Query  935   EKDKR-EQGELSGVLKEVGYTENMVYKF  1015
             +K K   QGEL+G+LKE+GYTE MVYKF
Sbjct  297   DKAKDWSQGELTGILKELGYTEEMVYKF  324



>gb|KHG22330.1| hypothetical protein F383_00898 [Gossypium arboreum]
Length=326

 Score =   466 bits (1199),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 249/325 (77%), Positives = 281/325 (86%), Gaps = 4/325 (1%)
 Frame = +2

Query  44    LFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQIN  223
              F+RL+KA P  F+ AFRG+ KS      F F   AAVAGG S +Y FS  NLV+LDQ+N
Sbjct  5     FFRRLSKATPATFNNAFRGQPKS--GFAGFRFCTIAAVAGGISTYYCFSDSNLVHLDQVN  62

Query  224   EDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQD  403
             E+T  K AL  ++W+EFKL+D A VSHNTHLFRFSFDPSAKLGLD+ASCI+TRAP+GQ D
Sbjct  63    EETGPKVALKSDKWLEFKLQDTARVSHNTHLFRFSFDPSAKLGLDVASCILTRAPLGQ-D  121

Query  404   AEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQY  583
             AEGK KYVIRPYTPISDPDAKG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+KL+Y
Sbjct  122   AEGKTKYVIRPYTPISDPDAKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKLRY  181

Query  584   RPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAA  763
              PNMKKHIGMIAGG+GITPMLQVIEAILKNPDD TQ+SLLYANVSPDDILLK+KLD+LAA
Sbjct  182   SPNMKKHIGMIAGGTGITPMLQVIEAILKNPDDKTQVSLLYANVSPDDILLKQKLDILAA  241

Query  764   THPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKD  943
             +HPNLKVFYTVD+PTK W+GG+GFISKDMV KGLP P+ DTLI VCGPPGMM H+SG+K 
Sbjct  242   SHPNLKVFYTVDNPTKTWKGGAGFISKDMVTKGLPGPAADTLILVCGPPGMMEHISGDKA  301

Query  944   K-REQGELSGVLKEVGYTENMVYKF  1015
             K   QGEL+G+LKE+GYTE MVYKF
Sbjct  302   KDYSQGELTGILKELGYTEQMVYKF  326



>ref|XP_002285073.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Vitis vinifera]
 emb|CBI28170.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   465 bits (1197),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 243/328 (74%), Positives = 279/328 (85%), Gaps = 3/328 (1%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+L FKRLAKA+P+AF+ AF G+ KS  A          A   G   +Y FSS NLV+LD
Sbjct  1     MALFFKRLAKASPVAFTNAFGGQPKS-GARNFRIPFGAIAAVSGGISYYCFSSENLVHLD  59

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
             QINE+   K ALNP++W+EFKL+D A VSHNT LFRFSFDP+AKLGLDIASCI+TRAPIG
Sbjct  60    QINENAGPKVALNPDKWLEFKLQDTASVSHNTQLFRFSFDPTAKLGLDIASCILTRAPIG  119

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             Q D EGK KYVIRPYTPISDPD+KG+FDLLIKVYPEGKMSQHF+ LKPGD +EVKGPI+K
Sbjct  120   QDD-EGKIKYVIRPYTPISDPDSKGYFDLLIKVYPEGKMSQHFSHLKPGDIIEVKGPIEK  178

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
             L+Y PNMKK IGMIAGG+GITPMLQ+IEAILKNPDD TQ+SL+YANVSPDDILLKKKLD+
Sbjct  179   LRYTPNMKKQIGMIAGGTGITPMLQIIEAILKNPDDKTQVSLIYANVSPDDILLKKKLDM  238

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             LAATHPNLK+FYTVD+P+  WRGG+G+ISKDMVVKGLP PSDD+LI VCGPPGMM H+SG
Sbjct  239   LAATHPNLKIFYTVDNPSNNWRGGTGYISKDMVVKGLPAPSDDSLILVCGPPGMMKHISG  298

Query  935   EKDK-REQGELSGVLKEVGYTENMVYKF  1015
              K K   QGEL+G+LKE+GYTE+MVYKF
Sbjct  299   NKAKDYSQGELTGILKELGYTEDMVYKF  326



>ref|XP_011019319.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Populus 
euphratica]
Length=317

 Score =   458 bits (1178),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 238/327 (73%), Positives = 275/327 (84%), Gaps = 13/327 (4%)
 Frame = +2

Query  38    SLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQ  217
             S  F+R+AKA P++F+    GE +STF       G  + +          +SPNL +L++
Sbjct  3     STFFRRIAKATPVSFA----GEPRSTFGAIAAVTGGISYLYYY-------NSPNLAHLEE  51

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQ  397
             +  + S K ALNP++WIEFKL+D A VSHNTHLFRFSFDP+AKLGLDIASCIITRAPIGQ
Sbjct  52    VKVEGSPKVALNPDKWIEFKLQDTARVSHNTHLFRFSFDPAAKLGLDIASCIITRAPIGQ  111

Query  398   QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKL  577
              DAEGK KYV+RPYTPISDPD+KG+FDLLIKVYPEGKMSQHFA+LK GD VEVKGPI+KL
Sbjct  112   -DAEGKTKYVVRPYTPISDPDSKGYFDLLIKVYPEGKMSQHFATLKSGDVVEVKGPIEKL  170

Query  578   QYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVL  757
             +Y PNMKKHIGMIAGG+GITPMLQVIEAILKN DDNTQ+SLLYANVSPDDILLK+KLD L
Sbjct  171   RYSPNMKKHIGMIAGGTGITPMLQVIEAILKNTDDNTQVSLLYANVSPDDILLKQKLDFL  230

Query  758   AATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGE  937
             AA+HPNLK+FYTVD+P+K W+GGSG+ISKDMVVKGLP PSDDTLI VCGPPGMM H+SG+
Sbjct  231   AASHPNLKIFYTVDNPSKNWKGGSGYISKDMVVKGLPGPSDDTLILVCGPPGMMKHISGD  290

Query  938   KDK-REQGELSGVLKEVGYTENMVYKF  1015
             K K R QGEL+G+LKE GYTE MVYKF
Sbjct  291   KAKDRSQGELTGLLKEAGYTEEMVYKF  317



>ref|XP_011084136.1| PREDICTED: NADH-cytochrome b5 reductase-like protein isoform 
X1 [Sesamum indicum]
Length=318

 Score =   457 bits (1177),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 243/326 (75%), Positives = 283/326 (87%), Gaps = 9/326 (3%)
 Frame = +2

Query  41    LLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQI  220
             + F+RLAK A I+F    + +S+         +GA AA++GG S  Y FSS NLVYLDQ 
Sbjct  1     MFFRRLAKDAWISFGDRMKSDSR-------IRYGALAAISGGVSTCYVFSSSNLVYLDQP  53

Query  221   NEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQ  400
             NED + K ALNP++WIEFKL+D+   SHN+ LFRFSFDPSAKLGLD+ASCIITRAP+GQ 
Sbjct  54    NEDGAPKVALNPDKWIEFKLQDKVQASHNSQLFRFSFDPSAKLGLDVASCIITRAPMGQ-  112

Query  401   DAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQ  580
             +AEGK KYVIRPYTPISDP+AKG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+KL+
Sbjct  113   NAEGKTKYVIRPYTPISDPNAKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKLR  172

Query  581   YRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLA  760
             Y PNMKKHIGMIAGG+GITPMLQ+I+AILKNPDDNTQ+SLLYANVSPDDILLKKKLDVLA
Sbjct  173   YSPNMKKHIGMIAGGTGITPMLQIIDAILKNPDDNTQVSLLYANVSPDDILLKKKLDVLA  232

Query  761   ATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEK  940
             A++PNLK+FYTVD+PTK+W GG G+ISKDMVVKGLP PSDDTLI VCGPPG+M H+SG+K
Sbjct  233   ASNPNLKIFYTVDNPTKDWLGGKGYISKDMVVKGLPSPSDDTLILVCGPPGLMKHISGDK  292

Query  941   DK-REQGELSGVLKEVGYTENMVYKF  1015
              K R QG+L+G+LKE+GYTE+MVYKF
Sbjct  293   AKDRSQGQLTGILKELGYTEDMVYKF  318



>ref|XP_010250026.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Nelumbo 
nucifera]
Length=327

 Score =   456 bits (1172),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 246/328 (75%), Positives = 288/328 (88%), Gaps = 2/328 (1%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+  F+RLAKAAP+AF+ AF+ + KS F GFR P+GA AAV+GG SY+YYFSSPN+V LD
Sbjct  1     MAQFFRRLAKAAPLAFANAFKDQPKSNFGGFRIPYGAIAAVSGGISYYYYFSSPNVVQLD  60

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
              INE    K ALNP++WIEFKL+D A VSHNT LFRFSFDP+AKLGLD+ASCIITRAP+G
Sbjct  61    HINEAVGPKVALNPDKWIEFKLQDTATVSHNTKLFRFSFDPTAKLGLDVASCIITRAPLG  120

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             + D+EGK KYVIRPYTPISDPD+KG+FDLLIKVYPEGKMSQHFASLK GD +EVKGPI+K
Sbjct  121   K-DSEGKTKYVIRPYTPISDPDSKGYFDLLIKVYPEGKMSQHFASLKAGDVLEVKGPIEK  179

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
             L+Y PNMKK IGMIAGG+G+TPMLQV+EAILKNP+DNTQ+SLLYAN+SP+DILLKKKLD+
Sbjct  180   LRYTPNMKKKIGMIAGGTGLTPMLQVVEAILKNPEDNTQVSLLYANISPEDILLKKKLDI  239

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             LA +HPN KVFYTVD P++ WRGG G+ISKDM++KGLP P DDTLI VCGPPGMM H+SG
Sbjct  240   LATSHPNFKVFYTVDKPSENWRGGKGYISKDMILKGLPGPGDDTLILVCGPPGMMKHISG  299

Query  935   EKDK-REQGELSGVLKEVGYTENMVYKF  1015
             +K K R QGEL+G+LKE+GY E MVYKF
Sbjct  300   DKAKDRSQGELTGLLKELGYLEEMVYKF  327



>ref|XP_007013383.1| FAD/NAD(P)-binding oxidoreductase isoform 1 [Theobroma cacao]
 gb|EOY31002.1| FAD/NAD(P)-binding oxidoreductase isoform 1 [Theobroma cacao]
Length=326

 Score =   454 bits (1168),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 246/327 (75%), Positives = 282/327 (86%), Gaps = 4/327 (1%)
 Frame = +2

Query  38    SLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQ  217
             +  F+RLAKA P +F+ AF G+ K+      F F A AAVAGG S +YYFS  NLV+LDQ
Sbjct  3     TTFFRRLAKATPPSFTDAFGGQPKA--GFAGFRFSAIAAVAGGISSYYYFSESNLVHLDQ  60

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQ  397
             INE+T  K AL  ++WI FKL+D A VSHNT LFRFSFDP++KLGLD+ASCI+TRAP+GQ
Sbjct  61    INEETGPKVALKSDKWIGFKLQDTARVSHNTQLFRFSFDPTSKLGLDVASCILTRAPLGQ  120

Query  398   QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKL  577
              DAEGK KYVIRPYTPISDPDAKG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+KL
Sbjct  121   -DAEGKTKYVIRPYTPISDPDAKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKL  179

Query  578   QYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVL  757
             +Y PNMKKHIGMIAGG+GITPMLQVIEAILK PDDNTQ+SLLYANVSPDDILLK+KLD+L
Sbjct  180   RYSPNMKKHIGMIAGGTGITPMLQVIEAILKKPDDNTQVSLLYANVSPDDILLKQKLDIL  239

Query  758   AATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGE  937
             AA+HPNLKVFYTVD+P+K W+GG+G+ISKDMV KGLP P +DTLI VCGPPGMM H+SG+
Sbjct  240   AASHPNLKVFYTVDNPSKNWKGGAGYISKDMVTKGLPGPGEDTLILVCGPPGMMKHISGD  299

Query  938   KDK-REQGELSGVLKEVGYTENMVYKF  1015
             K K   QGEL+G+LKE+GYTE MVYKF
Sbjct  300   KAKDYSQGELTGILKELGYTEQMVYKF  326



>ref|XP_002309454.2| hypothetical protein POPTR_0006s23520g [Populus trichocarpa]
 gb|EEE92977.2| hypothetical protein POPTR_0006s23520g [Populus trichocarpa]
Length=322

 Score =   452 bits (1163),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 239/332 (72%), Positives = 274/332 (83%), Gaps = 18/332 (5%)
 Frame = +2

Query  38    SLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQ  217
             S  F+RL+KA P++F     G+ KSTF       G  + +          +SPNL +L++
Sbjct  3     STFFRRLSKATPVSFG----GQPKSTFGAIAAVTGGISYLYYY-------NSPNLAHLEE  51

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQ  397
             +  + S K ALNP++WIEFKL+D A VSHNTHLFRFSFDP+AKLGLDIASCIITRAPIGQ
Sbjct  52    VKVEGSPKVALNPDKWIEFKLQDTARVSHNTHLFRFSFDPAAKLGLDIASCIITRAPIGQ  111

Query  398   QDAEGKPKYVIRPYTPISDPDAKGHFDLLIK-----VYPEGKMSQHFASLKPGDKVEVKG  562
              DAEGK KYV+RPYTPISDPD+KG+FDLLIK     VYPEGKMSQHFA+LK GD VEVKG
Sbjct  112   -DAEGKTKYVVRPYTPISDPDSKGYFDLLIKISDIIVYPEGKMSQHFATLKSGDVVEVKG  170

Query  563   PIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkk  742
             PI+KL+Y PNMKKHIGMIAGG+GITPMLQVIEAILKNPDDNTQ+SLLYANVSPDDILLK+
Sbjct  171   PIEKLRYSPNMKKHIGMIAGGTGITPMLQVIEAILKNPDDNTQVSLLYANVSPDDILLKQ  230

Query  743   kldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMT  922
             KLD LAA+HPNLK+FYTVD+P+K W+GGSGFISKDMVVKGLP P DDTLI VCGPPGMM 
Sbjct  231   KLDFLAASHPNLKIFYTVDNPSKNWKGGSGFISKDMVVKGLPGPCDDTLILVCGPPGMMK  290

Query  923   HVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             H+SG+K K R QGEL+G+LKE GYTE MVYKF
Sbjct  291   HISGDKAKDRSQGELTGLLKEAGYTEEMVYKF  322



>ref|XP_002524462.1| NADH-cytochrome B5 reductase, putative [Ricinus communis]
 gb|EEF37902.1| NADH-cytochrome B5 reductase, putative [Ricinus communis]
Length=324

 Score =   452 bits (1163),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 246/327 (75%), Positives = 280/327 (86%), Gaps = 6/327 (2%)
 Frame = +2

Query  38    SLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQ  217
             S+ FKRLAKA+ I F     G+SKS F GFR P GA AA +GG SY YY+SSPNL YLD+
Sbjct  3     SMFFKRLAKASSIGFG----GQSKSNFNGFRIPIGAIAAASGGISYLYYYSSPNLAYLDE  58

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQ  397
             + ED   K AL P++WIEFKL+D A VSHNT LFRFSFDPSAKLGLDIASCI+TRAP+G 
Sbjct  59    VKEDAGPKVALKPDKWIEFKLQDTARVSHNTQLFRFSFDPSAKLGLDIASCILTRAPLGH  118

Query  398   QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKL  577
              DAEGK KYVIRPYTPISDPDAKG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+KL
Sbjct  119   -DAEGKTKYVIRPYTPISDPDAKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKL  177

Query  578   QYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVL  757
             +Y PNMKKHIGMIAGGSGITPMLQ+IEAILKNPDDNTQ++LLY N+SPDDILL++KLD L
Sbjct  178   RYSPNMKKHIGMIAGGSGITPMLQIIEAILKNPDDNTQVTLLYGNISPDDILLQQKLDFL  237

Query  758   AATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGE  937
             AA+HPN KVFYTV++P+K W+GG G++SKDM +KGLP PS+DTLI VCGP GMM H+SG 
Sbjct  238   AASHPNFKVFYTVENPSKNWKGGVGYVSKDMALKGLPGPSNDTLILVCGPSGMMEHISGS  297

Query  938   KDK-REQGELSGVLKEVGYTENMVYKF  1015
             K K   QGEL+G+LKE+GYTE MVYKF
Sbjct  298   KAKDYSQGELTGLLKELGYTEQMVYKF  324



>gb|KDP32376.1| hypothetical protein JCGZ_13301 [Jatropha curcas]
Length=324

 Score =   451 bits (1160),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 249/327 (76%), Positives = 281/327 (86%), Gaps = 6/327 (2%)
 Frame = +2

Query  38    SLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQ  217
             S  F+RLA+A PI + +    ++KS F GFR P GA AA +GG SY YYFSSPNL +LD+
Sbjct  3     STFFRRLARATPIGYGR----QNKSNFDGFRIPLGAIAAASGGISYLYYFSSPNLAHLDE  58

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQ  397
             + E+   K AL P++WIEFKL+D A VSHNTHLFRFSFDPSAKLGL IASCI+TRAP GQ
Sbjct  59    VKEEAHPKVALKPDKWIEFKLQDTARVSHNTHLFRFSFDPSAKLGLHIASCILTRAPSGQ  118

Query  398   QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKL  577
              DAEGK +YVIRPYTPISDPDAKG+FDLLIKVYP+GKMSQHFASLKPGD VEVKGPI K+
Sbjct  119   -DAEGKTEYVIRPYTPISDPDAKGYFDLLIKVYPKGKMSQHFASLKPGDVVEVKGPIDKI  177

Query  578   QYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVL  757
             +Y PNMKKHIGMIAGG+GITPMLQVIEAILKNPDDNTQ+SLLYAN+SPDDILLK+KLD L
Sbjct  178   RYSPNMKKHIGMIAGGTGITPMLQVIEAILKNPDDNTQVSLLYANISPDDILLKQKLDFL  237

Query  758   AATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGE  937
             AA+HPNLKVFYTVD P+K W+GG G+ISKDMVVKGLP P DDTLI VCGPPGMM H+SG+
Sbjct  238   AASHPNLKVFYTVDEPSKNWKGGKGYISKDMVVKGLPGPGDDTLIMVCGPPGMMKHISGD  297

Query  938   KDK-REQGELSGVLKEVGYTENMVYKF  1015
             K K   QGELSG+LKE+GYTE MVYKF
Sbjct  298   KAKDYSQGELSGILKELGYTEEMVYKF  324



>emb|CAN63505.1| hypothetical protein VITISV_011680 [Vitis vinifera]
Length=347

 Score =   451 bits (1161),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 242/349 (69%), Positives = 278/349 (80%), Gaps = 24/349 (7%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLV---  205
             M+L FKRLAKA+P+AF+ AF G+ KS  A          A   G   +Y FSS NLV   
Sbjct  1     MALFFKRLAKASPVAFTNAFGGQPKS-GARNFRIPFGAIAAVSGGISYYCFSSENLVCLV  59

Query  206   ------------------YLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF  331
                               +LDQINE+   K ALNP++W+EFKL+D A VSHNT LFRFSF
Sbjct  60    TSLMLLQHVTRRIGIRKVHLDQINENAGPKVALNPDKWLEFKLQDTASVSHNTQLFRFSF  119

Query  332   DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKM  511
             DP+AKLGLDIASCI+TRAPIGQ D EGK KYVIRPYTPISDPD+KG+FDLLIKVYPEGKM
Sbjct  120   DPTAKLGLDIASCILTRAPIGQDD-EGKIKYVIRPYTPISDPDSKGYFDLLIKVYPEGKM  178

Query  512   SQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQ  691
             SQHF+ LKPGD +EVKGPI+KL+Y PNMKK IGMIAGG+GITPMLQ+IEAILKNPDD TQ
Sbjct  179   SQHFSHLKPGDIIEVKGPIEKLRYTPNMKKQIGMIAGGTGITPMLQIIEAILKNPDDKTQ  238

Query  692   ISLLYANVSPddillkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPP  871
             +SL+YANVSPDDILLKKKLD+LAATHPN K+FYTVD+P+  WRGG+G+ISKDMVVKGLP 
Sbjct  239   VSLIYANVSPDDILLKKKLDMLAATHPNXKIFYTVDNPSNNWRGGTGYISKDMVVKGLPA  298

Query  872   PSDDTLIFVCGPPGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             PSDD+LI VCGPPGMM H+SG K K   QGEL+G+LKE+GYTE+MVYKF
Sbjct  299   PSDDSLILVCGPPGMMKHISGNKAKDYSQGELTGILKELGYTEDMVYKF  347



>ref|XP_007154982.1| hypothetical protein PHAVU_003G162900g [Phaseolus vulgaris]
 gb|ESW26976.1| hypothetical protein PHAVU_003G162900g [Phaseolus vulgaris]
Length=323

 Score =   450 bits (1157),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 241/328 (73%), Positives = 279/328 (85%), Gaps = 6/328 (2%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+ L +R ++A  I F+     +S S+ +  R PF A AA++GG S+ YY SSPNLV+  
Sbjct  1     MAALLRRFSRATLIPFA----AQSNSSHSNLRLPFTAIAAISGGVSFLYYHSSPNLVHSQ  56

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
             Q  ++ SR  ALNP++WIEFKL+D A VSHNT LFRFSFDP+ KLGLDIASCI+TRAP+G
Sbjct  57    QTEQEESRNIALNPDKWIEFKLQDTARVSHNTQLFRFSFDPTQKLGLDIASCILTRAPLG  116

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             Q DAEGKPK+V+RPYTPISD ++KGHFDLLIK+YPEGKMSQHFASLKPGD VEVKGPI+K
Sbjct  117   Q-DAEGKPKFVVRPYTPISDSESKGHFDLLIKLYPEGKMSQHFASLKPGDVVEVKGPIEK  175

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
             L+Y PNMKKHIGMIAGGSGITPMLQVIEAILKNPDD TQ+SLLYANVSPDDILLK+KLD+
Sbjct  176   LRYTPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDKTQVSLLYANVSPDDILLKQKLDI  235

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             LA +HPNLK+FYTVD+PTK WRGG+G+ISKDMVVKGLP PSDDTLI VCGPPGMM  +SG
Sbjct  236   LATSHPNLKIFYTVDNPTKNWRGGAGYISKDMVVKGLPAPSDDTLILVCGPPGMMKQISG  295

Query  935   EKDKR-EQGELSGVLKEVGYTENMVYKF  1015
             EK K   QGE+SG+LKE GYTE MVYKF
Sbjct  296   EKAKDWTQGEVSGILKEAGYTEQMVYKF  323



>ref|XP_010321068.1| PREDICTED: NADH-cytochrome b5 reductase-like protein isoform 
X1 [Solanum lycopersicum]
Length=374

 Score =   451 bits (1161),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 258/379 (68%), Positives = 297/379 (78%), Gaps = 57/379 (15%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+ L ++LAKAAPIAF    RG+SKS FA  RFPFGA AAVAG  SY+Y  SS NLVYL+
Sbjct  1     MAALLRKLAKAAPIAF----RGDSKSNFADPRFPFGAIAAVAGCVSYYYCHSSANLVYLE  56

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
             QI+ED+ +K ALNP++WIEFKL+DRAPVSHN+HLFRFSFDPS+KLGLDIASCI+TRAP+G
Sbjct  57    QISEDSGKKVALNPDKWIEFKLQDRAPVSHNSHLFRFSFDPSSKLGLDIASCILTRAPMG  116

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             + +AEGKPKY IRPYTPISDP+AKG+FDLLIKVYPEGKMSQHFA LKPGD ++VKGPI+K
Sbjct  117   E-NAEGKPKYAIRPYTPISDPEAKGYFDLLIKVYPEGKMSQHFAKLKPGDILQVKGPIEK  175

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
             L Y  NMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQ+SL+YAN+SPDDILLKKKLDV
Sbjct  176   LHYSSNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQVSLVYANLSPDDILLKKKLDV  235

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIF-------------  895
             LAATHPNLKVFYTVD+PT +WRGG G++SK+M+VKGLPPP DDTLI              
Sbjct  236   LAATHPNLKVFYTVDNPTNDWRGGIGYVSKNMIVKGLPPPGDDTLILIILRIWNWKTHHS  295

Query  896   --------------------------------------VCGPPGMMTHVSGEK-DKREQG  958
                                                   VCGPPGM+ H+SGEK + REQG
Sbjct  296   DVATLLGEKGIGMSQRQDWIGSYFRRMKDIFQPKYTIGVCGPPGMIRHLSGEKPNPREQG  355

Query  959   ELSGVLKEVGYTENMVYKF  1015
             EL+G+LK+VG+TENMVYKF
Sbjct  356   ELTGLLKDVGFTENMVYKF  374



>ref|XP_004287348.1| PREDICTED: NADH-cytochrome b5 reductase-like protein-like [Fragaria 
vesca subsp. vesca]
Length=325

 Score =   449 bits (1155),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 250/329 (76%), Positives = 282/329 (86%), Gaps = 6/329 (2%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+  F+RLAKA P AF+ AF   S  + + FRFP GA AAV+GG SY YY SS   VYLD
Sbjct  1     MAAFFQRLAKATPTAFTAAFNSGSGHSRSAFRFPIGALAAVSGGISYVYYHSS---VYLD  57

Query  215   QINED-TSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPI  391
             +I E+ T  K ALNPN+W EFKL+D A VSHNT LFRF+FDP+AKLGLD+ASC+ITRAPI
Sbjct  58    EIKEEQTGPKVALNPNKWTEFKLQDSARVSHNTQLFRFTFDPTAKLGLDVASCLITRAPI  117

Query  392   GQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQ  571
             GQ DAEGKPK+V RPYTPISDP++KG+FDLLIKVYPEGKMSQHFASLKPGD +EVKGPI+
Sbjct  118   GQ-DAEGKPKFVTRPYTPISDPESKGYFDLLIKVYPEGKMSQHFASLKPGDVLEVKGPIE  176

Query  572   KLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkld  751
             KL+Y PNMKKHIGMIAGGSGITPMLQVIEAILKNPDD T++SLLYANVSPDDILLK+KLD
Sbjct  177   KLRYIPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDTTKVSLLYANVSPDDILLKQKLD  236

Query  752   VLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVS  931
             +LAA HPNLKV+YTVD+PTK W+GG GFISKDM VKGLP PS+DTLI VCGPPGMM H+S
Sbjct  237   LLAAAHPNLKVYYTVDNPTKSWKGGKGFISKDMAVKGLPGPSEDTLILVCGPPGMMEHIS  296

Query  932   GEKDKR-EQGELSGVLKEVGYTENMVYKF  1015
             G K K   QGELSG+LKE+GYTE MVYKF
Sbjct  297   GGKAKDWSQGELSGILKELGYTEEMVYKF  325



>ref|XP_010688037.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Beta vulgaris 
subsp. vulgaris]
Length=320

 Score =   449 bits (1154),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 228/328 (70%), Positives = 266/328 (81%), Gaps = 9/328 (3%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M++ F+RLAK+API FS AFRG   S+F      F                SSPNL +LD
Sbjct  1     MAMFFRRLAKSAPITFSNAFRGSQSSSFGVIAATFSGGVLYYFT-------SSPNLAHLD  53

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
              INE++ +K AL  ++W+EFKL + A VSHNT L+RFSFD  A+LGLDIASCI+TRAP G
Sbjct  54    SINEESQKKVALKSDKWLEFKLHETANVSHNTKLYRFSFDSDAELGLDIASCILTRAPTG  113

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             Q D EGK KYV+RPYTPISDPDAKG+FDL+IK+YPEGKMSQHFA LKPGD VEVKGPI+K
Sbjct  114   QND-EGKTKYVVRPYTPISDPDAKGYFDLMIKLYPEGKMSQHFAKLKPGDVVEVKGPIEK  172

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
             L+Y PNMKKHIGMIAGGSGITPMLQ++EAILKNPDD TQ+SL+YANVSPDDILLK+KLD+
Sbjct  173   LRYTPNMKKHIGMIAGGSGITPMLQIVEAILKNPDDKTQVSLVYANVSPDDILLKQKLDI  232

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             LA +HPN KVFYTVD+P+K+WRGG G++SKD+V KGLP P DD+LI VCGPPGMM H+SG
Sbjct  233   LATSHPNFKVFYTVDNPSKDWRGGVGYVSKDVVSKGLPGPGDDSLILVCGPPGMMQHISG  292

Query  935   EKDK-REQGELSGVLKEVGYTENMVYKF  1015
              K K   QGELSGVLKE+GYTE MVYKF
Sbjct  293   GKAKDYSQGELSGVLKELGYTEEMVYKF  320



>ref|XP_010047814.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Eucalyptus 
grandis]
 gb|KCW79797.1| hypothetical protein EUGRSUZ_C011341 [Eucalyptus grandis]
Length=328

 Score =   446 bits (1147),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 241/327 (74%), Positives = 283/327 (87%), Gaps = 2/327 (1%)
 Frame = +2

Query  38    SLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQ  217
             S   K+LA+ APIA ++++R  S S+  GFR P GA AAV+GG S FY+ SSPN+ +LDQ
Sbjct  3     STFLKKLARTAPIAVAESYRRRSNSSSGGFRIPVGAIAAVSGGLSCFYFASSPNVAHLDQ  62

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQ  397
             + EDT  K ALNP++WIEFKL+D A VSHNT LFRFSFDP+ +LGL +ASCI+TRAP GQ
Sbjct  63    VGEDTGSKIALNPDKWIEFKLQDTARVSHNTQLFRFSFDPNVQLGLHVASCILTRAPTGQ  122

Query  398   QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKL  577
              DAEGK KYV+RPYTPISDPDAKG+FDLLIKVYPEGKMSQHFA LKPGD VEVKGPI+K 
Sbjct  123   -DAEGKTKYVVRPYTPISDPDAKGYFDLLIKVYPEGKMSQHFAILKPGDVVEVKGPIEKF  181

Query  578   QYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVL  757
             +Y PNMKK+IGMIAGG+GITPMLQVI+AILKNPDDNTQ+SLLYANVSPDDILLK+KLD+L
Sbjct  182   KYTPNMKKNIGMIAGGTGITPMLQVIDAILKNPDDNTQVSLLYANVSPDDILLKQKLDIL  241

Query  758   AATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGE  937
             AA+HPNLK++YTVD+PTK W+GG G+ISKDM +KGLP PS+D LI VCGPPGMM H+SG+
Sbjct  242   AASHPNLKIYYTVDNPTKNWKGGKGYISKDMAIKGLPAPSEDALILVCGPPGMMKHISGD  301

Query  938   KDK-REQGELSGVLKEVGYTENMVYKF  1015
             K K R QGEL+G+LKE+GYTE MVYKF
Sbjct  302   KAKDRSQGELTGILKELGYTEQMVYKF  328



>ref|XP_002871921.1| hypothetical protein ARALYDRAFT_910048 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48180.1| hypothetical protein ARALYDRAFT_910048 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   443 bits (1140),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 237/325 (73%), Positives = 277/325 (85%), Gaps = 2/325 (1%)
 Frame = +2

Query  44    LFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQIN  223
              F+RLA++API F  AF  +SKS    FRF  GA AA++GG SY+Y  S  NLVYLDQ  
Sbjct  5     FFRRLARSAPITFPVAFGSQSKSGSGAFRFSTGAIAALSGGFSYYYLTSGNNLVYLDQAK  64

Query  224   EDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQD  403
             E+T  KTALNP++W+EFKL+D A VSHNT LFRFSFDPSA+LGL +ASC++TRAP+G  +
Sbjct  65    EETGPKTALNPDKWLEFKLQDTARVSHNTQLFRFSFDPSAQLGLHVASCLLTRAPLGY-N  123

Query  404   AEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQY  583
             AEGK KYVIRPYTPISDP+AKG+FDLLIKVYP+GKMSQHFASLKPGD +EVKGP++K +Y
Sbjct  124   AEGKTKYVIRPYTPISDPEAKGYFDLLIKVYPDGKMSQHFASLKPGDVLEVKGPVEKFKY  183

Query  584   RPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAA  763
              PNMKKHIGMIAGGSGITPMLQVI+AI+KNP+DNTQISLLYANVSPDDILLK+KLDVL A
Sbjct  184   SPNMKKHIGMIAGGSGITPMLQVIDAIVKNPEDNTQISLLYANVSPDDILLKQKLDVLQA  243

Query  764   THPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKD  943
              HPNLK+FYTVD+PTK W+GG G+ISKDM +KGLP P+DDTLI VCGPPGMM H+SG K 
Sbjct  244   NHPNLKIFYTVDNPTKNWKGGVGYISKDMALKGLPLPTDDTLILVCGPPGMMEHISGGKA  303

Query  944   -KREQGELSGVLKEVGYTENMVYKF  1015
                 QGE+ G+LKE+GYTE MV+KF
Sbjct  304   PDWSQGEVKGILKELGYTEQMVFKF  328



>ref|NP_568391.1| NADH-cytochrome b5 reductase-like protein [Arabidopsis thaliana]
 sp|P83291.2|NB5R2_ARATH RecName: Full=NADH-cytochrome b5 reductase-like protein; Short=B5R 
[Arabidopsis thaliana]
 gb|AAM64833.1| cytochrome-b5 reductase-like protein [Arabidopsis thaliana]
 gb|ABD59058.1| At5g20080 [Arabidopsis thaliana]
 dbj|BAE98953.1| cytochrome-b5 reductase - like protein [Arabidopsis thaliana]
 gb|AED92791.1| NADH-cytochrome b5 reductase-like protein [Arabidopsis thaliana]
Length=328

 Score =   443 bits (1139),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 237/325 (73%), Positives = 277/325 (85%), Gaps = 2/325 (1%)
 Frame = +2

Query  44    LFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQIN  223
              F+RLA++API F  AF  +SKS    FRF  GA AA++GG SY+Y  S  NLVYLDQ  
Sbjct  5     FFRRLARSAPITFPVAFGSQSKSGSGAFRFSTGAIAALSGGFSYYYLTSGNNLVYLDQAK  64

Query  224   EDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQD  403
             E+T  KTALNP++W+EFKL+D A VSHNT LFRFSFDPSA+LGL +ASC++TRAP+G  +
Sbjct  65    EETGPKTALNPDKWLEFKLQDTARVSHNTQLFRFSFDPSAELGLHVASCLLTRAPLGY-N  123

Query  404   AEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQY  583
             AEGK KYVIRPYTPISDP+AKG+FDLLIKVYP+GKMSQHFASLKPGD +EVKGP++K +Y
Sbjct  124   AEGKTKYVIRPYTPISDPEAKGYFDLLIKVYPDGKMSQHFASLKPGDVLEVKGPVEKFKY  183

Query  584   RPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAA  763
              PNMKKHIGMIAGGSGITPMLQVI+AI+KNP+DNTQISLLYANVSPDDILLK+KLDVL A
Sbjct  184   SPNMKKHIGMIAGGSGITPMLQVIDAIVKNPEDNTQISLLYANVSPDDILLKQKLDVLQA  243

Query  764   THPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKD  943
              HPNLK+FYTVD+PTK W+GG G+ISKDM +KGLP P+DDTLI VCGPPGMM H+SG K 
Sbjct  244   NHPNLKIFYTVDNPTKNWKGGVGYISKDMALKGLPLPTDDTLILVCGPPGMMEHISGGKA  303

Query  944   -KREQGELSGVLKEVGYTENMVYKF  1015
                 QGE+ G+LKE+GYTE MV+KF
Sbjct  304   PDWSQGEVKGILKELGYTEEMVFKF  328



>ref|XP_010535871.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Tarenaya 
hassleriana]
Length=328

 Score =   442 bits (1137),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 238/327 (73%), Positives = 278/327 (85%), Gaps = 2/327 (1%)
 Frame = +2

Query  38    SLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQ  217
             +  F+RLAK+APIAFS A R +S+S F+ FRFP GA AA++GG SY+Y  S  NLVYLD 
Sbjct  3     TTFFRRLAKSAPIAFSGASRSQSESGFSAFRFPVGAIAALSGGLSYYYVSSDSNLVYLDH  62

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQ  397
               E++  KTAL P+ W+EFKL+D A VSHNT LFRFSFDPSAKLGL++ASCI+TRAPIG 
Sbjct  63    AKEESGPKTALKPDTWLEFKLQDTARVSHNTQLFRFSFDPSAKLGLEVASCILTRAPIGY  122

Query  398   QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKL  577
              D+EGK K+VIRPYTPISDP+AKG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+K 
Sbjct  123   -DSEGKTKFVIRPYTPISDPEAKGYFDLLIKVYPEGKMSQHFASLKPGDAVEVKGPIEKF  181

Query  578   QYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVL  757
             +Y PNMK+HIGMIAGG+GITPMLQVIEAILKNP+D TQISLLY NVSPDDILLK+KLD L
Sbjct  182   KYSPNMKRHIGMIAGGTGITPMLQVIEAILKNPEDKTQISLLYGNVSPDDILLKQKLDAL  241

Query  758   AATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGE  937
              A HPNLKV+YTVD+PTK W+GG G+ISKDM +KGLPPP+DDT + +CGPPGMM H+SG 
Sbjct  242   QAKHPNLKVYYTVDNPTKNWKGGVGYISKDMALKGLPPPADDTFVLICGPPGMMEHISGG  301

Query  938   KD-KREQGELSGVLKEVGYTENMVYKF  1015
             K     QGE+ G+LKE+GYTE MV+KF
Sbjct  302   KAPDWSQGEVKGILKELGYTEQMVFKF  328



>ref|XP_010321069.1| PREDICTED: NADH-cytochrome b5 reductase-like protein isoform 
X2 [Solanum lycopersicum]
Length=370

 Score =   442 bits (1138),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 257/379 (68%), Positives = 295/379 (78%), Gaps = 61/379 (16%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+ L ++LAKAAPIAF    RG+SKS FA  RFPFGA AAVAG  SY+Y  SS NLVYL+
Sbjct  1     MAALLRKLAKAAPIAF----RGDSKSNFADPRFPFGAIAAVAGCVSYYYCHSSANLVYLE  56

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
             QI+ED+    ALNP++WIEFKL+DRAPVSHN+HLFRFSFDPS+KLGLDIASCI+TRAP+G
Sbjct  57    QISEDS----ALNPDKWIEFKLQDRAPVSHNSHLFRFSFDPSSKLGLDIASCILTRAPMG  112

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             + +AEGKPKY IRPYTPISDP+AKG+FDLLIKVYPEGKMSQHFA LKPGD ++VKGPI+K
Sbjct  113   E-NAEGKPKYAIRPYTPISDPEAKGYFDLLIKVYPEGKMSQHFAKLKPGDILQVKGPIEK  171

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
             L Y  NMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQ+SL+YAN+SPDDILLKKKLDV
Sbjct  172   LHYSSNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQVSLVYANLSPDDILLKKKLDV  231

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIF-------------  895
             LAATHPNLKVFYTVD+PT +WRGG G++SK+M+VKGLPPP DDTLI              
Sbjct  232   LAATHPNLKVFYTVDNPTNDWRGGIGYVSKNMIVKGLPPPGDDTLILIILRIWNWKTHHS  291

Query  896   --------------------------------------VCGPPGMMTHVSGEK-DKREQG  958
                                                   VCGPPGM+ H+SGEK + REQG
Sbjct  292   DVATLLGEKGIGMSQRQDWIGSYFRRMKDIFQPKYTIGVCGPPGMIRHLSGEKPNPREQG  351

Query  959   ELSGVLKEVGYTENMVYKF  1015
             EL+G+LK+VG+TENMVYKF
Sbjct  352   ELTGLLKDVGFTENMVYKF  370



>ref|XP_010493103.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Camelina 
sativa]
Length=328

 Score =   440 bits (1132),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 235/327 (72%), Positives = 278/327 (85%), Gaps = 2/327 (1%)
 Frame = +2

Query  38    SLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQ  217
             +  F+RLA++APIAF  A   +SK+    FRF  GA AA++GG SY+Y  S  NLVYLDQ
Sbjct  3     TTFFRRLARSAPIAFPVALGSQSKAGSGAFRFSAGAIAALSGGFSYYYLASGNNLVYLDQ  62

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQ  397
               E+T  KTALNP++W+EFKL+D A VSHNT LFRFSF+PSA+LGL +ASC++TRAP+G 
Sbjct  63    AKEETGPKTALNPDKWLEFKLQDTARVSHNTQLFRFSFEPSAELGLHVASCLLTRAPLGY  122

Query  398   QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKL  577
              +AEGK KYVIRPYTPISDP+AKG+FDLLIKVYP+GKMSQHFASLKPGD +EVKGP++K 
Sbjct  123   -NAEGKTKYVIRPYTPISDPEAKGYFDLLIKVYPDGKMSQHFASLKPGDVLEVKGPVEKF  181

Query  578   QYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVL  757
             +Y PNMKKHIGMIAGGSGITPMLQVI+AI+KNP+DNTQISLLYANVSPDDILLK+KLDVL
Sbjct  182   KYSPNMKKHIGMIAGGSGITPMLQVIDAIVKNPEDNTQISLLYANVSPDDILLKQKLDVL  241

Query  758   AATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGE  937
              A HPNLK+FYTVD+PTK W+GG G++SKDM +KGLP P+DDTLI VCGPPGMM H+SG 
Sbjct  242   QANHPNLKIFYTVDNPTKNWKGGVGYVSKDMALKGLPLPADDTLILVCGPPGMMEHISGG  301

Query  938   KD-KREQGELSGVLKEVGYTENMVYKF  1015
             K     QGE+ GVLKE+GYTE MV+KF
Sbjct  302   KAPDWSQGEVKGVLKELGYTEQMVFKF  328



>gb|KHN27422.1| NADH-cytochrome b5 reductase-like protein [Glycine soja]
Length=323

 Score =   440 bits (1131),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 237/328 (72%), Positives = 274/328 (84%), Gaps = 6/328 (2%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+   +R A+A PI F+     +S S+    R PF A AA++GG S+ +Y SSPN  +  
Sbjct  1     MTAFLRRFARATPILFA----AQSNSSHTNLRLPFTAIAAISGGVSFLFYHSSPNFAHSQ  56

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
             +  +  S+  AL P++W+EFKL+D A VSHNT LFRFSFDP+ KLGLDIASCI+TRAP+G
Sbjct  57    EAEQVESKNIALVPDKWVEFKLQDTARVSHNTQLFRFSFDPTQKLGLDIASCILTRAPLG  116

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             Q DAEGKPK+VIRPYTPISDP +KG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+K
Sbjct  117   Q-DAEGKPKFVIRPYTPISDPQSKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEK  175

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
             L+Y PNMKKHIGMIAGG+GITPMLQVIEAILKNPDD TQISLLYANVSPDDILLK+KLD+
Sbjct  176   LRYTPNMKKHIGMIAGGTGITPMLQVIEAILKNPDDKTQISLLYANVSPDDILLKQKLDI  235

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             LA +HPNLK+FYTVD+PTK WRGG+G+ISKD+VVKGLP PSDDTLI VCGPPGMM  +SG
Sbjct  236   LATSHPNLKIFYTVDNPTKNWRGGAGYISKDIVVKGLPGPSDDTLILVCGPPGMMKAISG  295

Query  935   EKDKR-EQGELSGVLKEVGYTENMVYKF  1015
             EK K   QGE+SGVLKE GYTE MVYKF
Sbjct  296   EKAKDWTQGEVSGVLKEAGYTEQMVYKF  323



>ref|XP_006289228.1| hypothetical protein CARUB_v10002684mg [Capsella rubella]
 gb|EOA22126.1| hypothetical protein CARUB_v10002684mg [Capsella rubella]
Length=328

 Score =   440 bits (1131),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 234/325 (72%), Positives = 276/325 (85%), Gaps = 2/325 (1%)
 Frame = +2

Query  44    LFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQIN  223
              F+RLAK+API F  A   +SKS    FRF  GA AA++GG SY+Y  S  NLVYLDQ  
Sbjct  5     FFRRLAKSAPITFPVALGSQSKSGSGAFRFSAGAIAALSGGFSYYYLASGNNLVYLDQAK  64

Query  224   EDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQD  403
             E+T  KTALNP++W+EFKL+D A VSHNT LFRFSFDPSA+LGL +ASC++TRAP+G  +
Sbjct  65    EETGPKTALNPDKWLEFKLQDTARVSHNTQLFRFSFDPSAELGLHVASCLLTRAPLGY-N  123

Query  404   AEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQY  583
             AEGK KYVIRPYTPISDPD+KG+FDLLIKVYP+GKMSQHFASLKPGD +EVKGP++K +Y
Sbjct  124   AEGKTKYVIRPYTPISDPDSKGYFDLLIKVYPDGKMSQHFASLKPGDVLEVKGPVEKFKY  183

Query  584   RPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAA  763
              PNMKKHIGMIAGGSGITPMLQVI+AI+KNP+DNTQISLLYANVSPDDILLK+KLDVL A
Sbjct  184   SPNMKKHIGMIAGGSGITPMLQVIDAIVKNPEDNTQISLLYANVSPDDILLKQKLDVLQA  243

Query  764   THPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKD  943
              HPNLK+FYTVD+PTK W+GG G++SKDM +KGLP P+DDTL+ VCGPPGMM H+SG K 
Sbjct  244   NHPNLKIFYTVDNPTKTWKGGVGYVSKDMALKGLPLPADDTLVLVCGPPGMMEHISGGKA  303

Query  944   -KREQGELSGVLKEVGYTENMVYKF  1015
                 QGE+ G+LK++GYTE MV+KF
Sbjct  304   PDWSQGEVKGILKDLGYTEQMVFKF  328



>ref|XP_010420842.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Camelina 
sativa]
Length=328

 Score =   439 bits (1129),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 234/327 (72%), Positives = 278/327 (85%), Gaps = 2/327 (1%)
 Frame = +2

Query  38    SLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQ  217
             +  F+R+A++APIAF  A   +SK+    FRF  GA AA++GG SY+Y  S  NLVYLDQ
Sbjct  3     TTFFRRIARSAPIAFPVALGSQSKAGSGAFRFSAGAIAALSGGFSYYYLASGNNLVYLDQ  62

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQ  397
               E+T  KTALNP++W+EFKL+D A VSHNT LFRFSF+PSA+LGL +ASC++TRAP+G 
Sbjct  63    AKEETGPKTALNPDKWLEFKLQDTARVSHNTQLFRFSFEPSAELGLHVASCLLTRAPLGY  122

Query  398   QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKL  577
              +AEGK KYVIRPYTPISDP+AKG+FDLLIKVYP+GKMSQHFASLKPGD +EVKGP++K 
Sbjct  123   -NAEGKTKYVIRPYTPISDPEAKGYFDLLIKVYPDGKMSQHFASLKPGDVLEVKGPVEKF  181

Query  578   QYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVL  757
             +Y PNMKKHIGMIAGGSGITPMLQVI+AI+KNP+DNTQISLLYANVSPDDILLK+KLDVL
Sbjct  182   KYSPNMKKHIGMIAGGSGITPMLQVIDAIVKNPEDNTQISLLYANVSPDDILLKQKLDVL  241

Query  758   AATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGE  937
              A HPNLK+FYTVD+PTK W+GG G++SKDM +KGLP P+DDTLI VCGPPGMM H+SG 
Sbjct  242   QANHPNLKIFYTVDNPTKNWKGGVGYVSKDMALKGLPLPADDTLILVCGPPGMMEHISGG  301

Query  938   KD-KREQGELSGVLKEVGYTENMVYKF  1015
             K     QGE+ GVLKE+GYTE MV+KF
Sbjct  302   KAPDWSQGEVKGVLKELGYTEQMVFKF  328



>ref|XP_010088329.1| NADH-cytochrome b5 reductase-like protein [Morus notabilis]
 gb|EXB33945.1| NADH-cytochrome b5 reductase-like protein [Morus notabilis]
Length=344

 Score =   439 bits (1130),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 236/348 (68%), Positives = 271/348 (78%), Gaps = 25/348 (7%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLV---  205
             M+  F RLAK+AP+AFS AF  + KS          A +       ++   SSP L    
Sbjct  1     MASFFHRLAKSAPLAFSNAFGAQRKSRHGIPFGALAAISGGFSYFYFY---SSPQLCGNE  57

Query  206   -YLDQINEDTSRKTA----------------LNPNQWIEFKLEDRAPVSHNTHLFRFSFD  334
              +LDQINE++  K                  LNP++WIEFKL+D A VSHNT LFRFSFD
Sbjct  58    AHLDQINEESGPKVGESLYLENGDVDNVFATLNPDKWIEFKLQDTARVSHNTQLFRFSFD  117

Query  335   PSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMS  514
             P+AKLGLDIASCI+TRAP+G  D EGKPKYV+RPYTPISDPD+KG FDLLIKVYPEGKMS
Sbjct  118   PTAKLGLDIASCILTRAPLGH-DVEGKPKYVVRPYTPISDPDSKGFFDLLIKVYPEGKMS  176

Query  515   QHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQI  694
             QHFASLKPGD VEVKGPI+KL+Y PNMKKHIGMIAGG+GITPMLQVIEAILKNPDDNTQ+
Sbjct  177   QHFASLKPGDVVEVKGPIEKLRYSPNMKKHIGMIAGGTGITPMLQVIEAILKNPDDNTQV  236

Query  695   SLLYANVSPddillkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPP  874
             SLLY NVSPDDILLK+KLD LAA+HPNLKV+YTVD+PTK W+GG G+ISK++V+KGLP P
Sbjct  237   SLLYGNVSPDDILLKQKLDFLAASHPNLKVYYTVDNPTKNWKGGKGYISKEIVLKGLPGP  296

Query  875   SDDTLIFVCGPPGMMTHVSGEKDKR-EQGELSGVLKEVGYTENMVYKF  1015
              +DTLI VCGPPGMM H+SGEK K   QGEL G+LKE+GYTE MVYKF
Sbjct  297   GEDTLILVCGPPGMMKHISGEKAKDWTQGELRGILKELGYTEEMVYKF  344



>ref|NP_001242425.1| uncharacterized protein LOC100781191 [Glycine max]
 gb|ACU21409.1| unknown [Glycine max]
Length=323

 Score =   437 bits (1123),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 237/328 (72%), Positives = 273/328 (83%), Gaps = 6/328 (2%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+   +R A+A PI F+     +S S+    R PF A AA++GG S+ YY SSPN  +  
Sbjct  1     MAAFLRRFARATPILFA----AQSNSSHTNLRLPFTAIAAISGGVSFLYYHSSPNFAHSQ  56

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
             +  +  S+  AL P++W+EFKL+D A VSHNT LFRFSFDP+ KLGLDIASCI+TRA +G
Sbjct  57    EAEQVESKNIALVPDKWVEFKLQDTARVSHNTQLFRFSFDPTQKLGLDIASCILTRASLG  116

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             Q DAEGKPK+VIRPYTPISDP +KG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+K
Sbjct  117   Q-DAEGKPKFVIRPYTPISDPQSKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEK  175

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
             L+Y PNMKKHIGMIAGG+GITPMLQVIEAILKNPDD TQISLLYANVSPDDILLK+KLD+
Sbjct  176   LRYTPNMKKHIGMIAGGTGITPMLQVIEAILKNPDDKTQISLLYANVSPDDILLKQKLDI  235

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             LA +HPNLK+FYTVD+PTK WRGG+G+ISKD+VVKGLP PSDDTLI VCGPPGMM  +SG
Sbjct  236   LATSHPNLKIFYTVDNPTKNWRGGAGYISKDIVVKGLPGPSDDTLILVCGPPGMMKAISG  295

Query  935   EKDKR-EQGELSGVLKEVGYTENMVYKF  1015
             EK K   QGE+SGVLKE GYTE MVYKF
Sbjct  296   EKAKDWTQGEVSGVLKEAGYTEQMVYKF  323



>emb|CDP10379.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   437 bits (1123),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 246/315 (78%), Positives = 279/315 (89%), Gaps = 2/315 (1%)
 Frame = +2

Query  74    IAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQINEDTSRKTALN  253
             IAF+ AF  +SKSTF  FR PFGA AAV+GG SY+YYFSS ++ YLD+I +DT  K ALN
Sbjct  16    IAFNGAFLAQSKSTFPNFRIPFGAIAAVSGGISYYYYFSSSSVAYLDEIADDTGSKMALN  75

Query  254   PNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIR  433
             PN+W EFKLED+A VSHNT LFRFSFDPS +LGLDIASCI+TRAP GQ DAEGK KYVIR
Sbjct  76    PNKWTEFKLEDKAQVSHNTQLFRFSFDPSVRLGLDIASCILTRAPTGQ-DAEGKTKYVIR  134

Query  434   PYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGM  613
             PYTPISDPDAKG+FDL+IKVYPEGKMSQHFASLKPGD +EVKGPI+KL+Y PNMKKHIGM
Sbjct  135   PYTPISDPDAKGYFDLMIKVYPEGKMSQHFASLKPGDVMEVKGPIEKLRYSPNMKKHIGM  194

Query  614   IAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPNLKVFYT  793
             IAGG+GITPMLQ+I+AILKNPDDNTQ+SLLYANVSPDDILLKKKLDVLAA+HPNL + YT
Sbjct  195   IAGGTGITPMLQIIDAILKNPDDNTQVSLLYANVSPDDILLKKKLDVLAASHPNLTIHYT  254

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDKR-EQGELSG  970
             VD+PT +W GG G+ISKDMVVKGLP P+DDTLI VCGPP MM H+SG+K K   QGEL+G
Sbjct  255   VDNPTNDWIGGKGYISKDMVVKGLPGPADDTLILVCGPPDMMQHISGDKAKDYSQGELTG  314

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GYTE+MVYKF
Sbjct  315   LLKELGYTESMVYKF  329



>ref|XP_010520587.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Tarenaya 
hassleriana]
Length=328

 Score =   437 bits (1123),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 239/327 (73%), Positives = 274/327 (84%), Gaps = 2/327 (1%)
 Frame = +2

Query  38    SLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQ  217
             +  F+RLAK+AP  FS+A R    S F  FRFP GA AA++GG SY+Y  S  NLVYLDQ
Sbjct  3     TTFFRRLAKSAPTTFSRASRFHGDSGFGTFRFPVGAIAALSGGLSYYYSSSDNNLVYLDQ  62

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQ  397
               E+T  KTAL P++W EFKL+D A VSHNT LFRFSFDPSAKLGL++ASCI+TRAP+G 
Sbjct  63    EKEETGPKTALKPDKWNEFKLQDTARVSHNTQLFRFSFDPSAKLGLEVASCIVTRAPVGY  122

Query  398   QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKL  577
              D+EGKPKYVIRPYTPISDP+AKG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+K 
Sbjct  123   -DSEGKPKYVIRPYTPISDPEAKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKF  181

Query  578   QYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVL  757
             +Y PNMK++IGMIAGG+GITPMLQVIEAILKNP+D TQISLLY NVSPDDILLK+KLD L
Sbjct  182   KYSPNMKRNIGMIAGGTGITPMLQVIEAILKNPEDKTQISLLYGNVSPDDILLKQKLDAL  241

Query  758   AATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGE  937
              A HPNLKV+YTVD+PTK W+GG G+ISKDM +KGLPPP DDT I VCGPPGMM H+SG 
Sbjct  242   QAKHPNLKVYYTVDNPTKSWKGGVGYISKDMALKGLPPPGDDTFILVCGPPGMMEHISGG  301

Query  938   KD-KREQGELSGVLKEVGYTENMVYKF  1015
             K     QGE+ G+LKE+GYTE MV+KF
Sbjct  302   KAPDWSQGEVKGILKELGYTEQMVFKF  328



>emb|CDX70911.1| BnaC03g09950D [Brassica napus]
Length=327

 Score =   436 bits (1122),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 232/328 (71%), Positives = 274/328 (84%), Gaps = 2/328 (1%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+  F+RLA++APIAF  A R + KS    FRF  GA AA++GG S +Y  S  NL YLD
Sbjct  1     MATFFRRLARSAPIAFPAALRSQIKSGHGTFRFSAGAIAALSGGFSCYYLTSGNNLAYLD  60

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
             Q  E+T  KTALNP++W+EFKL+D A VSHNT LFRFSFDPSA LGL +ASC++TRAP+G
Sbjct  61    QAKEETGPKTALNPDKWLEFKLQDTATVSHNTKLFRFSFDPSANLGLHVASCLLTRAPLG  120

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
               +AEGK KYV+RPYTPISDP+AKG+FDLLIKVYP+GKMSQHFASLKPGD +EVKGPI+K
Sbjct  121   Y-NAEGKTKYVVRPYTPISDPEAKGYFDLLIKVYPDGKMSQHFASLKPGDVLEVKGPIEK  179

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
              +Y PNMKKHIGMIAGGSGITPMLQVI+ I+KNP+DNT+I+LLYANVSPDDILLK+KLD 
Sbjct  180   FKYSPNMKKHIGMIAGGSGITPMLQVIDTIVKNPEDNTKITLLYANVSPDDILLKQKLDA  239

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             L A HPNLKVFYTVD+PTK W+GG G++SKDM +KGLP P+DDTLI VCGPPGMM HVSG
Sbjct  240   LQANHPNLKVFYTVDNPTKNWKGGVGYVSKDMALKGLPLPADDTLILVCGPPGMMEHVSG  299

Query  935   EKD-KREQGELSGVLKEVGYTENMVYKF  1015
              K     QGE+ G+LKE+G+TE MV+KF
Sbjct  300   GKAPDWSQGEVKGILKELGFTEQMVFKF  327



>ref|XP_004508521.1| PREDICTED: NADH-cytochrome b5 reductase-like protein-like [Cicer 
arietinum]
Length=325

 Score =   436 bits (1121),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 236/330 (72%), Positives = 279/330 (85%), Gaps = 8/330 (2%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+   +R+A + PIAF+     +SKS+   F  PF A AA++GG SY YY SSPNLV+ +
Sbjct  1     MAAFLRRVATSTPIAFAS----QSKSSRTNFHLPFTAIAAISGGFSYLYYSSSPNLVHSE  56

Query  215   QINEDT--SRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAP  388
             QI E+   ++  AL P++W+EFKL+D A VS NTHL+RFSFDP+  LGLD+ASCI+TRAP
Sbjct  57    QIGEEEIKTKNIALVPDKWVEFKLQDTARVSQNTHLYRFSFDPTKNLGLDVASCILTRAP  116

Query  389   IGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPI  568
             +GQ DAE KPKYVIRPYTPISDP++KG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI
Sbjct  117   LGQ-DAEEKPKYVIRPYTPISDPESKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPI  175

Query  569   QKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkl  748
             +K +Y PNMKK+IGMIAGG+GITPMLQVIEA+LKN DD TQISLLYAN+SPDDILLK+KL
Sbjct  176   EKFKYTPNMKKNIGMIAGGTGITPMLQVIEAVLKNSDDKTQISLLYANISPDDILLKQKL  235

Query  749   dVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHV  928
             D+L ++HPNLK+FYTVD+PTK W+GG+G+ISKDMVVKGLP PSDDTLI VCGPPGMM HV
Sbjct  236   DILESSHPNLKIFYTVDNPTKNWKGGAGYISKDMVVKGLPAPSDDTLILVCGPPGMMKHV  295

Query  929   SGEKDKR-EQGELSGVLKEVGYTENMVYKF  1015
             SGEK K   QGE+SG+LKE GYTE MVYKF
Sbjct  296   SGEKAKDWTQGEVSGLLKEAGYTEQMVYKF  325



>ref|XP_010454305.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Camelina 
sativa]
Length=329

 Score =   435 bits (1119),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 235/328 (72%), Positives = 278/328 (85%), Gaps = 3/328 (1%)
 Frame = +2

Query  38    SLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQ  217
             +  F+RLA++APIAF  A   +SK+    FRF  GA AA++GG SY+Y  S  NLVYLDQ
Sbjct  3     TTFFRRLARSAPIAFPVALGSQSKAGSGAFRFSAGAIAALSGGFSYYYLASGNNLVYLDQ  62

Query  218   I-NEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
                E+T  KTALNP++W+EFKL+D A VSHNT LFRFSF+PSA+LGL +ASC++TRAP+G
Sbjct  63    AKEEETGPKTALNPDKWLEFKLQDTARVSHNTQLFRFSFEPSAELGLHVASCLLTRAPLG  122

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
               +AEGK KYVIRPYTPISDP+AKG+FDLLIKVYP+GKMSQHFASLKPGD +EVKGP++K
Sbjct  123   Y-NAEGKTKYVIRPYTPISDPEAKGYFDLLIKVYPDGKMSQHFASLKPGDVLEVKGPVEK  181

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
              +Y PNMKKHIGMIAGGSGITPMLQVI+AI+KNP+DNTQISLLYANVSPDDILLK+KLDV
Sbjct  182   FKYSPNMKKHIGMIAGGSGITPMLQVIDAIVKNPEDNTQISLLYANVSPDDILLKQKLDV  241

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             L A HPNLK+FYTVD+PTK W+GG G++SKDM +KGLP P+DDTLI VCGPPGMM H+SG
Sbjct  242   LQANHPNLKIFYTVDNPTKTWKGGVGYVSKDMALKGLPLPADDTLILVCGPPGMMEHISG  301

Query  935   EKD-KREQGELSGVLKEVGYTENMVYKF  1015
              K     QGE+ GVLKE+GYTE MV+KF
Sbjct  302   GKAPDWSQGEVKGVLKELGYTEQMVFKF  329



>ref|XP_003609284.1| NADH-cytochrome b5 reductase-like protein [Medicago truncatula]
 gb|AES91481.1| NADH-cytochrome b5 reductase-like protein [Medicago truncatula]
Length=325

 Score =   435 bits (1118),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 236/330 (72%), Positives = 278/330 (84%), Gaps = 8/330 (2%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+   +R+A++ PI F       SKS+ + F  PF A AA++GG SY YY SSPNLV+ D
Sbjct  1     MAAFLRRVARSTPIGFG----AHSKSSRSNFHLPFTAIAAISGGFSYLYYSSSPNLVHSD  56

Query  215   QINED--TSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAP  388
             QI ++   ++  AL P++W+EFKL+D A VSH+THL+RFSFDP+ KLGLD+ASCI+TRAP
Sbjct  57    QIGDEDIKTKNIALIPDKWVEFKLQDTARVSHDTHLYRFSFDPTKKLGLDVASCILTRAP  116

Query  389   IGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPI  568
              GQ DAE KPKYVIRPYTPISD ++KG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI
Sbjct  117   FGQ-DAEEKPKYVIRPYTPISDTESKGYFDLLIKVYPEGKMSQHFASLKPGDMVEVKGPI  175

Query  569   QKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkl  748
             +K +Y PNMKK+IGMIAGGSGITPMLQVIEAILKN DD TQISL+YANVSPDDILL++KL
Sbjct  176   EKFKYTPNMKKNIGMIAGGSGITPMLQVIEAILKNSDDKTQISLIYANVSPDDILLQQKL  235

Query  749   dVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHV  928
             D+LA +HPNLKVFYTVD+PTK W+GG+G+ISKDMVVKGLP PSDDTL+ VCGPPGMM H+
Sbjct  236   DILAKSHPNLKVFYTVDNPTKTWKGGAGYISKDMVVKGLPAPSDDTLVLVCGPPGMMQHI  295

Query  929   SGEKDKR-EQGELSGVLKEVGYTENMVYKF  1015
             SGEK K   QGE+SG+LKE GYTE MVYKF
Sbjct  296   SGEKAKDWTQGEVSGILKEAGYTEQMVYKF  325



>gb|KCW79798.1| hypothetical protein EUGRSUZ_C011341, partial [Eucalyptus grandis]
Length=271

 Score =   432 bits (1112),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 212/271 (78%), Positives = 244/271 (90%), Gaps = 2/271 (1%)
 Frame = +2

Query  206   YLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRA  385
             +LDQ+ EDT  K ALNP++WIEFKL+D A VSHNT LFRFSFDP+ +LGL +ASCI+TRA
Sbjct  2     HLDQVGEDTGSKIALNPDKWIEFKLQDTARVSHNTQLFRFSFDPNVQLGLHVASCILTRA  61

Query  386   PIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGP  565
             P GQ DAEGK KYV+RPYTPISDPDAKG+FDLLIKVYPEGKMSQHFA LKPGD VEVKGP
Sbjct  62    PTGQ-DAEGKTKYVVRPYTPISDPDAKGYFDLLIKVYPEGKMSQHFAILKPGDVVEVKGP  120

Query  566   IQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkk  745
             I+K +Y PNMKK+IGMIAGG+GITPMLQVI+AILKNPDDNTQ+SLLYANVSPDDILLK+K
Sbjct  121   IEKFKYTPNMKKNIGMIAGGTGITPMLQVIDAILKNPDDNTQVSLLYANVSPDDILLKQK  180

Query  746   ldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTH  925
             LD+LAA+HPNLK++YTVD+PTK W+GG G+ISKDM +KGLP PS+D LI VCGPPGMM H
Sbjct  181   LDILAASHPNLKIYYTVDNPTKNWKGGKGYISKDMAIKGLPAPSEDALILVCGPPGMMKH  240

Query  926   VSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             +SG+K K R QGEL+G+LKE+GYTE MVYKF
Sbjct  241   ISGDKAKDRSQGELTGILKELGYTEQMVYKF  271



>ref|XP_009131771.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Brassica 
rapa]
Length=328

 Score =   434 bits (1117),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 231/325 (71%), Positives = 272/325 (84%), Gaps = 2/325 (1%)
 Frame = +2

Query  44    LFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQIN  223
              F+RLA++APIAF  A R + KS    FRF  GA AA++GG S +Y  S  NL YLDQ  
Sbjct  5     FFRRLARSAPIAFPAALRSQIKSGHGTFRFSAGAIAALSGGFSCYYLTSGNNLAYLDQAK  64

Query  224   EDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQD  403
             E+T  KTALNP++W+EFKL+D A VSHNT LFRFSFDPSA LGL +ASC++TRAP+G  +
Sbjct  65    EETGPKTALNPDKWLEFKLQDTATVSHNTKLFRFSFDPSANLGLHVASCLLTRAPLGY-N  123

Query  404   AEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQY  583
             AEGK KYV+RPYTPISDP+AKG+FDLLIKVYP+GKMSQHFASLKPGD +EVKGPI+K +Y
Sbjct  124   AEGKTKYVVRPYTPISDPEAKGYFDLLIKVYPDGKMSQHFASLKPGDVLEVKGPIEKFKY  183

Query  584   RPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAA  763
              PNMKKHIGMIAGGSGITPMLQVI+ I+KNP+DNT+I+LLYANVSPDDILLK+KLD L A
Sbjct  184   SPNMKKHIGMIAGGSGITPMLQVIDTIVKNPEDNTKITLLYANVSPDDILLKQKLDALQA  243

Query  764   THPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKD  943
              HPNLKVFYTVD+PTK W+GG G++SKDM +KGLP P+DDTLI VCGPPGMM HVSG K 
Sbjct  244   NHPNLKVFYTVDNPTKNWKGGVGYVSKDMALKGLPLPADDTLILVCGPPGMMEHVSGGKA  303

Query  944   -KREQGELSGVLKEVGYTENMVYKF  1015
                 QGE+ G+LKE+G+TE MV+KF
Sbjct  304   PDWSQGEVKGILKELGFTEQMVFKF  328



>gb|KFK26253.1| hypothetical protein AALP_AA8G223100 [Arabis alpina]
Length=324

 Score =   433 bits (1114),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 225/328 (69%), Positives = 262/328 (80%), Gaps = 5/328 (2%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+  F+RLAK+API F  AF  ++KS          A +            S  NLVYLD
Sbjct  1     MASFFRRLAKSAPITFPVAFGSQTKSGSRFSAGAIAALSGGFSYYYLT---SGNNLVYLD  57

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
                E+   KTALNP++W+EFKL+D A VSHNT LFRFSFDPSA LGL +ASC++TRAP+G
Sbjct  58    AAKEEAGPKTALNPDKWLEFKLQDTARVSHNTQLFRFSFDPSANLGLHVASCLLTRAPLG  117

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
               ++EGK KYVIRPYTPISDP+AKG+FDLLIKVYP+GKMSQHFASLKPGD +EVKGP++K
Sbjct  118   Y-NSEGKSKYVIRPYTPISDPEAKGYFDLLIKVYPDGKMSQHFASLKPGDVLEVKGPVEK  176

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
              +Y PNMKKHIGMIAGGSGITPMLQVI+AILKNP+DNT+ISLLYANVSPDDILLK+KLDV
Sbjct  177   FKYSPNMKKHIGMIAGGSGITPMLQVIDAILKNPEDNTKISLLYANVSPDDILLKQKLDV  236

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             L A HPNLKVFYTVD+P K W+GG G+ISKDM +KGLP P+DDTLI VCGPPGMM H+SG
Sbjct  237   LQANHPNLKVFYTVDNPAKNWKGGVGYISKDMALKGLPLPADDTLILVCGPPGMMEHISG  296

Query  935   EKD-KREQGELSGVLKEVGYTENMVYKF  1015
              K     QGE+ GVLKE+GYTE MV+KF
Sbjct  297   GKAPDWSQGEVKGVLKELGYTEEMVFKF  324



>ref|NP_001239743.1| uncharacterized protein LOC100819222 [Glycine max]
 gb|ACU23343.1| unknown [Glycine max]
 gb|KHN15108.1| NADH-cytochrome b5 reductase-like protein [Glycine soja]
Length=319

 Score =   432 bits (1112),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 234/328 (71%), Positives = 271/328 (83%), Gaps = 10/328 (3%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+ L +R A A PI         S S+    R PF A AA++GG S+ +Y SSPN  +  
Sbjct  1     MAALLRRFASATPIP--------SNSSHTNLRLPFTAIAAISGGVSFLFYHSSPNFAHSQ  52

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
             +  +  S+  AL P++W+EFKL+D A VSHNT LFRFSFDP+ KLGLDIASCI+TRAP+G
Sbjct  53    EAEQVESKNIALVPDKWVEFKLQDTARVSHNTQLFRFSFDPTQKLGLDIASCILTRAPLG  112

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             Q DAEGKPK+VIRPYTPISDP++ G+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+K
Sbjct  113   Q-DAEGKPKFVIRPYTPISDPESNGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEK  171

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
             L+Y PNMKKHIGMIAGG+GITPMLQVIEAIL+NPDD TQISLLYANVSPDDILLK+KLD+
Sbjct  172   LRYTPNMKKHIGMIAGGTGITPMLQVIEAILRNPDDKTQISLLYANVSPDDILLKQKLDI  231

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             LA +HPNLK+FYTVD+PTK WRGG+G+ISKD+VVKGLP PSDDTLI VCGPPGMM  +SG
Sbjct  232   LATSHPNLKIFYTVDNPTKNWRGGAGYISKDVVVKGLPSPSDDTLILVCGPPGMMKAISG  291

Query  935   EKDKR-EQGELSGVLKEVGYTENMVYKF  1015
             EK K   QGE+SG+LKE GYTE MVYKF
Sbjct  292   EKAKDWTQGEVSGILKEAGYTEQMVYKF  319



>ref|XP_007013384.1| FAD/NAD(P)-binding oxidoreductase isoform 2 [Theobroma cacao]
 gb|EOY31003.1| FAD/NAD(P)-binding oxidoreductase isoform 2 [Theobroma cacao]
Length=309

 Score =   432 bits (1110),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 218/273 (80%), Positives = 247/273 (90%), Gaps = 3/273 (1%)
 Frame = +2

Query  203   VYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLF-RFSFDPSAKLGLDIASCIIT  379
             V+LDQINE+T  K AL  ++WI FKL+D A VSHNT LF RFSFDP++KLGLD+ASCI+T
Sbjct  38    VHLDQINEETGPKVALKSDKWIGFKLQDTARVSHNTQLFSRFSFDPTSKLGLDVASCILT  97

Query  380   RAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVK  559
             RAP+GQ DAEGK KYVIRPYTPISDPDAKG+FDLLIKVYPEGKMSQHFASLKPGD VEVK
Sbjct  98    RAPLGQ-DAEGKTKYVIRPYTPISDPDAKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVK  156

Query  560   GPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillk  739
             GPI+KL+Y PNMKKHIGMIAGG+GITPMLQVIEAILK PDDNTQ+SLLYANVSPDDILLK
Sbjct  157   GPIEKLRYSPNMKKHIGMIAGGTGITPMLQVIEAILKKPDDNTQVSLLYANVSPDDILLK  216

Query  740   kkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMM  919
             +KLD+LAA+HPNLKVFYTVD+P+K W+GG+G+ISKDMV KGLP P +DTLI VCGPPGMM
Sbjct  217   QKLDILAASHPNLKVFYTVDNPSKNWKGGAGYISKDMVTKGLPGPGEDTLILVCGPPGMM  276

Query  920   THVSGEKDKR-EQGELSGVLKEVGYTENMVYKF  1015
              H+SG+K K   QGEL+G+LKE+GYTE MVYKF
Sbjct  277   KHISGDKAKDYSQGELTGILKELGYTEQMVYKF  309



>ref|XP_004139319.1| PREDICTED: NADH-cytochrome b5 reductase-like protein-like [Cucumis 
sativus]
Length=328

 Score =   429 bits (1103),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 234/329 (71%), Positives = 273/329 (83%), Gaps = 3/329 (1%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRG-ESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYL  211
             M+   +RLA AAP     A  G +SK   + FRFP GA AA +GG SY YY S  +LV+L
Sbjct  1     MATFLRRLANAAPSLRYNALLGTQSKIHSSNFRFPIGAIAAASGGISYLYYVSYSDLVHL  60

Query  212   DQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPI  391
             DQ +E+ S K AL   +WIEFKL+D A V+HNTHLFRFSFDPS  LGL++ASCI TRAPI
Sbjct  61    DQSSEEASPKVALKSGKWIEFKLQDSARVTHNTHLFRFSFDPSETLGLNVASCIYTRAPI  120

Query  392   GQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQ  571
             GQ D EGK KYV+RPYTPISDPDAKG+FDLLIKVYP+GKMSQHFA+LKPGD +EVKGPI+
Sbjct  121   GQDD-EGKAKYVVRPYTPISDPDAKGYFDLLIKVYPQGKMSQHFATLKPGDVLEVKGPIE  179

Query  572   KLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkld  751
             KL+Y PNMKKHIGMIAGG+GITPMLQVI+AI+KNPDDNTQ+SLLY NVSPDDILLK+KLD
Sbjct  180   KLKYSPNMKKHIGMIAGGTGITPMLQVIDAIVKNPDDNTQVSLLYGNVSPDDILLKQKLD  239

Query  752   VLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVS  931
             +LA++HPN+KVFYTVD PTK W+GG G++SKDMV+KGLPPP DD LI VCGPPGMM H+S
Sbjct  240   ILASSHPNIKVFYTVDKPTKNWKGGKGYVSKDMVIKGLPPPGDDALILVCGPPGMMKHIS  299

Query  932   GEKD-KREQGELSGVLKEVGYTENMVYKF  1015
             G+K     QGEL G+LKE+GYT+ MVYKF
Sbjct  300   GDKAPDYSQGELDGMLKELGYTKEMVYKF  328



>ref|XP_011084137.1| PREDICTED: NADH-cytochrome b5 reductase-like protein isoform 
X2 [Sesamum indicum]
Length=304

 Score =   427 bits (1099),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 211/260 (81%), Positives = 242/260 (93%), Gaps = 2/260 (1%)
 Frame = +2

Query  239   KTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQDAEGKP  418
             +  LNP++WIEFKL+D+   SHN+ LFRFSFDPSAKLGLD+ASCIITRAP+GQ +AEGK 
Sbjct  46    RITLNPDKWIEFKLQDKVQASHNSQLFRFSFDPSAKLGLDVASCIITRAPMGQ-NAEGKT  104

Query  419   KYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMK  598
             KYVIRPYTPISDP+AKG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+KL+Y PNMK
Sbjct  105   KYVIRPYTPISDPNAKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKLRYSPNMK  164

Query  599   KHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPNL  778
             KHIGMIAGG+GITPMLQ+I+AILKNPDDNTQ+SLLYANVSPDDILLKKKLDVLAA++PNL
Sbjct  165   KHIGMIAGGTGITPMLQIIDAILKNPDDNTQVSLLYANVSPDDILLKKKLDVLAASNPNL  224

Query  779   KVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDK-REQ  955
             K+FYTVD+PTK+W GG G+ISKDMVVKGLP PSDDTLI VCGPPG+M H+SG+K K R Q
Sbjct  225   KIFYTVDNPTKDWLGGKGYISKDMVVKGLPSPSDDTLILVCGPPGLMKHISGDKAKDRSQ  284

Query  956   GELSGVLKEVGYTENMVYKF  1015
             G+L+G+LKE+GYTE+MVYKF
Sbjct  285   GQLTGILKELGYTEDMVYKF  304



>gb|EPS65850.1| hypothetical protein M569_08927, partial [Genlisea aurea]
Length=296

 Score =   424 bits (1089),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/277 (76%), Positives = 247/277 (89%), Gaps = 2/277 (1%)
 Frame = +2

Query  188   SSPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
             S+ NLV+ D+ ++ T+ K ALNP+ WIEFKL+D+A  SHN+HLFRFSFDPS KLGLD++S
Sbjct  21    SNSNLVFSDEASDVTAPKVALNPDNWIEFKLQDKARASHNSHLFRFSFDPSVKLGLDVSS  80

Query  368   CIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDK  547
             CI+TRAP+GQ DAEGK KY IRPYTPISDP+AKG+FDLLIKVYPEGKM+QHFASLKPGD 
Sbjct  81    CILTRAPVGQ-DAEGKTKYAIRPYTPISDPEAKGYFDLLIKVYPEGKMTQHFASLKPGDV  139

Query  548   VEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPdd  727
             VEVKGP++KL+Y PNMKKHIGMIAGG+GITPMLQ+I+AILKNPDDNTQ+SL+YANVSPDD
Sbjct  140   VEVKGPVEKLRYSPNMKKHIGMIAGGTGITPMLQIIDAILKNPDDNTQVSLIYANVSPDD  199

Query  728   illkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGP  907
             ILLKKKLD L+A+ PNLKVFYTVD PT +W GG G++SK++ +KGLP PSDDTLI VCGP
Sbjct  200   ILLKKKLDKLSASSPNLKVFYTVDKPTDDWVGGKGYVSKEVALKGLPCPSDDTLILVCGP  259

Query  908   PGMMTHVSGEKDKR-EQGELSGVLKEVGYTENMVYKF  1015
             PGMM H+SGEK K   QGELSG+LKE+GY E+MVYKF
Sbjct  260   PGMMKHISGEKAKDWTQGELSGILKELGYKEDMVYKF  296



>ref|XP_010914901.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Elaeis 
guineensis]
Length=328

 Score =   424 bits (1089),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 226/329 (69%), Positives = 279/329 (85%), Gaps = 3/329 (1%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPN-LVYL  211
             M+LL +RL++A+ +    A R E      G RFPFGA AAV+ G + +Y+ SSP  L  L
Sbjct  1     MALLMRRLSRASALGLGNALRVEPNWKSGGRRFPFGAAAAVSSGIAVYYFCSSPTMLAQL  60

Query  212   DQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPI  391
             +  +E+ + K AL+P +W+EFKL++ A VSHNT LFRFSFDP+AKLGLDIASCI+TRAPI
Sbjct  61    EPKSEEPAGKVALDPEKWLEFKLQETARVSHNTQLFRFSFDPAAKLGLDIASCILTRAPI  120

Query  392   GQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQ  571
             G++ +EG+ KYVIRPYTPISDPD+KG+FDLLIKVYP GKMSQHFASLKPGD VEVKGPI+
Sbjct  121   GEE-SEGRRKYVIRPYTPISDPDSKGYFDLLIKVYPNGKMSQHFASLKPGDVVEVKGPIE  179

Query  572   KLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkld  751
             KL+Y PNMKK IGMIAGG+GITPMLQVI+AILKNP+DNTQ+SLLYAN+SPDDILLK++LD
Sbjct  180   KLRYSPNMKKKIGMIAGGTGITPMLQVIKAILKNPNDNTQVSLLYANISPDDILLKRELD  239

Query  752   VLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVS  931
              L+A++PN KVFYTVD P+K+WRGG+G+ISKDM+ KGLP P++D+LI VCGPPGMM H+S
Sbjct  240   RLSASYPNFKVFYTVDKPSKDWRGGAGYISKDMIAKGLPGPTEDSLILVCGPPGMMKHIS  299

Query  932   GEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             G+K K R QGEL+G+L+E+GYTE MVYKF
Sbjct  300   GDKAKDRSQGELTGLLREIGYTEEMVYKF  328



>ref|XP_008457751.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Cucumis 
melo]
Length=329

 Score =   422 bits (1085),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 229/330 (69%), Positives = 275/330 (83%), Gaps = 4/330 (1%)
 Frame = +2

Query  35    MSLLFKRLAKAAP--IAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVY  208
             M+  F+RLA AAP  + ++     +SK   + FRFP GA AA +GG SY YY SS ++V+
Sbjct  1     MATFFRRLANAAPSLLRYNALLGTQSKIHSSNFRFPIGAIAAASGGVSYLYYVSSSDMVH  60

Query  209   LDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAP  388
             LD  +E+ S K AL   +WIEFKL+D A V+HNT LFRFSFDPS  LGL++ASCI TRAP
Sbjct  61    LDPNSEEASSKVALKSGKWIEFKLQDSARVTHNTQLFRFSFDPSETLGLNVASCIYTRAP  120

Query  389   IGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPI  568
             IGQ D EGK KYV+RPYTPISDPDA+G+FDLLIKVYP+GKMSQHFASLKPGD +EVKGPI
Sbjct  121   IGQDD-EGKVKYVVRPYTPISDPDARGYFDLLIKVYPQGKMSQHFASLKPGDVLEVKGPI  179

Query  569   QKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkl  748
             +KL+Y PNMKK IGMIAGG+GITPMLQVI+AI+KNPDDNTQ+SLLY NVSPDDILLK+KL
Sbjct  180   EKLKYSPNMKKRIGMIAGGTGITPMLQVIDAIVKNPDDNTQVSLLYGNVSPDDILLKQKL  239

Query  749   dVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHV  928
             D+LA++HPNLKVFYTVD+P++ W+GG G++SKDMV+KGLPPP DD+LI VCGPPGMM H+
Sbjct  240   DILASSHPNLKVFYTVDNPSQNWKGGKGYVSKDMVIKGLPPPGDDSLILVCGPPGMMKHI  299

Query  929   SGEKD-KREQGELSGVLKEVGYTENMVYKF  1015
             SG+K     QGEL G+LKE+GYT+ MVYKF
Sbjct  300   SGDKAPDYSQGELDGMLKELGYTKEMVYKF  329



>ref|XP_006842829.1| hypothetical protein AMTR_s00081p00094290 [Amborella trichopoda]
 gb|ERN04504.1| hypothetical protein AMTR_s00081p00094290 [Amborella trichopoda]
Length=339

 Score =   422 bits (1084),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 222/340 (65%), Positives = 263/340 (77%), Gaps = 14/340 (4%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfS--------  190
             M+LL KR A+ AP+A     +    S  +   F   +        ++F   S        
Sbjct  1     MALLLKRFARTAPVALRSRAQSNLSSMASSPSFHTTSEELWKKSKAHFGAISAISGGLAY  60

Query  191   ----SPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLD  358
                 S + V LD   ED++R  ALNP +WI+FKL ++A VS NTHLFRFSFD S  LGL 
Sbjct  61    LYLFSDDKVQLDSQPEDSARSGALNPEKWIQFKLLEKAKVSPNTHLFRFSFDHSLSLGLR  120

Query  359   IASCIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKP  538
             +ASCI+TRAP G+ D+EGK KYVIRPYTPISDPD+KG+FDL++KVYPEGKMSQ+ ASLKP
Sbjct  121   VASCILTRAPFGK-DSEGKTKYVIRPYTPISDPDSKGYFDLMVKVYPEGKMSQYLASLKP  179

Query  539   GDKVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVS  718
             GD VEVKGPI+KL+Y PNMKK IGMIAGG+GITPMLQVIEAILKNPDDNTQISLLYAN+S
Sbjct  180   GDVVEVKGPIEKLRYHPNMKKRIGMIAGGTGITPMLQVIEAILKNPDDNTQISLLYANIS  239

Query  719   PddillkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFV  898
             PDDILLK+KLD+L+A HPNLK+FYTVD P++ WRGG+G+IS DM++KGLP PSDDTLI V
Sbjct  240   PDDILLKEKLDMLSANHPNLKIFYTVDKPSQNWRGGAGYISNDMIIKGLPVPSDDTLILV  299

Query  899   CGPPGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             CGPPGMM H+SG+K K R QGELSG+LKEVGYTE MVYKF
Sbjct  300   CGPPGMMKHISGDKAKDRSQGELSGLLKEVGYTEEMVYKF  339



>ref|XP_008673639.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Zea mays]
 gb|ACG34836.1| NADH-cytochrome b5 reductase-like protein [Zea mays]
 tpg|DAA53220.1| TPA: NADH-cytochrome b5 reductase-like protein [Zea mays]
Length=311

 Score =   414 bits (1065),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 202/277 (73%), Positives = 247/277 (89%), Gaps = 3/277 (1%)
 Frame = +2

Query  188   SSPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
             SSP + +L++  +  + + ALNP++W+EFKL+++A VSHN+ LFRFSFDPS KLGLD+AS
Sbjct  37    SSPTVAHLEETGK-AAEQVALNPDKWLEFKLQEKATVSHNSQLFRFSFDPSTKLGLDVAS  95

Query  368   CIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDK  547
             C+ITRAPIG++ AEG+ KYVIRPYTPISDPD+KG+FDLLIKVYP+GKMSQ+FASLKPGD 
Sbjct  96    CLITRAPIGEE-AEGRRKYVIRPYTPISDPDSKGYFDLLIKVYPDGKMSQYFASLKPGDV  154

Query  548   VEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPdd  727
             VEVKGPI+KL+Y PNMKK IGMIAGGSGITPMLQV+ AILKNP+DNTQ+SL+YANVSPDD
Sbjct  155   VEVKGPIEKLRYNPNMKKQIGMIAGGSGITPMLQVVRAILKNPNDNTQVSLIYANVSPDD  214

Query  728   illkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGP  907
             ILLK++LD LA+++PN KVFYTVD P+ +WRGG GF+SKDMV+KGLP P++D+LI VCGP
Sbjct  215   ILLKRELDRLASSYPNFKVFYTVDKPSTDWRGGVGFVSKDMVLKGLPGPAEDSLILVCGP  274

Query  908   PGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             PGMM H+SG+K K R QGELSGVLK++GYT  MVYKF
Sbjct  275   PGMMNHISGDKAKDRSQGELSGVLKDLGYTAEMVYKF  311



>ref|XP_002455097.1| hypothetical protein SORBIDRAFT_03g004270 [Sorghum bicolor]
 gb|EES00217.1| hypothetical protein SORBIDRAFT_03g004270 [Sorghum bicolor]
Length=311

 Score =   414 bits (1063),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 201/277 (73%), Positives = 245/277 (88%), Gaps = 3/277 (1%)
 Frame = +2

Query  188   SSPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
             SSP + YL++  E  + K ALNP++W+EFKL+D+A VSHN+ LFRFSFDPS KLGLD+AS
Sbjct  37    SSPTVAYLEEKGE-AAEKVALNPDKWLEFKLQDKATVSHNSQLFRFSFDPSTKLGLDVAS  95

Query  368   CIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDK  547
             C+ITRAPIG++  EG+ K+VIRPYTPISDPD+KG+FDLLIKVYP+GKMSQ+FASLKPGD 
Sbjct  96    CLITRAPIGEE-VEGRRKFVIRPYTPISDPDSKGYFDLLIKVYPDGKMSQYFASLKPGDV  154

Query  548   VEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPdd  727
             +EVKGPI+KL+Y PNMKK IGMIAGG+GITPMLQV+ AILKNPDDNTQ+SL+YANVSPDD
Sbjct  155   LEVKGPIEKLRYSPNMKKQIGMIAGGTGITPMLQVVRAILKNPDDNTQVSLIYANVSPDD  214

Query  728   illkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGP  907
             ILLK++LD LA ++PN KVFYTVD P+ +WRGG GF+SKDMV+KGLP P++D+LI VCGP
Sbjct  215   ILLKRELDRLANSYPNFKVFYTVDKPSTDWRGGVGFVSKDMVLKGLPGPAEDSLILVCGP  274

Query  908   PGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             PGMM H+SG+K K R QGE+SG+LK++GYT  MVYKF
Sbjct  275   PGMMNHISGDKAKDRSQGEVSGILKDLGYTAEMVYKF  311



>gb|EEC70028.1| hypothetical protein OsI_00602 [Oryza sativa Indica Group]
Length=311

 Score =   413 bits (1062),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 200/277 (72%), Positives = 244/277 (88%), Gaps = 2/277 (1%)
 Frame = +2

Query  188   SSPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
             S P +  +++  ED + K ALNP++W+EFKL+++A VSHN+ LFRFSFDPS KLGLD+AS
Sbjct  36    SPPIIALMEEKGEDAATKVALNPDKWLEFKLQEKATVSHNSQLFRFSFDPSTKLGLDVAS  95

Query  368   CIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDK  547
             C+ITRAPIG++  EG+ K+VIRPYTPISDPD+KG+FDLLIKVYP+GKMSQ+FASLKPGD 
Sbjct  96    CLITRAPIGEE-VEGRRKFVIRPYTPISDPDSKGYFDLLIKVYPDGKMSQYFASLKPGDV  154

Query  548   VEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPdd  727
             VEVKGPI+KL+Y PNMKK IGMIAGG+GITPMLQV+ AILKNPDDNTQ+SL+YANVSPDD
Sbjct  155   VEVKGPIEKLRYSPNMKKQIGMIAGGTGITPMLQVVRAILKNPDDNTQVSLIYANVSPDD  214

Query  728   illkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGP  907
             ILLK++LD LA+++PN KVFYTVD P+ +WRGG G+ISKDM +KGLP P +D+LI VCGP
Sbjct  215   ILLKRELDRLASSYPNFKVFYTVDKPSNDWRGGVGYISKDMALKGLPRPGEDSLILVCGP  274

Query  908   PGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             PGMM H+SG+K K R QGEL+GVLKE+GYT +MVYKF
Sbjct  275   PGMMNHISGDKAKDRSQGELTGVLKELGYTADMVYKF  311



>ref|XP_006645552.1| PREDICTED: NADH-cytochrome b5 reductase-like protein-like, partial 
[Oryza brachyantha]
Length=294

 Score =   412 bits (1058),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 200/278 (72%), Positives = 243/278 (87%), Gaps = 2/278 (1%)
 Frame = +2

Query  188   SSPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
             S P +  L++  E+   K ALNP++W+EFKL+++A VSHN+ LFRFSFDPS KLGLD+AS
Sbjct  17    SPPTVALLEEKGEEAVAKVALNPDKWLEFKLQEKATVSHNSQLFRFSFDPSNKLGLDVAS  76

Query  368   CIITRAPIGQQ-DAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGD  544
             C+ITRAPIG++ + EG+ KYVIRPYTPISDPD+KG+FDLLIKVYP+GKMSQ+FASLKPGD
Sbjct  77    CLITRAPIGEEVEGEGRRKYVIRPYTPISDPDSKGYFDLLIKVYPDGKMSQYFASLKPGD  136

Query  545   KVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPd  724
              VEVKGPI+KL+Y PNMKK IGMIAGG+GITPMLQV+ AILKNPDDNTQ+SL+YANVSPD
Sbjct  137   VVEVKGPIEKLRYSPNMKKKIGMIAGGTGITPMLQVVRAILKNPDDNTQVSLIYANVSPD  196

Query  725   dillkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCG  904
             DILLK++LD LA+++PN KVFYTVD P+ +WRGG G+ISKDM +KGLP P +D+LI VCG
Sbjct  197   DILLKRELDRLASSYPNFKVFYTVDKPSSDWRGGVGYISKDMALKGLPGPREDSLILVCG  256

Query  905   PPGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             PPGMM H+SG+K K R QGEL+G+LKE+GYT  MVYKF
Sbjct  257   PPGMMNHISGDKAKDRSQGELTGILKELGYTAEMVYKF  294



>emb|CDM81967.1| unnamed protein product [Triticum aestivum]
Length=309

 Score =   412 bits (1058),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 197/277 (71%), Positives = 245/277 (88%), Gaps = 2/277 (1%)
 Frame = +2

Query  188   SSPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
             S+P + ++++  ED + K ALNP +W+EFKL+++A VSH++ LFRFSFDPS KLGLD+AS
Sbjct  34    SNPTIAHMEEKGEDAAAKVALNPEKWLEFKLQEKATVSHDSELFRFSFDPSTKLGLDVAS  93

Query  368   CIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDK  547
             C++TRAPIGQ+  EGK KYVIRPYTPISDPD+KG+FDLLIKVYPEGKMSQHFA+LKPGD 
Sbjct  94    CLVTRAPIGQE-VEGKRKYVIRPYTPISDPDSKGYFDLLIKVYPEGKMSQHFANLKPGDV  152

Query  548   VEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPdd  727
             +EVKGPI+KL+Y PNMK+ IGM+AGG+GITPMLQV+ AILKNPDDNTQ+SL+YANVSPDD
Sbjct  153   LEVKGPIEKLRYSPNMKRQIGMVAGGTGITPMLQVVRAILKNPDDNTQVSLIYANVSPDD  212

Query  728   illkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGP  907
             ILLKK+LD LA+++PN KVFYTVD P+ +WRGG G+ISKDMV+KGLP P +D+LI VCGP
Sbjct  213   ILLKKELDRLASSYPNFKVFYTVDKPSSDWRGGVGYISKDMVLKGLPGPGEDSLILVCGP  272

Query  908   PGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             PGMM H+SG+K K   QGE++G+LK++GYT +MVYKF
Sbjct  273   PGMMNHISGDKAKDYSQGEVTGLLKDLGYTADMVYKF  309



>ref|XP_003569450.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Brachypodium 
distachyon]
Length=311

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 195/277 (70%), Positives = 246/277 (89%), Gaps = 2/277 (1%)
 Frame = +2

Query  188   SSPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
             S P + +L++  E+ + + ALNP +W+EFKL+++A VSH++ LFRFSFDPS KLGLD+AS
Sbjct  36    SPPTVAHLEEKGEEAAARVALNPEKWLEFKLQEKATVSHDSQLFRFSFDPSTKLGLDVAS  95

Query  368   CIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDK  547
             C++TRAPIGQ+  EG+ KYVIRPYTPISDPD+KGHFDLLIKVYP+G+MSQ+FA+LKPGD 
Sbjct  96    CLVTRAPIGQE-VEGRKKYVIRPYTPISDPDSKGHFDLLIKVYPDGQMSQYFANLKPGDV  154

Query  548   VEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPdd  727
             VEVKGPI+KL+Y PNMK+ IGMIAGG+GITPMLQV+ AILKNPDDNTQ+SL+YANVSPDD
Sbjct  155   VEVKGPIEKLRYSPNMKRQIGMIAGGTGITPMLQVVRAILKNPDDNTQVSLIYANVSPDD  214

Query  728   illkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGP  907
             ILLK++LD LA+++PN KVFYTVD P+ +WRGG+G+ISKDMV+KGLP P +D+LI VCGP
Sbjct  215   ILLKRELDRLASSYPNFKVFYTVDKPSSDWRGGAGYISKDMVLKGLPGPGEDSLILVCGP  274

Query  908   PGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             PG+M H+SG+K K R QGE+SG+LK++GYT +MVYKF
Sbjct  275   PGLMNHISGDKAKDRSQGEVSGLLKDLGYTADMVYKF  311



>ref|NP_001042163.1| Os01g0174300 [Oryza sativa Japonica Group]
 dbj|BAD68119.1| putative cytochrome b5 reductase [Oryza sativa Japonica Group]
 dbj|BAF04077.1| Os01g0174300 [Oryza sativa Japonica Group]
 gb|EEE53961.1| hypothetical protein OsJ_00570 [Oryza sativa Japonica Group]
Length=311

 Score =   410 bits (1054),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 198/277 (71%), Positives = 242/277 (87%), Gaps = 2/277 (1%)
 Frame = +2

Query  188   SSPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
             S P +  +++  ED + K ALNP++W+EFKL+++A VSHN+ LFRFSFDPS KLGLD+AS
Sbjct  36    SPPTIALMEEKGEDAAAKVALNPDKWLEFKLQEKATVSHNSQLFRFSFDPSTKLGLDVAS  95

Query  368   CIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDK  547
             C+ITRAPIG++  EG  K+VIRPYTPISDPD+KG+FDLLIKVYP+GKMSQ+FASLKPGD 
Sbjct  96    CLITRAPIGEE-VEGGRKFVIRPYTPISDPDSKGYFDLLIKVYPDGKMSQYFASLKPGDV  154

Query  548   VEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPdd  727
             VEVKGPI+KL+Y PNMKK IGMIAGG+GITPMLQV+ AILKNPDDNTQ+SL+YANVSPDD
Sbjct  155   VEVKGPIEKLRYSPNMKKQIGMIAGGTGITPMLQVVRAILKNPDDNTQVSLIYANVSPDD  214

Query  728   illkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGP  907
             ILLK++LD LA+++PN KVFYTVD P+ +WRGG G+ISKD+ +KGLP P +D+LI VCGP
Sbjct  215   ILLKRELDRLASSYPNFKVFYTVDKPSNDWRGGVGYISKDIALKGLPRPGEDSLILVCGP  274

Query  908   PGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             PGMM H+SG+K K R QGEL+G+LKE+GYT  MVYKF
Sbjct  275   PGMMNHISGDKAKDRSQGELTGILKELGYTAEMVYKF  311



>ref|XP_009380415.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Musa acuminata 
subsp. malaccensis]
Length=331

 Score =   409 bits (1051),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 198/277 (71%), Positives = 246/277 (89%), Gaps = 2/277 (1%)
 Frame = +2

Query  188   SSPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
             SSP +  LD   +++  K AL+P +W+EFKL++ A VSHNT LFRFSFDP+AKLGLD+AS
Sbjct  56    SSPTVAQLDPKIDESIIKVALDPEKWLEFKLQETARVSHNTQLFRFSFDPTAKLGLDVAS  115

Query  368   CIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDK  547
             CI+TRAP+G++ +EG+ KYVIRPYTPISDPD+KG+FDLLIKVYP+G+MSQHFA+L+PGD 
Sbjct  116   CILTRAPVGEE-SEGRRKYVIRPYTPISDPDSKGYFDLLIKVYPDGQMSQHFATLQPGDV  174

Query  548   VEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPdd  727
             VEVKGPI+KL+Y PNMKK+IGMIAGG+GITPMLQVI+AILKNPDDNTQ+SL+YAN+SPDD
Sbjct  175   VEVKGPIEKLRYSPNMKKNIGMIAGGTGITPMLQVIKAILKNPDDNTQVSLIYANISPDD  234

Query  728   illkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGP  907
             ILLK +LD L+ ++PN KVFYTVD P+K WRGG+G++SKDMV+KGLP P ++TLI VCGP
Sbjct  235   ILLKGELDRLSTSYPNFKVFYTVDKPSKTWRGGTGYVSKDMVLKGLPSPGEETLILVCGP  294

Query  908   PGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             PGMM H+SG+K K R QGEL+G+LKE+GY+E MVYKF
Sbjct  295   PGMMKHISGDKAKDRSQGELTGILKELGYSEEMVYKF  331



>gb|EMT04682.1| NADH-cytochrome b5 reductase-like protein [Aegilops tauschii]
Length=269

 Score =   406 bits (1044),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 195/270 (72%), Positives = 241/270 (89%), Gaps = 2/270 (1%)
 Frame = +2

Query  209   LDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAP  388
             +++  ED + K ALNP +W+EFKL+++A VSH++ LFRFSFDPS KLGLD+ASC++TRAP
Sbjct  1     MEEKGEDAAAKVALNPEKWLEFKLQEKATVSHDSELFRFSFDPSTKLGLDVASCLVTRAP  60

Query  389   IGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPI  568
             IGQ+  EGK KYVIRPYTPISDPD+KG+FDLLIKVYPEGKMSQHFA+LKPGD +EVKGPI
Sbjct  61    IGQE-VEGKRKYVIRPYTPISDPDSKGYFDLLIKVYPEGKMSQHFANLKPGDVLEVKGPI  119

Query  569   QKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkl  748
             +KL+Y PNMK+ IGM+AGG+GITPMLQV+ AILKNPDDNTQ+SL+YANVSPDDILLKK+L
Sbjct  120   EKLRYSPNMKRQIGMVAGGTGITPMLQVVRAILKNPDDNTQVSLIYANVSPDDILLKKEL  179

Query  749   dVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHV  928
             D LA+++PN KVFYTVD P+ +WRGG+G+ISKDMV+KGLP P +D+LI VCGPPGMM H+
Sbjct  180   DRLASSYPNFKVFYTVDKPSSDWRGGAGYISKDMVLKGLPGPGEDSLILVCGPPGMMNHI  239

Query  929   SGEKDKR-EQGELSGVLKEVGYTENMVYKF  1015
             SG+K K   QGE++G+LK++GYT +MVYKF
Sbjct  240   SGDKAKDYSQGEVTGLLKDLGYTADMVYKF  269



>ref|XP_008792068.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Phoenix 
dactylifera]
Length=328

 Score =   407 bits (1046),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 217/329 (66%), Positives = 271/329 (82%), Gaps = 3/329 (1%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNL-VYL  211
             M+ L +RL++ + +    A + E     +G R PFGA AA++ G + + + SSP +   L
Sbjct  1     MAHLLRRLSRVSALGLGNALKEEPNWKSSGRRLPFGAAAAISSGIAVYCFCSSPTVQAQL  60

Query  212   DQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPI  391
             +  ++D + K AL+P +W+EFKL++ A VSHNT LFRFSFDP+AKLGLDIASCI+TRAPI
Sbjct  61    EPKSDDPAGKVALDPEKWLEFKLQETARVSHNTQLFRFSFDPAAKLGLDIASCILTRAPI  120

Query  392   GQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQ  571
              ++ +EG+ KYVIRPYTPISDPD+KG+FDLLIKVYP+GKMSQH ASLKPGD VEVKGPI+
Sbjct  121   AEE-SEGRRKYVIRPYTPISDPDSKGYFDLLIKVYPDGKMSQHLASLKPGDVVEVKGPIE  179

Query  572   KLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkld  751
             KL+Y PNMKK IGMIAGG+GITPMLQVI+AILKNPDDNTQ+SLLYAN+SPDDILLK++LD
Sbjct  180   KLRYSPNMKKKIGMIAGGTGITPMLQVIKAILKNPDDNTQVSLLYANISPDDILLKRELD  239

Query  752   VLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVS  931
              L+ ++PN KVFYTVD P+  W GG+G+ISKDM+ KGLP P++D+LI VCGPPGMM H+S
Sbjct  240   RLSVSYPNFKVFYTVDKPSSNWIGGAGYISKDMIAKGLPGPAEDSLILVCGPPGMMKHIS  299

Query  932   GEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             G+K K R QGEL+G+LKEVGYTE MVYKF
Sbjct  300   GDKAKDRSQGELTGLLKEVGYTEQMVYKF  328



>gb|EYU29785.1| hypothetical protein MIMGU_mgv1a010756mg [Erythranthe guttata]
Length=302

 Score =   404 bits (1037),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 224/329 (68%), Positives = 259/329 (79%), Gaps = 29/329 (9%)
 Frame = +2

Query  35    MSLLFKRLAKAA-PIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYL  211
             M++  KRLAKAA PIAF     G++KS            A   G  SY+ + SS +LVYL
Sbjct  1     MAVFLKRLAKAAAPIAFG----GQTKS--GSPIRFGALAAISGGITSYYLFSSSHDLVYL  54

Query  212   DQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPI  391
             DQ+NEDT+ K ALNP++WIEFKL+D+   SHN+ LFR                    AP 
Sbjct  55    DQLNEDTTPKVALNPDKWIEFKLQDKVQASHNSQLFR--------------------APT  94

Query  392   GQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQ  571
             GQ +AEGK KY IRPYTPISDPDAKG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+
Sbjct  95    GQ-NAEGKTKYAIRPYTPISDPDAKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIE  153

Query  572   KLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkld  751
             KL+Y  NMKKHIGMIAGG+GITPMLQ+I++ILKNPDDNTQ+SLLYANVSPDDILLKKKLD
Sbjct  154   KLRYSANMKKHIGMIAGGTGITPMLQIIDSILKNPDDNTQVSLLYANVSPDDILLKKKLD  213

Query  752   VLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVS  931
             +L+A++PNLKVFYTVD+PTK+W GG GFISK MVVKGLP PSDDTLI VCGPPGMM H+S
Sbjct  214   MLSASNPNLKVFYTVDNPTKDWLGGRGFISKQMVVKGLPVPSDDTLILVCGPPGMMNHIS  273

Query  932   GEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             G+K K R QGEL+G+LKE+GYTE+MVYKF
Sbjct  274   GDKAKDRSQGELTGILKELGYTEDMVYKF  302



>emb|CDX88861.1| BnaA03g07880D [Brassica napus]
Length=1405

 Score =   432 bits (1111),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 231/326 (71%), Positives = 272/326 (83%), Gaps = 3/326 (1%)
 Frame = +2

Query  44    LFKRLAKAAPIA-FSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQI  220
              F+RLA++APIA F  A R + KS    FRF  GA AA++GG S +Y  S  NL YLDQ 
Sbjct  1081  FFRRLARSAPIAAFPAALRSQIKSGHGTFRFSAGAIAALSGGFSCYYLTSGNNLAYLDQA  1140

Query  221   NEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQ  400
              E+T  KTALNP++W+EFKL+D A VSHNT LFRFSFDPSA LGL +ASC++TRAP+G  
Sbjct  1141  KEETGLKTALNPDKWLEFKLQDTATVSHNTKLFRFSFDPSANLGLHVASCLLTRAPLGY-  1199

Query  401   DAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQ  580
             +AEGK KYV+RPYTPISDP+AKG+FDLLIKVYP+GKMSQHFASLKPGD +EVKGPI+K +
Sbjct  1200  NAEGKTKYVVRPYTPISDPEAKGYFDLLIKVYPDGKMSQHFASLKPGDVLEVKGPIEKFK  1259

Query  581   YRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLA  760
             Y PNMKKHIGMIAGGSGITPMLQVI+ I+KNP+DNT+I+LLYANVSPDDILLK+KLD L 
Sbjct  1260  YSPNMKKHIGMIAGGSGITPMLQVIDTIVKNPEDNTKITLLYANVSPDDILLKQKLDSLQ  1319

Query  761   ATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEK  940
             A HPNLKVFYTVD+PTK W+GG G++SKDM +KGLP P+DDTLI VCGPPGMM HVSG K
Sbjct  1320  ANHPNLKVFYTVDNPTKNWKGGVGYVSKDMALKGLPLPADDTLILVCGPPGMMEHVSGGK  1379

Query  941   D-KREQGELSGVLKEVGYTENMVYKF  1015
                  QGE+ G+LKE+G+TE MV+KF
Sbjct  1380  APDWSQGEVKGILKELGFTEQMVFKF  1405



>ref|XP_004968383.1| PREDICTED: NADH-cytochrome b5 reductase-like protein-like [Setaria 
italica]
Length=311

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 199/277 (72%), Positives = 245/277 (88%), Gaps = 2/277 (1%)
 Frame = +2

Query  188   SSPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
             S P + ++++  E+ + K ALNP++W+EFKL+++A VSHN+ LFRFSFDP+ KLGLD+AS
Sbjct  36    SPPAVAHMEEKGEEAAEKAALNPDKWLEFKLQEKANVSHNSQLFRFSFDPNTKLGLDVAS  95

Query  368   CIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDK  547
             C+ITRAPIG++  EG+ K+VIRPYTPISDPD+KG+FDLLIKVYP+GKMSQ+FASLKPGD 
Sbjct  96    CLITRAPIGEE-VEGRRKFVIRPYTPISDPDSKGYFDLLIKVYPDGKMSQYFASLKPGDV  154

Query  548   VEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPdd  727
             VEVKGPI+KL+Y PNMKK IGMIAGG+GITPMLQV+ AILKNPDDNTQ+SL+YANVSPDD
Sbjct  155   VEVKGPIEKLRYSPNMKKQIGMIAGGTGITPMLQVVRAILKNPDDNTQVSLIYANVSPDD  214

Query  728   illkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGP  907
             ILLK++LD LA+++PN KVFYTVD P+ +WRGG GFISKDMV+KGLP P +D+LI VCGP
Sbjct  215   ILLKRELDRLASSYPNFKVFYTVDKPSNDWRGGVGFISKDMVLKGLPGPGEDSLILVCGP  274

Query  908   PGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             PGMM H+SG+K K R QGELSG+LK++GYT  MVYKF
Sbjct  275   PGMMNHISGDKAKDRSQGELSGLLKDLGYTAEMVYKF  311



>ref|XP_009768340.1| PREDICTED: NADH-cytochrome b5 reductase-like protein, partial 
[Nicotiana sylvestris]
Length=241

 Score =   397 bits (1019),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 201/233 (86%), Positives = 223/233 (96%), Gaps = 2/233 (1%)
 Frame = +2

Query  320   RFSFDPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYP  499
             RFSFDPS+KLGLDIASCI+TRAP+G+ +AEGKPKYVIRPYTPISDPD+KG+FDLLIKVYP
Sbjct  10    RFSFDPSSKLGLDIASCILTRAPMGE-NAEGKPKYVIRPYTPISDPDSKGYFDLLIKVYP  68

Query  500   EGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPD  679
             EGKMSQHFASLKPGD +EVKGPI+KL+Y PNMKKHIGMIA GSGITPMLQVIEAILKNPD
Sbjct  69    EGKMSQHFASLKPGDVLEVKGPIEKLRYSPNMKKHIGMIAAGSGITPMLQVIEAILKNPD  128

Query  680   DNTQISLLYANVSPddillkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVK  859
             D+TQ+SL+YANVSPDDILLKKKLDVLAATHPNLKVFYTVDSPT +WRGG G++SKDM+VK
Sbjct  129   DHTQVSLIYANVSPDDILLKKKLDVLAATHPNLKVFYTVDSPTNDWRGGIGYVSKDMIVK  188

Query  860   GLPPPSDDTLIFVCGPPGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             GLPPPSDDTLI VCGPPGMM H+SGEK K REQGEL+G+LK+VG+TENMVYKF
Sbjct  189   GLPPPSDDTLILVCGPPGMMKHLSGEKPKPREQGELTGLLKDVGFTENMVYKF  241



>gb|EMS59096.1| NADH-cytochrome b5 reductase-like protein [Triticum urartu]
Length=306

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/307 (64%), Positives = 239/307 (78%), Gaps = 39/307 (13%)
 Frame = +2

Query  209   LDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLF---------RFSFDPSAKLGLDI  361
             +++  ED + K ALNP +W+EFKL+++A VSH++ LF         RFSFDPS KLGLD+
Sbjct  1     MEEKGEDAAAKVALNPEKWLEFKLQEKATVSHDSELFSLMQAILPGRFSFDPSTKLGLDV  60

Query  362   ASCIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPG  541
             ASC++TRAPIGQ+  EGK KYVIRPYTPISDPD+KG+FDLLIKVYPEGKMSQHFA+LKPG
Sbjct  61    ASCLVTRAPIGQE-VEGKRKYVIRPYTPISDPDSKGYFDLLIKVYPEGKMSQHFANLKPG  119

Query  542   DKVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSP  721
             D +EVKGPI+KL+Y PNMK+ IGM+AGG+GITPMLQV+ AILKNPDDNTQ+SL+YANVSP
Sbjct  120   DVLEVKGPIEKLRYSPNMKRQIGMVAGGTGITPMLQVVRAILKNPDDNTQVSLIYANVSP  179

Query  722   ddillkkkldVLAATHPNLK----------------------------VFYTVDSPTKEW  817
             DDILLKK+LD LA+++PN K                            VFYTVD P+ +W
Sbjct  180   DDILLKKELDRLASSYPNFKVSFGELLGLLNCHMGEVTAKHDIFATFQVFYTVDKPSSDW  239

Query  818   RGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDK-REQGELSGVLKEVGYT  994
             RGG G+ISKDMV+KGLP P +D+LI VCGPPGMM H+SG K K   QGE++G+LK++GYT
Sbjct  240   RGGVGYISKDMVLKGLPGPGEDSLILVCGPPGMMNHISGNKAKDYSQGEVTGLLKDLGYT  299

Query  995   ENMVYKF  1015
              +MVYKF
Sbjct  300   ADMVYKF  306



>ref|XP_009626072.1| PREDICTED: NADH-cytochrome b5 reductase-like protein [Nicotiana 
tomentosiformis]
Length=311

 Score =   363 bits (931),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/275 (67%), Positives = 216/275 (79%), Gaps = 21/275 (8%)
 Frame = +2

Query  194   PNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCI  373
             P+LVYL+QINED+ +K ALNP++WIEFKL+DRAPVSHN+HLFRFSFDPS+KLGLDIASCI
Sbjct  57    PHLVYLEQINEDSGQKVALNPDKWIEFKLQDRAPVSHNSHLFRFSFDPSSKLGLDIASCI  116

Query  374   ITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVE  553
             +TRAP+G+ +AEGKPKYVIRPYTPISDPD+KG+FDLLIKVYPEGKMSQHFASLKPGD +E
Sbjct  117   LTRAPMGE-NAEGKPKYVIRPYTPISDPDSKGYFDLLIKVYPEGKMSQHFASLKPGDVLE  175

Query  554   VKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddil  733
             VKGPI+KL+Y PNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQ+ LL  + S     
Sbjct  176   VKGPIEKLRYSPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQVCLLIQSFSAS---  232

Query  734   lkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPG  913
                     + +     V++ V +    +     F+           P     + VCGPPG
Sbjct  233   --------STSQYARGVYHFVLTKXNLFCSDIRFMWNH--------PKLSVCVQVCGPPG  276

Query  914   MMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             MM H+SGEK K REQGEL+G+LK+VG+TENMVYKF
Sbjct  277   MMKHLSGEKPKPREQGELTGLLKDVGFTENMVYKF  311



>gb|AAK69398.1|AF274589_1 cytochrome b5 reductase PP36 [Cucurbita maxima]
Length=327

 Score =   351 bits (901),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 195/328 (59%), Positives = 248/328 (76%), Gaps = 2/328 (1%)
 Frame = +2

Query  35    MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
             M+   +RLA AAP     A  G+S+   + FRFP G   AV  G SY +Y S+ NLV+L 
Sbjct  1     MAAFLRRLATAAPALRYNALCGQSRIESSKFRFPIGTITAVTAGFSYMFYASTSNLVHLA  60

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
                E+  +K AL P++WIEF+L+D A VSHNT+L+RFSFDPS   G  +    +    + 
Sbjct  61    PNCEEDGQKVALKPDKWIEFELQDVARVSHNTNLYRFSFDPSENWGWMLLHASLQELQLI  120

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             + +  G+ KYV R YTPISDP+AKG+FDLLIK+YP+GKM+QHFA LKPGDK+EVKGPI+K
Sbjct  121   KTN-RGEVKYVARSYTPISDPEAKGYFDLLIKIYPQGKMTQHFAKLKPGDKLEVKGPIRK  179

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
             L+Y PNMKKHIGMIAGG+GITPMLQVI+AI KN DD TQ+SL++ANVS DDILLK+KLD 
Sbjct  180   LKYSPNMKKHIGMIAGGTGITPMLQVIDAIAKNQDDITQVSLIFANVSADDILLKEKLDK  239

Query  755   LAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             LAA HPN+KVFYTV +P + W+GG G +SKDM++K LP P +D LI VCGPPGMM H+ G
Sbjct  240   LAACHPNIKVFYTVSNPPRGWKGGKGHVSKDMIIKCLPSPGNDALILVCGPPGMMKHICG  299

Query  935   EKDKR-EQGELSGVLKEVGYTENMVYKF  1015
              K+K   QGEL G+LK++GY+++MV+KF
Sbjct  300   PKNKDFTQGELGGLLKDLGYSKDMVFKF  327



>ref|XP_001754409.1| predicted protein [Physcomitrella patens]
 gb|EDQ80859.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   343 bits (881),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 167/259 (64%), Positives = 211/259 (81%), Gaps = 2/259 (1%)
 Frame = +2

Query  242   TALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQDAEGKPK  421
             TALNP ++++FK+ +   V+HNT L+RF+FD    LGL +ASC+IT+A IG++  +G P 
Sbjct  6     TALNPKEFVKFKVSEVRDVNHNTKLYRFTFDSQEALGLHVASCLITKAEIGKK-KDGSPN  64

Query  422   YVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKK  601
             YVIRPYTPIS PD+KG+FDLL+K+YP GKM+QH A LKPGD ++VKGPI KL Y PNMKK
Sbjct  65    YVIRPYTPISPPDSKGYFDLLVKIYPNGKMTQHLAQLKPGDTLDVKGPIPKLPYAPNMKK  124

Query  602   HIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPNLK  781
              IGMIAGG+GITPMLQVI+AI+ NP+DNTQ+SL++AN +P DILLK KLD L+  HPN K
Sbjct  125   QIGMIAGGTGITPMLQVIDAIVSNPEDNTQVSLVFANTTPADILLKSKLDALSFAHPNFK  184

Query  782   VFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKD-KREQG  958
             V+Y VDSPT +W+GG G+I+KD+++KGLP PSDDTLI VCGPPG+M  +SG+K   R QG
Sbjct  185   VYYVVDSPTNDWKGGKGYINKDVLLKGLPSPSDDTLILVCGPPGLMNLISGDKAPDRSQG  244

Query  959   ELSGVLKEVGYTENMVYKF  1015
             EL G+LKE+GYT   VYKF
Sbjct  245   ELVGLLKELGYTSEQVYKF  263



>gb|KGN60665.1| hypothetical protein Csa_2G006110 [Cucumis sativus]
Length=285

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 193/213 (91%), Gaps = 2/213 (1%)
 Frame = +2

Query  380   RAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVK  559
             RAPIGQ D EGK KYV+RPYTPISDPDAKG+FDLLIKVYP+GKMSQHFA+LKPGD +EVK
Sbjct  74    RAPIGQDD-EGKAKYVVRPYTPISDPDAKGYFDLLIKVYPQGKMSQHFATLKPGDVLEVK  132

Query  560   GPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillk  739
             GPI+KL+Y PNMKKHIGMIAGG+GITPMLQVI+AI+KNPDDNTQ+SLLY NVSPDDILLK
Sbjct  133   GPIEKLKYSPNMKKHIGMIAGGTGITPMLQVIDAIVKNPDDNTQVSLLYGNVSPDDILLK  192

Query  740   kkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMM  919
             +KLD+LA++HPN+KVFYTVD PTK W+GG G++SKDMV+KGLPPP DD LI VCGPPGMM
Sbjct  193   QKLDILASSHPNIKVFYTVDKPTKNWKGGKGYVSKDMVIKGLPPPGDDALILVCGPPGMM  252

Query  920   THVSGEKD-KREQGELSGVLKEVGYTENMVYKF  1015
              H+SG+K     QGEL G+LKE+GYT+ MVYKF
Sbjct  253   KHISGDKAPDYSQGELDGMLKELGYTKEMVYKF  285



>gb|AHI85717.1| stress-induced protein 12, partial [Capsicum annuum]
Length=285

 Score =   337 bits (865),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 178/263 (68%), Positives = 213/263 (81%), Gaps = 6/263 (2%)
 Frame = +2

Query  236   RKTALNPNQW--IEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQDAE  409
             +K ALNP++W  + +K+E +   +     FR     S+ L L +A     R    ++   
Sbjct  26    KKIALNPDKWMNLSWKIEHQLATTVICSGFRLILLQSSVLILHLA---FLRGHQWEKMLR  82

Query  410   GKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRP  589
                   IRPYTPISDP+AKG+FDLLIKVYPEGKMSQHFA LKPGD ++VKGPI+KL+Y P
Sbjct  83    ENQNNAIRPYTPISDPEAKGYFDLLIKVYPEGKMSQHFARLKPGDVLQVKGPIEKLRYSP  142

Query  590   NMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATH  769
             N+KKHIGMIAGGSGITPMLQVIEAILKNPDDNTQ+SL+YAN+SPDDILLKKKLDVLAATH
Sbjct  143   NLKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQVSLVYANLSPDDILLKKKLDVLAATH  202

Query  770   PNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEK-DK  946
             PNLKVFYTVD+PT +WRG  G++SKDM++KGLPPP DDTLI VCGPPGM+ H+SGEK + 
Sbjct  203   PNLKVFYTVDNPTNDWRGSIGYVSKDMIIKGLPPPGDDTLILVCGPPGMIKHLSGEKPNP  262

Query  947   REQGELSGVLKEVGYTENMVYKF  1015
             REQGEL+G+LK+VG+TENMVYKF
Sbjct  263   REQGELTGLLKDVGFTENMVYKF  285



>ref|XP_008337406.1| PREDICTED: LOW QUALITY PROTEIN: NADH-cytochrome b5 reductase-like 
protein [Malus domestica]
Length=252

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 183/221 (83%), Gaps = 4/221 (2%)
 Frame = +2

Query  35   MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
            M+  F+RL+KAAPIAFS +FRG+SKS+F        A +       Y+   SSP+L YLD
Sbjct  1    MATFFQRLSKAAPIAFSSSFRGQSKSSFRIPFGAVAAVSGGISYLXYY---SSPDLAYLD  57

Query  215  QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
            +  E    K ALNP++WIEFKL+D A VSHNT LFRF+FDP+ KLGLD+ASC+ITRAP+G
Sbjct  58   EDKEQAGPKVALNPDKWIEFKLQDTARVSHNTQLFRFTFDPTVKLGLDVASCLITRAPLG  117

Query  395  QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
            Q DAEGKPKYVIRPYTPISDPD+KG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+K
Sbjct  118  Q-DAEGKPKYVIRPYTPISDPDSKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEK  176

Query  575  LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQIS  697
            L+Y PNMKKHIGMIAGGSGITPMLQVIEAILKNPDD TQ+S
Sbjct  177  LRYTPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDTTQVS  217



>ref|XP_007013385.1| FAD/NAD(P)-binding oxidoreductase isoform 3 [Theobroma cacao]
 gb|EOY31004.1| FAD/NAD(P)-binding oxidoreductase isoform 3 [Theobroma cacao]
Length=242

 Score =   318 bits (815),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 194/228 (85%), Gaps = 3/228 (1%)
 Frame = +2

Query  38   SLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLDQ  217
            +  F+RLAKA P +F+ AF G+ K+      F F A AAVAGG S +YYFS  NLV+LDQ
Sbjct  3    TTFFRRLAKATPPSFTDAFGGQPKA--GFAGFRFSAIAAVAGGISSYYYFSESNLVHLDQ  60

Query  218  INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQ  397
            INE+T  K AL  ++WI FKL+D A VSHNT LFRFSFDP++KLGLD+ASCI+TRAP+GQ
Sbjct  61   INEETGPKVALKSDKWIGFKLQDTARVSHNTQLFRFSFDPTSKLGLDVASCILTRAPLGQ  120

Query  398  QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKL  577
             DAEGK KYVIRPYTPISDPDAKG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI+KL
Sbjct  121  -DAEGKTKYVIRPYTPISDPDAKGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKL  179

Query  578  QYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSP  721
            +Y PNMKKHIGMIAGG+GITPMLQVIEAILK PDDNTQ+SLLYANVSP
Sbjct  180  RYSPNMKKHIGMIAGGTGITPMLQVIEAILKKPDDNTQVSLLYANVSP  227



>gb|KCW79799.1| hypothetical protein EUGRSUZ_C011341, partial [Eucalyptus grandis]
Length=237

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 178/194 (92%), Gaps = 1/194 (1%)
 Frame = +2

Query  206  YLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRA  385
            +LDQ+ EDT  K ALNP++WIEFKL+D A VSHNT LFRFSFDP+ +LGL +ASCI+TRA
Sbjct  2    HLDQVGEDTGSKIALNPDKWIEFKLQDTARVSHNTQLFRFSFDPNVQLGLHVASCILTRA  61

Query  386  PIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGP  565
            P GQ DAEGK KYV+RPYTPISDPDAKG+FDLLIKVYPEGKMSQHFA LKPGD VEVKGP
Sbjct  62   PTGQ-DAEGKTKYVVRPYTPISDPDAKGYFDLLIKVYPEGKMSQHFAILKPGDVVEVKGP  120

Query  566  IQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkk  745
            I+K +Y PNMKK+IGMIAGG+GITPMLQVI+AILKNPDDNTQ+SLLYANVSPDDILLK+K
Sbjct  121  IEKFKYTPNMKKNIGMIAGGTGITPMLQVIDAILKNPDDNTQVSLLYANVSPDDILLKQK  180

Query  746  ldVLAATHPNLKVF  787
            LD+LAA+HPNLKV+
Sbjct  181  LDILAASHPNLKVY  194



>gb|KCW79800.1| hypothetical protein EUGRSUZ_C011341, partial [Eucalyptus grandis]
Length=231

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 178/194 (92%), Gaps = 1/194 (1%)
 Frame = +2

Query  206  YLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRA  385
            +LDQ+ EDT  K ALNP++WIEFKL+D A VSHNT LFRFSFDP+ +LGL +ASCI+TRA
Sbjct  2    HLDQVGEDTGSKIALNPDKWIEFKLQDTARVSHNTQLFRFSFDPNVQLGLHVASCILTRA  61

Query  386  PIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGP  565
            P GQ DAEGK KYV+RPYTPISDPDAKG+FDLLIKVYPEGKMSQHFA LKPGD VEVKGP
Sbjct  62   PTGQ-DAEGKTKYVVRPYTPISDPDAKGYFDLLIKVYPEGKMSQHFAILKPGDVVEVKGP  120

Query  566  IQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkk  745
            I+K +Y PNMKK+IGMIAGG+GITPMLQVI+AILKNPDDNTQ+SLLYANVSPDDILLK+K
Sbjct  121  IEKFKYTPNMKKNIGMIAGGTGITPMLQVIDAILKNPDDNTQVSLLYANVSPDDILLKQK  180

Query  746  ldVLAATHPNLKVF  787
            LD+LAA+HPNLKV+
Sbjct  181  LDILAASHPNLKVY  194



>ref|XP_004173389.1| PREDICTED: NADH-cytochrome b5 reductase-like protein-like, partial 
[Cucumis sativus]
Length=254

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 179/254 (70%), Positives = 210/254 (83%), Gaps = 2/254 (1%)
 Frame = +2

Query  35   MSLLFKRLAKAAPIAFSQAFRG-ESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYL  211
            M+   +RLA AAP     A  G +SK   + FRFP GA AA +GG SY YY S  +LV+L
Sbjct  1    MATFLRRLANAAPSLRYNALLGTQSKIHSSNFRFPIGAIAAASGGISYLYYVSYSDLVHL  60

Query  212  DQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPI  391
            DQ +E+ S K AL   +WIEFKL+D A V+HNTHLFRFSFDPS  LGL++ASCI TRAPI
Sbjct  61   DQSSEEASPKVALKSGKWIEFKLQDSARVTHNTHLFRFSFDPSETLGLNVASCIYTRAPI  120

Query  392  GQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQ  571
            GQ D EGK KYV+RPYTPISDPDAKG+FDLLIKVYP+GKMSQHFA+LKPGD +EVKGPI+
Sbjct  121  GQDD-EGKAKYVVRPYTPISDPDAKGYFDLLIKVYPQGKMSQHFATLKPGDVLEVKGPIE  179

Query  572  KLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkld  751
            KL+Y PNMKKHIGMIAGG+GITPMLQVI+AI+KNPDDNTQ+SLLY NVSPDDILLK+KLD
Sbjct  180  KLKYSPNMKKHIGMIAGGTGITPMLQVIDAIVKNPDDNTQVSLLYGNVSPDDILLKQKLD  239

Query  752  VLAATHPNLKVFYT  793
            +LA++HPN+KV + 
Sbjct  240  ILASSHPNIKVLFV  253



>ref|XP_005645756.1| cytochrome-b5 reductase like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21212.1| cytochrome-b5 reductase like protein [Coccomyxa subellipsoidea 
C-169]
Length=307

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/260 (58%), Positives = 196/260 (75%), Gaps = 3/260 (1%)
 Frame = +2

Query  245   ALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPK  421
             AL+PN+W  FK+  +  ++HNT   RF+  DP+   GL +ASC++TRAPIG +  +G  K
Sbjct  48    ALDPNEWRSFKVVSKDVITHNTSRLRFATPDPNQTSGLFVASCLLTRAPIGAKKEDGNQK  107

Query  422   YVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKK  601
             +VIRPYTP S PD KGHFDL++K YP+GKMS+H  +L  GD +E KGPI KL+Y+PNMKK
Sbjct  108   FVIRPYTPTSAPDQKGHFDLVVKGYPDGKMSKHIVNLNVGDSLECKGPISKLRYKPNMKK  167

Query  602   HIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPNLK  781
              IGMIAGG+GITPMLQV   +L+NPDD T++SL++ NVS DDILL+K++D +A  H N K
Sbjct  168   KIGMIAGGTGITPMLQVASEVLRNPDDKTEVSLVFGNVSEDDILLRKEIDEMAKKHSNFK  227

Query  782   VFYTVDSPTK-EWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEK-DKREQ  955
             V+Y VD PT   WRGG G+I++D V K LPPPSD +LI VCGPP +M  +SG+K + + Q
Sbjct  228   VYYVVDKPTSFFWRGGKGYITEDTVKKHLPPPSDVSLILVCGPPPLMKAISGDKAEDKSQ  287

Query  956   GELSGVLKEVGYTENMVYKF  1015
             GEL+G LK +GYT + VYKF
Sbjct  288   GELTGTLKSIGYTSDQVYKF  307



>ref|XP_002957125.1| hypothetical protein VOLCADRAFT_107549 [Volvox carteri f. nagariensis]
 gb|EFJ41779.1| hypothetical protein VOLCADRAFT_107549 [Volvox carteri f. nagariensis]
Length=311

 Score =   281 bits (720),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 145/264 (55%), Positives = 191/264 (72%), Gaps = 5/264 (2%)
 Frame = +2

Query  239   KTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQDAEGKP  418
             K AL+PN++  FKL+++  ++ NT L+RF        G+ +ASC++TRA +  +  + KP
Sbjct  48    KGALDPNEFRAFKLKEKRQLTRNTFLYRFELPEGQTSGIFVASCLVTRAMLKAKPEDEKP  107

Query  419   KYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMK  598
             K VIRPYTP S PDAKG+ DL++KVY +G MS+H  SLK GD +E+KGPI+K  Y  N K
Sbjct  108   KAVIRPYTPTSPPDAKGYLDLVVKVYDKGVMSKHIDSLKIGDSLEIKGPIKKYPYEANTK  167

Query  599   KHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-N  775
             KHIGM+AGG+GITPMLQVI+AIL NP+D TQ+SL+YANVS  DI+L+ K+D LAA HP  
Sbjct  168   KHIGMVAGGTGITPMLQVIDAILDNPNDKTQVSLVYANVSESDIILQDKIDALAAQHPGR  227

Query  776   LKVFYTVDSPTKE---WRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKD-  943
              KV+Y VD P      WRGG G+++KDM+ K LP P+ D+L+ VCGPPGMM  VSG K  
Sbjct  228   FKVYYVVDKPAWGGLFWRGGVGYLTKDMLSKHLPAPAKDSLVMVCGPPGMMEAVSGNKAP  287

Query  944   KREQGELSGVLKEVGYTENMVYKF  1015
                QGE+ G+LKE+GY  + V+KF
Sbjct  288   DYSQGEVKGLLKELGYDSSSVFKF  311



>ref|XP_006400575.1| hypothetical protein EUTSA_v100141990mg, partial [Eutrema salsugineum]
 gb|ESQ42028.1| hypothetical protein EUTSA_v100141990mg, partial [Eutrema salsugineum]
Length=176

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 156/176 (89%), Gaps = 1/176 (1%)
 Frame = +2

Query  491   VYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILK  670
             VYP+GKMSQHFASLKPGD +EVKGPI+K +Y PNMKKHIGMIAGGSGITPMLQVI+A++K
Sbjct  1     VYPDGKMSQHFASLKPGDVLEVKGPIEKFKYSPNMKKHIGMIAGGSGITPMLQVIDAVMK  60

Query  671   NPDDNTQISLLYANVSPddillkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDM  850
             NP+DNTQI+LLYANVSPDDILLK+KLDVL A HPNLKVFYTVD+PTK W+GG G+ISKDM
Sbjct  61    NPEDNTQITLLYANVSPDDILLKQKLDVLQANHPNLKVFYTVDNPTKNWKGGVGYISKDM  120

Query  851   VVKGLPPPSDDTLIFVCGPPGMMTHVSGEKD-KREQGELSGVLKEVGYTENMVYKF  1015
              +KGLP P+DDTLI VCGP GMM H+SG K     QGE+ G+LKE+GYTE MV+KF
Sbjct  121   ALKGLPLPADDTLILVCGPSGMMEHISGGKAPDWSQGEVKGILKELGYTEQMVFKF  176



>tpg|DAA53221.1| TPA: hypothetical protein ZEAMMB73_223419, partial [Zea mays]
Length=246

 Score =   269 bits (688),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 153/170 (90%), Gaps = 2/170 (1%)
 Frame = +2

Query  188  SSPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
            SSP + +L++  +  + + ALNP++W+EFKL+++A VSHN+ LFRFSFDPS KLGLD+AS
Sbjct  37   SSPTVAHLEETGK-AAEQVALNPDKWLEFKLQEKATVSHNSQLFRFSFDPSTKLGLDVAS  95

Query  368  CIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDK  547
            C+ITRAPIG+ +AEG+ KYVIRPYTPISDPD+KG+FDLLIKVYP+GKMSQ+FASLKPGD 
Sbjct  96   CLITRAPIGE-EAEGRRKYVIRPYTPISDPDSKGYFDLLIKVYPDGKMSQYFASLKPGDV  154

Query  548  VEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQIS  697
            VEVKGPI+KL+Y PNMKK IGMIAGGSGITPMLQV+ AILKNP+DNTQ+S
Sbjct  155  VEVKGPIEKLRYNPNMKKQIGMIAGGSGITPMLQVVRAILKNPNDNTQVS  204



>gb|EAY72732.1| hypothetical protein OsI_00597 [Oryza sativa Indica Group]
Length=384

 Score =   263 bits (673),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 167/226 (74%), Gaps = 38/226 (17%)
 Frame = +2

Query  188  SSPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
            S P +  +++  ED + K ALNP++W+EFKL+++A VSHN+ LFR               
Sbjct  36   SPPTIALMEEKGEDAAAKVALNPDKWLEFKLQEKATVSHNSQLFR---------------  80

Query  368  CIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDK  547
                                   YTPISDPD+KG+FDLLIKVYP+GKMSQ+FASLKPGD 
Sbjct  81   -----------------------YTPISDPDSKGYFDLLIKVYPDGKMSQYFASLKPGDV  117

Query  548  VEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPdd  727
            VEVKGPI+KL+Y PNMKK IGMIAGG+GITPMLQV+ AILKNPDDNTQ+SL+YANVSPDD
Sbjct  118  VEVKGPIEKLRYSPNMKKQIGMIAGGTGITPMLQVVRAILKNPDDNTQVSLIYANVSPDD  177

Query  728  illkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGL  865
            ILLK++LD LA+++PN KVFYTVD P+ +WRGG G+ISKDM +KG+
Sbjct  178  ILLKRELDRLASSYPNFKVFYTVDKPSNDWRGGVGYISKDMALKGV  223



>ref|XP_005791288.1| putative cytochrome b5 reductase [Emiliania huxleyi CCMP1516]
 gb|EOD38859.1| putative cytochrome b5 reductase [Emiliania huxleyi CCMP1516]
Length=337

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 188/268 (70%), Gaps = 13/268 (5%)
 Frame = +2

Query  245   ALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPK  421
              L+P +W   +LE   P+SHNT ++RF+F D +A  G+ +ASC++T+A IG + A+G   
Sbjct  72    GLSPTEWRALRLESVTPLSHNTAVYRFAFEDETASSGMRVASCLLTKAAIGSEKADGSRA  131

Query  422   YVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKK  601
              VIRPYTPIS PDAKGH DL +K YP+GKMSQH ASLK GD +E+KGP+ KL Y+ N   
Sbjct  132   NVIRPYTPISRPDAKGHVDLAVKTYPDGKMSQHIASLKVGDTLEIKGPVVKLPYKLNEHA  191

Query  602   HIGMIAGGSGITPMLQVIEAILKNPD----DNTQISLLYANVSPddillkkkldVLAATH  769
              +GMIAGG+GI PMLQVI+ IL        DNT++SL++ANVS  DILLK+++D  AA +
Sbjct  192   KLGMIAGGTGIAPMLQVIDEILAGESAFGKDNTKVSLIFANVSEQDILLKEEVDRRAAAN  251

Query  770   PN-LKVFYTVDSPTK-EWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEK-  940
             P+ L+VFY VD  +  +W GG G+++K M+ + +PPP     +FVCGPP M+  V G K 
Sbjct  252   PSQLEVFYLVDKASSPDWSGGVGYVTKQMLAERMPPPGSSGRVFVCGPPPMV--VCGAKG  309

Query  941   ---DKREQGELSGVLKEVGYTENMVYKF  1015
                D + QGELSG+LKE+GY +  V+KF
Sbjct  310   TKEDPKAQGELSGMLKELGYAKEEVFKF  337



>ref|XP_002900838.1| NADH-cytochrome b5 reductase, putative [Phytophthora infestans 
T30-4]
 gb|EEY59645.1| NADH-cytochrome b5 reductase, putative [Phytophthora infestans 
T30-4]
Length=299

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/266 (46%), Positives = 180/266 (68%), Gaps = 9/266 (3%)
 Frame = +2

Query  224   EDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQ  400
             E+   K AL+P ++  F +     V++NT    F+   P  ++GL   SC++ RA +   
Sbjct  41    EEEKSKVALSPKEFRSFTVRKVETVNYNTKRVTFALPTPEHEMGLTTPSCLMARAKVDG-  99

Query  401   DAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQ  580
                   K V+RPYTP++  D KG  +L++K YP+GK+S+H   LK GD +++KGP  K  
Sbjct  100   ------KTVVRPYTPVNVNDEKGFLELVVKGYPQGKLSKHIVQLKEGDSLDMKGPFPKFN  153

Query  581   YRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLA  760
             Y PN  K IGMIAGGSGITPMLQ+I+AI +NP+D T+I+LLY +VS +DI+L+++++ + 
Sbjct  154   YYPNRYKSIGMIAGGSGITPMLQLIKAICRNPEDRTEITLLYCSVSEEDIILREEVEAMM  213

Query  761   ATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEK  940
               +P + V + + +P+ EW+G +GF+SK+M+ K +P PSDD L+ VCGPP MM HVSG+K
Sbjct  214   YLYPQISVIHVLSNPSAEWKGLTGFVSKEMIEKYMPEPSDDNLVCVCGPPPMMYHVSGDK  273

Query  941   DK-REQGELSGVLKEVGYTENMVYKF  1015
              K R QGEL G+LK++ YT   V+KF
Sbjct  274   AKDRSQGELQGLLKDMNYTSTQVFKF  299



>ref|XP_001754645.1| predicted protein [Physcomitrella patens]
 gb|EDQ80615.1| predicted protein [Physcomitrella patens]
Length=260

 Score =   241 bits (614),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 127/260 (49%), Positives = 175/260 (67%), Gaps = 4/260 (2%)
 Frame = +2

Query  242   TALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQDAEGKPK  421
              ALN   W+ F L +   V+HNT +FRF  DP A LGL   S I+ R  +   +  G+ +
Sbjct  3     VALNMKNWVNFTLLESHRVAHNTRIFRFELDPKASLGLQPISHILVRGEV--VNRRGRLE  60

Query  422   YVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKK  601
              + R Y P+SD  A G+FDLLIK+ P+G +SQ  A L PGD +E++GP+ +L Y+ NMK 
Sbjct  61    KITRSYVPVSDLGATGYFDLLIKILPDGMLSQRIARLNPGDSLEMRGPVVELPYKANMKT  120

Query  602   HIGMIAGGSGITPMLQVIEAILKNPDDNT-QISLLYANVSPddillkkkldVLAATHPNL  778
             H+GMIAG  GIT M+Q+I+AI+ NP+D T Q+SL+Y N SP+DILLK++LD L+  +PN 
Sbjct  121   HLGMIAGDIGITHMVQLIKAIVLNPNDYTQQVSLIYENESPEDILLKEELDKLSRAYPNF  180

Query  779   KVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDK-REQ  955
             KVFYTV+   +EW GG G I+ +M+ K LP PS +TL+ V GP   M  V G KD+ R  
Sbjct  181   KVFYTVNIAGREWEGGVGHITAEMIYKALPHPSPNTLVLVAGPSTFMDRVCGRKDQERYS  240

Query  956   GELSGVLKEVGYTENMVYKF  1015
             G++ G+LK++GY +  VYKF
Sbjct  241   GQVLGLLKQLGYKKEHVYKF  260



>ref|XP_009521628.1| hypothetical protein PHYSODRAFT_297652 [Phytophthora sojae]
 gb|EGZ26340.1| hypothetical protein PHYSODRAFT_297652 [Phytophthora sojae]
Length=300

 Score =   239 bits (611),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 183/271 (68%), Gaps = 13/271 (5%)
 Frame = +2

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFD---PSAKLGLDIASCIITRA  385
             Q  E    K AL+P ++  F +     V+HNT   R +FD   P  ++G+   SC++ RA
Sbjct  39    QCEEAQQPKVALSPEEFRSFTVRKVEDVNHNTK--RVTFDLPSPHHEMGITTPSCLVARA  96

Query  386   PIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGP  565
                  + +GK   V+RPYTP +  + KG  +L++K YP+GK+S+H   LK GD +++KGP
Sbjct  97    -----EVDGKT--VVRPYTPTNVNEEKGFLELVVKGYPQGKLSKHIVELKEGDSLDMKGP  149

Query  566   IQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkk  745
               K+ Y PN  K IGMIAGGSGITPMLQ+I+ I +NP+D T+I+LLY +VS +DI+L+++
Sbjct  150   FPKISYYPNRYKSIGMIAGGSGITPMLQLIKTICRNPEDRTEITLLYCSVSEEDIILREE  209

Query  746   ldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTH  925
             ++ +   +P + V + + +P+ +W+G +GF+SK+MV K +P PSDD L+ VCGPP MM H
Sbjct  210   VEAMMYLYPQIAVVHVLSNPSDQWKGLTGFVSKEMVEKYMPEPSDDNLVCVCGPPPMMYH  269

Query  926   VSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             VSG+K K + QGEL G+LKE+ YT   V+KF
Sbjct  270   VSGDKAKDKSQGELQGLLKELNYTSTQVFKF  300



>gb|AFK47499.1| unknown [Medicago truncatula]
Length=202

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 159/200 (80%), Gaps = 7/200 (4%)
 Frame = +2

Query  35   MSLLFKRLAKAAPIAFSQAFRGESKSTfagfrfpfgafaavaggasyfyyfSSPNLVYLD  214
            M+   +R+A++ PI F       SKS+ + F  P  A AA++GG SY YY SSPNLV+ D
Sbjct  1    MAAFLRRVARSTPIGFG----AHSKSSRSNFHLPLTAIAAISGGFSYLYYSSSPNLVHSD  56

Query  215  QINED--TSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAP  388
            QI ++   ++  AL P++W+EFKL+D A VSH+THL+RFSFDP+ KLGLD+ASCI+TRAP
Sbjct  57   QIGDEDIKTKNIALIPDKWVEFKLQDTARVSHDTHLYRFSFDPTKKLGLDVASCILTRAP  116

Query  389  IGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPI  568
             GQ DA  KPKYVIRPYTPISD ++KG+FDLLIKVYPEGKMSQHFASLKPGD VEVKGPI
Sbjct  117  FGQ-DAGEKPKYVIRPYTPISDTESKGYFDLLIKVYPEGKMSQHFASLKPGDMVEVKGPI  175

Query  569  QKLQYRPNMKKHIGMIAGGS  628
            +K +Y PNMKK+IGMIAGGS
Sbjct  176  EKFKYTPNMKKNIGMIAGGS  195



>emb|CDS07838.1| hypothetical protein LRAMOSA01787 [Absidia idahoensis var. thermophila]
Length=333

 Score =   238 bits (608),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 186/264 (70%), Gaps = 10/264 (4%)
 Frame = +2

Query  245   ALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAK--LGLDIASCIITRAPIGQQDAEGKP  418
             A +  Q+  FKLE   P++HNT ++RFS  PS K    L +ASC+ITR PI ++D  G P
Sbjct  73    AFDGKQFKAFKLEKVEPINHNTAVYRFSL-PSEKQRAELPVASCLITRYPITKKD--GSP  129

Query  419   KYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMK  598
              ++IRPYTP S  +A+G+FDL++K YP+GKMS+H A+LK GD +E+KGPI K  +  N  
Sbjct  130   GFIIRPYTPTSPEEAEGYFDLIVKEYPQGKMSKHIANLKVGDTLEMKGPIPKYNWEENKV  189

Query  599   KHIGMIAGGSGITPMLQVIEAIL--KNPDDNTQISLLYANVSPddillkkkldVLAATHP  772
             +++GMIAGG+GITPMLQ+I  +   K+ D  T+++L++AN + +DILLK++LD  A  HP
Sbjct  190   ENVGMIAGGTGITPMLQIIRKVFDKKSSDKTTKVTLVFANQTEEDILLKEELDTYAKEHP  249

Query  773   N-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSD-DTLIFVCGPPGMMTHVSGEKDK  946
             +  KV Y +D P K+W+G  GF++ + + K LP P D +  IF+CGP  M+  +SG K K
Sbjct  250   DRFKVVYALDRPPKDWQGLQGFVNAEAIKKYLPSPEDKNAKIFICGPDPMLASISGPKAK  309

Query  947   -REQGELSGVLKEVGYTENMVYKF  1015
              + QGE+SG+LKE+GY E+ VYKF
Sbjct  310   DKSQGEVSGILKELGYNESNVYKF  333



>gb|ETI36282.1| hypothetical protein F443_17558, partial [Phytophthora parasitica 
P1569]
Length=316

 Score =   238 bits (606),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/269 (44%), Positives = 178/269 (66%), Gaps = 9/269 (3%)
 Frame = +2

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPI  391
                E+   K AL+P ++  F +     V+HNT    F+   P  ++G+   SC++ RA +
Sbjct  55    HCEEEQQPKVALSPKEFRSFTVRKVETVNHNTKRVTFALPTPEHEMGITTPSCLMARAKV  114

Query  392   GQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQ  571
                      K V+RPYTP +  + KG  +L++K YP+GK+S+H   LK GD +++KGP  
Sbjct  115   DG-------KTVVRPYTPTNVNEEKGFLELVVKGYPQGKLSKHIVELKEGDSLDMKGPFP  167

Query  572   KLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkld  751
             K  Y PN  K IGMIAGGSGITPMLQ+I+ I +NP+D T+I+LLY +VS +DI+L+++++
Sbjct  168   KFSYYPNRYKSIGMIAGGSGITPMLQLIKTICRNPEDRTEITLLYCSVSEEDIILREEVE  227

Query  752   VLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVS  931
              +   +P + V + + +P+ EW+G +GF+SK+MV K +P PSDD L+ VCGPP MM H+S
Sbjct  228   AMMYLYPQISVIHVLSNPSAEWKGLTGFVSKEMVEKYMPGPSDDNLVCVCGPPPMMYHIS  287

Query  932   GEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             G+K K + QGE+ G+LKE+ YT   V+KF
Sbjct  288   GDKAKDKSQGEVQGLLKELNYTSTQVFKF  316



>ref|XP_008896046.1| hypothetical protein PPTG_03992, partial [Phytophthora parasitica 
INRA-310]
 gb|ETN18365.1| hypothetical protein PPTG_03992, partial [Phytophthora parasitica 
INRA-310]
 gb|ETO65008.1| hypothetical protein F444_17600, partial [Phytophthora parasitica 
P1976]
Length=316

 Score =   237 bits (605),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/269 (44%), Positives = 178/269 (66%), Gaps = 9/269 (3%)
 Frame = +2

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPI  391
                E+   K AL+P ++  F +     V+HNT    F+   P  ++G+   SC++ RA +
Sbjct  55    HCEEEQQPKVALSPKEFRSFTVRKVETVNHNTKRVTFALPTPEHEMGITTPSCLMARAKV  114

Query  392   GQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQ  571
                      K V+RPYTP +  + KG  +L++K YP+GK+S+H   LK GD +++KGP  
Sbjct  115   DG-------KTVVRPYTPTNVNEEKGFLELVVKGYPQGKLSKHIVELKEGDSLDMKGPFP  167

Query  572   KLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkld  751
             K  Y PN  K IGMIAGGSGITPMLQ+I+ I +NP+D T+I+LLY +VS +DI+L+++++
Sbjct  168   KFSYYPNRYKSIGMIAGGSGITPMLQLIKTICRNPEDRTEITLLYCSVSEEDIILREEVE  227

Query  752   VLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVS  931
              +   +P + V + + +P+ EW+G +GF+SK+MV K +P PSDD L+ VCGPP MM H+S
Sbjct  228   AMMYLYPQISVIHVLSNPSAEWKGLTGFVSKEMVEKYMPGPSDDNLVCVCGPPPMMYHIS  287

Query  932   GEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             G+K K + QGE+ G+LKE+ YT   V+KF
Sbjct  288   GDKAKDKSQGEVQGLLKELNYTSTQVFKF  316



>gb|ETK76501.1| hypothetical protein L915_17091, partial [Phytophthora parasitica]
 gb|ETL29939.1| hypothetical protein L916_16987, partial [Phytophthora parasitica]
 gb|ETL83181.1| hypothetical protein L917_16815, partial [Phytophthora parasitica]
 gb|ETM36408.1| hypothetical protein L914_16895, partial [Phytophthora parasitica]
 gb|ETP06098.1| hypothetical protein F441_17427, partial [Phytophthora parasitica 
CJ01A1]
Length=316

 Score =   237 bits (605),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/269 (44%), Positives = 178/269 (66%), Gaps = 9/269 (3%)
 Frame = +2

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPI  391
                E+   K AL+P ++  F +     V+HNT    F+   P  ++G+   SC++ RA +
Sbjct  55    HCEEEQQPKVALSPKEFRSFTVRKVETVNHNTKRVTFALPTPEHEMGITTPSCLMARAKV  114

Query  392   GQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQ  571
                      K V+RPYTP +  + KG  +L++K YP+GK+S+H   LK GD +++KGP  
Sbjct  115   DG-------KTVVRPYTPTNVNEEKGFLELVVKGYPQGKLSKHIVELKEGDSLDMKGPFP  167

Query  572   KLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkld  751
             K  Y PN  K IGMIAGGSGITPMLQ+I+ I +NP+D T+I+LLY +VS +DI+L+++++
Sbjct  168   KFSYYPNRYKSIGMIAGGSGITPMLQLIKTICRNPEDRTEITLLYCSVSEEDIILREEVE  227

Query  752   VLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVS  931
              +   +P + V + + +P+ EW+G +GF+SK+MV K +P PSDD L+ VCGPP MM H+S
Sbjct  228   AMMYLYPQISVIHVLSNPSAEWKGLTGFVSKEMVEKYMPGPSDDNLVCVCGPPPMMYHIS  287

Query  932   GEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             G+K K + QGE+ G+LKE+ YT   V+KF
Sbjct  288   GDKAKDKSQGEVQGLLKELNYTSTQVFKF  316



>gb|AAR88781.1| cytochrome b5 reductase [Musa acuminata AAA Group]
Length=176

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = +2

Query  491  VYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILK  670
            VYPEG+MSQHFA+L+PGD VEVKGPI+KL+Y PNMKK IGMIAGG+GITPMLQVI+AILK
Sbjct  1    VYPEGQMSQHFATLQPGDVVEVKGPIEKLRYSPNMKKDIGMIAGGTGITPMLQVIKAILK  60

Query  671  NPDDNTQISLLYANVSPddillkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDM  850
            NPDDNTQ+SL+YAN+SPDDILLK +LD L+ ++PN KVFYTVD P+K WRGG+G++SKDM
Sbjct  61   NPDDNTQVSLIYANISPDDILLKGELDRLSTSYPNFKVFYTVDKPSKTWRGGTGYVSKDM  120

Query  851  VVKGLPPPSDDTLIFVCGPPGMMT-HVSGEKDKREQGELSGVLKEVGYTE  997
            V+KGLP P ++TLI VCGP    + ++   +    +GEL+G+LKE+GY+E
Sbjct  121  VLKGLPSPGEETLILVCGPQVCSSIYLETRQKTGRKGELTGILKELGYSE  170



>ref|XP_008864775.1| hypothetical protein H310_02881 [Aphanomyces invadans]
 gb|ETW06700.1| hypothetical protein H310_02881 [Aphanomyces invadans]
Length=309

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 172/273 (63%), Gaps = 9/273 (3%)
 Frame = +2

Query  203   VYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIIT  379
             + L   +   S   ALNPN+W  F++     ++HNTH  R  F +     GL +AS ++T
Sbjct  44    LMLASFSTAASNDHALNPNEWRSFRVYSNERLNHNTHKLRLEFPEEDQTSGLTVASFLLT  103

Query  380   RAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVK  559
             +A +         K VIRPYTP S    KGH +L++K YP G MS+H  +LK GD ++VK
Sbjct  104   KAHLNG-------KTVIRPYTPTSANSQKGHLELIVKGYPTGTMSKHLVNLKAGDHIDVK  156

Query  560   GPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillk  739
             GP  K  Y+PN +KHI M+AGGSGITPMLQV   IL+NP+DNT ++L++AN + +DI+L+
Sbjct  157   GPNIKFTYKPNSRKHIAMVAGGSGITPMLQVALEILRNPEDNTDVTLIFANDTEEDIILR  216

Query  740   kkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMM  919
              +L      +P LKV   +  P+  W G +G+++KD++ K LP PS D L+ VCGPPG M
Sbjct  217   DELASYEQIYPGLKVINVLSKPSASWTGYTGYVTKDILEKHLPGPSTDNLVLVCGPPGFM  276

Query  920   THVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
               VSG K K   QG++ G+LK++ YT   V+KF
Sbjct  277   HAVSGGKAKDYSQGQVEGILKDLHYTSETVFKF  309



>emb|CDH48899.1| nadh-cytochrome b5 reductase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=334

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 182/259 (70%), Gaps = 10/259 (4%)
 Frame = +2

Query  260   QWIEFKLEDRAPVSHNTHLFRFSFDPSAK--LGLDIASCIITRAPIGQQDAEGKPKYVIR  433
             Q+  FKLE   P++HNT ++RFS  PS K    L +ASC+ITR PI ++D  G P ++IR
Sbjct  79    QFKAFKLEKVEPINHNTAVYRFSL-PSEKQRAELPVASCLITRYPITKKD--GSPGFIIR  135

Query  434   PYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGM  613
             PYTP S  +A+G+FDL++K Y EGKMS+H A+LK GD +E+KGPI K  +  N  +++GM
Sbjct  136   PYTPTSPEEAEGYFDLIVKEYAEGKMSKHIANLKVGDTLEMKGPIPKYNWEENKVENVGM  195

Query  614   IAGGSGITPMLQVIEAIL--KNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKV  784
             IAGG+GITPMLQ+I  +    + D  T+++L++AN + +DILLK++LD  A  HP+  KV
Sbjct  196   IAGGTGITPMLQIIRKVFDKNSSDKTTKVTLVFANQTEEDILLKEELDTYAKEHPDRFKV  255

Query  785   FYTVDSPTKEWRGGSGFISKDMVVKGLPPPSD-DTLIFVCGPPGMMTHVSGEKDK-REQG  958
              YT+D P K+W+G  GF++ D + K LP P D +  IF+CGP  M+  +SG K K + QG
Sbjct  256   VYTLDRPPKDWQGLQGFVTADAIKKYLPSPEDKNAKIFICGPDPMLASISGPKAKDKSQG  315

Query  959   ELSGVLKEVGYTENMVYKF  1015
             E+SG+LKE+GY E  VYKF
Sbjct  316   EVSGILKELGYNEGNVYKF  334



>gb|EXX63737.1| Cbr1p [Rhizophagus irregularis DAOM 197198w]
Length=283

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 173/261 (66%), Gaps = 12/261 (5%)
 Frame = +2

Query  242   TALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQDAEGKPK  421
             + L   ++    +    P +HNT +FR  F    K    IASC++ +    Q        
Sbjct  32    STLTREKYTPLTVSKITPYNHNTSIFRLKFPKPLKEPSPIASCVLLKDDSSQ--------  83

Query  422   YVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKK  601
              ++RPYTPIS  D   H DL+IK Y  G MS+   SLK GDK++VKGPI  L Y+ NMKK
Sbjct  84    -IMRPYTPISLVDELNHIDLMIKRYDNGHMSKLVHSLKVGDKIDVKGPIVTLPYKANMKK  142

Query  602   HIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NL  778
             HIGMI GG+GITPM Q+I+ IL+NP+D T+I L+YAN++ +DILL ++L+ L+  +P   
Sbjct  143   HIGMICGGTGITPMHQLIDCILRNPEDKTKIYLVYANIAKEDILLHEELEQLSKENPEQF  202

Query  779   KVFYTVDSPTKE-WRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDK-RE  952
             K++YT+D+P KE W  G+GF+S+ MV + +P PSDD L+ VCGP GMM H+SG K + R 
Sbjct  203   KIYYTLDNPPKENWTQGTGFVSQKMVKENIPAPSDDVLVLVCGPGGMMRHISGPKARDRS  262

Query  953   QGELSGVLKEVGYTENMVYKF  1015
             QG + G+LKE+GYT+N V+KF
Sbjct  263   QGPVEGILKELGYTQNQVHKF  283



>ref|XP_005846927.1| hypothetical protein CHLNCDRAFT_10756, partial [Chlorella variabilis]
 gb|EFN54825.1| hypothetical protein CHLNCDRAFT_10756, partial [Chlorella variabilis]
Length=261

 Score =   231 bits (590),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 130/262 (50%), Positives = 176/262 (67%), Gaps = 6/262 (2%)
 Frame = +2

Query  245   ALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPK  421
             AL+P +W  FKL     V++ T LFRF+  D   + GL +ASC++ RAPIG +  +G   
Sbjct  1     ALSPEEWRSFKLALTKGVANPTVLFRFALPDKDHEPGLPVASCLLVRAPIGSEKPDGSRA  60

Query  422   YVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRP-NMK  598
             +V+RPYTPIS   AKGH DL IKVYP GKMSQH   LK GD+++ KGP+ K+     + +
Sbjct  61    FVLRPYTPISR-HAKGHMDLAIKVYPGGKMSQHIDHLKVGDQLDFKGPLMKISVEELSKR  119

Query  599   KHIGMIAGGSGITPMLQVIEAILKNPDDNTQ-ISLLYANVSPddillkkkldVLAATHPN  775
             K +G+IAGGSG+TPMLQ        P  + Q I++L+ANVS  DI+ K +LD LA  H N
Sbjct  120   KRLGLIAGGSGLTPMLQASWGRRPQPSHHGQDINMLFANVSEADIIAKDRLDGLAKRHKN  179

Query  776   LKVFYTVD-SPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEK-DKR  949
               + Y VD +  K W G  G+I+KD++ K +PPP+DD+L+ VCGPPG+M  VSG+K   +
Sbjct  180   FHIHYIVDKTDNKAWGGSVGYITKDLLAKLMPPPADDSLVLVCGPPGLMNAVSGDKLPDK  239

Query  950   EQGELSGVLKEVGYTENMVYKF  1015
              QG LSG+LK++GYTE  V+KF
Sbjct  240   TQGPLSGLLKDMGYTEQQVFKF  261



>ref|XP_003652250.1| hypothetical protein THITE_2150123 [Thielavia terrestris NRRL 
8126]
 gb|AEO65914.1| hypothetical protein THITE_2150123 [Thielavia terrestris NRRL 
8126]
Length=350

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 175/273 (64%), Gaps = 10/273 (4%)
 Frame = +2

Query  212   DQINEDTSRKTALNPNQ-WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRA  385
             D+++    +K     +Q W+  KLE+   V+HN+  FRF       + GL +AS I+T+ 
Sbjct  83    DKLSAGEVKKALTGGDQGWVSLKLEEVETVNHNSKRFRFRLPEDDMVSGLQVASAILTK-  141

Query  386   PIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGP  565
                  DAE   K VIRPYTPISD DA+G+ DLL+K YP G MS H   + PG  ++VKGP
Sbjct  142   -FQPADAE---KPVIRPYTPISDEDARGYLDLLVKKYPNGPMSTHLHDMVPGQHLDVKGP  197

Query  566   IQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkk  745
             + K  + PN   HI +IAGG+GITPM Q+  AI  NPDD T+++L++ NVS +DILL+ +
Sbjct  198   VPKYPWSPNKHAHIALIAGGTGITPMYQLCRAIFDNPDDQTKVTLVFGNVSEEDILLRNE  257

Query  746   ldVLAATHP-NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMM  919
             L  L   HP   + FY +D P K W G  G+I +D++   LP P ++ + +FVCGPPGMM
Sbjct  258   LAALENRHPRRFRAFYVLDKPPKHWTGAKGYIGRDLLKTVLPEPKEENIKVFVCGPPGMM  317

Query  920   THVSG-EKDKREQGELSGVLKEVGYTENMVYKF  1015
               +SG +K  ++QGEL+G+LKE+GYT   VYKF
Sbjct  318   DLISGNKKSPKDQGELTGILKELGYTPEQVYKF  350



>ref|XP_001269706.1| NADH-cytochrome b5 reductase, putative [Aspergillus clavatus 
NRRL 1]
 sp|A1CRK9.1|MCR1_ASPCL RecName: Full=NADH-cytochrome b5 reductase 2; AltName: Full=Mitochondrial 
cytochrome b reductase [Aspergillus clavatus NRRL 
1]
 gb|EAW08280.1| NADH-cytochrome b5 reductase, putative [Aspergillus clavatus 
NRRL 1]
Length=322

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 172/255 (67%), Gaps = 10/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W++ KL +   +SHNT   RF F D  A  GL +AS ++T+     + AEGKP  VIRPY
Sbjct  74    WVDLKLSEIENLSHNTKRLRFEFADKEAVSGLQVASALLTKF----KPAEGKP--VIRPY  127

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD D  G+ DL++KVYP G MS+H  S+    ++E KGPI K  +  N  KHI +IA
Sbjct  128   TPVSDEDQPGYLDLVVKVYPNGPMSEHLHSMNVDQRLEFKGPIPKYPWETNKHKHICLIA  187

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+   I KNP+D T+++L++ NVS +DILLKK+L  L  THP   K FY +
Sbjct  188   GGTGITPMYQLARQIFKNPEDQTKVTLVFGNVSEEDILLKKELQELENTHPRRFKAFYVL  247

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D+P KEW GG G+++K+++   LP P  +D  IFVCGPPGM   +SG K   ++QGEL+G
Sbjct  248   DNPPKEWTGGKGYVTKELLKTVLPEPKEEDIKIFVCGPPGMYKAISGPKVSPKDQGELTG  307

Query  971   VLKEVGYTENMVYKF  1015
             +L E+GY ++ VYKF
Sbjct  308   LLAELGYNKDQVYKF  322



>emb|CCA21618.1| NADHcytochrome b5 reductase putative [Albugo laibachii Nc14]
Length=299

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/272 (44%), Positives = 178/272 (65%), Gaps = 13/272 (5%)
 Frame = +2

Query  212   DQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFD-PSA--KLGLDIASCIITR  382
             D  NE + + +AL+PN++  F +     ++HN    R   D PS   ++GL +ASC++TR
Sbjct  37    DCENEKSDKTSALDPNEFRSFPVRSIDRLNHNVK--RIILDLPSEGHEMGLPVASCLLTR  94

Query  383   APIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKG  562
             A I         KY+IRPYTP++    +G+ +L++K YP+G MS H   L+ GD V++KG
Sbjct  95    AKINN-------KYIIRPYTPVNLNSERGYIELVVKEYPKGNMSTHLCGLQIGDNVDIKG  147

Query  563   PIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkk  742
             P  KL Y PN  K +G+IAGGSG+TPMLQ+ + I +NP+D+TQ+ LL+AN +  DI ++ 
Sbjct  148   PKMKLPYEPNTYKKVGLIAGGSGLTPMLQIAKEICRNPEDHTQVDLLFANSTEADIYMQD  207

Query  743   kldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMT  922
             +LD +   +P  KV Y V  P+++W G SG I+K+MV + +P PS++ L+ VCGPPGMM 
Sbjct  208   ELDAMQFLYPQFKVHYLVSRPSEDWEGLSGIITKEMVQQLMPLPSEEVLVCVCGPPGMMH  267

Query  923   HVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
              + GE+ K   QG+L G+LKE+ Y+   VYKF
Sbjct  268   LICGERSKDMSQGDLEGLLKELEYSSKNVYKF  299



>emb|CCI47508.1| unnamed protein product [Albugo candida]
Length=302

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/272 (44%), Positives = 177/272 (65%), Gaps = 13/272 (5%)
 Frame = +2

Query  212   DQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFD-PSA--KLGLDIASCIITR  382
             D  NE + + TAL+PN++  F +     ++HN    R   D PS   ++GL +ASC++TR
Sbjct  40    DCENEKSEKTTALDPNEFRSFPVRSIERLNHNVK--RIILDLPSEGHEMGLPVASCLLTR  97

Query  383   APIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKG  562
             A I         K  IRPYTP++    +G+ +L++K YP+G MS+H   LKPGD VE+KG
Sbjct  98    AKINN-------KQTIRPYTPVNLNSERGYIELVVKEYPKGIMSKHLCDLKPGDTVEIKG  150

Query  563   PIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkk  742
             P  KL Y PN  K IG+IAGGSG+TPMLQ+ + I +NP+D TQ+ LL+AN + +D+ L+ 
Sbjct  151   PKMKLPYEPNTYKKIGLIAGGSGLTPMLQIAKEICRNPNDQTQVVLLFANSTEEDMYLQD  210

Query  743   kldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMT  922
             +LD +   +P  +V + +  P+KEW G SG I+K+M+ + +P P ++ L+ VCGPPGMM 
Sbjct  211   ELDAMQFLYPQFEVHHVISRPSKEWEGLSGTITKEMIQEVMPSPDNEILVCVCGPPGMMH  270

Query  923   HVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
              + GE+ K   QG+L G+LKE+ Y+   VYKF
Sbjct  271   LICGERSKDMSQGDLEGLLKELEYSSKNVYKF  302



>gb|KEZ42260.1| NADH-cytochrome b5 reductase 2 [Scedosporium apiospermum]
Length=336

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 131/275 (48%), Positives = 180/275 (65%), Gaps = 11/275 (4%)
 Frame = +2

Query  209   LDQINEDTSRKTALNPNQ--WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIIT  379
             +D     T  K AL   +  +I  K+E    VSHNT   RF       + G+ IAS I+T
Sbjct  67    IDASAAGTPAKAALTGGEQGFIPLKVESVESVSHNTKKLRFKLPEDDMVSGVHIASAILT  126

Query  380   RAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVK  559
             +        EG  K VIRPYTPI+D +A+G+ DLL+K YP G MS H A+LKPGD ++ K
Sbjct  127   KF-----KPEGAEKPVIRPYTPINDEEARGYLDLLVKEYPNGPMSTHIANLKPGDVLDFK  181

Query  560   GPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillk  739
             GPI K  ++PN   HI ++AGG+GITPM Q++ AI  NPDD T+++L++ NV+  DILLK
Sbjct  182   GPIPKYLWQPNKHNHIALLAGGTGITPMYQLLRAIFSNPDDKTKVTLVFGNVTEGDILLK  241

Query  740   kkldVLAATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPG  913
             K+L  L   +P   + FYT+D P K W G SGFI+KD++   LP P ++ + +FVCGPPG
Sbjct  242   KELADLENRYPQRFRAFYTLDKPPKGWAGNSGFITKDLLKTVLPEPKEENVKVFVCGPPG  301

Query  914   MMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             +M  +SG K+  ++QGELSG+LKE+GY ++ VYKF
Sbjct  302   LMKAISGPKNSPQDQGELSGILKELGYGKDQVYKF  336



>ref|XP_003284619.1| hypothetical protein DICPUDRAFT_91353 [Dictyostelium purpureum]
 gb|EGC38825.1| hypothetical protein DICPUDRAFT_91353 [Dictyostelium purpureum]
Length=279

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 123/269 (46%), Positives = 178/269 (66%), Gaps = 20/269 (7%)
 Frame = +2

Query  212   DQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAP  388
             D+   + +   AL+PN++ +F+L+++  V+HNT +FRF+  + +  LGL I   I  RA 
Sbjct  30    DEKKSNETGSVALDPNEYKKFQLKEKFIVNHNTRIFRFALPNENDILGLPIGQHISLRAV  89

Query  389   IGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPI  568
             +G ++       V RPYTPIS  + +G+FDLLIKVY +G MS +  ++  GD +EVKGP 
Sbjct  90    VGGKE-------VYRPYTPISSDEERGYFDLLIKVYEKGAMSGYVDNMFIGDSIEVKGPK  142

Query  569   QKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkl  748
              K  Y  NM+KHIGM+AGG+GITPMLQVI+AILKNP+D TQISL++ N++ +DILLKK+L
Sbjct  143   GKFNYTANMRKHIGMLAGGTGITPMLQVIKAILKNPEDKTQISLVFGNITEEDILLKKEL  202

Query  749   dVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHV  928
             D LA  H N  V+Y +++P K W  G GF+S++++   LP PSDDT++ +CGPP M    
Sbjct  203   DELAEKHSNFNVYYVLNNPPKGWNQGVGFVSQEVIQSKLPAPSDDTMVVMCGPPMM----  258

Query  929   SGEKDKREQGELSGVLKEVGYTENMVYKF  1015
                        ++G L  +GY EN ++ F
Sbjct  259   --------NKAMTGHLTSLGYQENSIFTF  279



>ref|XP_002484036.1| NADH-cytochrome b5 reductase, putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED16802.1| NADH-cytochrome b5 reductase, putative [Talaromyces stipitatus 
ATCC 10500]
Length=323

 Score =   230 bits (586),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 127/255 (50%), Positives = 171/255 (67%), Gaps = 10/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             +++ KL D   +SHNT  +RF F D  A  GL +AS +IT+        EGKP  +IRPY
Sbjct  75    FVDLKLSDIEILSHNTKRYRFEFPDKEAVSGLHVASALITK----YTPPEGKP--IIRPY  128

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD D  G+ DL++K YP G MS H  S+  G +++ KGPI K  ++PN   HI MIA
Sbjct  129   TPVSDEDTPGYLDLIVKHYPNGPMSSHLDSMNVGQRLDFKGPIPKYPWQPNKHNHIAMIA  188

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+I AI KNPDD T+++L+Y NV  DDILLKK+L  L  T+P   K FY +
Sbjct  189   GGTGITPMYQLIRAIFKNPDDKTKVTLVYGNVGEDDILLKKELHDLENTYPQRFKAFYLL  248

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVS-GEKDKREQGELSG  970
             DSP KEW GG G+++K+++   LP P ++ + +FVCGPPG+   +S G+K   +QGEL G
Sbjct  249   DSPPKEWTGGKGYVTKELLKTVLPEPKEENIKVFVCGPPGLYKAISGGKKSPSDQGELEG  308

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GY +  VYKF
Sbjct  309   YLKELGYNKEQVYKF  323



>ref|XP_006675128.1| hypothetical protein BATDEDRAFT_15558 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83391.1| hypothetical protein BATDEDRAFT_15558 [Batrachochytrium dendrobatidis 
JAM81]
Length=357

 Score =   231 bits (589),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 130/272 (48%), Positives = 182/272 (67%), Gaps = 7/272 (3%)
 Frame = +2

Query  215   QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPI  391
             QI    +   AL+P  +  F + +   V+HNT + RF+  + + +LGL  ASC  T+   
Sbjct  88    QIAWKEAPVAALDPTTFKPFTVREIVDVNHNTKILRFALPEEATELGLKAASCCTTKFVK  147

Query  392   GQQDAEGKPKYVIRPYTPISDPDA--KGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGP  565
             G ++ +GKP  VIRPYTP+ DP     G+FD+L+K YP+G MS +  S + GD VE+KGP
Sbjct  148   GLKE-DGKPDVVIRPYTPLEDPAKGYTGYFDMLVKKYPDGVMSSYLHSRQVGDVVEIKGP  206

Query  566   IQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkk  745
               K +Y+ N  KHIGM+AGGSGITPM+QVI+ IL +P D T++SL++ANV+ DDI L+  
Sbjct  207   FSKFEYKANEFKHIGMVAGGSGITPMVQVIQKILSDPTDKTKVSLIFANVTEDDIPLRPY  266

Query  746   ldVLAATHP-NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMT  922
             LD LA  HP  + VF+T+D P   W+ GSG++S+DM+ K +P P    + F CG PGMM 
Sbjct  267   LDKLAKEHPGQINVFHTLDKPPAGWQQGSGYVSEDMLKKHMPAPGQGKVYF-CGNPGMMK  325

Query  923   HVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
              ++G K K  +QGELSG+LK++GYTE  V+KF
Sbjct  326   FITGPKTKDNKQGELSGLLKKLGYTEGDVFKF  357



>ref|XP_001819999.1| NADH-cytochrome b5 reductase 2 [Aspergillus oryzae RIB40]
 ref|XP_002374454.1| NADH-cytochrome b5 reductase, putative [Aspergillus flavus NRRL3357]
 sp|Q2UKB8.1|MCR1_ASPOR RecName: Full=NADH-cytochrome b5 reductase 2; AltName: Full=Mitochondrial 
cytochrome b reductase [Aspergillus oryzae RIB40]
 dbj|BAE57997.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED55672.1| NADH-cytochrome b5 reductase, putative [Aspergillus flavus NRRL3357]
 gb|EIT77083.1| NADH-cytochrome b-5 reductase [Aspergillus oryzae 3.042]
Length=323

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 171/256 (67%), Gaps = 11/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITR-APIGQQDAEGKPKYVIRP  436
             W++ KL +   +SHNT   RF F D  A  G+ IAS ++T+  P+G + A      V+RP
Sbjct  74    WVDLKLSEIEVLSHNTKRLRFEFEDKEAVSGVTIASALLTKFKPVGAEKA------VLRP  127

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTP SD D  G+ DL++KVYP G MS+H  S+    ++  KGP+ K Q+  N  +HI +I
Sbjct  128   YTPTSDEDQPGYLDLVVKVYPNGPMSEHLHSMNVDQRLSFKGPLPKYQWETNKHEHIALI  187

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             AGG+GITPM Q+I  I KNPDD T+++L+Y NV+ DDILLKK+L  L  T+P   K FY 
Sbjct  188   AGGTGITPMYQLIRQIFKNPDDKTKVTLVYGNVTEDDILLKKELQDLENTYPQRFKAFYL  247

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELS  967
             +D P KEW GG G+I+K+++   LP P ++   IFVCGPPG+   VSG K   ++QGELS
Sbjct  248   LDKPPKEWTGGKGYINKELLKTVLPEPKEENQKIFVCGPPGLYNAVSGNKVSPKDQGELS  307

Query  968   GVLKEVGYTENMVYKF  1015
             G+LKE+GY ++ VYKF
Sbjct  308   GILKELGYNKDQVYKF  323



>ref|XP_003659338.1| hypothetical protein MYCTH_2136940 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO54093.1| hypothetical protein MYCTH_2136940 [Myceliophthora thermophila 
ATCC 42464]
Length=351

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 168/255 (66%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             WI  KLE+   V+HN+  FRF       + G+ IAS I+T+      D     K VIRPY
Sbjct  102   WISLKLEEVEVVNHNSKRFRFRLPEDDMVSGVHIASAILTKFKPVDGD-----KPVIRPY  156

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD DAKG+ DLL+K YP G MS H   + PG  ++VKGPI K  + PN  +HI +IA
Sbjct  157   TPISDEDAKGYIDLLVKKYPNGPMSTHLHDMVPGQHLDVKGPIPKYPWEPNKHEHIALIA  216

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+  AI  NPDD T+++L++ N+S DDILLK +L  L   +P   + FY +
Sbjct  217   GGTGITPMWQLCRAIFNNPDDQTKVTLVFGNISEDDILLKNELAALENHNPRRFRAFYVL  276

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEKDK-REQGELSG  970
             D+P K W GG G+I+KD++   LP P ++ + IFVCGPPGMM  +SG K   ++QGEL G
Sbjct  277   DNPPKHWTGGKGYITKDLLKTVLPEPKNENIKIFVCGPPGMMESISGNKKSPKDQGELKG  336

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GY+ + VYKF
Sbjct  337   ILKELGYSPDQVYKF  351



>ref|XP_007287692.1| nadh-cytochrome b5 reductase [Colletotrichum gloeosporioides 
Nara gc5]
 gb|ELA23257.1| nadh-cytochrome b5 reductase [Colletotrichum gloeosporioides 
Nara gc5]
Length=328

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 174/256 (68%), Gaps = 11/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL--GLDIASCIITRAPIGQQDAEGKPKYVIRP  436
             ++  KLE    V+HNT  FRF+  P   +  GLD+AS ++T+   G +D     K  +RP
Sbjct  79    FVSLKLEAIENVNHNTKKFRFAL-PEGDMVSGLDVASAVLTKYK-GPEDE----KATLRP  132

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTPISD DAKG+ DLL+K YP G MS H   + PG +++ KGP+ K  + PN  +HI ++
Sbjct  133   YTPISDEDAKGYVDLLVKKYPNGPMSTHMHDMAPGQRLDFKGPLPKYPWTPNKHEHIALV  192

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             AGG+GITPM Q+  AI  NPDD T+++L++ NV+ +DILLKK+   L  T+P   + FY 
Sbjct  193   AGGTGITPMYQLARAIFSNPDDKTKVTLVFGNVTEEDILLKKEFAELENTYPQRFRAFYV  252

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSG-EKDKREQGELS  967
             +D P KEW GG GFI+K+++ + LP P S++  +FVCGPPG+M  VSG +K  ++QGEL 
Sbjct  253   LDKPPKEWVGGKGFITKELLKQVLPEPKSENIKVFVCGPPGLMNAVSGNKKSPKDQGELV  312

Query  968   GVLKEVGYTENMVYKF  1015
             GVLKE+GY+ + VYKF
Sbjct  313   GVLKELGYSPDQVYKF  328



>gb|ETP34222.1| hypothetical protein F442_17413 [Phytophthora parasitica P10297]
Length=285

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 167/242 (69%), Gaps = 9/242 (4%)
 Frame = +2

Query  296   VSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGH  472
             V+HNT    F+   P  ++G+   SC++ RA +         K V+RPYTP +  + KG 
Sbjct  51    VNHNTKRVTFALPTPEHEMGITTPSCLMARAKVDG-------KTVVRPYTPTNVNEEKGF  103

Query  473   FDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQV  652
              +L++K YP+GK+S+H   LK GD +++KGP  K  Y PN  K IGMIAGGSGITPMLQ+
Sbjct  104   LELVVKGYPQGKLSKHIVELKEGDSLDMKGPFPKFSYYPNRYKSIGMIAGGSGITPMLQL  163

Query  653   IEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPNLKVFYTVDSPTKEWRGGSG  832
             I+ I +NP+D T+I+LLY +VS +DI+L+++++ +   +P + V + + +P+ EW+G +G
Sbjct  164   IKTICRNPEDRTEITLLYCSVSEEDIILREEVEAMMYLYPQISVIHVLSNPSAEWKGLTG  223

Query  833   FISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVY  1009
             F+SK+MV K +P PSDD L+ VCGPP MM H+SG+K K + QGE+ G+LKE+ YT   V+
Sbjct  224   FVSKEMVEKYMPGPSDDNLVCVCGPPPMMYHISGDKAKDKSQGEVQGLLKELNYTSTQVF  283

Query  1010  KF  1015
             KF
Sbjct  284   KF  285



>gb|EQB59292.1| hypothetical protein CGLO_00344 [Colletotrichum gloeosporioides 
Cg-14]
Length=328

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 174/256 (68%), Gaps = 11/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL--GLDIASCIITRAPIGQQDAEGKPKYVIRP  436
             ++  KLE    V+HNT  FRF+  P   +  GLD+AS ++T+   G +D     K  +RP
Sbjct  79    FVSLKLEAIENVNHNTKKFRFAL-PEGDMVSGLDVASAVLTKYK-GPEDE----KATLRP  132

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTPISD DAKG+ DLL+K YP G MS H   + PG +++ KGP+ K  + PN  +HI ++
Sbjct  133   YTPISDEDAKGYVDLLVKKYPNGPMSTHMHDMAPGQRLDFKGPLPKYPWTPNKHEHIALV  192

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             AGG+GITPM Q+  AI  NPDD T+++L++ NV+ +DILLKK+   L  T+P   + FY 
Sbjct  193   AGGTGITPMYQLARAIFSNPDDKTKVTLVFGNVTEEDILLKKEFAELENTYPQRFRAFYV  252

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSG-EKDKREQGELS  967
             +D P KEW GG GFI+K+++ + LP P S++  +FVCGPPG+M  VSG +K  ++QGEL 
Sbjct  253   LDKPPKEWVGGKGFITKELLKQVLPEPKSENIKVFVCGPPGLMNAVSGNKKSPKDQGELV  312

Query  968   GVLKEVGYTENMVYKF  1015
             GVLKE+GY+ + VYKF
Sbjct  313   GVLKELGYSPDQVYKF  328



>ref|XP_008614124.1| hypothetical protein SDRG_09936 [Saprolegnia diclina VS20]
 gb|EQC32623.1| hypothetical protein SDRG_09936 [Saprolegnia diclina VS20]
Length=305

 Score =   227 bits (578),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 170/262 (65%), Gaps = 9/262 (3%)
 Frame = +2

Query  236   RKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEG  412
              K A++P +W   ++     ++HNTH  R  F   +   G+ +AS ++ +A +  ++   
Sbjct  51    EKHAISPGEWRSLRVLSNEKLTHNTHKVRLEFPSETDTSGMKVASFVMAKASLNGKN---  107

Query  413   KPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPN  592
                 VI+PYTP S P   G  DL++K YP G MS+H   L+ GD +++KGP+ K  Y  N
Sbjct  108   ----VIKPYTPTSAPMQAGFLDLIVKGYPNGSMSKHIVELQAGDSLDIKGPLMKFPYVAN  163

Query  593   MKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP  772
              +KH+GM+AGGSGITPMLQV   IL+NP+D+T+++L++AN + DDI+L+ +L      +P
Sbjct  164   SRKHVGMVAGGSGITPMLQVALEILRNPEDHTKVTLIFANQTEDDIILRDELATYERMYP  223

Query  773   NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDKR-  949
              LKV + +  P++ W G +G + KD++ K LP P+ D L+ VCGPPGMMT VSG K K  
Sbjct  224   GLKVIHILSKPSESWTGLTGRVDKDLLEKHLPAPAADNLVLVCGPPGMMTTVSGGKAKDF  283

Query  950   EQGELSGVLKEVGYTENMVYKF  1015
              QG++ G+LKE+ YT +MV+KF
Sbjct  284   SQGQVEGILKELNYTSDMVFKF  305



>ref|XP_009834721.1| hypothetical protein H257_10006 [Aphanomyces astaci]
 gb|ETV75590.1| hypothetical protein H257_10006 [Aphanomyces astaci]
Length=312

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 165/263 (63%), Gaps = 9/263 (3%)
 Frame = +2

Query  233   SRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAE  409
             S   ALNPN+W  F++     ++HNTH  R  F + +   GL +AS ++T+A +      
Sbjct  57    SNDHALNPNEWRSFRVYSNEQLNHNTHKLRLEFPEENQTSGLTVASFLLTKAHL------  110

Query  410   GKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRP  589
                K VIR YTP S    KGH +L++K Y  G MS+H   LK GD ++VKGP  K  Y+P
Sbjct  111   -NGKAVIRAYTPTSANSQKGHLELIVKGYTTGTMSKHLVGLKAGDHIDVKGPNIKFTYKP  169

Query  590   NMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATH  769
             N +KHI M+AGGSGITPMLQV   IL+NP+DNT ++L++AN + +DILL+ +L      +
Sbjct  170   NSRKHIAMVAGGSGITPMLQVALEILRNPEDNTDVTLIFANDTEEDILLRDELASYEQIY  229

Query  770   PNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDKR  949
             P  KV   +  P++ W G SG+I+KD++ K LP  S D L+ VCGPPG M  VSG K K 
Sbjct  230   PGFKVINVLSKPSESWTGYSGYITKDILEKHLPGASADNLVLVCGPPGFMLAVSGGKAKD  289

Query  950   -EQGELSGVLKEVGYTENMVYKF  1015
               QG++ G LK++ Y+   V+KF
Sbjct  290   FTQGQVEGYLKDLHYSSETVFKF  312



>ref|XP_003852910.1| hypothetical protein MYCGRDRAFT_70871 [Zymoseptoria tritici IPO323]
 gb|EGP87886.1| hypothetical protein MYCGRDRAFT_70871 [Zymoseptoria tritici IPO323]
Length=340

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 176/255 (69%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFD-PSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             +I   L+    ++HNT+ FRF F+ P A  GL IAS ++T+       AEG  K  IRPY
Sbjct  91    FISLTLDSTEKINHNTNKFRFKFENPDAVSGLTIASALVTK-----HKAEGDEKPTIRPY  145

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP SD D KG+ DL++K Y  GKMS+H  S++PG K+E+KGPI K Q++ N   HI ++A
Sbjct  146   TPTSDEDEKGYMDLIVKKYEGGKMSEHLHSMEPGQKLEMKGPIPKYQWQANKHNHIALLA  205

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+   I K+P+D T+++L++ N++ +DILLKK+ D L   +P   + FY +
Sbjct  206   GGTGITPMWQLARQIFKDPNDKTKVTLVFGNITEEDILLKKEFDDLEKQYPERFRAFYVL  265

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSG-EKDKREQGELSG  970
             D P+K W GG GFISK+++ K +P P ++ + +FVCGPPG++  +SG +K   +QG+L+G
Sbjct  266   DKPSKNWEGGKGFISKELLQKTIPQPDEENVKVFVCGPPGLVKAISGPKKSPADQGDLAG  325

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GY+++ V+KF
Sbjct  326   TLKEMGYSKDQVFKF  340



>ref|XP_004337883.1| oxidoreductase NADbinding domain containing protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR15870.1| oxidoreductase NADbinding domain containing protein [Acanthamoeba 
castellanii str. Neff]
Length=377

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 179/265 (68%), Gaps = 13/265 (5%)
 Frame = +2

Query  242   TALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAK--LGLDIASCIITRAPIGQQDAEGK  415
              +LN +++ EF+L +   ++ NT   RF+  PS    LGL +ASC++T+A IG+    GK
Sbjct  119   VSLNKDEFREFELVEVEDLTPNTRRLRFAL-PSRDHVLGLPVASCVVTKANIGEN---GK  174

Query  416   PKYVIRPYTPIS-DPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPN  592
             P  VIRPYTP++ D   KG+FD +IK YP G MS H   LK G+K++VKGPI KL Y  N
Sbjct  175   P--VIRPYTPVTNDKSDKGYFDFVIKDYPTGVMSSHIYHLKKGEKLQVKGPIPKLAYSKN  232

Query  593   MKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP  772
             MKKH+GM+AGG+GITPMLQV+E +L   DD T +SL++AN +  DI+LK +LD LA  HP
Sbjct  233   MKKHLGMLAGGTGITPMLQVLEEVLSEDDDKTHVSLVFANNTEQDIILKDRLDALAKKHP  292

Query  773   N-LKVFYTVDSP--TKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKD  943
             N L+V Y V  P     W+G +GFI+ D++ K +P P++D +++VCGPP     +SG K 
Sbjct  293   NRLEVHYVVAQPADAASWKGHTGFINADIIKKHIPGPAEDVMVYVCGPPPFYKALSGSKA  352

Query  944   -KREQGELSGVLKEVGYTENMVYKF  1015
                 QGEL GVLK++GY +  V+KF
Sbjct  353   PDYSQGELDGVLKDLGYIKEQVFKF  377



>gb|KDO32645.1| hypothetical protein SPRG_02346 [Saprolegnia parasitica CBS 223.65]
Length=305

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/262 (43%), Positives = 169/262 (65%), Gaps = 9/262 (3%)
 Frame = +2

Query  236   RKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEG  412
              K A++P +W   ++     ++HNTH  R  F   +   G+ +AS ++ +A +  ++   
Sbjct  51    EKHAISPGEWRSLRVLSNEKLTHNTHKVRLEFPSETDTSGMKVASFVMAKASLNGKN---  107

Query  413   KPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPN  592
                 VI+PYTP S P   G  DL++K YP G MS+H   L+ GD +++KGP+ K  Y  N
Sbjct  108   ----VIKPYTPTSAPTQAGFLDLIVKGYPNGSMSKHIVELQAGDSLDIKGPLMKFPYVAN  163

Query  593   MKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP  772
              +KH+GM+AGGSGITPMLQV   IL+NP+D+T+++L++AN + DDI+L+ +L      +P
Sbjct  164   SRKHVGMVAGGSGITPMLQVALEILRNPEDHTKVTLIFANQTEDDIILRDELATYERMYP  223

Query  773   NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDKR-  949
              LKV + +  P++ W G +G + KD++ K LP P+ D L+ VCGPPGMM  VSG K K  
Sbjct  224   GLKVIHILSKPSESWTGLTGRVDKDLLEKHLPAPAADNLVLVCGPPGMMATVSGGKAKDF  283

Query  950   EQGELSGVLKEVGYTENMVYKF  1015
              QG++ G+LKE+ YT +MV+KF
Sbjct  284   SQGQVEGILKELNYTSDMVFKF  305



>ref|XP_003348346.1| hypothetical protein SMAC_02843 [Sordaria macrospora k-hell]
 emb|CCC10266.1| unnamed protein product [Sordaria macrospora k-hell]
Length=343

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 170/256 (66%), Gaps = 11/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITR-APIGQQDAEGKPKYVIRP  436
             W+  KLE+   V+HNT   RF   +     GL +AS I+ +  P+   DAE   K V+RP
Sbjct  94    WVSLKLEEVELVNHNTKRLRFRLPEDDMVSGLHVASAILAKYKPL---DAE---KAVLRP  147

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTPISD  A+G+ DLL+K Y  G MS H   + PG ++++KGP+ K  +  N  KHI ++
Sbjct  148   YTPISDESAQGYIDLLVKKYEGGPMSTHLHDMAPGQRLDIKGPLPKYPWESNKHKHIALV  207

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             AGG+GI+PM Q++ AI  NPDD T+++L++ NVS +DILLK +L  L   +P   + FY 
Sbjct  208   AGGTGISPMYQLLRAIFNNPDDKTKVTLVFGNVSEEDILLKHELATLENHYPQRFRAFYV  267

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEKDK-REQGELS  967
             +D+P K+W G  G+I+KD++   LP P ++D  IFVCGPPGMMT +SG K   R+QGELS
Sbjct  268   LDNPPKQWTGAKGYINKDLLKTVLPEPKNEDIKIFVCGPPGMMTSISGNKKSPRDQGELS  327

Query  968   GVLKEVGYTENMVYKF  1015
             G+LKE+GY+   VYKF
Sbjct  328   GILKELGYSAEQVYKF  343



>tpg|DAA53222.1| TPA: hypothetical protein ZEAMMB73_223419 [Zea mays]
Length=178

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = +2

Query  188  SSPNLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
            SSP + +L++  +  + + ALNP++W+EFKL+++A VSHN+ LFRFSFDPS KLGLD+AS
Sbjct  37   SSPTVAHLEETGK-AAEQVALNPDKWLEFKLQEKATVSHNSQLFRFSFDPSTKLGLDVAS  95

Query  368  CIITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDK  547
            C+ITRAPIG++ AEG+ KYVIRPYTPISDPD+KG+FDLLIKVYP+GKMSQ+FASLKPGD 
Sbjct  96   CLITRAPIGEE-AEGRRKYVIRPYTPISDPDSKGYFDLLIKVYPDGKMSQYFASLKPGDV  154

Query  548  VEVKGPIQKLQYRPNMKKHIGMI  616
            VEVKGPI+KL+Y PNMKK IGM+
Sbjct  155  VEVKGPIEKLRYNPNMKKQIGMV  177



>ref|XP_964971.1| hypothetical protein NCU03112 [Neurospora crassa OR74A]
 sp|Q7SFY2.1|MCR1_NEUCR RecName: Full=NADH-cytochrome b5 reductase 2; AltName: Full=Mitochondrial 
cytochrome b reductase [Neurospora crassa OR74A]
 gb|EAA35735.1| NADH-cytochrome b5 reductase 2 [Neurospora crassa OR74A]
 gb|KHE85963.1| NADH-cytochrome b5 reductase 2 [Neurospora crassa]
Length=343

 Score =   225 bits (574),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 171/256 (67%), Gaps = 11/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITR-APIGQQDAEGKPKYVIRP  436
             W+  KLE+   V+HNT   RF       + GL +AS I+T+  PI   DAE   K V+RP
Sbjct  94    WLSLKLEEVELVNHNTKRLRFRLPEDDMVSGLHVASAILTKFKPI---DAE---KAVLRP  147

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTPISD  A+G+ DLL+K Y  G MS +   + PG ++++KGP+ K  +  N  KHI ++
Sbjct  148   YTPISDESAQGYIDLLVKKYEGGPMSTYLHDMAPGQRLDIKGPLPKYPWEANKHKHIALV  207

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             AGG+GITPM Q+I AI  NPDD T+++L++ NVS +D+LLK +L  +   +P   + FY 
Sbjct  208   AGGTGITPMYQLIRAIFNNPDDKTKVTLVFGNVSEEDVLLKHELATIENHYPQRFRAFYV  267

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEKDK-REQGELS  967
             +D+P KEW G  G+I+KD++   LP P ++D  IFVCGPPGMM  +SG K   R+QGEL+
Sbjct  268   LDNPPKEWAGNKGYINKDLLKTVLPEPKNEDIKIFVCGPPGMMNSISGNKKSPRDQGELT  327

Query  968   GVLKEVGYTENMVYKF  1015
             G+LKE+GY+ + VYKF
Sbjct  328   GILKELGYSPDQVYKF  343



>ref|XP_008727164.1| hypothetical protein G647_04601 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI25228.1| hypothetical protein G647_04601 [Cladophialophora carrionii CBS 
160.54]
Length=342

 Score =   225 bits (574),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 185/274 (68%), Gaps = 10/274 (4%)
 Frame = +2

Query  209   LDQINEDTSRKTALNPNQ-WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITR  382
             +++  E+   KT     Q +++ KL++  P +HNT  F+F+  D     GL++AS IIT+
Sbjct  74    INKQKEEAPGKTFTGGEQGFVDLKLKEIIPYNHNTKRFKFALPDEEHVSGLNVASAIITK  133

Query  383   APIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKG  562
                  +DAE   K VIRPYTPI+D DA+G+ +LL+KVYP+G MS+H   LK GD +  KG
Sbjct  134   --FKPEDAE---KPVIRPYTPINDEDARGYLELLVKVYPKGPMSEHIHGLKEGDTLSFKG  188

Query  563   PIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkk  742
             PI K  + PN   HI +I+GG+GITPM Q+I AI KNP+D T++SL++ N+  +DILLKK
Sbjct  189   PIPKYPWSPNKHSHITLISGGTGITPMYQLIRAIAKNPEDKTKVSLIFGNIKEEDILLKK  248

Query  743   kldVLAATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGM  916
             +L  L    P   +VFYT+D+P + W  G GFI+K+++ + +P P  + + IFVCGPPG+
Sbjct  249   ELSDLEKEFPQRFRVFYTLDNPPESWPYGKGFITKELLKEVIPDPKTENIKIFVCGPPGL  308

Query  917   MTHVSGEK-DKREQGELSGVLKEVGYTENMVYKF  1015
                VSG K   ++QGELSG+LKE+GYT+  V+KF
Sbjct  309   YKAVSGPKVSPQDQGELSGILKELGYTKEQVFKF  342



>gb|EHK40361.1| hypothetical protein TRIATDRAFT_302733 [Trichoderma atroviride 
IMI 206040]
Length=331

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/255 (48%), Positives = 169/255 (66%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W+  KL +   V+HNT   RF      ++ G+ IAS I+T+   G  DA    K  +RPY
Sbjct  82    WVSLKLSETEDVNHNTKRLRFELPEKDQVSGVQIASAILTKFK-GPNDA----KATLRPY  136

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD D +G  DLL+K YP G MS H   LK GD +++KGP+ K  +  N   HI +IA
Sbjct  137   TPVSDEDERGFLDLLVKKYPNGPMSTHIHDLKVGDSLDIKGPLPKYPWTANKHDHIALIA  196

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q++ AI KNP+D T+++L++ NV+ +DILLK K D L  T+P   + FY +
Sbjct  197   GGTGITPMYQLVRAIFKNPNDKTKVTLVFGNVTKEDILLKSKFDELENTYPQRFRAFYVL  256

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D P K+W GG GFISK+++ + LP P SD+  +FVCGPPG+M  +SG K   +EQG+++G
Sbjct  257   DKPPKDWVGGGGFISKELLKQVLPEPKSDNIKLFVCGPPGLMKAISGPKVSPKEQGDVTG  316

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GYT   VYKF
Sbjct  317   LLKELGYTNEQVYKF  331



>gb|KFM28023.1| NADH-cytochrome b5 reductase-like protein [Auxenochlorella protothecoides]
Length=305

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 181/268 (68%), Gaps = 13/268 (5%)
 Frame = +2

Query  242   TALNPNQWIEFKLEDRAPVSHNTH---LFRFSF-DPSAKLGLDIASCIITRAPIGQQDAE  409
             +AL+P++W   KL  +  ++  T+   LFRF+  D    +GL +ASC++TRAPI ++D  
Sbjct  41    SALSPDEWRSLKLVHKEQLTKTTNPVWLFRFALPDEKQVVGLPVASCLLTRAPITKKD--  98

Query  410   GKPKYVIRPYTPISDPDAKGHFDLLIKVYPE---GKMSQHFASLKPGDKVEVKGPIQKLQ  580
             G+P + IRPYTPI+ PDA+GHFDL IKVY +   GK+S  F  L  GD  + KGP+ KL 
Sbjct  99    GRPGWAIRPYTPITAPDARGHFDLAIKVYKQPSPGKVSTFFEGLSVGDSADFKGPLPKLS  158

Query  581   YRPNMK-KHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVL  757
                  K K +G++AGG+G+TPMLQV    L+      ++S ++ANVS DDI+++K LD L
Sbjct  159   LSDIAKRKEVGLVAGGTGLTPMLQVATEALRQ-GLPLKLSFIFANVSEDDIVMRKHLDGL  217

Query  758   AATHPNLKVFYTVDSPT-KEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSG  934
             AA H N +V+Y VD  T K W GG GFI+KDM+ + LP P  D+L+ VCGPPGMM  +SG
Sbjct  218   AAKHDNFRVYYVVDKATSKSWPGGVGFITKDMLKQHLPHPGPDSLVLVCGPPGMMGALSG  277

Query  935   EK-DKREQGELSGVLKEVGYTENMVYKF  1015
             +K   + QG L+G+LKE+G+ E+ VYKF
Sbjct  278   DKLPDKSQGPLTGLLKELGFDESNVYKF  305



>emb|CDS10572.1| hypothetical protein LRAMOSA11058 [Absidia idahoensis var. thermophila]
Length=339

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/269 (45%), Positives = 176/269 (65%), Gaps = 7/269 (3%)
 Frame = +2

Query  224   EDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQD  403
             E ++   A +P ++ EF L D  P++HN   FRF        GL +ASCI TR    + D
Sbjct  73    EASNPPAAFSPEEFREFTLVDVMPINHNVSRFRFKLPDGHVSGLHVASCIFTRHRFKKPD  132

Query  404   AEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQY  583
               G  +  +RPYTP SD DA+G+ D +IK YP+GKMS+H   LKPGDK+E+KGPI K  +
Sbjct  133   --GTEEATMRPYTPTSDEDARGYVDFVIKDYPQGKMSRHIHLLKPGDKLEIKGPIPKYNW  190

Query  584   RPNMKKHIGMIAGGSGITPMLQVIEAIL--KNPDDNTQISLLYANVSPddillkkkldVL  757
                 K+H+GMIAGG+GITPMLQ++  I    + D+NT+++L++ N +  DI+LK++LD  
Sbjct  191   DQGKKEHVGMIAGGTGITPMLQLLRKIFGPSSKDNNTKVTLIFGNQTEKDIILKEELDSY  250

Query  758   AATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSD-DTLIFVCGPPGMMTHVS  931
             A + PN  KV Y VD PTK W G  G+++ +++ K LP P   +++IFVCGP  M+  ++
Sbjct  251   AKSFPNRFKVVYAVDKPTKNWDGHHGYVNDELIKKHLPSPDQPNSIIFVCGPDAMLASLA  310

Query  932   GEKD-KREQGELSGVLKEVGYTENMVYKF  1015
             G K   + QG L+GVLK++GY ++ VYKF
Sbjct  311   GAKAPDKSQGPLNGVLKDMGYPQDHVYKF  339



>gb|KFH45499.1| NADH-cytochrome b5 reductase-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=329

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 171/256 (67%), Gaps = 11/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL--GLDIASCIITRAPIGQQDAEGKPKYVIRP  436
             ++  KL D   V+HNT  FRF   P   +  GL +AS I+T+   G  D     K  +RP
Sbjct  80    FLSLKLADVELVNHNTKRFRFEL-PEGDMVSGLHVASAILTKYK-GPNDE----KATLRP  133

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTPISD  AKG+ DLL+K YP+G MS H  +++PG +++VKGP+ K  +  N   HI ++
Sbjct  134   YTPISDEGAKGYIDLLVKRYPDGPMSNHLHNMRPGQRLDVKGPLPKYPWTENKHDHIALV  193

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             AGG+GITPM Q+  AI  NP+D T+++L++ NVS  DILLKK+   L  T+P   + FY 
Sbjct  194   AGGTGITPMYQLARAIFSNPNDKTKVTLVFGNVSEGDILLKKEFADLENTYPQRFRAFYV  253

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEKDK-REQGELS  967
             +D PTK+W G SG+I+KD++   LP P ++ + +FVCGPPGMM  +SG K   ++QGELS
Sbjct  254   LDKPTKDWAGASGYINKDLLKTVLPEPKEENIKVFVCGPPGMMKAISGPKTSPKDQGELS  313

Query  968   GVLKEVGYTENMVYKF  1015
             G+LKE+GY ++ VYKF
Sbjct  314   GLLKELGYKQDQVYKF  329



>emb|CDO68486.1| hypothetical protein BN946_scf184499.g11 [Trametes cinnabarina]
Length=332

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 178/268 (66%), Gaps = 9/268 (3%)
 Frame = +2

Query  233   SRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQ----  400
             S K+AL+P  +++FKL+   P +HNT  F F   P     L +ASC++ ++P        
Sbjct  67    SDKSALDPQNFVDFKLKKVEPYNHNTAKFIFELPPDTASLLPVASCVVVKSPPDAPNPLL  126

Query  401   DAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQ  580
             D++GKP  +IRPYTPIS  D  G    LIK Y  GKMS++   L+PGD++ +KGPI+K  
Sbjct  127   DSKGKP--IIRPYTPISPSDLPGELTFLIKRYDTGKMSKYIHELQPGDRLSIKGPIKKFD  184

Query  581   YRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLA  760
             ++ N    +GMIAGGSGITPM Q++E  L++P + T+ +L++ANV+  DILLK++ D L 
Sbjct  185   FQINQFDEVGMIAGGSGITPMYQILEHALRDPSNKTRFTLIFANVTEKDILLKEEFDALR  244

Query  761   ATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPS--DDTLIFVCGPPGMMTHVS  931
             A +P+   V YTVD  +  W+G  G+++ ++V + LPPP+  +   IFVCGPPG +  ++
Sbjct  245   AKYPSTFNVVYTVDQASPGWKGPVGYVNDELVQQHLPPPNLGEKAKIFVCGPPGQVAALA  304

Query  932   GEKDKREQGELSGVLKEVGYTENMVYKF  1015
             G KD  +QGEL G+LK++GYT++ V+KF
Sbjct  305   GPKDGMKQGELGGILKKLGYTDDQVFKF  332



>gb|KDN61616.1| putative oxidoreductase NAD-binding domain-containing protein 
[Colletotrichum sublineola]
Length=333

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 167/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++  KLED   V+HNT  FRF       + GL++AS ++T+   G +D     K  +RPY
Sbjct  84    FVSLKLEDVENVNHNTKKFRFKLPEDDMVSGLEVASAVLTKYK-GPEDE----KATLRPY  138

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP SD DAKG+ +L++K YP G MS H   + PG +++ KGP+ K  + PN   HI +IA
Sbjct  139   TPTSDEDAKGYLELIVKKYPNGPMSTHMHDMTPGQRLDFKGPLPKYPWSPNKHDHIALIA  198

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI KNPDD T+++L++ NVS +DILLKK+   L   +P   + FY +
Sbjct  199   GGTGITPMYQLARAIFKNPDDKTKVTLVFGNVSEEDILLKKEFSELENMYPQRFRAFYVL  258

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEKDK-REQGELSG  970
             D+P KEW G  GFI+KD++ + LP P S++  +FVCGPPGMM  +SG K   ++QGEL G
Sbjct  259   DNPPKEWVGNKGFITKDLLKQVLPEPKSENIKVFVCGPPGMMNAISGNKKSPKDQGELVG  318

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GY    VYKF
Sbjct  319   ALKELGYKPEQVYKF  333



>dbj|GAM38127.1| hypothetical protein TCE0_033f08621 [Talaromyces cellulolyticus]
Length=323

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 173/256 (68%), Gaps = 12/256 (5%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITR-APIGQQDAEGKPKYVIRP  436
             +++ KL D   +S NT  +RF F D  A  GL +AS ++T+ AP      EGKP  ++RP
Sbjct  75    FVDLKLSDIEILSPNTKRYRFEFEDKEAVSGLHVASALLTKYAP-----PEGKP--ILRP  127

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTPISD D  G+ DL++K YP+G MS H  S+  G +++ KGP  K  +  N   HI +I
Sbjct  128   YTPISDEDTPGYLDLIVKRYPDGPMSSHLDSMNVGQRLDFKGPFPKYPWEANKHTHIALI  187

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             AGG+GITPM Q+I AI KNPDD T+++L+Y NVS +DILLKK+L  L  T+P   KVFY 
Sbjct  188   AGGTGITPMYQLIRAIFKNPDDKTKVTLVYGNVSEEDILLKKELQHLENTYPQRFKVFYL  247

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVS-GEKDKREQGELS  967
             +D+P KEW GG G+++K+++   LP P ++ + +FVCGPPGM   +S G+K   +QGEL+
Sbjct  248   LDNPPKEWTGGKGYVTKELLKTVLPEPKEENVKVFVCGPPGMYKAISGGKKSPSDQGELA  307

Query  968   GVLKEVGYTENMVYKF  1015
             G LKE+GY +  VYKF
Sbjct  308   GYLKELGYDKEQVYKF  323



>emb|CCM00046.1| predicted protein [Fibroporia radiculosa]
Length=333

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/267 (44%), Positives = 175/267 (66%), Gaps = 9/267 (3%)
 Frame = +2

Query  236   RKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQDA---  406
              K+ L+P  +++FKL+   P +HNT  + F         L +ASC++ ++P    +A   
Sbjct  69    EKSPLDPENFVDFKLKRVEPYNHNTARYIFELPDGQASLLPVASCVVVKSPDDAPNALKG  128

Query  407   -EGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQY  583
               GKP  VIRPYTP+S PD  G F  LIK Y EGKMS+H + L+PG+ + +KGPI K+ Y
Sbjct  129   PNGKP--VIRPYTPVSPPDLPGEFIFLIKRYDEGKMSKHISELQPGESLAIKGPIMKIPY  186

Query  584   RPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAA  763
             + N  + +GMIAGGSGITPM QV++  L +P + T+ +L++ANV+  DILL+ + D L  
Sbjct  187   KANEFEQVGMIAGGSGITPMYQVLKHALADPTNTTRFTLVFANVTEKDILLRDEFDALKK  246

Query  764   THPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPS--DDTLIFVCGPPGMMTHVSG  934
              HP+ L V YT+D     W+G  G+++K+++ + + P S      +FVCGPPG ++ ++G
Sbjct  247   AHPDTLDVVYTLDQADDSWKGYKGYVNKEIITQHIGPASLGSKVKVFVCGPPGQVSAIAG  306

Query  935   EKDKREQGELSGVLKEVGYTENMVYKF  1015
             +KD  +QGEL G+LKE+GYTE+ V+KF
Sbjct  307   KKDGMKQGELGGILKELGYTEDQVFKF  333



>gb|EGZ77533.1| NADH-cytochrome b5 reductase 2 [Neurospora tetrasperma FGSC 2509]
Length=343

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 171/256 (67%), Gaps = 11/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITR-APIGQQDAEGKPKYVIRP  436
             W+  KLE+   V+HNT   RF       + GL +AS I+T+  PI   DAE   K V+RP
Sbjct  94    WLSLKLEEVELVNHNTKRLRFRLPEDDMVSGLHVASAILTKFKPI---DAE---KAVLRP  147

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTPISD  A+G+ DLL+K Y  G MS +   + PG ++++KGP+ K  +  N  KHI ++
Sbjct  148   YTPISDESAQGYIDLLVKKYEGGPMSTYLHDMAPGQRLDIKGPLPKYPWEANKHKHIALV  207

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             AGG+GITPM Q+I AI  NPDD T+++L++ NVS +D+LLK +L  +   +P   + FY 
Sbjct  208   AGGTGITPMYQLIRAIFNNPDDKTKVTLVFGNVSEEDVLLKHELATIENHYPQRFRAFYV  267

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEKDK-REQGELS  967
             +D+P KEW G  G+I+KD++   LP P ++D  IFVCGPPGMM  +SG K   R+QGE++
Sbjct  268   LDNPPKEWAGNKGYINKDLLKTVLPEPKNEDIKIFVCGPPGMMNSISGNKKSPRDQGEVT  327

Query  968   GVLKEVGYTENMVYKF  1015
             G+LKE+GY+ + VYKF
Sbjct  328   GILKELGYSPDQVYKF  343



>ref|XP_007741886.1| NADH-cytochrome b5 reductase 2 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ73323.1| NADH-cytochrome b5 reductase 2 [Cladophialophora psammophila 
CBS 110553]
Length=351

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 173/255 (68%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             +I+ KL +  P +HNT  F+F   D     GL++AS I+T+     Q+     K VIRPY
Sbjct  102   FIDLKLAEIIPYNHNTKRFQFELPDKEHVSGLNVASAIVTKFKPADQE-----KPVIRPY  156

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPI+D D KG+ +LL+KVYP G MS+H  S+KPG+ +  KGPI K  + PN  +HI +IA
Sbjct  157   TPINDEDVKGYLELLVKVYPNGPMSEHLHSMKPGETLSFKGPIPKYPWAPNKHEHITLIA  216

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+I  I KNPDD T++SL++ N+  +DILLK++L  L    P   + FYT+
Sbjct  217   GGTGITPMYQLIRTIFKNPDDTTKVSLVFGNIKEEDILLKQELSQLENEFPQRFRCFYTL  276

Query  797   DSPTKEWRGGSGFISKDMVVKGLP-PPSDDTLIFVCGPPGMMTHVSGEKDK-REQGELSG  970
             D+P + W  G GFI+K+++ + +P P S++  IFVCGPPGM   +SG K   ++QGEL+G
Sbjct  277   DNPPESWPYGKGFITKELLKEVIPDPKSENIKIFVCGPPGMYKAISGAKTSPQDQGELTG  336

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GY ++ V+KF
Sbjct  337   ILKELGYAKDQVFKF  351



>gb|EHK25217.1| hypothetical protein TRIVIDRAFT_85020 [Trichoderma virens Gv29-8]
Length=327

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 122/255 (48%), Positives = 167/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W+  K+ +   V+HNT   RF      ++ GL IAS ++T+       A    K  +RPY
Sbjct  78    WLSLKVSEVEDVNHNTKRVRFELPEKDQVSGLHIASAVLTKF-----KAPNAEKATLRPY  132

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD D KG  DLL+K YP G MS H   LK G+++ +KGP+ K  +  N   HI +IA
Sbjct  133   TPVSDEDDKGFLDLLVKKYPNGPMSTHIHDLKVGEELAIKGPLPKYSWSENKHDHIALIA  192

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q++ AI KNP+D T+++L++ NV+ +DILLK K D L  T+P   + FYT+
Sbjct  193   GGTGITPMYQLVRAIFKNPNDKTKVTLIFGNVTKEDILLKSKFDELENTYPQRFRAFYTL  252

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D   KEW GGSGFISKD++ + LP P S++  +FVCGPPG+M  +SG K   ++QGEL+G
Sbjct  253   DKAPKEWVGGSGFISKDLLKQVLPEPKSENIKLFVCGPPGLMKAISGPKVSPKDQGELTG  312

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GYT   VYKF
Sbjct  313   SLKELGYTAEQVYKF  327



>ref|XP_007802205.1| NADH-cytochrome b5 reductase 2 [Endocarpon pusillum Z07020]
 gb|ERF72136.1| NADH-cytochrome b5 reductase 2 [Endocarpon pusillum Z07020]
Length=321

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/255 (47%), Positives = 174/255 (68%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             +I+ KL + + ++HN    RF   D  A  GL +AS +IT+     QD E   K VIRPY
Sbjct  72    FIDLKLSEVSDINHNVKRLRFELPDKDAVSGLTVASALITK--YKSQDME---KPVIRPY  126

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD D +G+ DLLIK YP G MS+H  S+ PG +++ KGPI K Q+  N   HI +IA
Sbjct  127   TPISDEDERGYLDLLIKRYPNGPMSEHMHSMTPGQRLDFKGPIPKYQWSTNKHNHIALIA  186

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+   I K+P + T+++L++ANV  +DILLKK+ + L   +PN  + FYT+
Sbjct  187   GGTGITPMFQLTRRIFKDPAEKTKVTLVFANVGEEDILLKKEFERLENEYPNRFRAFYTL  246

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSG-EKDKREQGELSG  970
             D+P + W  G+G+++K+++ K +P P ++ + +FVCGPPGM   +SG +K  ++QGELSG
Sbjct  247   DTPPQSWPYGTGYVTKELLEKVIPGPKEENVKVFVCGPPGMYKAISGMKKSPQDQGELSG  306

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GY+E  VYKF
Sbjct  307   ILKELGYSEEQVYKF  321



>emb|CCE35167.1| probable cytochrome-b5 reductase, mitochondrial outer membrane 
form [Claviceps purpurea 20.1]
Length=331

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 175/275 (64%), Gaps = 11/275 (4%)
 Frame = +2

Query  209   LDQINEDTSRKTALNPNQ--WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIIT  379
             +++I E  + KTA       +I  KL D   V+HNT   RF    S ++ GL +AS I+T
Sbjct  62    VEKIKEPVAAKTAFTGGDQGFISLKLADVENVNHNTKRLRFELPESDQVSGLSVASAILT  121

Query  380   RAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVK  559
             +   G +D     K  +RPYTPISD D KG+ DLL+K YP G MS H  +L PG +++ K
Sbjct  122   KYK-GPEDE----KATLRPYTPISDEDEKGYLDLLVKKYPGGPMSTHMHNLVPGQRLDFK  176

Query  560   GPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillk  739
             GP+ K  +  N   HI +IAGG+GITPM Q+  AI  NP+D TQ++L+  NVS  DILL+
Sbjct  177   GPLPKYAWSENKHDHIALIAGGTGITPMYQLCRAIFNNPNDKTQVTLVVGNVSEQDILLR  236

Query  740   kkldVLAATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPG  913
             ++L  L  T+P   + FY +D   K W GGSGFI+K+++   LP P S++  +FVCGPPG
Sbjct  237   RELADLENTYPQRFRAFYVLDKAPKGWAGGSGFINKELLKTVLPEPKSENIKVFVCGPPG  296

Query  914   MMTHVSGEK-DKREQGELSGVLKEVGYTENMVYKF  1015
             +M  +SG K   ++QGELSG LKE+GYT+  VYKF
Sbjct  297   LMKAISGAKVSPKDQGELSGSLKELGYTKEQVYKF  331



>ref|XP_002150236.1| NADH-cytochrome b5 reductase, putative [Talaromyces marneffei 
ATCC 18224]
 gb|EEA21627.1| NADH-cytochrome b5 reductase, putative [Talaromyces marneffei 
ATCC 18224]
Length=273

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 171/256 (67%), Gaps = 12/256 (5%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITR-APIGQQDAEGKPKYVIRP  436
             ++  KL D   VS +T  +RF F D  A  GL +AS ++T+ AP      EGKP  ++RP
Sbjct  25    FVNLKLADIEVVSPDTKRYRFEFEDKEAVSGLHVASALLTKYAP-----PEGKP--ILRP  77

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTPISD D  GH DL++K YP G M+ H  S+  G  ++ KGP+ K  +  N   HI +I
Sbjct  78    YTPISDEDTPGHLDLIVKHYPNGAMTSHMDSMSVGQSLDFKGPLPKYPWDANKHTHIALI  137

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             AGG+GITPM Q+I AI KNP+D T+++L+Y NV+ DDILLKK+L  L  T+P   K FY 
Sbjct  138   AGGTGITPMYQLIRAIFKNPEDKTKVTLVYGNVTEDDILLKKELQHLENTYPQRFKTFYL  197

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVS-GEKDKREQGELS  967
             +D P KEW GGSG+++K+++   LP P ++ + +FVCGPPGM   +S G+K  R+QGEL+
Sbjct  198   LDKPPKEWTGGSGYVTKELLKTVLPEPKEENIKVFVCGPPGMYKAISGGKKSPRDQGELT  257

Query  968   GVLKEVGYTENMVYKF  1015
             G LKE+GY +  VYKF
Sbjct  258   GYLKELGYDQEQVYKF  273



>ref|XP_006696352.1| putative cytochrome b5 protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS18021.1| putative cytochrome b5 protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=349

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 166/256 (65%), Gaps = 11/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRA-PIGQQDAEGKPKYVIRP  436
             W+  KLED   V+HNT   R        + GL +AS ++T+  PIG        K VIRP
Sbjct  100   WLSLKLEDVELVNHNTKRLRLRLPEDDMVSGLHVASAVLTKYHPIGAD------KPVIRP  153

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTPISD   KG+ DLL+K YP G MS +   + PG +++VKGPI K  + PN  KHI ++
Sbjct  154   YTPISDETEKGYIDLLVKKYPNGPMSTYLHDMVPGQRLDVKGPIPKYPWEPNKHKHIALV  213

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYT  793
             AGG+GITPM Q+  AI  NPDD T+++L++ N+S +DILLK +L  L  T+P   + FY 
Sbjct  214   AGGTGITPMYQLCRAIFNNPDDQTKVTLVFGNISEEDILLKNELAKLENTYPRRFRAFYV  273

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEKDK-REQGELS  967
             +D+P   W GG G+I+K+++   LP P ++ + +FVCGPPGMM  +SG K   ++QGEL 
Sbjct  274   LDNPPAHWTGGKGYITKELLKTVLPEPKEENIKVFVCGPPGMMELISGNKKSPKDQGELK  333

Query  968   GVLKEVGYTENMVYKF  1015
             G+LKE+GY+   VYKF
Sbjct  334   GILKELGYSPEQVYKF  349



>ref|XP_003005835.1| NADH-cytochrome b5 reductase [Verticillium alfalfae VaMs.102]
 gb|EEY17679.1| NADH-cytochrome b5 reductase [Verticillium alfalfae VaMs.102]
Length=334

 Score =   223 bits (568),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 121/269 (45%), Positives = 173/269 (64%), Gaps = 11/269 (4%)
 Frame = +2

Query  227   DTSRKTALN--PNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQ  397
             + + K ALN     ++   LE+   V+HNT  FRF      ++ GL +AS ++T+    +
Sbjct  71    NATTKKALNGVDQGFVSLALENVEIVNHNTKRFRFKLPEDDQVSGLSVASAVLTKYKGPE  130

Query  398   QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKL  577
              +     K V+RPYTP+SD DAKG+ DLL+K YP+G MS H   + PG +++ KGP+ K 
Sbjct  131   ME-----KAVLRPYTPVSDEDAKGYLDLLVKKYPDGPMSTHMHDMTPGQRLDFKGPLPKY  185

Query  578   QYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVL  757
              +  N  +HI +IAGG+GITPM Q+  AI  NP D T+++L++ NV+ +DILL+K+   L
Sbjct  186   AWTANKHEHIALIAGGTGITPMYQLARAIFNNPADKTKVTLVFGNVTEEDILLRKEFAEL  245

Query  758   AATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSD-DTLIFVCGPPGMMTHVS  931
               T+P   + FY +D PT EW GG GFI K+++   LP PS  D  +FVCGPPG+M  VS
Sbjct  246   ENTYPQRFRAFYVLDKPTGEWSGGKGFIDKNLLKTVLPEPSSGDVKVFVCGPPGLMNAVS  305

Query  932   GEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             G K   ++QGEL G+LKE+GY+ + VYKF
Sbjct  306   GNKKSPKDQGELVGILKELGYSPDQVYKF  334



>ref|XP_009856344.1| hypothetical protein NEUTE1DRAFT_118894 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO52706.1| hypothetical protein NEUTE1DRAFT_118894 [Neurospora tetrasperma 
FGSC 2508]
Length=343

 Score =   223 bits (569),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/255 (47%), Positives = 169/255 (66%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W+  KLE+   V+HNT   RF       + GL +AS I+T+      DAE   K V+RPY
Sbjct  94    WLSLKLEEVELVNHNTKRLRFRLPEDDMVSGLHVASAILTK--FKPFDAE---KAVLRPY  148

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD  A+G+ DLL+K Y  G MS +   + PG ++++KGP+ K  +  N  KHI ++A
Sbjct  149   TPISDESAQGYIDLLVKKYEGGPMSTYLHDMAPGQRLDIKGPLPKYPWEANKHKHIALVA  208

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+I AI  NPDD T+++L++ N+S +D+LLK +L  +   +P   + FY +
Sbjct  209   GGTGITPMYQLIRAIFNNPDDKTKVTLVFGNISEEDVLLKHELATIENHYPQRFRAFYVL  268

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEKDK-REQGELSG  970
             D+P KEW G  G+I+KD++   LP P ++D  IFVCGPPGMM  +SG K   R+QGEL+G
Sbjct  269   DNPPKEWAGNKGYINKDLLKTVLPEPKNEDIKIFVCGPPGMMNSISGNKKSPRDQGELTG  328

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GY+ + VYKF
Sbjct  329   ILKELGYSPDQVYKF  343



>ref|XP_008032497.1| ferredoxin reductase-like C-terminal NADP-linked domain-containing 
protein [Trametes versicolor FP-101664 SS1]
 gb|EIW63702.1| ferredoxin reductase-like C-terminal NADP-linked domain-containing 
protein [Trametes versicolor FP-101664 SS1]
Length=329

 Score =   223 bits (567),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 122/283 (43%), Positives = 177/283 (63%), Gaps = 14/283 (5%)
 Frame = +2

Query  203   VYLDQINE-----DTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
             +YLD+ N        S K+ L+P  +++FKL+   P ++NT  F F         L +AS
Sbjct  49    LYLDRANAAPVKPKISDKSPLDPQNFVDFKLKKVEPYNYNTAKFIFELPADTASLLPVAS  108

Query  368   CIITRAPIGQQ----DAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLK  535
             C++ ++         D +GKP  VIRPYTPIS  D  G    LIK Y  GKMS++F  L 
Sbjct  109   CVVVKSAADTATPLLDDKGKP--VIRPYTPISPSDKPGELTFLIKKYETGKMSKYFFELN  166

Query  536   PGDKVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANV  715
             PGDK+ +KGPI K +Y+ N  + +GMIAGGSGITPM Q+++  L++P + T+ +L++ANV
Sbjct  167   PGDKLSIKGPIPKFEYKINQFEQVGMIAGGSGITPMYQILDYALQDPSNKTRFTLIFANV  226

Query  716   SPddillkkkldVLAATHP-NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPS--DDT  886
             +  DILLK++ D L A +P    V YT+D P+  W G +G++++++V   LP  +  D  
Sbjct  227   AEKDILLKEEFDALKAKYPKTFNVVYTLDKPSAGWTGTTGYVNQELVSTHLPAAALGDKA  286

Query  887   LIFVCGPPGMMTHVSGEKDKREQGELSGVLKEVGYTENMVYKF  1015
              IFVCGPPG +  +SG K   +QGEL G+LK++GYTE  V+KF
Sbjct  287   KIFVCGPPGQVAAISGPKKGYQQGELGGILKQLGYTEEQVFKF  329



>ref|XP_001220073.1| hypothetical protein CHGG_00852 [Chaetomium globosum CBS 148.51]
 sp|Q2HG02.1|MCR1_CHAGB RecName: Full=NADH-cytochrome b5 reductase 2; AltName: Full=Mitochondrial 
cytochrome b reductase [Chaetomium globosum CBS 
148.51]
 gb|EAQ92617.1| hypothetical protein CHGG_00852 [Chaetomium globosum CBS 148.51]
Length=348

 Score =   223 bits (569),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 167/256 (65%), Gaps = 11/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITR-APIGQQDAEGKPKYVIRP  436
             W+  KLE+   V+HN+   RF       + G+ +AS I+T+  P+   DAE   K VIRP
Sbjct  99    WVSLKLEEVEIVNHNSKRLRFRLPEDDMVSGVHVASAILTKFKPV---DAE---KPVIRP  152

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTP +D DA+G+ DLL+K YP G MS H   + PG +++VKGP+ K  +  N   HI ++
Sbjct  153   YTPTNDEDARGYLDLLVKKYPNGPMSTHLHDMVPGQRLDVKGPLPKYPWTANKHGHIALV  212

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYT  793
             AGG+GITPM Q+  AI  NPDD T+++L++ NV  DDILLKK+L  L   +P   + FY 
Sbjct  213   AGGTGITPMFQLCRAIFNNPDDQTKVTLVFGNVREDDILLKKELAALENNNPRRFRAFYV  272

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEKDK-REQGELS  967
             +D P K W GG GFI+KD++   LP P D+ + +FVCGPPGMM  +SG K   ++QGEL 
Sbjct  273   LDDPPKHWTGGKGFITKDLLKTVLPEPKDENIKVFVCGPPGMMDAISGNKKSPKDQGELK  332

Query  968   GVLKEVGYTENMVYKF  1015
             G+LKE+GY+   VYKF
Sbjct  333   GILKELGYSPEQVYKF  348



>ref|XP_009159077.1| NADH-cytochrome b5 reductase 2 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY58616.1| NADH-cytochrome b5 reductase 2 [Exophiala dermatitidis NIH/UT8656]
Length=338

 Score =   223 bits (568),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 176/268 (66%), Gaps = 9/268 (3%)
 Frame = +2

Query  224   EDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQ  400
             ++TS+        +I  KL +  P +HNT  F+F   DP    GL +AS IIT+    Q 
Sbjct  76    DETSKAFTGGDQGFISLKLAEVIPYNHNTKRFKFELPDPEQVSGLSVASAIITKY---QP  132

Query  401   DAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQ  580
                 KP  +IRPYTPI+D D KG+ +LL+KVYP G MS H  S+ PG ++E KGPI K  
Sbjct  133   PNAEKP--IIRPYTPINDEDVKGYLELLVKVYPNGPMSNHLHSMVPGQRLEFKGPIPKYP  190

Query  581   YRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLA  760
             + PN   HI +IAGG+GITPM Q+I  I KNP+D T++SL+Y NV+ DDILLKK+L+ + 
Sbjct  191   WAPNKHDHITLIAGGTGITPMFQLIRTIFKNPEDKTKVSLIYGNVTEDDILLKKELEEIE  250

Query  761   ATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLP-PPSDDTLIFVCGPPGMMTHVSG  934
                P   + FYT+D+P   W  G GFI+K+++   +P P S +  IFVCGPPGM   +SG
Sbjct  251   NEFPQRFRAFYTLDNPPPSWPYGKGFITKELLKTVIPDPKSPNIKIFVCGPPGMYNAISG  310

Query  935   -EKDKREQGELSGVLKEVGYTENMVYKF  1015
              +K  ++QGEL+G+LKE+GY+++ V+KF
Sbjct  311   NKKSPQDQGELTGILKELGYSKDQVFKF  338



>ref|XP_002150235.1| NADH-cytochrome b5 reductase, putative [Talaromyces marneffei 
ATCC 18224]
 gb|EEA21626.1| NADH-cytochrome b5 reductase, putative [Talaromyces marneffei 
ATCC 18224]
 gb|KFX43567.1| NADH-cytochrome b5 reductase 2 [Talaromyces marneffei PM1]
Length=323

 Score =   222 bits (566),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 171/256 (67%), Gaps = 12/256 (5%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITR-APIGQQDAEGKPKYVIRP  436
             ++  KL D   VS +T  +RF F D  A  GL +AS ++T+ AP      EGKP  ++RP
Sbjct  75    FVNLKLADIEVVSPDTKRYRFEFEDKEAVSGLHVASALLTKYAP-----PEGKP--ILRP  127

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTPISD D  GH DL++K YP G M+ H  S+  G  ++ KGP+ K  +  N   HI +I
Sbjct  128   YTPISDEDTPGHLDLIVKHYPNGAMTSHMDSMSVGQSLDFKGPLPKYPWDANKHTHIALI  187

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             AGG+GITPM Q+I AI KNP+D T+++L+Y NV+ DDILLKK+L  L  T+P   K FY 
Sbjct  188   AGGTGITPMYQLIRAIFKNPEDKTKVTLVYGNVTEDDILLKKELQHLENTYPQRFKTFYL  247

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVS-GEKDKREQGELS  967
             +D P KEW GGSG+++K+++   LP P ++ + +FVCGPPGM   +S G+K  R+QGEL+
Sbjct  248   LDKPPKEWTGGSGYVTKELLKTVLPEPKEENIKVFVCGPPGMYKAISGGKKSPRDQGELT  307

Query  968   GVLKEVGYTENMVYKF  1015
             G LKE+GY +  VYKF
Sbjct  308   GYLKELGYDQEQVYKF  323



>gb|EPB87581.1| hypothetical protein HMPREF1544_05563 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=335

 Score =   222 bits (566),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/266 (45%), Positives = 176/266 (66%), Gaps = 10/266 (4%)
 Frame = +2

Query  230   TSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQDAE  409
             T+  +A NP+ ++  KL +  PVSHNT +FRF+       GL +ASC++ +       AE
Sbjct  76    TAPASAFNPSGFVSLKLLEVQPVSHNTSIFRFALPEGHASGLPVASCVVAK----HTPAE  131

Query  410   GKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRP  589
             GKP  +IRPYTP+S+ +  GH D +IK Y  G ++    ++KPGD +E KGPI K  +  
Sbjct  132   GKP--IIRPYTPVSEEETVGHVDFIIKKYDNGALTPTIHNMKPGDSLEFKGPIPKYNWEQ  189

Query  590   NMKKHIGMIAGGSGITPMLQVIEAIL--KNPDDNTQISLLYANVSPddillkkkldVLAA  763
             + K ++GMIAGG+GITPMLQ+I  +   K+ D  T+ISL++AN + +DILLK +LD +A 
Sbjct  190   DQKANVGMIAGGTGITPMLQIIRRVFHEKSDDKKTKISLIFANQTEEDILLKDELDKIAK  249

Query  764   THPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSD-DTLIFVCGPPGMMTHVSGE  937
              HP+  KV Y VD   + W G +G+++K++V   LP P + D++IFVCGPP M+  ++G 
Sbjct  250   EHPDRFKVVYAVDKAPENWSGVTGYVTKEVVEANLPSPKEADSIIFVCGPPPMVKSIAGP  309

Query  938   KDKREQGELSGVLKEVGYTENMVYKF  1015
             +  + QGEL GVLKE+GY++  V+KF
Sbjct  310   RTMKSQGELEGVLKELGYSQEKVFKF  335



>ref|XP_002997509.1| NADH-cytochrome b5 reductase, putative [Phytophthora infestans 
T30-4]
 gb|EEY68703.1| NADH-cytochrome b5 reductase, putative [Phytophthora infestans 
T30-4]
Length=296

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/262 (44%), Positives = 171/262 (65%), Gaps = 11/262 (4%)
 Frame = +2

Query  239   KTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAK--LGLDIASCIITRAPIGQQDAEG  412
             K AL+P ++  FK+     V+H+T    F+  PS +  +G+ +ASC++ +A +  ++   
Sbjct  43    KVALSPKEFRSFKVTKVEEVTHDTKRLVFAL-PSKEHEMGITVASCLMAKASVDGKN---  98

Query  413   KPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPN  592
                 V+RPYTP +    KG  +L++K YP GK+S+H   L  GD++ +KGP  K +Y+PN
Sbjct  99    ----VVRPYTPTNTNAEKGELELVVKGYPTGKLSKHIVDLNVGDELAMKGPFVKFEYKPN  154

Query  593   MKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP  772
               K IG + GGSGITP LQV++ I +NPDD+TQ+ L++ N +  DI+L+ +LD L   +P
Sbjct  155   QYKSIGFLCGGSGITPALQVVKEICRNPDDSTQVVLIFCNRTEKDIILRDELDALQYMYP  214

Query  773   NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKD-KR  949
               +V Y +D P   W G SG+++K++V K LP PSD+TLI VCGPP MM  +SG K   R
Sbjct  215   QFQVNYVLDKPEANWEGYSGYVTKELVEKLLPGPSDETLIGVCGPPPMMDAISGNKAPDR  274

Query  950   EQGELSGVLKEVGYTENMVYKF  1015
              QGEL G+LKE+GYT + V+K+
Sbjct  275   SQGELKGLLKEMGYTSSQVFKY  296



>ref|XP_006966653.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR47546.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETS00881.1| ferredoxin reductase-like protein [Trichoderma reesei RUT C-30]
Length=331

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 172/257 (67%), Gaps = 13/257 (5%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITR--APIGQQDAEGKPKYVIR  433
             ++  K+ +   V+HNT   RF      ++ GL +AS I+T+  AP    DAE   K  +R
Sbjct  82    FLSLKVSEIEDVNHNTKRVRFDLPEKDQVSGLHVASAILTKFKAP----DAE---KATLR  134

Query  434   PYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGM  613
             PYTPISD D +G  DLL+K YP G MS H  SLK GD + +KGP+ K  +  N  +HI +
Sbjct  135   PYTPISDEDDRGFIDLLVKKYPNGPMSTHIHSLKVGDSLAIKGPLPKYPWTENKHEHIAL  194

Query  614   IAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFY  790
             IAGG+GITPM Q++ AI KNP+D T+++L++ NV+ +DILLK K D L  T+P   + FY
Sbjct  195   IAGGTGITPMYQLVRAIFKNPNDKTKVTLVFGNVTKEDILLKSKFDELENTYPQRFRAFY  254

Query  791   TVDSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEKDK-REQGEL  964
             T+D P K+W GG GFI+KD++ + LP P S++  +FVCGPPG+M  +SG K   ++QGEL
Sbjct  255   TLDKPPKDWVGGGGFITKDLLKQVLPEPKSENIKVFVCGPPGLMKAISGPKTSPKDQGEL  314

Query  965   SGVLKEVGYTENMVYKF  1015
             +G LKE+GYT   VYKF
Sbjct  315   TGALKELGYTAEQVYKF  331



>ref|XP_638259.1| NADH-cytochrome b5 reductase [Dictyostelium discoideum AX4]
 sp|Q54NC1.1|NCB5R_DICDI RecName: Full=NADH-cytochrome b5 reductase 1 [Dictyostelium discoideum]
 gb|EAL64774.1| NADH-cytochrome b5 reductase [Dictyostelium discoideum AX4]
Length=286

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/258 (47%), Positives = 174/258 (67%), Gaps = 20/258 (8%)
 Frame = +2

Query  245   ALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPK  421
             AL+P ++ +F+L+++  V+HNT +FRF+  +    LGL I   I  RA +G ++      
Sbjct  48    ALDPQEYRKFQLKEKFIVNHNTRIFRFALPNEDDILGLPIGQHISLRAVVGGKE------  101

Query  422   YVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKK  601
              V RPYTPIS  + +G+FDLLIKVY +G MS +  ++  GD +EVKGP  K  Y+PNM+K
Sbjct  102   -VYRPYTPISSDEERGYFDLLIKVYEKGAMSGYVDNMFIGDSIEVKGPKGKFNYQPNMRK  160

Query  602   HIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPNLK  781
              IGM+AGG+GITPMLQVI+AILKNP D T+ISL++ N++ +DILLKK+LD LA  HP  K
Sbjct  161   SIGMLAGGTGITPMLQVIKAILKNPSDKTEISLVFGNITEEDILLKKELDELAEKHPQFK  220

Query  782   VFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDKREQGE  961
             V+Y +++P K W  G GF+SK+++   LP PSD T++ +CGPP MM              
Sbjct  221   VYYVLNNPPKGWTQGVGFVSKEIIESRLPSPSDQTMVIMCGPP-MMNKA-----------  268

Query  962   LSGVLKEVGYTENMVYKF  1015
             ++G L+ +G+ E+ ++ F
Sbjct  269   MTGHLETIGFNESNIFTF  286



>ref|XP_381102.1| hypothetical protein FG00926.1 [Fusarium graminearum PH-1]
 gb|ESU06182.1| hypothetical protein FGSG_00926 [Fusarium graminearum PH-1]
 gb|EYB26326.1| hypothetical protein FG05_00926 [Fusarium graminearum]
 emb|CEF72969.1| unnamed protein product [Fusarium graminearum]
Length=331

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 164/255 (64%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W+  KL D   V+HNT   RF    + ++ GL +AS ++T+   G  D     K  +RPY
Sbjct  82    WVSLKLSDVEIVNHNTKRLRFELPEADQVSGLHVASALLTKYK-GPNDE----KATLRPY  136

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD   KG  DLLIK YP G MS H   + PG ++++KGP+ K  +  N   HI +IA
Sbjct  137   TPISDETDKGFLDLLIKKYPNGPMSTHLHDMAPGQRLDLKGPLPKYAWEENKHDHIALIA  196

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  NP D T+++L++ NVS  DILLKK+ + L  T+P   + FY +
Sbjct  197   GGTGITPMYQLARAIFNNPKDKTKVTLVFGNVSEQDILLKKQFEELENTYPQRFRAFYVL  256

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D+P K W GGSGFISKD++   LP P ++ + +FVCGPPG+M  +SG K   + QGEL+G
Sbjct  257   DNPPKGWAGGSGFISKDLLKTVLPEPKNENIKLFVCGPPGLMNAISGNKVSPKNQGELTG  316

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GY E+ VYKF
Sbjct  317   ALKELGYKEDQVYKF  331



>ref|XP_009263433.1| hypothetical protein FPSE_12041 [Fusarium pseudograminearum CS3096]
 gb|EKJ67769.1| hypothetical protein FPSE_12041 [Fusarium pseudograminearum CS3096]
Length=331

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 164/255 (64%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W+  KL D   V+HNT   RF    + ++ GL +AS ++T+   G  D     K  +RPY
Sbjct  82    WVSLKLSDVEIVNHNTKRLRFELPEADQVSGLHVASALLTKYK-GPNDE----KATLRPY  136

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD   KG  DLLIK YP G MS H   + PG ++++KGP+ K  +  N   HI +IA
Sbjct  137   TPISDETDKGFLDLLIKKYPNGPMSTHLHDMAPGQRLDLKGPLPKYAWEENKHDHIALIA  196

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  NP D T+++L++ NVS  DILLKK+ + L  T+P   + FY +
Sbjct  197   GGTGITPMYQLARAIFNNPKDKTKVTLVFGNVSEQDILLKKQFEELENTYPQRFRAFYVL  256

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D+P K W GGSGFISKD++   LP P ++ + +FVCGPPG+M  +SG K   + QGEL+G
Sbjct  257   DNPPKGWAGGSGFISKDLLKTVLPEPKNENIKLFVCGPPGLMNAISGNKVSPKNQGELTG  316

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GY E+ VYKF
Sbjct  317   ALKELGYKEDQVYKF  331



>emb|CDH59467.1| nadh-cytochrome b5 reductase 2 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=338

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/263 (46%), Positives = 174/263 (66%), Gaps = 7/263 (3%)
 Frame = +2

Query  242   TALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQDAEGKPK  421
              A +P ++ EF L D  P++HNT  FRF     +  GL +ASCI TR    + D  G   
Sbjct  78    AAFSPEEFREFTLVDVMPINHNTSRFRFKLPDDSVSGLHVASCIFTRHRYKKPD--GSEG  135

Query  422   YVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKK  601
              ++RPYTP SD   +G+ D +IK YP+GKMS+H   LKPGDK+E+KGPI K  +    K+
Sbjct  136   SIMRPYTPTSDEGERGYVDFVIKDYPQGKMSRHIHLLKPGDKLEIKGPIPKYNWDQGKKE  195

Query  602   HIGMIAGGSGITPMLQVIEAIL--KNPDDNTQISLLYANVSPddillkkkldVLAATHPN  775
             H+GMIAGG+GITPMLQ++  I    + D+NT+++L++ N + +DI+LKK+LD  A + P+
Sbjct  196   HVGMIAGGTGITPMLQLLRKIFGPSSKDNNTKVTLIFGNQTEEDIILKKELDSYAKSFPD  255

Query  776   -LKVFYTVDSPTKEWRGGSGFISKDMVVKGLP-PPSDDTLIFVCGPPGMMTHVSGEKD-K  946
               KV Y VD PTK W G  G+++ +++ K LP P   +++IFVCGP  M+  ++G K   
Sbjct  256   RFKVVYAVDKPTKNWDGHHGYVTAELIKKHLPNPDQSNSIIFVCGPDAMLASLAGPKAPD  315

Query  947   REQGELSGVLKEVGYTENMVYKF  1015
             + QG+L G+LKE+GY ++ VYKF
Sbjct  316   KSQGKLDGILKEMGYPQDHVYKF  338



>ref|XP_009648197.1| NADH-cytochrome b5 reductase [Verticillium dahliae VdLs.17]
 gb|EGY17334.1| NADH-cytochrome b5 reductase [Verticillium dahliae VdLs.17]
Length=334

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/269 (44%), Positives = 173/269 (64%), Gaps = 11/269 (4%)
 Frame = +2

Query  227   DTSRKTALN--PNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQ  397
             + + K ALN     ++   LE+   V+HNT  FRF      ++ GL +AS ++T+    +
Sbjct  71    NATTKKALNGVDQGFVSLALENVEIVNHNTKRFRFKLPEDDQVSGLSVASAVLTKYKGPE  130

Query  398   QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKL  577
              +     K V+RPYTP+SD DAKG+ DLL+K YP+G MS H   + PG +++ KGP+ K 
Sbjct  131   ME-----KAVLRPYTPVSDEDAKGYLDLLVKKYPDGPMSTHMHDMTPGQRLDFKGPLPKY  185

Query  578   QYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVL  757
              +  N  +HI ++AGG+GITPM Q+  AI  NP D T+++L++ NV+ +DILL+K+   L
Sbjct  186   AWTANKHEHIALVAGGTGITPMYQLARAIFNNPADKTKVTLVFGNVTEEDILLRKEFAEL  245

Query  758   AATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVS  931
               T+P   + FY +D PT EW GG GFI K+++   LP PS   + +FVCGPPG+M  VS
Sbjct  246   ENTYPQRFRAFYVLDKPTGEWSGGKGFIDKNLLKTVLPEPSSGNVKVFVCGPPGLMNAVS  305

Query  932   GEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             G K   ++QGEL G+LKE+GY+ + VYKF
Sbjct  306   GNKKSPKDQGELVGILKELGYSPDQVYKF  334



>ref|XP_001908827.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP69500.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP23520.1| Putative NADH-cytochrome b5 reductase [Podospora anserina S mat+]
Length=346

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 169/256 (66%), Gaps = 11/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITR-APIGQQDAEGKPKYVIRP  436
             ++  KLE+   ++HN+   RF       + GL +AS I+T+  P+   DAE   K V+RP
Sbjct  97    FLSLKLEEVEIINHNSKRLRFRLPEDDMVSGLPVASAILTKYKPV---DAE---KAVLRP  150

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTPISD D  G+ DLL+K YP G MS H   + PG +++VKGP+ K  + PN  +HI ++
Sbjct  151   YTPISDEDTPGYIDLLVKKYPNGPMSTHLHDMAPGQRLDVKGPLPKYAWSPNKHEHIALV  210

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             AGG+GITPM Q++  I  NP+D T+++L++ NVS DDILLK +L  L   +P   + FY 
Sbjct  211   AGGTGITPMYQLLRTIFNNPEDKTKVTLVFGNVSADDILLKNELATLENHYPQRFRAFYV  270

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEKDK-REQGELS  967
             +D+P K+W G  GFI+K+++   LP P ++ + +FVCGPPGMM  +SG K   R+QGEL 
Sbjct  271   LDNPPKQWTGAKGFINKELLKTVLPEPKNENIKVFVCGPPGMMDSISGNKKSPRDQGELK  330

Query  968   GVLKEVGYTENMVYKF  1015
             G+LKE+GYT   VYKF
Sbjct  331   GILKELGYTPEQVYKF  346



>ref|XP_007599327.1| oxidoreductase NAD-binding domain-containing protein [Colletotrichum 
fioriniae PJ7]
 gb|EXF77026.1| oxidoreductase NAD-binding domain-containing protein [Colletotrichum 
fioriniae PJ7]
Length=334

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 167/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++  KLED   ++HNT   RF       + GLD+AS I+T+   G +D     K  +RPY
Sbjct  85    FVSLKLEDTEIINHNTKKLRFKLPEDDMVSGLDVASAILTKYK-GPEDE----KATLRPY  139

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP SD DAKG+ +L++K YP G MS H   + PG +++ KGP+ K  + PN  +HI ++A
Sbjct  140   TPTSDEDAKGYLELIVKKYPNGPMSTHMHDMTPGQRLDFKGPLPKYPWSPNKHEHIALVA  199

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  NP+D T+++L++ NV+ +DILLKK+   L  T+P   + FY +
Sbjct  200   GGTGITPMYQLARAIFNNPEDKTKVTLVFGNVTEEDILLKKEFAELENTYPQRFRAFYVL  259

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEKDK-REQGELSG  970
             D P KEW G  GFISK+++ + LP P S++  +FVCGPPG+M  +SG K   ++QGEL G
Sbjct  260   DKPPKEWSGNKGFISKELLKQVLPEPKSENIKVFVCGPPGLMNAISGNKKSPKDQGELVG  319

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GY+   VYKF
Sbjct  320   TLKELGYSPEQVYKF  334



>gb|ENH80327.1| nadh-cytochrome b5 reductase [Colletotrichum orbiculare MAFF 
240422]
Length=332

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/256 (46%), Positives = 168/256 (66%), Gaps = 11/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL--GLDIASCIITRAPIGQQDAEGKPKYVIRP  436
             ++  KLED   V+HNT   RF+  P   +  GL++AS ++T+   G +D     K  +RP
Sbjct  83    FVSLKLEDVEIVNHNTKKLRFAL-PEEDMVSGLNVASAVLTKYK-GPEDQ----KATLRP  136

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTP SD DAKG  +L++K YP G MS H   L PG +++ KGP+ K  + PN   H+ ++
Sbjct  137   YTPTSDEDAKGFIELIVKKYPNGPMSTHMHDLTPGQRLDFKGPLPKYPWTPNKHDHVALV  196

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             AGG+GITPM Q+  AI KNPDD T+++L++ NV  +DILLKK+   L  T+P   + FY 
Sbjct  197   AGGTGITPMYQIARAIFKNPDDKTKVTLVFGNVGEEDILLKKEFAELENTYPQRFRAFYV  256

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELS  967
             +D P KEW G  GFI+K+++ + LP P ++ + +FVCGPPG+M  +SG K   ++QGEL+
Sbjct  257   LDKPPKEWVGSKGFITKELLKQVLPEPKNENIKVFVCGPPGLMNAISGNKVSPKDQGELT  316

Query  968   GVLKEVGYTENMVYKF  1015
             G+LKE+GY    VYKF
Sbjct  317   GILKELGYNSEQVYKF  332



>gb|EKC99052.1| cytochrome-b5 reductase [Trichosporon asahii var. asahii CBS 
8904]
Length=331

 Score =   221 bits (562),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 168/267 (63%), Gaps = 12/267 (4%)
 Frame = +2

Query  245   ALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAK----LGLDIASCIITRAPIGQ---QD  403
              L+P +W    LE+    +HN+H F+F F+   K     GL +A CI+ R+P G+    D
Sbjct  67    GLDPKEWTPLTLEEVKKYNHNSHTFKFDFEGDDKDQKTAGLSVAGCILVRSPTGEGQVND  126

Query  404   AEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQY  583
              +GKP  VIRPYTP+S  DA+GH +LLIK YP GK++   +SLKPGDKV  KGP++K QY
Sbjct  127   DKGKP--VIRPYTPVSAHDARGHIELLIKEYPTGKLTPWLSSLKPGDKVLFKGPMKKYQY  184

Query  584   RPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAA  763
             +         +AGGSGITP  Q+I+  L+NP D T+ +LLYANV  +DILL++K D LA 
Sbjct  185   QAGNFDRGVFVAGGSGITPAYQLIDYALENPQDKTKFTLLYANVEEEDILLREKWDKLAK  244

Query  764   THPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSD--DTLIFVCGPPGMMTHVSG  934
              HP+ L+V Y +D P   W G SG++SKD + K  P   D    + FVCGPP  +  V+G
Sbjct  245   AHPDRLQVVYFLDKPPANWNGESGYVSKDKIQKYFPAKKDGEKVMAFVCGPPPQVAAVAG  304

Query  935   EKDKREQGELSGVLKEVGYTENMVYKF  1015
              KD  +QG++ G  K++G T   V+KF
Sbjct  305   PKDGMKQGDVGGAFKDLGLTSEEVFKF  331



>gb|KDQ51129.1| hypothetical protein JAAARDRAFT_41396 [Jaapia argillacea MUCL 
33604]
Length=332

 Score =   221 bits (562),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 169/261 (65%), Gaps = 7/261 (3%)
 Frame = +2

Query  248   LNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRA--PIGQQDAEGKPK  421
             L+P  +++FKL+   P +HNT  F F    +    L +ASC++ ++  P   +DA+G+P 
Sbjct  74    LDPQNFVDFKLKKIEPYNHNTAKFTFELPENEASLLPVASCVVVKSSDPEALKDAKGRP-  132

Query  422   YVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKK  601
              VIRPYTPIS  D KG    LIK Y  GKM+ H   LKPGD + +KGPI K  ++ N  +
Sbjct  133   -VIRPYTPISPSDKKGELTFLIKKYDSGKMTVHIHDLKPGDSLSIKGPIPKWPWKMNEFE  191

Query  602   HIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NL  778
              +GMIAGGSGITPM Q++   L +P + T+  L++AN++  DILL+++ D L   +P N 
Sbjct  192   DVGMIAGGSGITPMYQILNHALTDPSNKTKFKLIFANLTEPDILLREEFDALKKKYPNNF  251

Query  779   KVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPS--DDTLIFVCGPPGMMTHVSGEKDKRE  952
              V YT+D P+ +W G +G++S D++ K   P S  +   IFVCGPPG +  ++G+KD  +
Sbjct  252   DVIYTLDKPSSDWTGSTGYVSSDLIKKTFSPASAGEKVKIFVCGPPGQLIALAGKKDGMK  311

Query  953   QGELSGVLKEVGYTENMVYKF  1015
             QGE+ G LKE+GYTE+ VYKF
Sbjct  312   QGEVGGTLKELGYTEDQVYKF  332



>gb|EJT48501.1| cytochrome-b5 reductase [Trichosporon asahii var. asahii CBS 
2479]
Length=331

 Score =   221 bits (562),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 168/267 (63%), Gaps = 12/267 (4%)
 Frame = +2

Query  245   ALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAK----LGLDIASCIITRAPIGQ---QD  403
              L+P +W    LE+    +HN+H F+F F+   K     GL +A CI+ R+P G+    D
Sbjct  67    GLDPKEWTPLTLEEVKKYNHNSHTFKFDFEGDDKDQKTAGLSVAGCILVRSPTGEGQVND  126

Query  404   AEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQY  583
              +GKP  VIRPYTP+S  DA+GH +LLIK YP GK++   +SLKPGDKV  KGP++K QY
Sbjct  127   DKGKP--VIRPYTPVSAHDARGHIELLIKEYPTGKLTPWLSSLKPGDKVLFKGPMKKYQY  184

Query  584   RPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAA  763
             +         +AGGSGITP  Q+I+  L+NP D T+ +LLYANV  +DILL++K D LA 
Sbjct  185   QAGNFDRGVFVAGGSGITPAYQLIDYALENPQDKTKFTLLYANVEEEDILLREKWDKLAK  244

Query  764   THPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSD--DTLIFVCGPPGMMTHVSG  934
              HP+ L+V Y +D P   W G SG++SKD + K  P   D    + FVCGPP  +  V+G
Sbjct  245   AHPDRLQVVYFLDKPPANWNGESGYVSKDKIQKYFPAKKDGEKVMAFVCGPPPQVAAVAG  304

Query  935   EKDKREQGELSGVLKEVGYTENMVYKF  1015
              KD  +QG++ G  K++G T   V+KF
Sbjct  305   PKDGMKQGDVGGAFKDLGLTSEEVFKF  331



>sp|Q0CRD8.2|MCR1_ASPTN RecName: Full=NADH-cytochrome b5 reductase 2; AltName: Full=Mitochondrial 
cytochrome b reductase [Aspergillus terreus NIH2624]
Length=319

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 120/255 (47%), Positives = 171/255 (67%), Gaps = 10/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W++ KL +   ++HNT  FRF F D  A  GL++AS ++T+        EG  K V+RPY
Sbjct  71    WVDLKLSEIEVLNHNTKRFRFEFEDKEAVSGLNVASALLTKF-----KPEGG-KAVLRPY  124

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD    G  DL++KVYP G MS+H  S+    ++E KGP+ K  +  N  +HI +IA
Sbjct  125   TPVSDESQPGFLDLVVKVYPNGPMSEHLHSMNVDQRLEFKGPLPKYPWEANKHQHICLIA  184

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+   I KNP+D T+++L+Y NVS  DILLKK+L+ L  T+P   K FY +
Sbjct  185   GGTGITPMYQLARHIFKNPEDKTKVTLVYGNVSEQDILLKKELEELENTYPQRFKAFYVL  244

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D+P KEW GG G+ISK+++   LP P ++ + IFVCGPPG+   +SG K   ++QGEL+G
Sbjct  245   DNPPKEWTGGKGYISKELLKTVLPEPKEENIKIFVCGPPGLYKAISGNKVSPKDQGELTG  304

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GY++  V+KF
Sbjct  305   ILKELGYSQEQVFKF  319



>gb|ETO67670.1| hypothetical protein F444_15412 [Phytophthora parasitica P1976]
Length=277

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 171/262 (65%), Gaps = 11/262 (4%)
 Frame = +2

Query  239   KTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAK--LGLDIASCIITRAPIGQQDAEG  412
             K AL+P ++  FK+     V+H+T    F+  PS +  +G+ +ASC++ +A +  ++   
Sbjct  24    KVALSPKEFRSFKVTRVEEVTHDTKRLVFAL-PSKEHEMGITVASCLMAKASVDGKN---  79

Query  413   KPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPN  592
                 V+RPYTP +    KG  +L+IK YP GK+S+H  +L  GD++ +KGP  K +Y+PN
Sbjct  80    ----VVRPYTPTNTNAEKGELELVIKGYPTGKLSKHIVNLNVGDELAMKGPFVKFEYKPN  135

Query  593   MKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP  772
               K IG + GGSGITP LQV++ I +NPDD+TQ+ L++ N +  DI+L+ +LD L   +P
Sbjct  136   QYKSIGFLCGGSGITPALQVVKEICRNPDDSTQVVLIFCNQTEKDIILRDELDALQYMYP  195

Query  773   NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKD-KR  949
               +V Y +D     W G +G+++K+++ K LP PSD++LI VCGPP MM  +SG K   R
Sbjct  196   QFQVHYVLDKAEANWEGYTGYVTKELIEKLLPGPSDESLIGVCGPPPMMDAISGNKAPDR  255

Query  950   EQGELSGVLKEVGYTENMVYKF  1015
              QGEL G+LKE+GYT + V+KF
Sbjct  256   SQGELKGLLKELGYTSSQVFKF  277



>ref|XP_003319934.2| hypothetical protein PGTG_00846 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP75515.2| hypothetical protein PGTG_00846 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=336

 Score =   220 bits (560),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 122/267 (46%), Positives = 168/267 (63%), Gaps = 11/267 (4%)
 Frame = +2

Query  242   TALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRA-----PIGQQDA  406
             +AL+P +W   KL+   P +HNT  F F        GL +ASC+IT++     P    D 
Sbjct  72    SALSPKEWRNLKLKQVIPYNHNTSTFIFELPKGTDSGLHVASCLITKSVAREGPTACNDD  131

Query  407   EGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYR  586
             +GKP  VIRPYTPI+ P  K    L++K Y EGKM+ H  SLKPGD++ +KGP  K  Y+
Sbjct  132   KGKP--VIRPYTPITPPKQKDTLHLMVKNYVEGKMTNHIFSLKPGDQLSMKGPFPKWLYK  189

Query  587   PNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAAT  766
             PN  K IGMIAGGSGITP  Q+I+ I  NP D T++ LL+AN   +DILL+++ + LA  
Sbjct  190   PNEFKTIGMIAGGSGITPHWQIIQEIASNPQDKTKVVLLFANQKEEDILLREEFERLAKE  249

Query  767   HP-NLKVFYTVDSPTKEWRGG-SGFISKDMVVKGLPPPS--DDTLIFVCGPPGMMTHVSG  934
              P    + + +D P K W     G+++KD++   LP PS   +  IFVCGPPG +  V+G
Sbjct  250   KPQQFSINFALDQPPKNWPSELKGYLTKDVLKSKLPSPSLGSEVKIFVCGPPGQVAAVAG  309

Query  935   EKDKREQGELSGVLKEVGYTENMVYKF  1015
              KD  EQGEL G+LK++G++++ VYKF
Sbjct  310   PKDDMEQGELKGMLKDLGFSQDQVYKF  336



>gb|ETI38943.1| hypothetical protein F443_15412 [Phytophthora parasitica P1569]
 gb|ETL85834.1| hypothetical protein L917_14681 [Phytophthora parasitica]
 gb|ETM38981.1| hypothetical protein L914_14817 [Phytophthora parasitica]
Length=274

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 171/262 (65%), Gaps = 11/262 (4%)
 Frame = +2

Query  239   KTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAK--LGLDIASCIITRAPIGQQDAEG  412
             K AL+P ++  FK+     V+H+T    F+  PS +  +G+ +ASC++ +A +  ++   
Sbjct  21    KVALSPKEFRSFKVTRVEEVTHDTKRLVFAL-PSKEHEMGITVASCLMAKASVDGKN---  76

Query  413   KPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPN  592
                 V+RPYTP +    KG  +L+IK YP GK+S+H  +L  GD++ +KGP  K +Y+PN
Sbjct  77    ----VVRPYTPTNTNAEKGELELVIKGYPTGKLSKHIVNLNVGDELAMKGPFVKFEYKPN  132

Query  593   MKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP  772
               K IG + GGSGITP LQV++ I +NPDD+TQ+ L++ N +  DI+L+ +LD L   +P
Sbjct  133   QYKSIGFLCGGSGITPALQVVKEICRNPDDSTQVVLIFCNQTEKDIILRDELDALQYMYP  192

Query  773   NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKD-KR  949
               +V Y +D     W G +G+++K+++ K LP PSD++LI VCGPP MM  +SG K   R
Sbjct  193   QFQVHYVLDKAEANWEGYTGYVTKELIEKLLPGPSDESLIGVCGPPPMMDAISGNKAPDR  252

Query  950   EQGELSGVLKEVGYTENMVYKF  1015
              QGEL G+LKE+GYT + V+KF
Sbjct  253   SQGELKGLLKELGYTSSQVFKF  274



>ref|XP_001388787.1| NADH-cytochrome b5 reductase 2 [Aspergillus niger CBS 513.88]
 sp|A2Q898.1|MCR1_ASPNC RecName: Full=NADH-cytochrome b5 reductase 2; AltName: Full=Mitochondrial 
cytochrome b reductase [Aspergillus niger CBS 513.88]
 emb|CAK36895.1| unnamed protein product [Aspergillus niger]
 gb|EHA26342.1| hypothetical protein ASPNIDRAFT_52003 [Aspergillus niger ATCC 
1015]
Length=322

 Score =   219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 119/255 (47%), Positives = 168/255 (66%), Gaps = 10/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W + KL +   ++HNT   RF F D  A  GL +AS ++T+      DA    K VIRPY
Sbjct  74    WFDLKLSEIEVLNHNTKRLRFEFEDKEALSGLQVASALLTK--FKPADA----KAVIRPY  127

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP SD +  G+ DL++KVYP G MS+H  S+  G +++ KGPI K  +  N   HI +IA
Sbjct  128   TPTSDEETPGYIDLVVKVYPNGPMSEHLHSMNVGQRLDFKGPIVKYPWETNKHNHICLIA  187

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+   I KNP+D T+++L++ NV  +DILLKK+ + L  T+P   + FY +
Sbjct  188   GGTGITPMYQLAREIFKNPEDQTKVTLVFGNVKEEDILLKKEFEELENTYPRRFRAFYVL  247

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEKDK-REQGELSG  970
             D+P KEW GG G+ISK+++   LP P ++ + IFVCGPPGM   +SG K+   +QGELSG
Sbjct  248   DNPPKEWTGGKGYISKELLKTVLPEPKEENIKIFVCGPPGMYKAISGTKNSPTDQGELSG  307

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GY++  V+KF
Sbjct  308   ILKELGYSKEQVFKF  322



>gb|EFQ27839.1| oxidoreductase NAD-binding domain-containing protein [Colletotrichum 
graminicola M1.001]
Length=333

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 166/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++  KL+D   V+HNT  FRF       + GL++AS ++T+   G +D     K  +RPY
Sbjct  84    FVSLKLDDVEIVNHNTKKFRFKLPEDDMVSGLEVASAVLTKYK-GPEDE----KATLRPY  138

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP SD DAKG+ +LL+K YP G MS H   + PG +++ KGP+ K  + PN   HI ++A
Sbjct  139   TPTSDEDAKGYIELLVKKYPNGPMSTHMHDMTPGQRLDFKGPLPKYPWSPNKHDHIALVA  198

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  NPDD T+++L++ NV+ +DILLKK+   L  T+P   + FY +
Sbjct  199   GGTGITPMYQLARAIFNNPDDKTKVTLIFGNVTEEDILLKKEFAELENTYPQRFRAFYVL  258

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEKDK-REQGELSG  970
             D P KEW G  GFI+K+++ + LP P S++  +FVCGPPGMM  +SG K   ++QGEL G
Sbjct  259   DKPPKEWVGNKGFITKELLKQVLPEPKSENIKVFVCGPPGMMNAISGNKKSPKDQGELVG  318

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GY    VYKF
Sbjct  319   ALKELGYKPEQVYKF  333



>ref|XP_008894985.1| hypothetical protein PPTG_04494 [Phytophthora parasitica INRA-310]
 gb|ETK79145.1| hypothetical protein L915_14969 [Phytophthora parasitica]
 gb|ETL32568.1| hypothetical protein L916_14871 [Phytophthora parasitica]
 gb|ETN19086.1| hypothetical protein PPTG_04494 [Phytophthora parasitica INRA-310]
 gb|ETP08851.1| hypothetical protein F441_15234 [Phytophthora parasitica CJ01A1]
 gb|ETP36885.1| hypothetical protein F442_15258 [Phytophthora parasitica P10297]
Length=296

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 171/262 (65%), Gaps = 11/262 (4%)
 Frame = +2

Query  239   KTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAK--LGLDIASCIITRAPIGQQDAEG  412
             K AL+P ++  FK+     V+H+T    F+  PS +  +G+ +ASC++ +A +  ++   
Sbjct  43    KVALSPKEFRSFKVTKVEEVTHDTKRLVFAL-PSKEHEMGITVASCLMAKASVDGKN---  98

Query  413   KPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPN  592
                 V+RPYTP +    KG  +L+IK YP GK+S+H  +L  GD++ +KGP  K +Y+PN
Sbjct  99    ----VVRPYTPTNTNAEKGELELVIKGYPTGKLSKHIVNLNVGDELAMKGPFVKFEYKPN  154

Query  593   MKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP  772
               K IG + GGSGITP LQV++ I +NPDD+TQ+ L++ N +  DI+L+ +LD L   +P
Sbjct  155   QYKSIGFLCGGSGITPALQVVKEICRNPDDSTQVVLIFCNQTEKDIILRDELDALQYMYP  214

Query  773   NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKD-KR  949
               +V Y +D     W G +G+++K+++ K LP PSD++LI VCGPP MM  +SG K   R
Sbjct  215   QFQVHYVLDKAEANWEGYTGYVTKELIEKLLPGPSDESLIGVCGPPPMMDAISGNKAPDR  274

Query  950   EQGELSGVLKEVGYTENMVYKF  1015
              QGEL G+LKE+GYT + V+KF
Sbjct  275   SQGELKGLLKELGYTSSQVFKF  296



>gb|EMD30879.1| hypothetical protein CERSUDRAFT_120279 [Ceriporiopsis subvermispora 
B]
Length=336

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/267 (43%), Positives = 178/267 (67%), Gaps = 10/267 (4%)
 Frame = +2

Query  236   RKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRA----PIGQQD  403
             +K AL+P  +++F+L+   P ++NT  F F+  P A   L +ASC++ ++    P   + 
Sbjct  73    KKDALDPKNFVDFELKKVEPYNYNTAKFVFALPPDAAAELPVASCVVVQSSADHPSPLKT  132

Query  404   AEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQY  583
              EGKP  VIRPYTPI+ PDA+G    LIK Y  G MS++   LKPG+K+ +KGPI K  +
Sbjct  133   GEGKP--VIRPYTPIT-PDAEGELTFLIKRYDTGVMSKYIHELKPGEKLSIKGPIPKFPF  189

Query  584   RPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAA  763
             + N  + +GM+AGGSGITPM Q++   L +P + T+ +L++AN++  DILL+++ + L  
Sbjct  190   KINEFEEVGMVAGGSGITPMHQILTHALNDPSNKTRFTLIFANIAERDILLREEFEKLRK  249

Query  764   THPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPS--DDTLIFVCGPPGMMTHVSG  934
              HP+   + YT+D P   W+G  G+++K+M+++ L PPS  +   IF+CGPPG +  ++G
Sbjct  250   EHPDTFNIVYTLDKPESGWKGYKGYVNKEMIMQHLGPPSLAEKVKIFICGPPGQVAAIAG  309

Query  935   EKDKREQGELSGVLKEVGYTENMVYKF  1015
             +K   +QGEL G+LKE+GYTE+ V+KF
Sbjct  310   KKAGMKQGELGGILKELGYTEDQVFKF  336



>emb|CCF40904.1| NADH-cytochrome b5 reductase 2 [Colletotrichum higginsianum]
Length=341

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/255 (47%), Positives = 168/255 (66%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++  KLED   V+HNT  FRF       + GL +AS ++T+   G +D     K  +RPY
Sbjct  92    FVSLKLEDVEIVNHNTKKFRFKLPEDDMVSGLTVASAVLTKY-KGPEDE----KATLRPY  146

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP SD DAKG+ +LL+K YP G MS H   + PG +++ KGP+ K  + PN   HI ++A
Sbjct  147   TPTSDEDAKGYVELLVKKYPNGPMSTHMHDMTPGQRLDFKGPLPKYPWSPNKHDHIALVA  206

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  NPDD T+++L++ NV+ +DILLKK+   L  T+P   + FY +
Sbjct  207   GGTGITPMYQLARAIFNNPDDKTKVTLVFGNVTEEDILLKKEFSELENTYPQRFRAFYVL  266

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSG-EKDKREQGELSG  970
             D P KEW G  G+I+KD++ + LP P S++  +FVCGPPG+M  VSG +K  ++QGEL G
Sbjct  267   DKPPKEWVGNKGYITKDLLKQVLPEPKSENIKVFVCGPPGLMNAVSGNKKSPKDQGELVG  326

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GY+ + VYKF
Sbjct  327   ALKELGYSPDQVYKF  341



>gb|EYE94500.1| NADH-cytochrome b5 reductase 2 [Aspergillus ruber CBS 135680]
Length=320

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 167/256 (65%), Gaps = 11/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITR-APIGQQDAEGKPKYVIRP  436
             W++ KL +   +SHNT  FRF F D  A  GL +AS ++ +  P G +      K VIRP
Sbjct  71    WVDLKLAEVETLSHNTKRFRFEFEDKEAVSGLQVASALLAKFKPAGAE------KPVIRP  124

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTP +D +  G  +L+IK YP G MS+HF S+  G ++E KGP+ K  +  N   HI +I
Sbjct  125   YTPTNDEEEPGQLELVIKAYPNGPMSEHFHSMNVGQRMEFKGPLPKYPWEANKHDHIALI  184

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             AGG+GITPM Q+   I KNPDD T+++L++ NVS DDILLKK+L  L  T+P   K FY 
Sbjct  185   AGGTGITPMYQLARQIFKNPDDKTKVTLVFGNVSEDDILLKKELSDLENTYPQRFKAFYV  244

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELS  967
             +D+P K W GG G+I+KD++   LP P +  + +FVCGPPG+   +SG K   ++QGEL 
Sbjct  245   LDNPPKGWTGGKGYINKDLLKTVLPEPKEGNIKLFVCGPPGLYKAISGTKVSPKDQGELD  304

Query  968   GVLKEVGYTENMVYKF  1015
             GVLKE+GY ++ V+KF
Sbjct  305   GVLKELGYNKDQVFKF  320



>dbj|GAA88697.1| NADH-cytochrome b5 reductase [Aspergillus kawachii IFO 4308]
Length=322

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 168/255 (66%), Gaps = 10/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W + KL +   ++HNT   RF F D  A  GL +AS ++T+      DA    K VIRPY
Sbjct  74    WFDLKLSEIEVLNHNTKRLRFEFEDKEAVSGLQVASALLTK--FKPADA----KAVIRPY  127

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP SD +  G+ DL++KVYP G MS+H  S+  G +++ KGPI K  +  N   HI +IA
Sbjct  128   TPTSDEETPGYIDLVVKVYPNGPMSEHLHSMNVGQRLDFKGPIVKYPWETNKHNHICLIA  187

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+   I KNP+D T+++L++ NV  +DILLKK+ + L  T+P   + FY +
Sbjct  188   GGTGITPMYQLAREIFKNPEDQTKVTLVFGNVKEEDILLKKEFEELENTYPRRFRAFYVL  247

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEKDK-REQGELSG  970
             D+P KEW GG G+I+K+++   LP P ++ + IFVCGPPGM   +SG K+   +QGELSG
Sbjct  248   DNPPKEWTGGKGYINKELLKTVLPEPKEENIKIFVCGPPGMYKAISGTKNSPTDQGELSG  307

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GY++  V+KF
Sbjct  308   ILKELGYSKEQVFKF  322



>emb|CCT62674.1| probable cytochrome-b5 reductase, mitochondrial outer membrane 
form [Fusarium fujikuroi IMI 58289]
Length=332

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/255 (47%), Positives = 166/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++  KL D   V+HNT   RF   +P    GL +AS I+T+   G  D     K  +RPY
Sbjct  83    FVSLKLSDVELVNHNTKRLRFELPEPDQVSGLHVASAILTKYK-GPNDE----KATLRPY  137

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD   KG  DLL+K YP+G MS H  +L PG ++++KGP+ K  +  N  +HI +IA
Sbjct  138   TPISDESEKGFIDLLVKKYPDGPMSTHLHNLVPGQRLDIKGPLPKYPWEENKHEHIALIA  197

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  NP+D T+++L++ NVS  DILLKK+ + L  T P   + FY +
Sbjct  198   GGTGITPMYQLARAIFNNPNDKTKVTLVFGNVSEQDILLKKEFEHLENTFPQRFRAFYVL  257

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D+P KEW G SG+ISK+++   LP P ++ + +FVCGPPG+M  +SG K   + QGEL+G
Sbjct  258   DNPPKEWVGNSGYISKELLKTVLPEPKNENIKLFVCGPPGLMNAISGNKVSPKNQGELTG  317

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GY E+ VYKF
Sbjct  318   ALKELGYKEDQVYKF  332



>gb|KIH94306.1| cytochrome-b5 reductase [Sporothrix brasiliensis 5110]
Length=344

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 170/256 (66%), Gaps = 10/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++   +E    V+HNT L RF   +P    G+  AS ++T+        EG  K +IRPY
Sbjct  94    FVPLTVESVDVVNHNTKLVRFKLPEPDQIAGMHAASALLTKF-----KPEGAEKAIIRPY  148

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             T +SD DA+GH DLL+K Y  GKMS H  SL PGD ++ KGPI K ++ PN  + IG++A
Sbjct  149   TAVSDADAQGHLDLLVKRYEGGKMSPHIHSLAPGDTLDFKGPIVKYKWAPNKHEQIGLVA  208

Query  620   GGSGITPMLQVIEAILKNPD-DNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             GG+GITPM Q+I+A+L+N D D T+I+L+Y N++ +DILL K+L  L  T+P   + FY 
Sbjct  209   GGTGITPMYQLIKAVLRNADEDKTKITLVYGNIAEEDILLHKELRHLENTYPQRFRTFYV  268

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEKDK-REQGELS  967
             ++ PT +W+GG G+I+K+++ + LP P + D  +FVCGPPG+M  VSG K    +QGELS
Sbjct  269   LEKPTADWQGGKGYITKELLKQVLPEPKAGDFKLFVCGPPGLMNAVSGNKKSPSDQGELS  328

Query  968   GVLKEVGYTENMVYKF  1015
             G L+E+GYT+  V K 
Sbjct  329   GALQELGYTKEQVLKL  344



>gb|KFA78455.1| hypothetical protein S40288_06912 [Stachybotrys chartarum IBT 
40288]
Length=336

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 168/255 (66%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             +I  KL D   V+HNT   RF    S ++ GL +AS ++T+   G QD     K  +RPY
Sbjct  87    FISLKLADVEVVNHNTKKLRFELPESEQVSGLHVASALLTKYK-GPQDE----KPTLRPY  141

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD D KG+ +LL+K YP G MS H   + PG +++ KGP+ K  +  N   HI +IA
Sbjct  142   TPISDEDTKGYLELLVKKYPNGPMSTHMHDMAPGQRLDFKGPLPKYPWSENKHDHIALIA  201

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+G+TPM Q+  AI  NP+D T+++L++ NV+  DILLK+K + L  T+P   + FY +
Sbjct  202   GGTGVTPMYQLCRAIFNNPNDKTKVTLVFGNVTEQDILLKEKFEDLENTYPQRFRAFYVL  261

Query  797   DSPTKEWRGG-SGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEKDKREQGELSG  970
             D P K+W GG  G+I+KD++   LP P ++ + +FVCGPPGM+  +SG KDK +QGEL+G
Sbjct  262   DKPPKDWTGGKGGYITKDLLKTVLPEPKNENIKLFVCGPPGMVKAISGPKDKMQQGELAG  321

Query  971   VLKEVGYTENMVYKF  1015
             +LK++GYT   VYKF
Sbjct  322   LLKDLGYTSEQVYKF  336



>gb|ENH61392.1| NADH-cytochrome b5 reductase 2 [Fusarium oxysporum f. sp. cubense 
race 1]
Length=332

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 120/255 (47%), Positives = 166/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++  KL D   V+HNT   RF   +P    GL +AS I+T+   G  D     K  +RPY
Sbjct  83    FVSLKLSDVELVNHNTKRLRFELPEPDQVSGLHVASAILTKYK-GPNDE----KATLRPY  137

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD + KG  DLL+K YP G MS H  +L PG ++++KGP+ K  +  N  +HI +IA
Sbjct  138   TPISDENEKGFIDLLVKKYPNGPMSTHIHNLVPGQRLDIKGPLPKYPWEENKHEHIALIA  197

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  NP+D T+++L++ NVS  DILLKK+ + L  T P   + FY +
Sbjct  198   GGTGITPMYQLARAIFNNPNDKTKVTLVFGNVSEQDILLKKEFEHLENTFPQRFRAFYVL  257

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D+P KEW G SG+ISK+++   LP P ++ + +FVCGPPG+M  +SG K   + QGEL+G
Sbjct  258   DNPPKEWVGNSGYISKELLKTVLPEPKNENIKLFVCGPPGLMNAISGNKVSPKNQGELTG  317

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GY E+ VYKF
Sbjct  318   ALKELGYKEDQVYKF  332



>gb|EGU79604.1| hypothetical protein FOXB_09887 [Fusarium oxysporum Fo5176]
 gb|EWY93050.1| NADH-cytochrome b5 reductase 2 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ51638.1| NADH-cytochrome b5 reductase 2 [Fusarium oxysporum Fo47]
 gb|EWZ90888.1| NADH-cytochrome b5 reductase 2 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA52102.1| NADH-cytochrome b5 reductase 2 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK48941.1| NADH-cytochrome b5 reductase 2 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK96005.1| NADH-cytochrome b5 reductase 2 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL43677.1| NADH-cytochrome b5 reductase 2 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL89558.1| NADH-cytochrome b5 reductase 2 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM30217.1| NADH-cytochrome b5 reductase 2 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=332

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 120/255 (47%), Positives = 165/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++  KL D   V+HNT   RF   +P    GL +AS I+T+   G  D     K  +RPY
Sbjct  83    FVSLKLSDVELVNHNTKRLRFELPEPDQVSGLHVASAILTKYK-GPNDE----KATLRPY  137

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD + KG  DLL+K YP G MS H  +L PG ++++KGP+ K  +  N   HI +IA
Sbjct  138   TPISDENEKGFIDLLVKKYPNGPMSTHLHNLVPGQRLDIKGPLPKYPWEENKHDHIALIA  197

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  NP+D T+++L++ NVS  DILLKK+ + L  T P   + FY +
Sbjct  198   GGTGITPMYQLARAIFNNPNDKTKVTLVFGNVSEQDILLKKEFEHLENTFPQRFRAFYVL  257

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D+P KEW G SG+ISK+++   LP P ++ + +FVCGPPG+M  +SG K   + QGEL+G
Sbjct  258   DNPPKEWVGNSGYISKELLKTVLPEPKNENIKLFVCGPPGLMNAISGNKVSPKNQGELTG  317

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GY E+ VYKF
Sbjct  318   ALKELGYKEDQVYKF  332



>gb|EWG36827.1| NADH-cytochrome b5 reductase 2 [Fusarium verticillioides 7600]
Length=332

 Score =   217 bits (553),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 119/255 (47%), Positives = 166/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++  KL +   V+HNT   RF   +P    GL +AS I+T+   G +D     K  +RPY
Sbjct  83    FVSLKLSEVELVNHNTKRLRFELPEPDQVSGLHVASAILTKYK-GPEDE----KATLRPY  137

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD + KG  DLL+K YP G MS H  +L PG ++++KGP+ K  +  N   HI +IA
Sbjct  138   TPISDENEKGFIDLLVKKYPNGPMSTHLHNLVPGQRLDIKGPLPKYTWEENKHDHIALIA  197

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  NP+D T+++L++ NVS  DILLKK+ + L  T P   + FY +
Sbjct  198   GGTGITPMYQLARAIFNNPNDKTKVTLVFGNVSEQDILLKKEFEHLENTFPQRFRAFYVL  257

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D+P KEW G SG+ISK+++   LP P ++ + +FVCGPPG+M  +SG K   + QGEL+G
Sbjct  258   DNPPKEWVGNSGYISKELLKTVLPEPKNENIKLFVCGPPGLMNAISGNKVSPKNQGELTG  317

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GY E+ VYKF
Sbjct  318   ALKELGYKEDQVYKF  332



>gb|EGD98623.1| NADH-cytochrome b5 reductase [Trichophyton tonsurans CBS 112818]
 gb|EGE06820.1| NADH-cytochrome b5 reductase [Trichophyton equinum CBS 127.97]
 gb|EZF34868.1| NADH-cytochrome b5 reductase 2 [Trichophyton interdigitale H6]
 gb|KDB25896.1| NADH-cytochrome b5 reductase 2 [Trichophyton interdigitale MR816]
Length=321

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 158/255 (62%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W++ KL     VSHN    RF   D  +  GL IAS ++T+        EG  K  IRPY
Sbjct  72    WVDLKLSAVEEVSHNVKKLRFELPDSESVSGLHIASALLTKF-----KGEGDAKATIRPY  126

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD D  GH DLL+K YP G MS H   L  G+ +  KGPI K ++  N   H+ M+A
Sbjct  127   TPVSDEDEPGHLDLLVKKYPGGPMSTHIHELSVGEPLSFKGPIPKYEWEANKHSHVCMVA  186

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+I  I  NP D TQ++L+Y NV  +DILL+++L+ L   HP   KV Y +
Sbjct  187   GGTGITPMYQLIRKIFSNPADKTQVTLIYGNVGEEDILLRRELEHLENMHPRQFKVLYLL  246

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D P + W GG G+++K++V    P P  + + +FVCGPPGM   VSG K   ++QGEL+G
Sbjct  247   DRPGEGWTGGKGYVTKELVQMAFPEPKTEGIKLFVCGPPGMYKAVSGPKVSPKDQGELTG  306

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GYT+  VYKF
Sbjct  307   ILKELGYTKEQVYKF  321



>gb|EPQ62420.1| Mitochondrial NADH-cytochrome b5 reductase [Blumeria graminis 
f. sp. tritici 96224]
Length=271

 Score =   215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 171/264 (65%), Gaps = 10/264 (4%)
 Frame = +2

Query  239   KTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGK  415
             K A     +    L+    ++HNT  FRF+     ++ GL  ASC++TR     +D+  +
Sbjct  13    KPAFTGQGFFNLTLQSVENINHNTKKFRFALPEEDQVSGLQTASCLLTRF----KDSNTE  68

Query  416   PKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNM  595
              K VIRPYTPISD D +GH DLL+K YP G MS HF  + PG  +E KGPI K  + PNM
Sbjct  69    -KAVIRPYTPISDEDDQGHVDLLVKKYPTGVMSSHFHEMTPGQSLEFKGPISKYPWSPNM  127

Query  596   KKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN  775
               H+ MIAGG+GI PM Q++  I KNP++ T+++L+YANV+ +DILL+K+L  L  T+P 
Sbjct  128   HSHVTMIAGGTGIAPMYQLVRTIFKNPEEKTKVTLVYANVTEEDILLRKELMELENTYPQ  187

Query  776   -LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSG-EKDK  946
               +VFY +D+P K W G  G+I K+++   LP P ++ + IFVCGPP M   +SG +K  
Sbjct  188   RFRVFYVLDNPPKSWVGEKGYIGKNLLKTVLPEPKEENIKIFVCGPPPMYKSISGMKKSA  247

Query  947   REQGELSG-VLKEVGYTENMVYKF  1015
              +QG L G +L+E+GY+++ V+KF
Sbjct  248   SDQGNLDGSILEELGYSKDQVFKF  271



>emb|CCU78450.1| NADH-cytochrome b5 reductase [Blumeria graminis f. sp. hordei 
DH14]
Length=271

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 171/264 (65%), Gaps = 10/264 (4%)
 Frame = +2

Query  239   KTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGK  415
             K A     +    L+    ++HNT  FRF+     ++ GL  ASC++TR     +D+  +
Sbjct  13    KPAFTGQGFFNLTLQSVENINHNTKKFRFALPEEDQVSGLQTASCLLTRF----KDSSTE  68

Query  416   PKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNM  595
              K VIRPYTPISD D +GH DLL+K YP G MS HF  + PG  +E KGPI K  + PNM
Sbjct  69    -KAVIRPYTPISDEDDQGHVDLLVKKYPTGVMSSHFHEMAPGQTLEFKGPISKYPWSPNM  127

Query  596   KKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN  775
               H+ MIAGG+GI PM Q++  I KNP++ T+++L+YANV+ +DILL+K+L  L  T+P 
Sbjct  128   HSHVSMIAGGTGIAPMYQLVRTIFKNPEEKTKVTLVYANVTEEDILLRKELMELENTYPQ  187

Query  776   -LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSG-EKDK  946
               +VFY +D+P K W G  G+I K+++   LP P ++ + IFVCGPP M   +SG +K  
Sbjct  188   RFRVFYVLDNPPKSWVGEKGYIGKNLLKTVLPEPKEENIKIFVCGPPPMYKSISGMKKSP  247

Query  947   REQGELSG-VLKEVGYTENMVYKF  1015
              +QG L G +L+E+GY+++ V+KF
Sbjct  248   SDQGNLDGSILEELGYSKDQVFKF  271



>gb|KEY66507.1| hypothetical protein S7711_04834 [Stachybotrys chartarum IBT 
7711]
 gb|KFA51071.1| hypothetical protein S40293_08236 [Stachybotrys chartarum IBT 
40293]
Length=336

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 168/255 (66%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             +I  KL D   V+HNT   RF    S ++ GL +AS ++T+   G +D     K  +RPY
Sbjct  87    FISLKLADVEVVNHNTKKLRFELPESEQVSGLHVASALLTKYK-GPEDE----KPTLRPY  141

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD D KG+ +LL+K YP G MS H   + PG +++ KGP+ K  +  N   HI +IA
Sbjct  142   TPISDEDTKGYLELLVKKYPNGPMSTHMHDMAPGQRLDFKGPLPKYPWSENKHDHIALIA  201

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+G+TPM Q+  AI  NP+D T+++L++ NV+  DILLK+K + L  T+P   + FY +
Sbjct  202   GGTGVTPMYQLCRAIFNNPNDKTKVTLVFGNVTEQDILLKEKFEDLENTYPQRFRAFYVL  261

Query  797   DSPTKEWRGG-SGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEKDKREQGELSG  970
             D P K+W GG  G+I+KD++   LP P ++ + +FVCGPPGM+  +SG KDK +QGEL+G
Sbjct  262   DKPPKDWTGGKGGYITKDLLKTVLPEPKNENIKLFVCGPPGMVKAISGPKDKMQQGELAG  321

Query  971   VLKEVGYTENMVYKF  1015
             +LK++GYT   VYKF
Sbjct  322   LLKDLGYTSEQVYKF  336



>emb|CDF90866.1| ZYBA0S08-05006g1_1 [Zygosaccharomyces bailii CLIB 213]
Length=297

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 163/256 (64%), Gaps = 9/256 (4%)
 Frame = +2

Query  257   NQWIEFKLEDRAPVSHNTHLFRFSFD-PSAKLGLDIASCIITRAPIGQQDAEGKPKYVIR  433
             ++WI+ KL      SH+T  F F    P  +LGL + S ++T+          K   VIR
Sbjct  48    DKWIDLKLAKVEDESHDTKKFTFELQSPDQELGLTLCSALLTKY------VTEKGNNVIR  101

Query  434   PYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGM  613
             PYTP S+ D KG F+L+IK YPEGKMS+H  SLKP D +  KGPI+K Q++PN    I +
Sbjct  102   PYTPTSELDKKGEFNLVIKRYPEGKMSKHIHSLKPSDTLSFKGPIKKFQWQPNAFDSITL  161

Query  614   IAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFY  790
             I GGSGITP+ Q++ ++ +NP+D T++ L Y N +P DILLKK+LD L   HP+ +K+ Y
Sbjct  162   IGGGSGITPLYQLLRSVSENPEDKTKVKLFYGNKTPGDILLKKELDSLQEKHPDQVKITY  221

Query  791   TVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDK-REQGELS  967
              +D P  +++G  GFIS++ +    P PS+ T  FVCGPP +M  +SG K    EQGEL 
Sbjct  222   FLDKPDGDFKGEKGFISREFIAANAPKPSEKTHFFVCGPPPLMESISGNKKSPAEQGELK  281

Query  968   GVLKEVGYTENMVYKF  1015
             G LK++GY E  V+KF
Sbjct  282   GALKDLGYREEQVFKF  297



>ref|XP_007840466.1| NADH-cytochrome b5 reductase 2 [Pestalotiopsis fici W106-1]
 gb|ETS75210.1| NADH-cytochrome b5 reductase 2 [Pestalotiopsis fici W106-1]
Length=333

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 170/255 (67%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             +I   LED   ++HNT  FRF       + GL +AS ++T+     +DA G  K V+RPY
Sbjct  84    FISLLLEDVEIINHNTKKFRFKLPEDDMVSGLKVASALLTKF----KDA-GAEKPVLRPY  138

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP SD D +G+ +L++K YP G MS H   + PG +++ KGP+ K  +  N  +HI +IA
Sbjct  139   TPTSDEDTRGYLELIVKKYPNGPMSTHMHDMVPGQRLDFKGPLPKYAWETNKHQHIALIA  198

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+   I  NP+D T+++L++ N+S +DILLK++ + L  T+P   + FY +
Sbjct  199   GGTGITPMYQLARGIFNNPEDKTKVTLVFGNISEEDILLKREFEDLENTYPQRFRAFYVL  258

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D+P KEW GG GFI+KD++   LP P SD+  +FVCGPPG+   VSG K   ++QGEL+G
Sbjct  259   DNPPKEWAGGKGFITKDLLKTVLPEPKSDNIKVFVCGPPGLYKAVSGAKVSPKDQGELTG  318

Query  971   VLKEVGYTENMVYKF  1015
             +L+E+GY+++ VYKF
Sbjct  319   ILQELGYSKDQVYKF  333



>ref|XP_007265099.1| cytochrome-b5 reductase [Fomitiporia mediterranea MF3/22]
 gb|EJD03498.1| cytochrome-b5 reductase [Fomitiporia mediterranea MF3/22]
Length=332

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 174/265 (66%), Gaps = 7/265 (3%)
 Frame = +2

Query  236   RKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRA--PIGQQDAE  409
              K+ L+P+ +++FKL+   P +HNT  F F    +    L +ASC++ +A  P   +D++
Sbjct  70    EKSPLDPSNFVDFKLKKVEPYNHNTSKFIFELPNNEASLLPVASCVVVKASDPEALKDSK  129

Query  410   GKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRP  589
             GKP  VIRPYTPIS  +A G    LIK YP+G  S H  SLKPGD + +KGPI K  Y+ 
Sbjct  130   GKP--VIRPYTPISPSNAPGELTFLIKRYPQGLASVHIHSLKPGDTLSIKGPIPKFDYKI  187

Query  590   NMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATH  769
             +   ++G+I GGSG+TP+ QV+   L +P + T+ +LL++NV+  DILL+++ D LA   
Sbjct  188   HEFDNVGLIGGGSGVTPLYQVLTHALSDPSNKTKFTLLFSNVTDKDILLREEFDALAKKF  247

Query  770   P-NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPS--DDTLIFVCGPPGMMTHVSGEK  940
             P  LKV Y +D   K+W+G +G+ISK+ V K +  P   +   IFVCGPPG +  ++G+K
Sbjct  248   PETLKVVYYLDKGDKDWKGETGYISKEGVKKYVAGPEGGEKVKIFVCGPPGQVASLAGKK  307

Query  941   DKREQGELSGVLKEVGYTENMVYKF  1015
             D  +QGEL G+LKE+GYTE+ V+KF
Sbjct  308   DGMKQGELGGILKELGYTEDQVFKF  332



>ref|XP_003233920.1| NADH-cytochrome b5 reductase [Trichophyton rubrum CBS 118892]
 gb|EGD89551.1| NADH-cytochrome b5 reductase 2 [Trichophyton rubrum CBS 118892]
 gb|EZF24309.1| NADH-cytochrome b5 reductase 2 [Trichophyton rubrum MR850]
 gb|EZF43270.1| NADH-cytochrome b5 reductase 2 [Trichophyton rubrum CBS 100081]
 gb|EZF53997.1| NADH-cytochrome b5 reductase 2 [Trichophyton rubrum CBS 288.86]
 gb|EZF64560.1| NADH-cytochrome b5 reductase 2 [Trichophyton rubrum CBS 289.86]
 gb|EZF75142.1| NADH-cytochrome b5 reductase 2 [Trichophyton soudanense CBS 452.61]
 gb|EZF85839.1| NADH-cytochrome b5 reductase 2 [Trichophyton rubrum MR1448]
 gb|EZF96620.1| NADH-cytochrome b5 reductase 2 [Trichophyton rubrum MR1459]
 gb|EZG07748.1| NADH-cytochrome b5 reductase 2 [Trichophyton rubrum CBS 735.88]
 gb|EZG18060.1| NADH-cytochrome b5 reductase 2 [Trichophyton rubrum CBS 202.88]
 gb|EZG18231.1| NADH-cytochrome b5 reductase 2 [Trichophyton rubrum CBS 202.88]
 gb|KDB35104.1| NADH-cytochrome b5 reductase 2 [Trichophyton rubrum D6]
Length=321

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 159/255 (62%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W++ KL     VSHN    RF   D  +  GL IAS ++T+        EG  K  IRPY
Sbjct  72    WVDLKLSAVEEVSHNVKKLRFELPDSESVSGLHIASALLTKF-----KGEGDAKATIRPY  126

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD D  GH +LL+K YP G MS H   L  G+ +  KGPI K ++  N   H+ M+A
Sbjct  127   TPVSDEDEPGHLELLVKKYPGGPMSTHIHDLTVGEPLSFKGPIPKYEWEANKHSHVCMVA  186

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+I  I  NP D TQ++L+Y NV  +DILL+++L+ L   HP   KV Y +
Sbjct  187   GGTGITPMYQLIRKIFSNPADKTQVTLIYGNVGEEDILLRRELEHLENMHPRQFKVLYLL  246

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D P + W GG G+++K++V    P P+ + + +FVCGPPGM   VSG K   ++QGEL+G
Sbjct  247   DKPGEGWTGGKGYVTKELVKMAFPEPNTEGIKLFVCGPPGMYQAVSGNKVSPKDQGELTG  306

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GYT+  VYKF
Sbjct  307   ILKELGYTKEQVYKF  321



>ref|XP_003022050.1| hypothetical protein TRV_03791 [Trichophyton verrucosum HKI 0517]
 gb|EFE41432.1| hypothetical protein TRV_03791 [Trichophyton verrucosum HKI 0517]
Length=321

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 158/255 (62%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W++ KL     VSHN    RF   D  +  GL IAS ++T+        EG  K  IRPY
Sbjct  72    WVDLKLSAVEEVSHNVKKLRFELPDSESVSGLHIASALLTKF-----KGEGDAKATIRPY  126

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD D  GH DLL+K YP G MS H   L  G+ +  KGPI K ++  N   H+ M+A
Sbjct  127   TPVSDEDEPGHLDLLVKKYPGGPMSTHIHDLNVGEPLSFKGPIPKYEWEANKHSHVCMVA  186

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+I  I  NP D TQ++L+Y NV  +DILL+++L+ L   HP   KV Y +
Sbjct  187   GGTGITPMYQLIRKIFSNPADKTQVTLIYGNVGEEDILLRRELEHLENMHPRQFKVLYLL  246

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D P + W GG G+++K++V    P P  + + +FVCGPPG+   VSG K   ++QGEL+G
Sbjct  247   DKPGEGWTGGKGYVTKELVKMAFPEPKTEGIKLFVCGPPGLYKAVSGNKVSPKDQGELTG  306

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GYT+  VYKF
Sbjct  307   ILKELGYTKEQVYKF  321



>gb|EPY39717.1| cytochrome-b5 reductase [Angomonas deanei]
Length=293

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/276 (42%), Positives = 176/276 (64%), Gaps = 13/276 (5%)
 Frame = +2

Query  209   LDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRA  385
             + +++  ++ K+  NP+++  +KL      SH+T  F F+  +P  K  + +ASCI+ + 
Sbjct  24    VSEVSAASAAKSTFNPDEFQSYKLLSSRYESHDTRRFLFALPNPEDKFHMPVASCIVAKF  83

Query  386   PIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGP  565
                  D++GK   V+RPYTPI+    KG+F+LLIK YP+GKM  H  +++ G+++ +KGP
Sbjct  84    ----TDSDGKE--VVRPYTPITSNQNKGYFELLIKKYPKGKMGNHLFTMQVGEELLMKGP  137

Query  566   IQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkk  745
              +K  Y PN  KH+GMI GG+GI PM QV++ IL+NP D T ISLL+AN    DILL  +
Sbjct  138   FEKFSYTPNQWKHVGMICGGTGIAPMYQVVKTILENPKDKTNISLLFANNQRRDILLANE  197

Query  746   ldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSD-DTLIFVCGPPGMMT  922
             L  L  T+ N  V+ T+      W GG G+I+K+M+   +P P + +T I VCGPP M+ 
Sbjct  198   LMELQKTYNNFNVYLTLLQVPSRWLGGIGYINKEMIQTFMPKPGEKNTKILVCGPPPMLQ  257

Query  923   HVSGEKDKR-----EQGELSGVLKEVGYTENMVYKF  1015
              +SG+K  +     +QG LSG+L+E+GYTE+ V+K+
Sbjct  258   AISGDKLFQQGKPPQQGPLSGILRELGYTEDQVFKY  293



>gb|EMT61501.1| NADH-cytochrome b5 reductase 2 [Fusarium oxysporum f. sp. cubense 
race 4]
 gb|EXM12009.1| NADH-cytochrome b5 reductase 2 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
Length=332

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/255 (47%), Positives = 165/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++  KL D   V+HNT   RF   +P    GL +AS I+T+   G  D     K  +RPY
Sbjct  83    FVSLKLSDVELVNHNTKRLRFELPEPDQVSGLHVASAILTKYK-GPNDE----KATLRPY  137

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD + KG  DLL+K YP G MS H  +L PG ++++KGP+ K  +  N   HI +IA
Sbjct  138   TPISDENEKGFIDLLVKKYPNGPMSTHLHNLVPGQRLDIKGPLPKYPWEENKHDHIALIA  197

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  NP+D T+++L++ NVS  DILLKK+ + L  T P   + FY +
Sbjct  198   GGTGITPMYQLARAIFNNPNDKTKVTLVFGNVSEQDILLKKEFEHLENTFPQRFRAFYVL  257

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D+P K+W G SG+ISK+++   LP P ++ + +FVCGPPG+M  +SG K   + QGEL+G
Sbjct  258   DNPPKDWVGNSGYISKELLKTVLPEPKNENIKLFVCGPPGLMNAISGNKVSPKNQGELTG  317

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GY E+ VYKF
Sbjct  318   ALKELGYKEDQVYKF  332



>gb|EPS27970.1| hypothetical protein PDE_02915 [Penicillium oxalicum 114-2]
Length=323

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 170/255 (67%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFD-PSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W++ KL +   +SHNT  FRF FD P A  GL +AS ++ +      DAE   K V+RPY
Sbjct  74    WVDLKLAEIEILSHNTKRFRFEFDDPEAVSGLPVASALLAK--FKPADAE---KPVLRPY  128

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP SD D  G+ +L++K YP G MS+H  S+    ++ +KGP+ K  +  N   HI +IA
Sbjct  129   TPTSDEDTPGYLELVVKAYPGGPMSEHLHSMNVDQRLSLKGPLPKYPWEANKHDHITLIA  188

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+   I KNPDD T+++L++ NVS DDILLKK+L+ L  T+P   + FY +
Sbjct  189   GGTGITPMYQLARRIFKNPDDRTKVTLVFGNVSEDDILLKKELEDLENTYPQRFRAFYVL  248

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D+P + W GG G+I+KD++   +P P ++ + IFVCGPPG+   +SG K   ++QGEL+G
Sbjct  249   DNPPEGWTGGKGYITKDLLKTVMPEPKEENIKIFVCGPPGLYKAISGPKVSPKDQGELTG  308

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GYT+  V+KF
Sbjct  309   ILKELGYTKEQVFKF  323



>gb|ERS99239.1| hypothetical protein HMPREF1624_04437 [Sporothrix schenckii ATCC 
58251]
Length=344

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 169/256 (66%), Gaps = 10/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++   +E    V+HNT L RF   +P    G+  AS ++T+        EG  K +IRPY
Sbjct  94    FVPLTVESVDVVNHNTKLVRFKLPEPDQIAGMHAASALLTKF-----KPEGAEKAIIRPY  148

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             T +SD DA+GH DLL+K Y  GKMS H  SL PGD ++ KGPI K ++ PN  + IG++A
Sbjct  149   TAVSDADAQGHLDLLVKRYEGGKMSPHIHSLAPGDTLDFKGPIVKYKWAPNKHEQIGLVA  208

Query  620   GGSGITPMLQVIEAILKNPD-DNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             GG+GITPM Q+I+A+L+N D D T+I+L+Y N++ +DILL K+L  L   +P   + FY 
Sbjct  209   GGTGITPMYQLIKAVLRNADEDKTKITLVYGNIAEEDILLHKELRHLENKYPQRFRTFYV  268

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEKDK-REQGELS  967
             ++ PT +W+GG G+I+K+++ + LP P + D  +FVCGPPG+M  VSG K    +QGELS
Sbjct  269   LEKPTADWQGGKGYITKELLKQVLPEPKAGDFKLFVCGPPGLMNAVSGNKKSPSDQGELS  328

Query  968   GVLKEVGYTENMVYKF  1015
             G L+E+GYT+  V K 
Sbjct  329   GALQELGYTKEQVLKL  344



>ref|XP_001464343.1| putative cytochrome-b5 reductase [Leishmania infantum JPCM5]
 ref|XP_003859530.1| cytochrome-b5 reductase, putative [Leishmania donovani]
 emb|CAM66725.1| putative cytochrome-b5 reductase [Leishmania infantum JPCM5]
 emb|CBZ32822.1| cytochrome-b5 reductase, putative [Leishmania donovani]
Length=279

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 118/265 (45%), Positives = 165/265 (62%), Gaps = 13/265 (5%)
 Frame = +2

Query  242   TALNPNQWIEFKLEDRAPVSHNTHLFRFSFD-PSAKLGLDIASCIITRAPIGQQDAEGKP  418
                +P+ +  FKL      SH+T  F F+ D P     + +ASCII +      DA+GK 
Sbjct  21    NTFSPDSYKPFKLISSRYESHDTRRFYFALDSPDDSFYMPVASCIIAK----YTDADGKD  76

Query  419   KYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMK  598
               V RPYTPIS    KGHF+L++K YP+GKM  +  S++PGD++ VKGP +K  Y+PNM 
Sbjct  77    --VARPYTPISSNSTKGHFELVVKKYPKGKMGNYLFSMQPGDELLVKGPFEKFAYKPNMW  134

Query  599   KHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPNL  778
             KH+GMIAGG+GI+PM QVI A+L+NP D T ISL+YAN    DILL  +L  +   + N 
Sbjct  135   KHVGMIAGGTGISPMYQVIRAVLENPKDKTNISLIYANNQRRDILLANELIEMQKVYNNF  194

Query  779   KVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSD-DTLIFVCGPPGMMTHVSGEK-----  940
              ++ T+      W GG G+++  MV   +P P + +T I VCGPP MM  +SG+K     
Sbjct  195   NMYLTLLEVPHRWLGGIGYVNSAMVTTFMPKPGEKNTKILVCGPPPMMQAISGDKLFEPG  254

Query  941   DKREQGELSGVLKEVGYTENMVYKF  1015
                +QG++SG+LK +GYTE  V+K+
Sbjct  255   KPPQQGQVSGLLKTLGYTEEQVFKY  279



>ref|XP_003716173.1| NADH-cytochrome b5 reductase 2 [Magnaporthe oryzae 70-15]
 sp|A4QR21.1|MCR1_MAGO7 RecName: Full=NADH-cytochrome b5 reductase 2; AltName: Full=Mitochondrial 
cytochrome b reductase [Magnaporthe oryzae 70-15]
 gb|EHA49854.1| NADH-cytochrome b5 reductase 2 [Magnaporthe oryzae 70-15]
 gb|ELQ38352.1| NADH-cytochrome b5 reductase [Magnaporthe oryzae Y34]
 gb|ELQ66573.1| NADH-cytochrome b5 reductase [Magnaporthe oryzae P131]
Length=331

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 168/255 (66%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++  +L+D   V+HNT   RF       + GL +AS ++T+        EG  K V+RPY
Sbjct  82    FVSLQLDDVEVVNHNTKRLRFKLPEDDMVSGLHVASALLTKF-----KPEGAEKPVLRPY  136

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD D KG+ DL++K Y  G MS H   L PG K++ KGP+ K ++  N   H+ MIA
Sbjct  137   TPISDEDQKGYLDLIVKKYEGGPMSTHIHELVPGQKLDFKGPLPKYEWSANKHPHVAMIA  196

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q++ AI KNP D T+++L+  N++ +DILLKK+L  L  T+P   + FY +
Sbjct  197   GGTGITPMYQIMRAIFKNPADKTKVTLVVGNITEEDILLKKQLAELENTYPQRFRAFYVL  256

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D+P K+W G  G+I+KD++   LP P ++ + +FVCGPPGMM  +SG K   ++QGE+SG
Sbjct  257   DNPPKDWAGTKGYITKDLLKTVLPEPKEENIKVFVCGPPGMMKAISGNKVSPKDQGEVSG  316

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GY ++ +YKF
Sbjct  317   ILKELGYKQDQIYKF  331



>emb|CDH16881.1| probable NADH-cytochrome b5 reductase 2-A [Zygosaccharomyces 
bailii ISA1307]
Length=312

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 162/256 (63%), Gaps = 9/256 (4%)
 Frame = +2

Query  257   NQWIEFKLEDRAPVSHNTHLFRFSFD-PSAKLGLDIASCIITRAPIGQQDAEGKPKYVIR  433
             ++WI+ KL      SH+T  F F    P  +LGL + S ++T+          K   VIR
Sbjct  63    DKWIDLKLAKVEDESHDTKKFTFELQSPDQELGLTLCSALLTKY------LTEKGNNVIR  116

Query  434   PYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGM  613
             PYTP S+ D KG F+L+IK YPEGKMS H  SLKP D +  KGPI+K Q++PN    I +
Sbjct  117   PYTPTSELDKKGEFNLVIKRYPEGKMSTHIHSLKPSDTLSFKGPIKKFQWQPNAFDSITL  176

Query  614   IAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFY  790
             I GGSGITP+ Q++ ++ +NP+D T++ L Y N +P DILLKK+LD L   HP+ +K+ Y
Sbjct  177   IGGGSGITPLYQLLRSVSENPEDKTKVKLFYGNKTPGDILLKKELDSLQEKHPDQVKITY  236

Query  791   TVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDK-REQGELS  967
              +D P  +++G  GFIS++ +    P PS+ T  FVCGPP +M  +SG K    EQGEL 
Sbjct  237   FLDKPDGDFKGEKGFISREFIAANAPKPSEKTHFFVCGPPPLMESISGNKKSPAEQGELK  296

Query  968   GVLKEVGYTENMVYKF  1015
             G LK++GY E  V+KF
Sbjct  297   GALKDLGYREEQVFKF  312



>gb|KDQ18155.1| hypothetical protein BOTBODRAFT_29492 [Botryobasidium botryosum 
FD-172 SS1]
Length=328

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 164/261 (63%), Gaps = 5/261 (2%)
 Frame = +2

Query  242   TALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQDAEGKPK  421
             +AL+ + ++EF L+     +HNT  + F         L I+SC++ + P    DA+GKP 
Sbjct  70    SALDKDNFVEFPLKKIEEYNHNTAKYIFELPEHTASLLPISSCVVVKTPETFVDAKGKP-  128

Query  422   YVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKK  601
               +RPYTPISD DA+G    LIK YPEG +S+   S+K GDK+ VKGP  K  Y+ N  +
Sbjct  129   -FVRPYTPISDSDAEGELAFLIKYYPEGNVSKFVHSMKIGDKLAVKGPFPKFPYKSNEFE  187

Query  602   HIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-L  778
             HIGMIAGGSGITPM Q+++  L   DD T+ +LL+ANV+P DILL++  D L A HP   
Sbjct  188   HIGMIAGGSGITPMYQILKHALAISDDKTKFTLLFANVTPADILLREDFDALKAKHPERF  247

Query  779   KVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPS--DDTLIFVCGPPGMMTHVSGEKDKRE  952
              V Y VD     W+G +G+I+ D++ + + P S  D   + VCGPP  +  ++G K   +
Sbjct  248   DVVYVVDKADSNWKGPTGYITPDLIKEHIAPASAGDKVRVLVCGPPPQVAAIAGAKAGMQ  307

Query  953   QGELSGVLKEVGYTENMVYKF  1015
             QGEL+G LKE+GYT + V+KF
Sbjct  308   QGELNGTLKELGYTPDQVFKF  328



>gb|EKG13870.1| Oxidoreductase FAD/NAD(P)-binding protein [Macrophomina phaseolina 
MS6]
Length=334

 Score =   215 bits (547),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 169/256 (66%), Gaps = 10/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++   L++   ++HNT  FRF   +P    GL IAS ++T+    + +     K V+RPY
Sbjct  84    FLSLVLDEVETLNHNTKRFRFKLPEPDNVSGLHIASALLTKYKGPEME-----KPVLRPY  138

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP SD DA G  DL++K YP G MS+H  S+ PG +++ KGP+ K  + PN  +HI +IA
Sbjct  139   TPTSDEDATGFIDLVVKRYPNGPMSEHLHSMTPGQRLDFKGPLPKYPWAPNKHEHIALIA  198

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+I AI KNP+D T+++L+Y N++ DDILLKK+L  L  T+P   + FYT+
Sbjct  199   GGTGITPMYQLIRAIFKNPEDKTKVTLVYGNLTEDDILLKKELHELENTYPQRFRAFYTL  258

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPP--SDDTLIFVCGPPGMMTHVSGEK-DKREQGELS  967
             D+P KEW  G G ++K+++   LP P   +   IFVCGPPGM   +SG K   ++QGELS
Sbjct  259   DNPPKEWTQGKGHVTKELLKTVLPEPKEGEKLKIFVCGPPGMYKAISGNKVSPKDQGELS  318

Query  968   GVLKEVGYTENMVYKF  1015
             G+LKE+GY +  VYKF
Sbjct  319   GILKELGYDKEQVYKF  334



>emb|CDH12382.1| probable NADH-cytochrome b5 reductase 2-A [Zygosaccharomyces 
bailii ISA1307]
Length=312

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 163/256 (64%), Gaps = 9/256 (4%)
 Frame = +2

Query  257   NQWIEFKLEDRAPVSHNTHLFRFSFD-PSAKLGLDIASCIITRAPIGQQDAEGKPKYVIR  433
             ++WI+ KL      SH+T  F F    P  +LGL + S ++T+          K   VIR
Sbjct  63    DKWIDLKLAKVEDESHDTKKFTFELQSPDQELGLTLCSALLTKY------VTEKGNNVIR  116

Query  434   PYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGM  613
             PYTP S+ + KG F+L+IK YPEGKMS+H  SLKP D +  KGPI+K Q++PN    I +
Sbjct  117   PYTPTSELNKKGEFNLVIKRYPEGKMSKHIHSLKPSDTLSFKGPIKKFQWQPNAFDSITL  176

Query  614   IAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFY  790
             I GGSGITP+ Q++ ++ +NP+D T++ L Y N +P D+LLKK+LD L   HP+ +K+ Y
Sbjct  177   IGGGSGITPLYQLLRSVSENPEDKTKVKLFYGNKTPGDVLLKKELDSLQEKHPDQVKITY  236

Query  791   TVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDK-REQGELS  967
              +D P  +++G  GFIS++ +    P PS+ T  FVCGPP +M  +SG K    EQGEL 
Sbjct  237   FLDKPDGDFKGEKGFISREFIAANAPKPSEKTHFFVCGPPPLMESISGNKKSPAEQGELK  296

Query  968   GVLKEVGYTENMVYKF  1015
             G LK++GY E  V+KF
Sbjct  297   GALKDLGYREEQVFKF  312



>gb|EPY34376.1| cytochrome-b5 reductase [Angomonas deanei]
 gb|EPY38748.1| cytochrome-b5 reductase [Angomonas deanei]
 gb|EPY39639.1| cytochrome-b5 reductase [Angomonas deanei]
Length=340

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 115/276 (42%), Positives = 176/276 (64%), Gaps = 13/276 (5%)
 Frame = +2

Query  209   LDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRA  385
             + +++  ++ K+  NP+++  +KL      SH+T  F F+  +P  K  + +ASCI+ + 
Sbjct  71    VSEVSAASAAKSTFNPDEFQSYKLLSSRYESHDTRRFLFALPNPEDKFHMPVASCIVAKF  130

Query  386   PIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGP  565
                  D++GK   V+RPYTPI+    KG+F+LLIK YP+GKM  H  +++ G+++ +KGP
Sbjct  131   ----TDSDGKE--VVRPYTPITSNQNKGYFELLIKKYPKGKMGNHLFTMQVGEELLMKGP  184

Query  566   IQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkk  745
              +K  Y PN  KH+GMI GG+GI PM QV++ IL+NP D T ISLL+AN    DILL  +
Sbjct  185   FEKFSYTPNQWKHVGMICGGTGIAPMYQVVKTILENPKDKTNISLLFANNQRRDILLANE  244

Query  746   ldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSD-DTLIFVCGPPGMMT  922
             L  L  T+ N  V+ T+      W GG G+I+K+M+   +P P + +T I VCGPP M+ 
Sbjct  245   LMELQKTYNNFNVYLTLLQVPSRWLGGIGYINKEMIQTFMPKPGEKNTKILVCGPPPMLQ  304

Query  923   HVSGEKDKR-----EQGELSGVLKEVGYTENMVYKF  1015
              +SG+K  +     +QG LSG+L+E+GYTE+ V+K+
Sbjct  305   AISGDKLFQQGKPPQQGPLSGILRELGYTEDQVFKY  340



>ref|XP_009540573.1| hypothetical protein HETIRDRAFT_437452 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW86565.1| hypothetical protein HETIRDRAFT_437452 [Heterobasidion irregulare 
TC 32-1]
Length=327

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 116/267 (43%), Positives = 167/267 (63%), Gaps = 9/267 (3%)
 Frame = +2

Query  236   RKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRA--PIGQQDAE  409
              K+ L+P  +++FKL+   P +HNT  F F    +    L +ASC++ RA  P    DA+
Sbjct  63    EKSPLDPQNFLDFKLKRVVPYNHNTATFVFELPNNEASLLPVASCLLVRASDPAALTDAK  122

Query  410   GKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRP  589
             G+P  V+RPYTP+S PDA G   LL+K Y  G  S+H   LK GD + +KGPI K  Y+ 
Sbjct  123   GRP--VVRPYTPVSQPDAPGELALLVKKYDAGNASKHIHDLKVGDTLAIKGPIAKFPYKV  180

Query  590   NMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATH  769
             N    + +I GGSGITP+ Q++   L +P + T+  L++AN +  DILL+++ D L   H
Sbjct  181   NEFDEVALIGGGSGITPLYQILTYALADPSNKTKFKLVFANQTEADILLREEFDALRKAH  240

Query  770   PN-LKVFYTVDSPT--KEWRGGSGFISKDMVVKGLPPPS--DDTLIFVCGPPGMMTHVSG  934
             P+   V Y VD P   K W G +GF+SKD++ + L PPS  D   +FVCGPPG +  ++G
Sbjct  241   PDTFDVLYAVDKPESGKAWTGHTGFLSKDVLKQHLAPPSLNDKVKVFVCGPPGQVAAIAG  300

Query  935   EKDKREQGELSGVLKEVGYTENMVYKF  1015
             +K+  +QG + G+LKE+GYTE+ VYKF
Sbjct  301   KKEGPKQGAVGGILKELGYTEDQVYKF  327



>ref|XP_007588735.1| putative nadh-cytochrome b5 reductase protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD43791.1| putative nadh-cytochrome b5 reductase protein [Neofusicoccum 
parvum UCRNP2]
Length=328

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/258 (45%), Positives = 171/258 (66%), Gaps = 14/258 (5%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITR--APIGQQDAEGKPKYVIR  433
             ++   LE+   ++HNT  FRF    +  + GL +AS ++T+   P  Q       K V+R
Sbjct  78    FVSLVLEEVENINHNTKRFRFKLPEADNVSGLHVASALLTKYKGPEMQ-------KAVLR  130

Query  434   PYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGM  613
             PYTP SD D +G+ DL++K YP G MS+HF +++PG  ++ KGP+ K  + PN  +HI +
Sbjct  131   PYTPTSDEDTQGYLDLIVKKYPGGPMSEHFHNMQPGQSLDFKGPLPKYAWAPNKHEHIAL  190

Query  614   IAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFY  790
             IAGG+GITPM Q+I AI KNP+D T+++L+Y N++ DDILLKK+L  L  T+P   + FY
Sbjct  191   IAGGTGITPMYQLIRAIFKNPEDKTKVTLVYGNITEDDILLKKELHELENTYPQRFRAFY  250

Query  791   TVDSPTKEWRGGSGFISKDMVVKGLPPP--SDDTLIFVCGPPGMMTHVSGEK-DKREQGE  961
             T+D P  +W  G GF++K+++   LP P   +   +FVCGPPG+   +SG K   ++QGE
Sbjct  251   TLDKPPADWSQGKGFVTKELLKTVLPEPKEGEKVKVFVCGPPGLYKAISGNKVSPQDQGE  310

Query  962   LSGVLKEVGYTENMVYKF  1015
             L+G+LK++GY +N VYKF
Sbjct  311   LTGILKDLGYDKNQVYKF  328



>ref|XP_007360878.1| cytochrome-b5 reductase [Dichomitus squalens LYAD-421 SS1]
 gb|EJF67513.1| cytochrome-b5 reductase [Dichomitus squalens LYAD-421 SS1]
Length=332

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/269 (44%), Positives = 174/269 (65%), Gaps = 10/269 (4%)
 Frame = +2

Query  233   SRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITR----APIGQQ  400
             S ++ L+P  + +FKL+   P +HNT  + F   P +   L IASC++ +    AP    
Sbjct  66    SDQSPLDPQNFKDFKLKKVEPYNHNTAKYIFELPPDSASLLPIASCVVVKSADDAPNPLL  125

Query  401   DAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQ  580
             D +GKP  VIRPYTPIS  D  G    LIK Y +GKMS++   LK G+ + +KGPI K +
Sbjct  126   DPKGKP--VIRPYTPISPSDLPGELTFLIKRYDQGKMSKYIHDLKIGESLAIKGPIPKFE  183

Query  581   YRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLA  760
             Y+ N    +GMIAGGSGITPM Q+++  LK+P + T+ +L++AN +  DILLK++ D L 
Sbjct  184   YKINQFDQVGMIAGGSGITPMYQILDYALKDPSNKTRFTLIFANATEKDILLKEEFDALK  243

Query  761   ATHPN-LKVFYTVDSP-TKEWRGGSGFISKDMVVKGLPPPS--DDTLIFVCGPPGMMTHV  928
               +P    V YT+D P T +W+G  G+I+K+++ + +PP    + T IFVCGPPG +  +
Sbjct  244   KKYPQTFNVVYTIDKPETSDWKGPVGYINKELIAQHIPPADLGEKTKIFVCGPPGQVNAL  303

Query  929   SGEKDKREQGELSGVLKEVGYTENMVYKF  1015
             +G+K+  +QG LSGVLKE+GY E+ V+KF
Sbjct  304   AGKKEGMKQGALSGVLKELGYNEDQVFKF  332



>ref|XP_005703556.1| cytochrome-b5 reductase [Galdieria sulphuraria]
 gb|EME27036.1| cytochrome-b5 reductase [Galdieria sulphuraria]
Length=364

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/276 (45%), Positives = 176/276 (64%), Gaps = 11/276 (4%)
 Frame = +2

Query  197   NLVYLD-QINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCI  373
             N + LD Q+  + ++K  LNP  ++  +L    P +HN    RF+   + +      S +
Sbjct  97    NKIKLDSQVVGEEAKK--LNPEDFVPIQLISNTPYNHNVARLRFAIQSAEQEDFPAVSFV  154

Query  374   ITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVE  553
             + +     +D +G    VIRPY P+S   AKG+ +L++K YP  KM  +  S +PGD V 
Sbjct  155   LVKT----KDEQGND--VIRPYNPVSGVSAKGYLELMVKKYPNSKMGTYLHSRQPGDSVL  208

Query  554   VKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddil  733
             VKGP+++  Y+PN KK IG +AGG+GITP+ Q+I+ IL NP D+T+I+LLYAN +P+DIL
Sbjct  209   VKGPMRQYPYQPNAKKEIGFVAGGTGITPVYQLIDYILSNPKDHTKITLLYANKTPEDIL  268

Query  734   lkkkldVLAATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPP  910
             LK +LD L   H + L + YTVD P   W+G  G I KDM+ K LP  S + LIFVCGPP
Sbjct  269   LKSELDALQRKHSDRLVIHYTVDQPNDHWQGEKGQIQKDMLKKYLPRASHENLIFVCGPP  328

Query  911   GMMTHVSGEKD-KREQGELSGVLKEVGYTENMVYKF  1015
              MM  +SG K   ++QG LSG+LKE+GY+E+ V+KF
Sbjct  329   PMMEAISGTKTPDKKQGPLSGLLKELGYSEDNVWKF  364



>ref|XP_007719963.1| cytochrome-b5 reductase [Capronia coronata CBS 617.96]
 gb|EXJ95734.1| cytochrome-b5 reductase [Capronia coronata CBS 617.96]
Length=336

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 168/255 (66%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             +I  KL +    +HNT + +F+  DP    GL +AS +IT+     Q   G+ K +IRPY
Sbjct  87    FISLKLAEVHEYNHNTKILKFALPDPEQVSGLSVASAVITK----YQPPNGE-KPIIRPY  141

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPI+D D KG+ +LL+KVYP G MS+H  S+ P  +++ KGPI K  + PN   HI +IA
Sbjct  142   TPINDEDVKGYLELLVKVYPNGPMSEHMHSMVPPQRLDFKGPIPKYPWAPNKHDHITLIA  201

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+I  I KNP+D T++SL+Y NV+  DILLK++L+ +    P   + FY +
Sbjct  202   GGTGITPMYQLIRTIFKNPEDKTKVSLIYGNVTEADILLKEELEKIENEFPQRFRAFYLL  261

Query  797   DSPTKEWRGGSGFISKDMVVKGLP-PPSDDTLIFVCGPPGMMTHVSGEKDK-REQGELSG  970
             D+P   W  G GFISK++V    P P S +  IFVCGPPGM   VSG K   ++QGELSG
Sbjct  262   DNPPPSWPYGKGFISKELVKTVAPDPKSGNIKIFVCGPPGMYKAVSGNKTSPQDQGELSG  321

Query  971   VLKEVGYTENMVYKF  1015
             +LK++GYT++ V+KF
Sbjct  322   ILKDLGYTKDQVFKF  336



>ref|XP_001212924.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU35548.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=329

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/260 (46%), Positives = 170/260 (65%), Gaps = 10/260 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIAS-----CIITRAPIGQQDAEGKPKY  424
             W++ KL +   ++HNT  FRF F D  A  GL++A       +   A + +   EG  K 
Sbjct  71    WVDLKLSEIEVLNHNTKRFRFEFEDKEAVSGLNVAFRLNVFSLSAAALLTKFKPEGG-KA  129

Query  425   VIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKH  604
             V+RPYTP+SD    G  DL++KVYP G MS+H  S+    ++E KGP+ K  +  N  +H
Sbjct  130   VLRPYTPVSDESQPGFLDLVVKVYPNGPMSEHLHSMNVDQRLEFKGPLPKYPWEANKHQH  189

Query  605   IGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LK  781
             I +IAGG+GITPM Q+   I KNP+D T+++L+Y NVS  DILLKK+L+ L  T+P   K
Sbjct  190   ICLIAGGTGITPMYQLARHIFKNPEDKTKVTLVYGNVSEQDILLKKELEELENTYPQRFK  249

Query  782   VFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQ  955
              FY +D+P KEW GG G+ISK+++   LP P ++ + IFVCGPPG+   +SG K   ++Q
Sbjct  250   AFYVLDNPPKEWTGGKGYISKELLKTVLPEPKEENIKIFVCGPPGLYKAISGNKVSPKDQ  309

Query  956   GELSGVLKEVGYTENMVYKF  1015
             GEL+G+LKE+GY++  V+KF
Sbjct  310   GELTGILKELGYSQEQVFKF  329



>ref|XP_007860321.1| ferredoxin reductase-like protein [Gloeophyllum trabeum ATCC 
11539]
 gb|EPQ59980.1| ferredoxin reductase-like protein [Gloeophyllum trabeum ATCC 
11539]
Length=327

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/283 (44%), Positives = 177/283 (63%), Gaps = 15/283 (5%)
 Frame = +2

Query  203   VYLDQINEDTSRKTAL-----NPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIAS  367
             VYLD+  +  ++  AL     +P++++EF L+   P +HNT  + F    +    L +AS
Sbjct  48    VYLDRTGKAQAKPKALGPSPLDPSKFVEFPLKKVEPYNHNTAKYTFELPENTAAQLPVAS  107

Query  368   CIITRAPIGQ---QDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKP  538
             C+  +A  G    +DA+G P  V RPYTPIS PD  G F  LIK Y  G M+   A++KP
Sbjct  108   CVYLKA-FGDNAPKDAKGNP--VARPYTPISPPDLPGEFVFLIKKYDTGVMTPWIANMKP  164

Query  539   GDKVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVS  718
             GDK+ VKGP+ K  Y+ N    +GMIAGGSGITPM Q+++  L++P + T+  L++ANV+
Sbjct  165   GDKISVKGPLPKWPYKINEFDDVGMIAGGSGITPMYQILKYALEDPSNKTRFKLIFANVT  224

Query  719   PddillkkkldVLAATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPS--DDTL  889
               DILLK++ D +   +P    V YTVD P+ EW+G  G+++ D+V K   P +  D   
Sbjct  225   EKDILLKEEFDEMKKKYPQTFDVIYTVDQPSPEWKGPVGYVNADLVKKTFAPSNVGDKVK  284

Query  890   IFVCGPPGMMTHVSGEKDK-REQGELSGVLKEVGYTENMVYKF  1015
             IFVCGPPG +  ++G K   ++QGEL GVLKE+GY EN V+KF
Sbjct  285   IFVCGPPGQVNSLAGPKASIKDQGELKGVLKELGYNENQVFKF  327



>ref|XP_007879830.1| hypothetical protein PFL1_04115 [Pseudozyma flocculosa PF-1]
 gb|EPQ28288.1| hypothetical protein PFL1_04115 [Pseudozyma flocculosa PF-1]
Length=354

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/266 (44%), Positives = 169/266 (64%), Gaps = 4/266 (2%)
 Frame = +2

Query  227   DTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQDA  406
             +T +  ALN + + EF L++  P +H++  + F      K G+ +AS ++ +A +G+   
Sbjct  90    ETVQGGALNKDAFTEFTLKEVKPYNHDSATYIFELPDGKKPGMSVASAVVFKA-VGEGLK  148

Query  407   EGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYR  586
             + K K VIRPYTP+S PD  GH D LIK Y  GKM+ +  S+KPGDK+ +KGPI K  Y+
Sbjct  149   DDKGKDVIRPYTPVSSPDTAGHIDFLIKRYENGKMTNYVHSMKPGDKIAIKGPIAKFPYK  208

Query  587   PNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAAT  766
              N  +HIG++AGGSGITPM Q+I+ I  +P D T+ +L+YAN S  DILL+++ D LAA 
Sbjct  209   ANEFEHIGLVAGGSGITPMWQIIQQIASDPSDKTKATLIYANKSEKDILLREEFDKLAAK  268

Query  767   HPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPP--SDDTLIFVCGPPGMMTHVSGEK  940
              P  KV Y VD   K++ G  G+++  ++   LP P  ++   +FVCGPPG +  + G K
Sbjct  269   DPRFKVVYGVDQKPKDFDGFEGYVTSGILGHHLPLPGLANKAKVFVCGPPGQVEAICGGK  328

Query  941   D-KREQGELSGVLKEVGYTENMVYKF  1015
               K  QGEL G+L ++GY  + VYKF
Sbjct  329   GPKGSQGELKGLLADLGYQPDQVYKF  354



>ref|XP_008712070.1| hypothetical protein HMPREF1541_09173 [Cyphellophora europaea 
CBS 101466]
 gb|ETN45342.1| hypothetical protein HMPREF1541_09173 [Cyphellophora europaea 
CBS 101466]
Length=332

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 167/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             +I+ KL++    +HNT  F F    + +L G+++AS IIT+     Q+     K  IRPY
Sbjct  83    FIDLKLKEAKDYNHNTKRFVFELPEADQLSGMNVASAIITKFKAADQE-----KPTIRPY  137

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISDPD KG  +LL+K YP G MS+H   +KPGD + +KGPI K  +  N  +HI  +A
Sbjct  138   TPISDPDEKGSIELLVKKYPNGPMSEHIHDMKPGDTLSMKGPIPKYPWEANKHEHITCVA  197

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+I  I KNP+D T++SL++ NV+ DDILLK++   L    P   K FYTV
Sbjct  198   GGTGITPMYQLIHTIFKNPNDKTKVSLIFGNVTEDDILLKEEFQKLERDFPQRFKAFYTV  257

Query  797   DSPTKEWRGGSGFISKDMVVKGLP-PPSDDTLIFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D P K+W  G G I+K+++ + +P   S++  +FVCGPPG+   +SG K    +QGEL G
Sbjct  258   DKPPKDWPYGKGVITKELLKEVIPDSKSNNIKVFVCGPPGLYKAISGAKVSPTDQGELDG  317

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GY+++ VYKF
Sbjct  318   ILKELGYSKDQVYKF  332



>ref|XP_001265210.1| NADH-cytochrome b5 reductase, putative [Neosartorya fischeri 
NRRL 181]
 sp|A1D4H0.1|MCR1_NEOFI RecName: Full=NADH-cytochrome b5 reductase 2; AltName: Full=Mitochondrial 
cytochrome b reductase [Neosartorya fischeri NRRL 
181]
 gb|EAW23313.1| NADH-cytochrome b5 reductase, putative [Neosartorya fischeri 
NRRL 181]
Length=323

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/255 (45%), Positives = 166/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W++ KL     +S NT   RF F D  A  GL +AS ++T+         G  K VIRPY
Sbjct  74    WVDLKLAQIENLSPNTKRLRFEFPDKEAVSGLHVASALLTKF-----KPHGAEKPVIRPY  128

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD +  G+ DL++KVYP G MS+H  S+    ++E KGPI K  +  N  KHI +IA
Sbjct  129   TPVSDEEQPGYLDLVVKVYPNGPMSEHLHSMNVDQRLEFKGPIPKYPWEANKHKHICLIA  188

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+   I K+P+D T+++L++ NV  +DILLKK+L  L  T+P   + FY +
Sbjct  189   GGTGITPMYQLARKIFKDPEDQTKVTLVFGNVREEDILLKKELQELENTYPRRFRAFYVL  248

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D P KEW GG G+I+K+++   LP P ++ + IFVCGPPGM   +SG K   ++QGEL+G
Sbjct  249   DHPPKEWTGGKGYITKELLKTVLPEPKEENIKIFVCGPPGMYKSISGPKVSPKDQGELTG  308

Query  971   VLKEVGYTENMVYKF  1015
             +L E+GY+++ V+KF
Sbjct  309   ILAELGYSKDQVFKF  323



>ref|XP_006958608.1| ferredoxin reductase-like protein [Wallemia sebi CBS 633.66]
 gb|EIM21254.1| ferredoxin reductase-like protein [Wallemia sebi CBS 633.66]
Length=330

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 171/271 (63%), Gaps = 5/271 (2%)
 Frame = +2

Query  212   DQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPI  391
             D+I    + + AL    +    L++    +H++ +F F    S+  GL+ A  ++ +A  
Sbjct  62    DRIESLQTPQVALTKENFTNLTLKNVKKYNHDSSIFEFELPGSSVSGLETAGLVVVKAAD  121

Query  392   GQQDAE-GKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPI  568
                  + GKP  VIRPYTPIS  D +G  D LIK Y +GK + +  SLKPGD++ +KGP+
Sbjct  122   DSVKGDNGKP--VIRPYTPISTGDTRGQIDFLIKKYDDGKFTPYIHSLKPGDQLAIKGPL  179

Query  569   QKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkl  748
             QK ++ PN  + IG+IAGGSGITPM Q+ E IL NP+D T+++LL+AN +P+DILLK+ L
Sbjct  180   QKFKWVPNTYEKIGLIAGGSGITPMTQLAETILNNPEDKTKVTLLFANKTPEDILLKETL  239

Query  749   dVLAATHP-NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTH  925
             D     +P    V YT+D  T  W G  G+ + D++ K LP P  +   +VCGPP MM  
Sbjct  240   DDWKKKYPEQFNVVYTIDKETPGWDGLVGYFTGDILKKNLPAPGSNGKTYVCGPPPMMKA  299

Query  926   VSGEK-DKREQGELSGVLKEVGYTENMVYKF  1015
             +SG K +K  QGEL+G+LKE+GYTE+ ++K+
Sbjct  300   ISGNKTNKGAQGELTGILKELGYTEDQIFKY  330



>ref|XP_002849495.1| NADH-cytochrome b5 reductase 2 [Arthroderma otae CBS 113480]
 gb|EEQ29610.1| NADH-cytochrome b5 reductase 2 [Arthroderma otae CBS 113480]
Length=321

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 158/255 (62%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             WI+ KL     VSHN    RF   D  +  GL IAS ++T+        EG  K  IRPY
Sbjct  72    WIDLKLSAVEEVSHNVKKLRFDLPDSESVSGLHIASALLTKF-----KGEGDAKPTIRPY  126

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD +  GH DLL+K YP G MS H   L  G  +  KGPI K +++ N   H+ M+A
Sbjct  127   TPISDEEEPGHLDLLVKQYPNGPMSTHIHGLSVGQPLSFKGPIPKYEWKANKHSHVCMVA  186

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+I  I  +P D TQ++L+Y NV  +DILL+++L+ L  THP   K  Y +
Sbjct  187   GGTGITPMYQLIRKIFSDPADKTQVTLIYGNVGEEDILLRRELEELENTHPRRFKALYLL  246

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D P + W GG G+++K++V    P P  + + +FVCGPPGM   VSG K   ++QGEL+G
Sbjct  247   DKPGEGWTGGKGYVTKELVKMAFPEPKTEGIKVFVCGPPGMYKAVSGPKVSPKDQGELTG  306

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GY++  VYKF
Sbjct  307   ILKELGYSKEQVYKF  321



>ref|XP_502694.1| YALI0D11330p [Yarrowia lipolytica]
 sp|Q6C9G8.1|MCR1_YARLI RecName: Full=NADH-cytochrome b5 reductase 2; AltName: Full=Mitochondrial 
cytochrome b reductase [Yarrowia lipolytica CLIB122]
 emb|CAG80882.1| YALI0D11330p [Yarrowia lipolytica CLIB122]
Length=291

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 118/273 (43%), Positives = 168/273 (62%), Gaps = 16/273 (6%)
 Frame = +2

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITR--AP  388
             I+ D    T    +QW++ KL+    +SHNT    F    P + LGL  AS ++T+   P
Sbjct  28    ISNDAKTATLKGDDQWVDLKLKSSKDLSHNTKALIFELPTPDSTLGLTTASALLTKYVTP  87

Query  389   IGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPI  568
              G          V+RPYTP+SDPD+KG F+L++K YPEGKMS+H   LK GD +  KGPI
Sbjct  88    KGSN--------VVRPYTPVSDPDSKGEFELVVKSYPEGKMSKHIHELKEGDTLSFKGPI  139

Query  569   QKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkl  748
              K Q++PN+ K I +I  G+GITP+ Q+I AI KNP+D T+++L Y N +  DILLK ++
Sbjct  140   IKYQWQPNLHKEITLIGAGTGITPLYQLISAINKNPEDKTKVNLFYGNATEGDILLKDEI  199

Query  749   dVLAATHP-NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPP--SDDTLIFVCGPPGMM  919
             D +A   P    V Y +D P+  W+G +GFIS++  +KG  P   SD+  +FVCGPP   
Sbjct  200   DAIAKAKPQQFNVHYFLDKPSDNWKGENGFISEEF-IKGNSPAADSDNVKVFVCGPPPFY  258

Query  920   THVSGEK-DKREQGELSGVLKEVGYTENMVYKF  1015
               +SG K    +QGE+ G LK +G+ ++ V+KF
Sbjct  259   KAISGAKVSPTDQGEVDGALKNLGFNKDQVFKF  291



>ref|XP_003197005.1| cytochrome-b5 reductase [Cryptococcus gattii WM276]
 gb|ADV25218.1| Cytochrome-b5 reductase, putative [Cryptococcus gattii WM276]
Length=352

 Score =   213 bits (541),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 168/266 (63%), Gaps = 10/266 (4%)
 Frame = +2

Query  242   TALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAK---LGLDIASCIITRAPIGQ---QD  403
             +A   + WI F LE     +HN +++ FSF    K    G ++AS ++ R+P G    +D
Sbjct  89    SAFVKDTWIPFTLEKIEKYNHNANIYHFSFGEEGKDKISGGEVASVVLLRSPEGPDQIKD  148

Query  404   AEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQY  583
              +GKP  +IRPYTPIS PD KG  +L+IK Y  GK + + A L PG +V  KGP+QK +Y
Sbjct  149   EKGKP--IIRPYTPISPPDQKGSVELMIKKYSTGKFTPYLADLTPGQQVLFKGPLQKFKY  206

Query  584   RPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAA  763
              PN  +    IAGGSGITPM Q+I   L  P+D T+ +L+YANVS  DILL+K+ D LA 
Sbjct  207   EPNSFEKGLCIAGGSGITPMWQLINHSLSIPEDKTKWTLIYANVSEADILLRKEFDALAQ  266

Query  764   THPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGE  937
              +P  L + Y +D     W+G +G+++ D++ K  P   D+ +  FVCGPPG M  +SGE
Sbjct  267   KYPGRLDIKYVLDKGPWGWKGETGYVTADLIKKTFPKNEDENVRAFVCGPPGQMKAISGE  326

Query  938   KDKREQGELSGVLKEVGYTENMVYKF  1015
             KD  +QGELSG LK++GYT N V+K+
Sbjct  327   KDGMKQGELSGALKDLGYTSNEVFKY  352



>ref|XP_001681919.1| putative cytochrome-b5 reductase [Leishmania major strain Friedlin]
 emb|CAJ03229.1| putative cytochrome-b5 reductase [Leishmania major strain Friedlin]
Length=279

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/264 (44%), Positives = 163/264 (62%), Gaps = 13/264 (5%)
 Frame = +2

Query  245   ALNPNQWIEFKLEDRAPVSHNTHLFRFSFD-PSAKLGLDIASCIITRAPIGQQDAEGKPK  421
               +P+ +  FKL      SH+T  F F+ D P     + +ASCII +      DA+GK  
Sbjct  22    TFSPDAYKPFKLISSRYESHDTRRFYFALDSPDDSFYMPVASCIIAK----YTDADGKD-  76

Query  422   YVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKK  601
              V RPYTPIS    KGHF+L++K YP+GKM  +  S++PGD++ VKGP +K  Y+PNM K
Sbjct  77    -VARPYTPISSNSTKGHFELVVKKYPKGKMGNYLFSMQPGDELLVKGPFEKFAYKPNMWK  135

Query  602   HIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPNLK  781
             H+GMIAGG+GI PM QV+ A+L+NP D T ISL+YAN    DILL  +L  +   + N  
Sbjct  136   HVGMIAGGTGIAPMYQVLRAVLENPRDKTNISLIYANNQRRDILLANELIEMQKVYTNFN  195

Query  782   VFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSD-DTLIFVCGPPGMMTHVSGEK-----D  943
             ++ T+      W GG G+++  MV   +P P + +T I VCGPP MM  +SG+K      
Sbjct  196   MYLTLLEVPHRWLGGIGYVNSAMVTTFMPKPGEKNTKILVCGPPPMMQAISGDKLFEPGK  255

Query  944   KREQGELSGVLKEVGYTENMVYKF  1015
               +QG++ G+LK +GYTE  V+K+
Sbjct  256   PPQQGQVGGLLKTLGYTEEQVFKY  279



>ref|XP_007782407.1| NADH-cytochrome b5 reductase 2 [Coniosporium apollinis CBS 100218]
 gb|EON67090.1| NADH-cytochrome b5 reductase 2 [Coniosporium apollinis CBS 100218]
Length=349

 Score =   213 bits (541),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 111/255 (44%), Positives = 169/255 (66%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             +I  KLE    ++HNT  FRF   +  +  GL +AS +I +    + +     K  IRPY
Sbjct  100   FISLKLESVEDINHNTKRFRFKLPEEDSVSGLHVASAVIAKYKGPEME-----KPAIRPY  154

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD D K + D +IK YP+G MS+H  S+ PG +++ KGPI K  + PN   HI ++A
Sbjct  155   TPVSDEDTKNYMDFVIKRYPDGPMSEHLHSMNPGQRLDFKGPIPKYPWEPNKHDHIALVA  214

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI KNP+D T+++L++ N++ +D+LLK++ D L  T+P   + FYT+
Sbjct  215   GGTGITPMYQLARAIFKNPEDKTKVTLVFGNIAEEDVLLKREWDELENTYPQRFRAFYTL  274

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSG-EKDKREQGELSG  970
             D P ++W+ G GFI+K+++   LP P +  + +FVCGPPG+   VSG +K  ++QGEL G
Sbjct  275   DKPPEDWQQGKGFITKELLKTVLPEPKEKNVKVFVCGPPGLYKAVSGTKKSPQDQGELEG  334

Query  971   VLKEVGYTENMVYKF  1015
              LK++GY+++ VYKF
Sbjct  335   HLKDLGYSKDQVYKF  349



>ref|XP_003303374.1| hypothetical protein PTT_15546 [Pyrenophora teres f. teres 0-1]
 gb|EFQ88511.1| hypothetical protein PTT_15546 [Pyrenophora teres f. teres 0-1]
Length=340

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 116/258 (45%), Positives = 168/258 (65%), Gaps = 14/258 (5%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITR--APIGQQDAEGKPKYVIR  433
             ++   LE    V+HNT   RF   +   + GL +AS +IT+   P  Q       K VIR
Sbjct  90    FVSLMLEKSEVVNHNTKKLRFKLPEEDMESGLPVASAVITKYKGPEMQ-------KPVIR  142

Query  434   PYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGM  613
             PYTPISD D KG  D +IK YP G MS+H  +++PG ++++KGPI K Q++ N+ +HI +
Sbjct  143   PYTPISDVDQKGSVDFIIKAYPGGPMSEHMHAMEPGQRLDIKGPIPKFQWKENLHEHIAL  202

Query  614   IAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFY  790
             IAGG+GITPM Q    I +NP D T+++L+Y NVS +DILLK++ + L  T+P   + FY
Sbjct  203   IAGGTGITPMWQTARHIFRNPQDKTKVTLIYGNVSEEDILLKREWEELENTYPQRFRAFY  262

Query  791   TVDSPTKEWRGGSGFISKDMVVKGLPPP--SDDTLIFVCGPPGMMTHVS-GEKDKREQGE  961
              +D+P + W+GG G ++K+++   LP P   +   IFVCGPPGM   +S G+K   +QGE
Sbjct  263   VLDNPPESWQGGKGHVTKELLKTVLPEPKEGEKIKIFVCGPPGMYKAISGGKKSPSDQGE  322

Query  962   LSGVLKEVGYTENMVYKF  1015
             L G+LKE+GY+++ VYKF
Sbjct  323   LDGMLKELGYSKDQVYKF  340



>gb|KFA67170.1| hypothetical protein S40285_05255 [Stachybotrys chlorohalonata 
IBT 40285]
Length=337

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/255 (45%), Positives = 166/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             +I  KL D   V+HNT   RF      ++ GL +AS ++T+   G +D     K  +RPY
Sbjct  88    FISLKLSDVEVVNHNTKKLRFELPEGDQVSGLHVASALLTKYK-GPEDE----KPTLRPY  142

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD D KG+ +LL+K YP G MS H   + PG +++ KGP+ K  +  N   HI +IA
Sbjct  143   TPISDEDTKGYLELLVKKYPNGPMSTHMHDMAPGQRLDFKGPLPKYPWSENKHDHIALIA  202

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+G+TPM Q+  AI  NP+D T+++L++ NV+  DILLK+K + L  T+P   + FY +
Sbjct  203   GGTGVTPMYQLCRAIFNNPNDKTKVTLVFGNVTEQDILLKEKFEDLENTYPQRFRAFYVL  262

Query  797   DSPTKEWRGG-SGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEKDKREQGELSG  970
             D P K+W GG  G+I+KD++   LP P ++ + +FVCGPPGM+  + G K+K +QGEL+G
Sbjct  263   DKPPKDWTGGKGGYITKDLLKTVLPEPKNENIKLFVCGPPGMVKAICGPKNKMQQGELAG  322

Query  971   VLKEVGYTENMVYKF  1015
             +LK++GYT   VYKF
Sbjct  323   LLKDLGYTSEQVYKF  337



>ref|XP_658036.1| hypothetical protein AN0432.2 [Aspergillus nidulans FGSC A4]
 sp|Q5BG98.1|MCR1_EMENI RecName: Full=NADH-cytochrome b5 reductase 2; AltName: Full=Mitochondrial 
cytochrome b reductase [Aspergillus nidulans FGSC 
A4]
 gb|EAA66531.1| hypothetical protein AN0432.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF89495.1| TPA: NADH-cytochrome b5 reductase 2 (EC 1.6.2.2)(Mitochondrial 
cytochrome b reductase) [Source:UniProtKB/Swiss-Prot;Acc:Q5BG98] 
[Aspergillus nidulans FGSC A4]
Length=322

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/257 (45%), Positives = 168/257 (65%), Gaps = 13/257 (5%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITR--APIGQQDAEGKPKYVIR  433
             W+  KL D   +SHNT   RF F D  A  GL IAS ++T+   P G        K VIR
Sbjct  73    WVNLKLSDIEILSHNTKRLRFEFPDKEAVSGLHIASALLTKYSPPDGS-------KPVIR  125

Query  434   PYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGM  613
             PYTP SD D  G+ +L++K YP G MS+H  ++    +++ KGP+ K  +  N  KHI +
Sbjct  126   PYTPTSDEDQPGYLELVVKRYPNGPMSEHLHNMNVDQRLDFKGPLPKYPWEANKHKHICL  185

Query  614   IAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFY  790
             +AGG+GITPM Q+   I KNP+D T+++L++ NVS +DILLK++ + L  T+P   + FY
Sbjct  186   VAGGTGITPMYQLAREIFKNPEDKTKVTLVFGNVSEEDILLKREFEDLENTYPQRFRAFY  245

Query  791   TVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGEL  964
              +D+P + W GG G+I+K+++   LP P ++ + IFVCGPPGM   +SG K   ++QGEL
Sbjct  246   VLDNPPEGWTGGKGYITKELLKTVLPEPKEENIKIFVCGPPGMYKAISGPKVSPKDQGEL  305

Query  965   SGVLKEVGYTENMVYKF  1015
             +G+LKE+GY+++ VYKF
Sbjct  306   TGILKELGYSKDQVYKF  322



>ref|XP_007914401.1| putative nadh-cytochrome b5 reductase protein [Togninia minima 
UCRPA7]
 gb|EOO00701.1| putative nadh-cytochrome b5 reductase protein [Togninia minima 
UCRPA7]
Length=348

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/257 (46%), Positives = 169/257 (66%), Gaps = 13/257 (5%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITR--APIGQQDAEGKPKYVIR  433
             +I  KLED   V+HNT  FRF       + GL +AS I+T+  AP    DAE   K  IR
Sbjct  99    FISLKLEDVEIVNHNTKRFRFKLPEDDMVSGLHVASAILTKYKAP----DAE---KPTIR  151

Query  434   PYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGM  613
             PYTP+SD +AKG+ DLLIK Y  G MS H   + PG +++ KGP+ K  +  N   HI +
Sbjct  152   PYTPVSDENAKGYVDLLIKKYEGGPMSTHLHDMAPGQRLDFKGPLPKYPWTANKHNHIAL  211

Query  614   IAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFY  790
             +AGG+GITPM Q+  AI  NPDD T+++L++ N++ +DILLKK+   L  T+P   + FY
Sbjct  212   VAGGTGITPMYQLARAIFSNPDDKTKVTLVFGNITEEDILLKKEFAELENTYPQRFRAFY  271

Query  791   TVDSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEK-DKREQGEL  964
              +D P KEW G  G+I+K+++   LP P S++  +FVCGPPG+M  +SG K   ++QG+L
Sbjct  272   VLDKPPKEWAGNKGYINKELLKTVLPEPKSENVKVFVCGPPGLMKAISGPKVSPQDQGDL  331

Query  965   SGVLKEVGYTENMVYKF  1015
             +G+L ++GY+++ VYKF
Sbjct  332   TGILADLGYSKDQVYKF  348



>ref|XP_003054461.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU48748.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=330

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 166/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++  KL +   V+HNT   RF   +P    GL +AS ++T+   G +D     K  +RPY
Sbjct  81    FLSLKLAEVEIVNHNTKRLRFELPEPDQVSGLPVASALLTKYK-GPEDE----KATLRPY  135

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP SD   KG  DL++K YP G MS H  +L PG ++++KGP+ K Q+  N   HI +IA
Sbjct  136   TPTSDESEKGFLDLVVKKYPNGPMSTHIHNLVPGQRLDIKGPLPKYQWEENKHTHIALIA  195

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  NP+D T+++L++ NV+ +DILLKK  D L  T+P   + FY +
Sbjct  196   GGTGITPMYQLARAIFNNPNDKTKVTLVFGNVTEEDILLKKNFDELENTYPQRFRAFYVL  255

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D+P KEW G  G+ISK+++   LP P ++ + +FVCGPPG+M  +SG K   ++QGEL+G
Sbjct  256   DNPPKEWVGNKGYISKELLKTVLPEPKEENIKLFVCGPPGLMKAISGNKVSPKDQGELTG  315

Query  971   VLKEVGYTENMVYKF  1015
              LKE+GY++  VYKF
Sbjct  316   SLKELGYSQEQVYKF  330



>ref|XP_003170191.1| NADH-cytochrome b5 reductase 2 [Microsporum gypseum CBS 118893]
 gb|EFR04428.1| NADH-cytochrome b5 reductase 2 [Microsporum gypseum CBS 118893]
Length=320

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 155/255 (61%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             WI+ KL     VSHN    RF   D     GL +AS ++T+        EG  K  IRPY
Sbjct  71    WIDLKLSAVEDVSHNVKKLRFDLPDGENVSGLHVASALLTKF-----KGEGDAKATIRPY  125

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD D  GH DLL+K YP G MS H   L  G  +  KGPI K ++  N   H+ M+A
Sbjct  126   TPVSDEDEPGHLDLLVKKYPNGPMSTHIHDLSVGQPLSFKGPIPKYEWEANKHSHVCMVA  185

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+I  I  +P D TQ++L+Y NV  +DILL+++LD L   HP   KV Y +
Sbjct  186   GGTGITPMYQLIRKIFNDPADKTQVTLIYGNVGEEDILLRRELDHLENMHPRQFKVLYLL  245

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D P + W GG G+++K++V    P P  + + +FVCGPPGM   VSG K   ++QGEL+G
Sbjct  246   DKPGEGWTGGKGYVTKELVKMAFPEPKTEGIKLFVCGPPGMYKAVSGTKVSPKDQGELTG  305

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GY +  VYKF
Sbjct  306   ILKELGYNKEQVYKF  320



>gb|EEH38032.2| NADH-cytochrome b5 reductase [Paracoccidioides sp. 'lutzii' Pb01]
Length=323

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 169/255 (66%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W+  +L     VSHN    RF F DP +  G+ ++S ++T+   G +D     K  IRPY
Sbjct  74    WVGLRLVGIENVSHNVKKLRFEFEDPESVSGVHVSSAVLTKYK-GPKDE----KPTIRPY  128

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD D  G+ +LL+K YP G MS H  ++  G +++ KGPI K  + PN   HI MIA
Sbjct  129   TPISDEDQPGYLELLVKQYPNGPMSTHLHNMAVGQQLDFKGPIPKYPWEPNKHDHICMIA  188

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+I  I  NPDD T+++L++ NV+ DDILLKK+L+ L  T+P   + FYT+
Sbjct  189   GGTGITPMYQLIRKIFSNPDDKTKVTLVFGNVTEDDILLKKELEKLENTYPRRFRAFYTL  248

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D P K+W  G+GF++K+++   LP P  + + IFVCGPPGM   +SG K   ++QGEL+G
Sbjct  249   DKPPKDWPQGTGFVTKELLKTVLPEPKTENIKIFVCGPPGMYNAISGPKVSPKDQGELTG  308

Query  971   VLKEVGYTENMVYKF  1015
             +L+++GYT++ VYKF
Sbjct  309   MLRDLGYTKDQVYKF  323



>dbj|BAE94684.1| NADH-cytochrome b5 reductase [Physarum polycephalum]
Length=281

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/263 (45%), Positives = 169/263 (64%), Gaps = 20/263 (8%)
 Frame = +2

Query  230   TSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFD-PSAKLGLDIASCIITRAPIGQQDA  406
             + R+ ALNPN++ +F L ++  ++HNT LFRF+   P   +GL I   +  +A +     
Sbjct  38    SKREPALNPNEYKKFMLREKQIINHNTRLFRFNLHHPEDVVGLPIGQHMSVKATV-----  92

Query  407   EGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYR  586
             +GK  Y  RPYTP+S  D KG+FDL+IKVY +G+MSQ+   L PGD ++V+GP  +  Y+
Sbjct  93    DGKEIY--RPYTPVSSDDEKGYFDLIIKVYEKGQMSQYIDHLNPGDFLQVRGPKGQFDYK  150

Query  587   PNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAAT  766
             PNM K +GMIAGG+GITPMLQV  AI+KNP + T I+L++ANV+ DDILL+ +LD +A  
Sbjct  151   PNMVKEMGMIAGGTGITPMLQVARAIIKNPKEKTIINLIFANVNEDDILLRTELDDMAKK  210

Query  767   HPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDK  946
             + N KV+Y +++P   W GG GF+S DM+ +   PPS D  + +CGPP M        +K
Sbjct  211   YSNFKVYYVLNNPPAGWTGGVGFVSADMIKQHFSPPSSDIKVMMCGPPMM--------NK  262

Query  947   REQGELSGVLKEVGYTENMVYKF  1015
               QG     L+ +GYT    + F
Sbjct  263   AMQGH----LETLGYTPEQWFIF  281



>gb|EMD86858.1| hypothetical protein COCHEDRAFT_1023681 [Bipolaris maydis C5]
 gb|ENI04145.1| hypothetical protein COCC4DRAFT_32816 [Bipolaris maydis ATCC 
48331]
Length=341

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 164/247 (66%), Gaps = 14/247 (6%)
 Frame = +2

Query  296   VSHNTHLFRFSF-DPSAKLGLDIASCIITR--APIGQQDAEGKPKYVIRPYTPISDPDAK  466
             V+HNT    F   +   + GL +AS +IT+   P  Q       K VIRPYTPISD D K
Sbjct  102   VNHNTKKLTFKLPEEDMESGLPVASAVITKYKGPEMQ-------KPVIRPYTPISDVDQK  154

Query  467   GHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPML  646
             G  D +IK YP G MS+H  S++PG ++++KGPI K Q+ PN  +HI +IAGG+GITPM 
Sbjct  155   GTVDFIIKAYPNGPMSEHMHSMEPGQRLDIKGPIPKFQWSPNKFEHIALIAGGTGITPMW  214

Query  647   QVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTVDSPTKEWRG  823
             Q   AI +NP+D T+++L+Y NV+ +DILLK++ + L  T+P   + FY +D+P + W+G
Sbjct  215   QTARAIFRNPEDKTKVTLVYGNVTEEDILLKREFEELENTYPQRFRAFYVLDNPPESWQG  274

Query  824   GSGFISKDMVVKGLPPPSDDTLI--FVCGPPGMMTHVS-GEKDKREQGELSGVLKEVGYT  994
             G G+I+K+++   LP P +   I  FVCGPPGM   +S G+K   +QGEL G LKE+GY+
Sbjct  275   GKGYITKELLKTVLPEPKEGEKIKLFVCGPPGMYKAISGGKKSPSDQGELDGYLKELGYS  334

Query  995   ENMVYKF  1015
             ++ VYKF
Sbjct  335   KDQVYKF  341



>ref|XP_007704621.1| hypothetical protein COCSADRAFT_151944 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD59593.1| hypothetical protein COCSADRAFT_151944 [Bipolaris sorokiniana 
ND90Pr]
Length=341

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 164/247 (66%), Gaps = 14/247 (6%)
 Frame = +2

Query  296   VSHNTHLFRFSF-DPSAKLGLDIASCIITR--APIGQQDAEGKPKYVIRPYTPISDPDAK  466
             V+HNT    F   +   + GL +AS +IT+   P  Q       K VIRPYTPISD D K
Sbjct  102   VNHNTKKLTFKLPEEDMESGLPVASAVITKYKGPEMQ-------KPVIRPYTPISDVDQK  154

Query  467   GHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPML  646
             G  D +IK YP G MS+H  S++PG ++++KGPI K Q+ PN  +HI +IAGG+GITPM 
Sbjct  155   GTVDFIIKAYPNGPMSEHMHSMEPGQRLDIKGPIPKFQWTPNKFEHIALIAGGTGITPMW  214

Query  647   QVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTVDSPTKEWRG  823
             Q   AI +NP+D T+++L+Y NV+ +DILLK++ + L  T+P   + FY +D+P + W+G
Sbjct  215   QTARAIFRNPEDKTKVTLVYGNVTEEDILLKREFEELENTYPQRFRAFYVLDNPPESWQG  274

Query  824   GSGFISKDMVVKGLPPPSDDTLI--FVCGPPGMMTHVS-GEKDKREQGELSGVLKEVGYT  994
             G G+I+K+++   LP P +   I  FVCGPPGM   +S G+K   +QGEL G LKE+GY+
Sbjct  275   GKGYITKELLKTVLPEPKEGEKIKLFVCGPPGMYKAISGGKKSPSDQGELDGYLKELGYS  334

Query  995   ENMVYKF  1015
             ++ VYKF
Sbjct  335   KDQVYKF  341



>ref|XP_007414895.1| hypothetical protein MELLADRAFT_72914 [Melampsora larici-populina 
98AG31]
 gb|EGG01795.1| hypothetical protein MELLADRAFT_72914 [Melampsora larici-populina 
98AG31]
Length=346

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 168/269 (62%), Gaps = 7/269 (3%)
 Frame = +2

Query  230   TSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQD--  403
             ++ + AL+P +W +FKL+   P +HNT  F F    +   GL IAS +IT++     +  
Sbjct  78    SASQAALSPEEWRDFKLQKVIPYNHNTSTFVFELPKNVPSGLTIASALITKSVAKDGELA  137

Query  404   -AEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQ  580
               + K K VIRPYTP + PD      LL+K Y EGKM+ H  +LKPGD + +KGPI K  
Sbjct  138   CTDDKGKLVIRPYTPTTPPDQHDTLHLLVKKYTEGKMTNHIHNLKPGDSLSMKGPIPKWA  197

Query  581   YRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLA  760
             Y+ N  K IGMIAGGSGITP  Q+I+ I  NP+D T++ L ++N   +DILL+++ + L 
Sbjct  198   YKANEFKTIGMIAGGSGITPHWQIIQEIASNPEDQTKVILFFSNQKEEDILLREEFEKLQ  257

Query  761   ATHPN-LKVFYTVDSPTKEWRGG-SGFISKDMVVKGLPPP--SDDTLIFVCGPPGMMTHV  928
                P+   + + +D+P K W     G+++  ++   LP P    DT IFVCGPPG ++ +
Sbjct  258   KEKPHQFSINFVLDNPPKGWSSDLKGYLTASLLKSKLPSPKLGSDTKIFVCGPPGQVSAI  317

Query  929   SGEKDKREQGELSGVLKEVGYTENMVYKF  1015
             SG K  ++QGEL G+LKE+GYT++ VYKF
Sbjct  318   SGPKKGKDQGELGGILKELGYTQDQVYKF  346



>ref|XP_007685644.1| hypothetical protein COCMIDRAFT_3240 [Bipolaris oryzae ATCC 44560]
 gb|EUC47760.1| hypothetical protein COCMIDRAFT_3240 [Bipolaris oryzae ATCC 44560]
Length=341

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 164/247 (66%), Gaps = 14/247 (6%)
 Frame = +2

Query  296   VSHNTHLFRFSF-DPSAKLGLDIASCIITR--APIGQQDAEGKPKYVIRPYTPISDPDAK  466
             V+HNT    F   +   + GL +AS +IT+   P  Q       K VIRPYTPISD D K
Sbjct  102   VNHNTKKLTFKLPEEDMESGLPVASAVITKYKGPEMQ-------KPVIRPYTPISDVDQK  154

Query  467   GHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPML  646
             G  D +IK YP G MS+H  S++PG ++++KGPI K Q+ PN  +HI +IAGG+GITPM 
Sbjct  155   GTVDFIIKAYPNGPMSEHMHSMEPGQRLDIKGPIPKFQWSPNKFEHIALIAGGTGITPMW  214

Query  647   QVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTVDSPTKEWRG  823
             Q   AI +NP+D T+++L+Y NV+ +DILLK++ + L  T+P   + FY +D+P + W+G
Sbjct  215   QTARAIFRNPEDKTKVTLVYGNVTEEDILLKREFEELENTYPQRFRAFYVLDNPPESWQG  274

Query  824   GSGFISKDMVVKGLPPPSDDTLI--FVCGPPGMMTHVS-GEKDKREQGELSGVLKEVGYT  994
             G G+I+K+++   LP P +   I  FVCGPPGM   +S G+K   +QGEL G LKE+GY+
Sbjct  275   GKGYITKELLKTVLPEPKEGEKIKLFVCGPPGMYKAISGGKKSPSDQGELDGYLKELGYS  334

Query  995   ENMVYKF  1015
             ++ VYKF
Sbjct  335   KDQVYKF  341



>ref|XP_007714565.1| hypothetical protein COCCADRAFT_102110 [Bipolaris zeicola 26-R-13]
 gb|EUC31132.1| hypothetical protein COCCADRAFT_102110 [Bipolaris zeicola 26-R-13]
 gb|EUN28777.1| hypothetical protein COCVIDRAFT_94876 [Bipolaris victoriae FI3]
Length=341

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 164/247 (66%), Gaps = 14/247 (6%)
 Frame = +2

Query  296   VSHNTHLFRFSF-DPSAKLGLDIASCIITR--APIGQQDAEGKPKYVIRPYTPISDPDAK  466
             V+HNT    F   +   + GL +AS +IT+   P  Q       K VIRPYTPISD D K
Sbjct  102   VNHNTKKLTFKLPEEDMESGLPVASAVITKYKGPEMQ-------KPVIRPYTPISDVDQK  154

Query  467   GHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIAGGSGITPML  646
             G  D +IK YP G MS+H  S++PG ++++KGPI K Q+ PN  +HI +IAGG+GITPM 
Sbjct  155   GTVDFIIKAYPNGPMSEHMHSMEPGQRLDIKGPIPKFQWSPNKFEHIALIAGGTGITPMW  214

Query  647   QVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTVDSPTKEWRG  823
             Q   AI +NP+D T+++L+Y NV+ +DILLK++ + L  T+P   + FY +D+P + W+G
Sbjct  215   QTARAIFRNPEDKTKVTLVYGNVTEEDILLKREFEELENTYPQRFRAFYVLDNPPESWQG  274

Query  824   GSGFISKDMVVKGLPPPSDDTLI--FVCGPPGMMTHVS-GEKDKREQGELSGVLKEVGYT  994
             G G+I+K+++   LP P +   I  FVCGPPGM   +S G+K   +QGEL G LKE+GY+
Sbjct  275   GKGYITKELLKTVLPEPKEGEKIKLFVCGPPGMYKAISGGKKSPSDQGELDGYLKELGYS  334

Query  995   ENMVYKF  1015
             ++ VYKF
Sbjct  335   KDQVYKF  341



>ref|XP_001593010.1| hypothetical protein SS1G_05932 [Sclerotinia sclerotiorum 1980]
 sp|A7EKT5.1|MCR1_SCLS1 RecName: Full=NADH-cytochrome b5 reductase 2; AltName: Full=Mitochondrial 
cytochrome b reductase [Sclerotinia sclerotiorum 
1980 UF-70]
 gb|EDO03451.1| hypothetical protein SS1G_05932 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=345

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/257 (46%), Positives = 167/257 (65%), Gaps = 13/257 (5%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITR--APIGQQDAEGKPKYVIR  433
             +I  KL+    V+HNT  FRF    S ++ GL + S +IT+   P  Q+ A       IR
Sbjct  96    FISLKLDSVELVNHNTKKFRFELPESDQVSGLHVTSALITKYKGPEMQKPA-------IR  148

Query  434   PYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGM  613
             PYTP SD   KG  DLL+K YP G MS+H   + PG +++ KGPI K  +  N   HI +
Sbjct  149   PYTPTSDEGEKGFIDLLVKKYPNGVMSEHMHEMVPGQRLDFKGPIPKYAWSANKHDHIAL  208

Query  614   IAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFY  790
             IAGG+GITPM Q+  AI  NP D T+++L++ANV+ +DILLK++ + L  T+P   + FY
Sbjct  209   IAGGTGITPMYQLARAIFNNPADKTKVTLVFANVTEEDILLKREFEDLENTYPQRFRAFY  268

Query  791   TVDSPTKEWRGGSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEK-DKREQGEL  964
              +D+P K W+GG GFI+K+++   LP P S++  +FVCGPPGM   +SG K    +QGEL
Sbjct  269   VLDNPPKSWKGGKGFINKELLKTVLPEPKSENIKLFVCGPPGMYKAISGGKVSPSDQGEL  328

Query  965   SGVLKEVGYTENMVYKF  1015
             +G+LKE+GY+++ VYKF
Sbjct  329   AGILKELGYSKDQVYKF  345



>ref|XP_009224456.1| NADH-cytochrome b5 reductase 2 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT74512.1| NADH-cytochrome b5 reductase 2 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=361

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 169/256 (66%), Gaps = 11/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITR-APIGQQDAEGKPKYVIRP  436
             ++   +ED   V+HNT   RF    +  + G+ +AS ++T+  P G +      K VIRP
Sbjct  112   FVSLLVEDVEIVNHNTKRVRFKLPENDMVSGMTVASALLTKFKPAGAE------KPVIRP  165

Query  437   YTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMI  616
             YTPISD D  G+ DLL+K Y  G MS H   L PG ++++KGP+ K  +  N   HI  I
Sbjct  166   YTPISDEDTTGYMDLLVKKYEGGPMSTHIHELVPGQRLDIKGPLPKYGWTANKHPHIACI  225

Query  617   AGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYT  793
             AGG+GITPM Q++ AI KNPDD T+++L+  N++ +DILLK++L  L  T+P   + FY 
Sbjct  226   AGGTGITPMYQLMRAIFKNPDDKTKVTLVVGNIAEEDILLKQQLAELENTYPQRFRAFYV  285

Query  794   VDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELS  967
             +D+P K W GG GF++++++   LP P +D + +FVCGPPGMM  VSG K   ++QGE+S
Sbjct  286   LDNPPKGWAGGKGFVTQELLKTVLPEPKEDNIKVFVCGPPGMMKAVSGAKVSPKDQGEVS  345

Query  968   GVLKEVGYTENMVYKF  1015
             G+LKE+GY+++ VYKF
Sbjct  346   GILKELGYSKDQVYKF  361



>pdb|2EIX|A Chain A, The Structure Of Physarum Polycephalum Cytochrome B5 
Reductase
 pdb|2EIX|B Chain B, The Structure Of Physarum Polycephalum Cytochrome B5 
Reductase
Length=243

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 166/261 (64%), Gaps = 20/261 (8%)
 Frame = +2

Query  236   RKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFD-PSAKLGLDIASCIITRAPIGQQDAEG  412
             R+ ALNPN++ +F L ++  ++HNT LFRF+   P   +GL I   +  +A +     +G
Sbjct  2     REPALNPNEYKKFMLREKQIINHNTRLFRFNLHHPEDVVGLPIGQHMSVKATV-----DG  56

Query  413   KPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPN  592
             K  Y  RPYTP+S  D KG+FDL+IKVY +G+MSQ+   L PGD ++V+GP  +  Y+PN
Sbjct  57    KEIY--RPYTPVSSDDEKGYFDLIIKVYEKGQMSQYIDHLNPGDFLQVRGPKGQFDYKPN  114

Query  593   MKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP  772
             M K +GMIAGG+GITPMLQV  AI+KNP + T I+L++ANV+ DDILL+ +LD +A  + 
Sbjct  115   MVKEMGMIAGGTGITPMLQVARAIIKNPKEKTIINLIFANVNEDDILLRTELDDMAKKYS  174

Query  773   NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDKRE  952
             N KV+Y +++P   W GG GF+S DM+ +   PPS D  + +CGPP M            
Sbjct  175   NFKVYYVLNNPPAGWTGGVGFVSADMIKQHFSPPSSDIKVMMCGPPMM------------  222

Query  953   QGELSGVLKEVGYTENMVYKF  1015
                + G L+ +GYT    + F
Sbjct  223   NKAMQGHLETLGYTPEQWFIF  243



>ref|XP_003015848.1| hypothetical protein ARB_06160 [Arthroderma benhamiae CBS 112371]
 gb|EFE35203.1| hypothetical protein ARB_06160 [Arthroderma benhamiae CBS 112371]
Length=402

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 159/271 (59%), Gaps = 20/271 (7%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITR----------------API  391
             W++ KL     VSHN    RF   D  +  GL IA   I R                A +
Sbjct  132   WVDLKLSAVEEVSHNVKKLRFELPDSESVSGLHIACTYIRRETKPRDMYSHANGLTAALL  191

Query  392   GQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQ  571
              +   EG  K  IRPYTP+SD D  GH DLL+K YP G MS H   L  G+ +  KGPI 
Sbjct  192   TKFKGEGDAKATIRPYTPVSDEDEPGHLDLLVKKYPGGPMSTHIHELNVGEPLSFKGPIP  251

Query  572   KLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkld  751
             K ++  N   H+ M+AGG+GITPM Q+I  I  NP D TQ++L+Y NV  +DILL+++L+
Sbjct  252   KYEWEANKHSHVCMVAGGTGITPMYQLIRKIFSNPADKTQVTLIYGNVGEEDILLRRELE  311

Query  752   VLAATHP-NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTH  925
              L   HP  LKV Y +D P + W GG G+++K++V    P P  + + +FVCGPPG+   
Sbjct  312   HLENMHPRQLKVLYLLDKPGEGWTGGKGYVTKELVKMAFPEPKTEGIKLFVCGPPGLYKA  371

Query  926   VSGEK-DKREQGELSGVLKEVGYTENMVYKF  1015
             VSG K   ++QGEL+G+LKE+GYTE  VYKF
Sbjct  372   VSGNKVSPKDQGELTGILKELGYTEEQVYKF  402



>gb|KEQ94190.1| hypothetical protein AUEXF2481DRAFT_89970 [Aureobasidium subglaciale 
EXF-2481]
Length=346

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/270 (42%), Positives = 175/270 (65%), Gaps = 16/270 (6%)
 Frame = +2

Query  239   KTALNPNQ--------WIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIG  394
             K A NP++        ++   L++   ++HNT   RF        GL IAS +IT+    
Sbjct  82    KQAANPSKCFTGGDQGFVSLVLQESEVINHNTKKLRFHLPEDNVSGLTIASALITKYKGP  141

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
             + +     K VIRPYTP+SD D+ G+ D ++K YP G MS+H  +++PG ++++KGPI K
Sbjct  142   EME-----KPVIRPYTPVSDEDSVGYLDFIVKKYPGGPMSEHLHNMQPGQRLDMKGPIPK  196

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
               +  N   HI +IAGG+GITPM Q+  AI KNP+D T+++L++ NVS +D+LLK++ + 
Sbjct  197   YPWEENKHDHIALIAGGTGITPMYQLARAIFKNPNDKTKVTLVFGNVSEEDVLLKREWED  256

Query  755   LAATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHV  928
             L   +PN ++ FYT+D P ++W G  G I+KD++   LP PS + + +FVCGPPGM   +
Sbjct  257   LENQYPNRMRAFYTLDKPPQDWPGPKGMITKDLLKTVLPDPSKENIKVFVCGPPGMYKAI  316

Query  929   SG-EKDKREQGELSGVLKEVGYTENMVYKF  1015
             +G +K  ++QGEL+G+L E+GY ++ VYKF
Sbjct  317   AGPKKSPKDQGELTGMLAELGYNKDQVYKF  346



>ref|XP_001934969.1| NADH-cytochrome b5 reductase 3 [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU47543.1| NADH-cytochrome b5 reductase 3 [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=340

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/258 (45%), Positives = 167/258 (65%), Gaps = 14/258 (5%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITR--APIGQQDAEGKPKYVIR  433
             ++   LE    V+HNT   RF   +   + GL + S +IT+   P  Q       K VIR
Sbjct  90    FVSLMLEKSEVVNHNTKKLRFKLPEEDMESGLPVTSAVITKYKGPEMQ-------KPVIR  142

Query  434   PYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGM  613
             PYTPISD D KG  D +IK YP G MS+H  +++PG ++++KGPI K Q++ N+ +HI +
Sbjct  143   PYTPISDVDQKGSVDFIIKAYPGGPMSEHMHAMEPGQRLDIKGPIPKFQWKENLHEHIAL  202

Query  614   IAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFY  790
             IAGG+GITPM Q    I +NP D T+++L+Y NVS +DILLK++ + L  T+P   + FY
Sbjct  203   IAGGTGITPMWQTARHIFRNPQDKTKVTLIYGNVSEEDILLKREWEELENTYPQRFRAFY  262

Query  791   TVDSPTKEWRGGSGFISKDMVVKGLPPP--SDDTLIFVCGPPGMMTHVS-GEKDKREQGE  961
              +D+P + W+GG G ++K+++   LP P   +   IFVCGPPGM   +S G+K   +QGE
Sbjct  263   VLDNPPESWQGGRGHVTKELLKTVLPEPKEGEKIKIFVCGPPGMYKAISGGKKSPSDQGE  322

Query  962   LSGVLKEVGYTENMVYKF  1015
             L G+LKE+GY+++ VYKF
Sbjct  323   LDGMLKELGYSKDQVYKF  340



>ref|XP_007731232.1| cytochrome-b5 reductase [Capronia epimyces CBS 606.96]
 gb|EXJ89835.1| cytochrome-b5 reductase [Capronia epimyces CBS 606.96]
Length=337

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 172/268 (64%), Gaps = 10/268 (4%)
 Frame = +2

Query  227   DTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQD  403
             +TS+        +++ KL +    +HNT  F+F      ++ GL +AS +IT+      D
Sbjct  75    ETSKAFTGGDQGFVDLKLAEVILYNHNTKRFKFELPEQDQVSGLSVASAVITKYQPPNAD  134

Query  404   AEGKPKYVIRPYTPISDP-DAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQ  580
                  K VIRPYTPI+D  D KG+ +LL+KVYP G +S H  S+ PG ++  KGPI K  
Sbjct  135   -----KPVIRPYTPINDEVDVKGYLELLVKVYPNGALSSHLDSMVPGQRLSFKGPIPKYP  189

Query  581   YRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLA  760
             + PN  +HI +IAGG+GITPM Q+I AI KNP+D T++SL+Y N++ +DILLKK+L+ + 
Sbjct  190   WSPNKHEHITLIAGGTGITPMYQLIRAIFKNPEDKTKVSLVYGNITEEDILLKKELEDIE  249

Query  761   ATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLP-PPSDDTLIFVCGPPGMMTHVSG  934
                P   + FY +D P   W  G GFISK+++   +P P S +  IFVCGPPG+   +SG
Sbjct  250   KEFPQRFRAFYVLDQPPSSWPYGKGFISKELLKTIVPDPKSSNIKIFVCGPPGLYKAISG  309

Query  935   EKDK-REQGELSGVLKEVGYTENMVYKF  1015
              K   ++QGELSG+LKE+GYT++ VYKF
Sbjct  310   NKTSPQDQGELSGILKELGYTKDQVYKF  337



>gb|AFR98892.1| cytochrome b5 reductase [Cryptococcus neoformans var. grubii 
H99]
Length=352

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 166/264 (63%), Gaps = 6/264 (2%)
 Frame = +2

Query  242   TALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAK---LGLDIASCIITRAPIG-QQDAE  409
             +A   + WI F LE     +HN +++ FSF    K    G ++AS ++ R+P G  Q  +
Sbjct  89    SAFVKDTWIPFTLEKIEKYNHNANIYHFSFGEEGKDKISGGEVASVVLLRSPEGPDQVKD  148

Query  410   GKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRP  589
              K K +IRPYTPIS PD KG  + +IK Y  GK + +  SL PG +V  KGP+QK +Y+P
Sbjct  149   EKDKPIIRPYTPISPPDQKGSIEFMIKSYSGGKFTPYLTSLSPGQQVLFKGPLQKFKYQP  208

Query  590   NMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATH  769
             N  +    IAGGSGITPM Q+I   L  P+D T+ +L+Y+NVS  DILL+K+ D LA  +
Sbjct  209   NSFEKGLCIAGGSGITPMWQLINHSLSIPEDKTKWTLIYSNVSEADILLRKEFDALAQKY  268

Query  770   PN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPP-PSDDTLIFVCGPPGMMTHVSGEKD  943
             P  L + Y VD   + W+G +G+I+ D++ K  P    ++   FVCGPPG M  +SGEKD
Sbjct  269   PGRLDIKYVVDKGPRGWKGETGYITADLIKKTFPKNEGENVRAFVCGPPGQMKAISGEKD  328

Query  944   KREQGELSGVLKEVGYTENMVYKF  1015
               +QGELSG LK++GYT N V+K+
Sbjct  329   GMKQGELSGALKDLGYTSNEVFKY  352



>gb|KFY31715.1| hypothetical protein V493_00869 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=336

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 171/256 (67%), Gaps = 10/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W+  +L     V+HNT  F F   D     GL +AS I+T+    + +     K VIRPY
Sbjct  86    WVSLRLAKVENVNHNTKKFFFDLPDEDYVSGLKVASAILTKYKGPEME-----KPVIRPY  140

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD D +GHF LL+K YP+G MS H  ++KP  +++VKGPI K  +  N   HI ++A
Sbjct  141   TPVSDEDERGHFTLLVKKYPDGPMSTHLHNMKPDQRLDVKGPIPKYPWTTNKHDHIALVA  200

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  NP+D T+++L+Y NVS DDILLK++L+ L  T+P  L+VFYT+
Sbjct  201   GGTGITPMYQLTRAIFNNPEDKTKVTLVYGNVSEDDILLKRELEDLENTYPQRLRVFYTL  260

Query  797   DSPTKEWRG-GSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVS-GEKDKREQGELS  967
             D+P K+      GFI+K+++   LP P S++  +FVCGPPGM   +S G+K  ++QGEL+
Sbjct  261   DNPPKDSTNFQKGFITKELLKTVLPEPKSENIKVFVCGPPGMYKAISGGKKSPKDQGELT  320

Query  968   GVLKEVGYTENMVYKF  1015
             G+L E+GY+++ VYKF
Sbjct  321   GILSELGYSKDQVYKF  336



>ref|XP_002616102.1| hypothetical protein CLUG_03343 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ39215.1| hypothetical protein CLUG_03343 [Clavispora lusitaniae ATCC 42720]
Length=293

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 168/264 (64%), Gaps = 13/264 (5%)
 Frame = +2

Query  239   KTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITR--APIGQQDAE  409
             KT    ++WI+ KL+D   +S NT  + F    P    GL  AS ++ +   P G     
Sbjct  38    KTFTGSDEWIDLKLKDSWHISPNTKHYVFELKSPEDVSGLVTASLLLAKYVTPKGNN---  94

Query  410   GKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRP  589
                  VIRPYTP+SD D KG  + +IK YP+GK S+H   LKP D V  KGPI K ++ P
Sbjct  95    -----VIRPYTPVSDVDQKGTLEFVIKTYPDGKFSKHMHDLKPNDTVSFKGPIVKWKWEP  149

Query  590   NMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATH  769
             N  KHI +I GGSGITP+ Q+I  I KNP+D T++SL Y N++ DDILL+K+LD +AA H
Sbjct  150   NQFKHITLIGGGSGITPLYQLIHEITKNPNDKTKVSLFYGNLTEDDILLRKELDDVAAKH  209

Query  770   PN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVSGEKDK  946
              + + + Y +D   + W+G +G+ISK+ + + LP PS D+ I+VCGPPG+   +SG K  
Sbjct  210   KDQVSIHYFLDKAPEGWKGHTGYISKEFLKEHLPGPSKDSKIYVCGPPGLYNAISGNKKS  269

Query  947   -REQGELSGVLKEVGYTENMVYKF  1015
               +QGE++G L E+GYT++ V+KF
Sbjct  270   PTDQGEVTGALAELGYTKDHVFKF  293



>ref|XP_750202.1| NADH-cytochrome b5 reductase [Aspergillus fumigatus Af293]
 sp|Q4WJW8.1|MCR1_ASPFU RecName: Full=NADH-cytochrome b5 reductase 2; AltName: Full=Mitochondrial 
cytochrome b reductase [Aspergillus fumigatus Af293]
 gb|EAL88164.1| NADH-cytochrome b5 reductase, putative [Aspergillus fumigatus 
Af293]
 gb|EDP55792.1| NADH-cytochrome b5 reductase, putative [Aspergillus fumigatus 
A1163]
 gb|KEY77828.1| NADH cytochrome b5 reductase [Aspergillus fumigatus var. RP-2014]
Length=323

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/255 (45%), Positives = 167/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W++ KL     +S NT   RF F D  A  GL +AS ++T+        +G  K VIRPY
Sbjct  74    WVDLKLAQIENLSPNTKRLRFEFPDKEAVSGLHVASALLTKF-----KPQGAEKPVIRPY  128

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD +  G+ DL++KVYP G MS+H  S+    ++E KGPI K  +  N  KHI +IA
Sbjct  129   TPVSDEEQPGYLDLVVKVYPNGPMSEHLHSMNVDQRLEFKGPIPKYPWEANKHKHICLIA  188

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+   I K+P+D T+++L++ NV  +DILLKK+L+ L  T+P   + FY +
Sbjct  189   GGTGITPMYQLARKIFKDPEDQTKVTLVFGNVREEDILLKKELEELENTYPRRFRAFYLL  248

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D P KEW GG G+I+K+++   LP P ++ + IFVCGPPGM   +SG K    +QGEL+G
Sbjct  249   DHPPKEWTGGKGYITKELLKTVLPEPKEENIKIFVCGPPGMYKSISGPKVSPTDQGELTG  308

Query  971   VLKEVGYTENMVYKF  1015
             +L E+GY+++ V+KF
Sbjct  309   ILAELGYSKDQVFKF  323



>gb|EGC46316.1| NADH-cytochrome b5 reductase [Histoplasma capsulatum H88]
Length=321

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/255 (45%), Positives = 165/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W+  KL     V+HN    RF F DP +  GL IAS ++T+    +   E KP  +IRPY
Sbjct  72    WVGLKLAHIDNVNHNVKKLRFEFEDPESVSGLHIASALLTKY---KGPTEEKP--IIRPY  126

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD    G+ DLL+K YP G MS H  ++  G +++ KGP+ K  + P+   HI +IA
Sbjct  127   TPVSDEGQPGYLDLLVKRYPNGPMSNHLHNMAVGQRLDFKGPLPKYPWEPSKHDHICLIA  186

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q++  I  NP+D T+++L+  NV+ +DILL+K+ + L  T+P   + FYT+
Sbjct  187   GGTGITPMYQLVRKIFSNPEDKTKVTLVCGNVTEEDILLRKEFEHLENTYPRRFRAFYTL  246

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D P K W  G+GFI+K+++   LP P  + + IFVCGPP M   +SG+K   ++QGELSG
Sbjct  247   DKPPKNWAQGTGFITKELLKTVLPEPKTENIKIFVCGPPAMYKAISGQKVSPKDQGELSG  306

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GY++  VYKF
Sbjct  307   ILKELGYSKEQVYKF  321



>ref|XP_007762853.1| cytochrome-b5 reductase [Coniophora puteana RWD-64-598 SS2]
 gb|EIW87194.1| cytochrome-b5 reductase [Coniophora puteana RWD-64-598 SS2]
Length=328

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 116/265 (44%), Positives = 165/265 (62%), Gaps = 7/265 (3%)
 Frame = +2

Query  236   RKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRA--PIGQQDAE  409
              K+ L+P  W+ FKL+   P +HNT  F      +    + I SC+  RA  P    D +
Sbjct  66    EKSPLDPKNWVNFKLKKVEPYNHNTAKFVLELPDNQASLMPITSCVYLRAANPDDLVDDK  125

Query  410   GKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRP  589
             GKP  VIRPYTPIS  DAKG F  LIK Y  G  S++  +LK GD + VKGPI KL ++ 
Sbjct  126   GKP--VIRPYTPISTSDAKGEFIFLIKKYDTGVASKYIHTLKEGDSLAVKGPIPKLAWKT  183

Query  590   NMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATH  769
             N  + +GM+AGGSGITPM Q++   L++ ++ T+  L+YANVS  DILLK++   L   +
Sbjct  184   NEFEQVGMVAGGSGITPMYQLLVHALRDKENKTKFKLIYANVSEGDILLKQEFADLKKKY  243

Query  770   P-NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPS--DDTLIFVCGPPGMMTHVSGEK  940
             P N  V YT+D P+K W G +G+++ +++ K L  P   +   +FVCGPP  M  ++G+K
Sbjct  244   PDNFDVIYTLDKPSKGWTGPTGYVNAELIKKHLASPDLKEKVKVFVCGPPPQMEALAGDK  303

Query  941   DKREQGELSGVLKEVGYTENMVYKF  1015
               R+QGE  G+LK++GYT+  V+KF
Sbjct  304   AGRDQGEFKGILKQMGYTQEQVFKF  328



>gb|KGO43235.1| Riboflavin synthase-like beta-barrel [Penicillium expansum]
 gb|KGO52291.1| Riboflavin synthase-like beta-barrel [Penicillium expansum]
 gb|KGO56513.1| Riboflavin synthase-like beta-barrel [Penicillium expansum]
Length=319

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 167/268 (62%), Gaps = 9/268 (3%)
 Frame = +2

Query  224   EDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFD-PSAKLGLDIASCIITRAPIGQQ  400
             E   R    N + W++ KL     +SHNT   RF +D   A  GL + S ++TR      
Sbjct  57    EPKERPKVFNGDGWVDLKLSSIEDLSHNTKRLRFEYDDKEAVSGLPVTSALLTRF-----  111

Query  401   DAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQ  580
               EG  K ++RPYTP SD D  G+ +L++K YP G+MS+H  S+K  +++  KGP+ K  
Sbjct  112   KPEGAEKNILRPYTPTSDEDIPGYLELVVKSYPGGRMSEHMHSMKIDERLSFKGPLPKYP  171

Query  581   YRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLA  760
             +  N   H+ +IAGG+GITPM Q+   I KNP+D T+++L++ NV+  DI+LKK+L  L 
Sbjct  172   WEANKHDHVCLIAGGTGITPMYQLAREIFKNPEDKTKVTLVFGNVTEQDIILKKELSDLE  231

Query  761   ATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSG  934
              T+P   + FY + +P  EW GG G+ISK+++   LP P ++ + +FVCGPP M   +SG
Sbjct  232   NTYPQRFRAFYVLSNPPAEWAGGKGYISKELLKTVLPEPKEENIKLFVCGPPPMYNAISG  291

Query  935   EK-DKREQGELSGVLKEVGYTENMVYKF  1015
              K   ++QGEL+G+LK++GY +  V+KF
Sbjct  292   NKISPKDQGELTGILKDLGYNKEQVFKF  319



>gb|KFY52174.1| hypothetical protein V496_08634 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY78296.1| hypothetical protein V498_09139 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=336

 Score =   209 bits (533),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 171/256 (67%), Gaps = 10/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W+  +L     V+HNT  F F       + GL +AS I+T+    + +     K VIRPY
Sbjct  86    WVSLRLSKVENVNHNTKKFFFDLPEDDNVSGLKVASAILTKYKGPEME-----KPVIRPY  140

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD D +GHF LL+K YP+G MS H  ++KP  +++VKGPI K  +  N   HI ++A
Sbjct  141   TPVSDEDERGHFTLLVKKYPDGPMSTHLHNMKPDQRLDVKGPIPKYPWAANKHDHIALVA  200

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  NP+D T+++L+Y NVS DDILLK++L+ L  T+P  L+VFYT+
Sbjct  201   GGTGITPMYQLTRAIFNNPEDKTKVTLVYGNVSEDDILLKRELEDLENTYPQRLRVFYTL  260

Query  797   DSPTKEWRG-GSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVS-GEKDKREQGELS  967
             D+P K+      GFI+K+++   LP P S++  IFVCGPPGM   +S G+K  ++QGEL+
Sbjct  261   DNPPKDSPNFQKGFITKELLKTVLPEPKSENIKIFVCGPPGMYKAISGGKKSPKDQGELT  320

Query  968   GVLKEVGYTENMVYKF  1015
             G+L E+GY+++ VYKF
Sbjct  321   GILSELGYSKDQVYKF  336



>emb|CCF50539.1| related to MCR1-cytochrome-b5 reductase [Ustilago hordei]
Length=350

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 167/265 (63%), Gaps = 4/265 (2%)
 Frame = +2

Query  230   TSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAPIGQQDAE  409
              ++ TALN +Q++EF L++  P +H++  F F    + K G+  AS ++ +A +G    +
Sbjct  87    AAQSTALNKDQFVEFTLKEIKPYNHDSATFVFELPDNKKPGMSTASAVVVKA-VGDGLKD  145

Query  410   GKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRP  589
              K K VIRPYTPI+ PD  GH D LIK YP G M+ H  S+KPGDK+ +KGPI K  Y+ 
Sbjct  146   DKGKDVIRPYTPITSPDTPGHMDFLIKKYPGGLMATHMHSMKPGDKLGIKGPIAKFPYKA  205

Query  590   NMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATH  769
             N  + IGMIAGGSGITPM QV++ I K+P D T+++L+Y N +  DILL++K D LA   
Sbjct  206   NEFESIGMIAGGSGITPMWQVMQDIAKDPSDKTKVTLIYTNRTEQDILLREKFDELAKKD  265

Query  770   PNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPS--DDTLIFVCGPPGMMTHVSGEKD  943
                 + Y +D   K + G  G+++ +++ K LP P     T +FVCGPP  +  +SG K 
Sbjct  266   DRFTIVYGLDKLPKGFSGFEGYVTPELITKYLPKPELGSKTKLFVCGPPPQVEAISGRKG  325

Query  944   -KREQGELSGVLKEVGYTENMVYKF  1015
              K  QGEL G+L ++GY  + VYKF
Sbjct  326   PKGSQGELKGLLAKMGYEADQVYKF  350



>gb|KHN96823.1| NADH-cytochrome b5 reductase [Metarhizium album ARSEF 1941]
Length=327

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 165/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++  KL D   V+HNT   RF    S  + GL IAS I+T+      +AE   K  +RPY
Sbjct  78    FVSLKLADVEIVNHNTKRLRFELPESDMVSGLQIASAILTK--YKSPNAE---KATLRPY  132

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD   KG  DLL+K YP+G MS H   L PG +++ KGP+ K  +  N   HIG+IA
Sbjct  133   TPISDEGDKGFLDLLVKKYPDGPMSTHMHDLVPGQRLDFKGPLPKYPWTENKHDHIGLIA  192

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+  AI  N +D T+++L++ NV+ +DILL+ KL  L  T+P   + FY +
Sbjct  193   GGTGITPMYQLCRAIFNNSNDKTKVTLVFGNVTEEDILLRSKLAELENTYPRRFRAFYVL  252

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D P K+W+G  G+ISK+++   LP P ++ + +FVCGPPG+M  +SG K   ++QGELSG
Sbjct  253   DKPPKDWQGNKGYISKELLKTVLPEPKEENIKVFVCGPPGLMKAISGPKVSPQDQGELSG  312

Query  971   VLKEVGYTENMVYKF  1015
              LK++GY++  VYKF
Sbjct  313   SLKDLGYSKEQVYKF  327



>ref|XP_001799967.1| hypothetical protein SNOG_09680 [Phaeosphaeria nodorum SN15]
 sp|Q0UEY4.2|NCB5R_PHANO RecName: Full=NADH-cytochrome b5 reductase 1; AltName: Full=Microsomal 
cytochrome b reductase [Phaeosphaeria nodorum SN15]
 gb|EAT82945.2| hypothetical protein SNOG_09680 [Phaeosphaeria nodorum SN15]
Length=282

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 158/234 (68%), Gaps = 8/234 (3%)
 Frame = +2

Query  230  TSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDA  406
            +  K  L PN++ EF+LE++  +SHNT ++RF     +  LGL I   I   A I     
Sbjct  27   SGSKKVLKPNEFQEFELEEKTVLSHNTAIYRFKLPRKTDILGLPIGQHISLGATI-----  81

Query  407  EGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYR  586
            EG+PK V+R YTPIS  + KGHFDLLIK YP G +S++ A+LK G+K+ VKGP   + Y 
Sbjct  82   EGQPKEVVRSYTPISSDEDKGHFDLLIKSYPTGNISKYVANLKVGEKMRVKGPKGAMVYT  141

Query  587  PNMKKHIGMIAGGSGITPMLQVIEAIL--KNPDDNTQISLLYANVSPddillkkkldVLA  760
            PNM +H GMI+GG+GITPMLQV++AI+  +   D T++ L++ANV+P+DILLK+ LD LA
Sbjct  142  PNMVRHFGMISGGTGITPMLQVVKAIIRGRGQGDTTEVDLIFANVNPEDILLKEDLDALA  201

Query  761  ATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMT  922
            A  P  +V Y +++P + W GG GF++ DM+ + LP P+ D  I VCGPP M+ 
Sbjct  202  AKDPKFRVHYVLNNPPEGWTGGVGFVTADMIKEKLPAPASDVKILVCGPPPMVA  255



>gb|EJU02531.1| ferredoxin reductase-like C-terminal NADP-linked domain-containing 
protein [Dacryopinax sp. DJM-731 SS1]
Length=333

 Score =   209 bits (533),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 172/263 (65%), Gaps = 8/263 (3%)
 Frame = +2

Query  245   ALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRAP---IGQQDAEGK  415
             AL+ +++  F+L+ + P ++NT  + F+        L +A+C++ +A     G +D +G+
Sbjct  73    ALDRDEFRTFELKRKEPYNYNTSRYVFALPEKTATLLPVAACVLLKAADDETGPKDDKGR  132

Query  416   PKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNM  595
             P  V+RPYTPISD    G  D LIK Y  GK + + +SL+PGDK+ +KGP+ K  Y PN 
Sbjct  133   P--VVRPYTPISDSRKVGEVDFLIKKYETGKFTPYLSSLEPGDKISIKGPLPKFAYEPNK  190

Query  596   KKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN  775
                 G+IAGGSGITPM Q+++  L  P+D T  +L++ANVS  DILLK++ D LA  HP+
Sbjct  191   FSQCGLIAGGSGITPMYQLLKHSLSIPEDKTHWTLIFANVSAKDILLKEEFDALAQAHPD  250

Query  776   -LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPS--DDTLIFVCGPPGMMTHVSGEKDK  946
              L V Y +D P K + G +G+++K+++ + LP P   + T +FVCGPPG +  V+G+K  
Sbjct  251   RLNVVYVLDKPEKGFTGPTGYVTKELIKQHLPGPELGEKTKLFVCGPPGQVAAVAGKKAG  310

Query  947   REQGELSGVLKEVGYTENMVYKF  1015
              +QGEL G LK++GYTE+ V+KF
Sbjct  311   MKQGELGGALKDLGYTEDQVFKF  333



>emb|CCG84183.1| protein of unknown function [Taphrina deformans PYCC 5710]
Length=318

 Score =   209 bits (532),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 116/264 (44%), Positives = 165/264 (63%), Gaps = 11/264 (4%)
 Frame = +2

Query  239   KTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAK--LGLDIASCIITRAPIGQQDAEG  412
             KT  +PN+W+   L     V+HNT   +F+  PS    +GL+IAS ++T+    +   + 
Sbjct  61    KTLTDPNEWVSLALMSTEQVNHNTKRLKFAL-PSEDHVIGLNIASSLLTKY---KGPTDE  116

Query  413   KPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPN  592
             KP   IRPYTP+S  DAKG+ + L+K YP G MS H   ++   +++ KGPI K +Y PN
Sbjct  117   KP--TIRPYTPVSQEDAKGYVEFLVKKYPNGPMSTHLCEMEKNQRLDFKGPILKYKYEPN  174

Query  593   MKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP  772
             M   IG++A G+GITPM Q+I A++KNP+D T+I L+ AN+S +DILLK++ + L   HP
Sbjct  175   MHSTIGLVAAGTGITPMYQLIRAVMKNPEDKTKIVLVTANISEEDILLKREFEKLEQEHP  234

Query  773   -NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSG-EKD  943
                + FY +++   +W G  G ISKD++   LP P D     FVCGPPG    VSG +K 
Sbjct  235   LQFRAFYVLENAPSDWPGQGGRISKDLLKTVLPGPEDKNFKAFVCGPPGFYAAVSGTKKS  294

Query  944   KREQGELSGVLKEVGYTENMVYKF  1015
              ++QGEL G L E+GY +  VYKF
Sbjct  295   PKDQGELGGFLSELGYAKEQVYKF  318



>ref|XP_002561243.1| Pc16g09250 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP93595.1| Pc16g09250 [Penicillium rubens Wisconsin 54-1255]
Length=319

 Score =   209 bits (531),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 115/271 (42%), Positives = 172/271 (63%), Gaps = 11/271 (4%)
 Frame = +2

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFD-PSAKLGLDIASCIITR-API  391
             ++E   R    N   W++ KL +   +S NT   RF FD   A  GL +AS ++TR  P+
Sbjct  55    VSEPKDRPKVFNGEDWVDLKLANIEVLSPNTKRLRFEFDDKEAVSGLPVASALLTRFKPV  114

Query  392   GQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQ  571
             G +      K V+RPYTP SD D  G+ +L++K YP+G MSQH  S+    ++  KGP+ 
Sbjct  115   GAE------KNVLRPYTPTSDEDIPGYLELVVKAYPDGPMSQHIHSMNVDQRLSFKGPLV  168

Query  572   KLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkld  751
             K  +  N   HI +IAGG+GITPM Q+   I KNP+D T+++L++ NVS +DILLKK+L 
Sbjct  169   KYPWEANKHNHICLIAGGTGITPMYQLAREIFKNPEDKTKVTLVFGNVSEEDILLKKELQ  228

Query  752   VLAATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTH  925
              L  T+P   + FY +D+P + W GG G+I+K+++   LP P ++ + +FVCGPP M   
Sbjct  229   DLENTYPQRFRAFYVLDNPPEGWTGGKGYITKELLKTVLPEPKEENIKLFVCGPPPMYKA  288

Query  926   VSGEK-DKREQGELSGVLKEVGYTENMVYKF  1015
             +SG K   ++QGEL+G+LK++GY++  V+KF
Sbjct  289   ISGGKVSPKDQGELTGILKDLGYSKEQVFKF  319



>sp|A5DQE4.2|MCR1_PICGU RecName: Full=NADH-cytochrome b5 reductase 2; AltName: Full=Mitochondrial 
cytochrome b reductase [Meyerozyma guilliermondii 
ATCC 6260]
 gb|EDK41397.2| hypothetical protein PGUG_05495 [Meyerozyma guilliermondii ATCC 
6260]
Length=294

 Score =   208 bits (529),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 121/269 (45%), Positives = 165/269 (61%), Gaps = 10/269 (4%)
 Frame = +2

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIG  394
             I  DT+ KT    ++WI+ KL+    VS NT  F F    P    GL  ASC++T+    
Sbjct  33    IQNDTA-KTFKGGDEWIDLKLKKSWDVSSNTRHFVFELKSPEDVSGLVTASCLMTKF---  88

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
                   K   VIRPYTP+SD D KG  D +IK Y  GKMS HF  LK GD V  KGPI K
Sbjct  89    ---VTAKGNNVIRPYTPVSDVDQKGTIDFVIKKYDGGKMSTHFHGLKEGDTVSFKGPIVK  145

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
              ++ PN  + I +I GG+GITP+ Q++  I KNP+D T++ L Y N++ +DIL+KK+LD 
Sbjct  146   WKWEPNQFQSIALIGGGTGITPLYQLLHEITKNPEDKTKVKLFYGNLTEEDILIKKELDD  205

Query  755   LAATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTLIFVCGPPGMMTHVS  931
             +A  H + + + Y VD  +  W+G +G I K+ +   LP PS D+ +FVCGPPG+   +S
Sbjct  206   IAEKHKDQVSITYFVDKASANWKGETGHIDKEFLQSNLPGPSKDSKVFVCGPPGLYKALS  265

Query  932   GEK-DKREQGELSGVLKEVGYTENMVYKF  1015
             G K    +QGE++GVL E+GYT+  VYKF
Sbjct  266   GVKVSPTDQGEVTGVLAELGYTKENVYKF  294



>gb|EKG07455.1| NADH-cytochrome b5 reductase, putative [Trypanosoma cruzi]
Length=288

 Score =   207 bits (528),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 114/280 (41%), Positives = 169/280 (60%), Gaps = 13/280 (5%)
 Frame = +2

Query  197   NLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCI  373
             +  Y  +    ++ K+  +  ++  FKL +    SHNT +FRF+  +    L L+++SCI
Sbjct  15    SFCYNREFATCSAAKSPFSTTEFRPFKLMNFYDESHNTRVFRFALPEADMPLNLEVSSCI  74

Query  374   ITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVE  553
               +      +A      VIRPYTPI+  D +G+F++L+K Y   KM+ H  SLK GD +E
Sbjct  75    TAKYTGKNGEA------VIRPYTPINKSDQRGYFEILVKRYDNSKMTAHLFSLKKGDTLE  128

Query  554   VKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddil  733
              KGP  K+  + N  +HIGMIAGG+GITPM QV   +L+ P + T ISL+YAN   +D+L
Sbjct  129   FKGPWVKIPIKANQYRHIGMIAGGTGITPMYQVARNVLRVPKNTTAISLIYANNRKEDVL  188

Query  734   lkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSD--DTLIFVCGP  907
             L  +L+ L  T P    +Y +     +W GG G+++K+M+   +PPPS   D++I VCGP
Sbjct  189   LGNELNELMETCPLFSPYYVLSQAPSDWMGGVGYVNKEMIKSVMPPPSSAADSIILVCGP  248

Query  908   PGMMTHVSGEKDKR----EQGELSGVLKEVGYTENMVYKF  1015
             P  M  +SG+KD +     QGEL G+LKE+GY + MV+KF
Sbjct  249   PPFMEAISGDKDFKTSPPSQGELKGMLKELGYMQKMVFKF  288



>ref|XP_819351.1| NADH-cytochrome B5 reductase [Trypanosoma cruzi strain CL Brener]
 gb|EAN97500.1| NADH-cytochrome B5 reductase, putative [Trypanosoma cruzi]
Length=288

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/280 (40%), Positives = 169/280 (60%), Gaps = 13/280 (5%)
 Frame = +2

Query  197   NLVYLDQINEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCI  373
             +  Y  ++   ++ K+  +  ++  F L +    SHNT +FRF+  +    L L+++SCI
Sbjct  15    SFCYNRELATCSAAKSPFSTTEFRPFTLMNFYDESHNTRVFRFALPEADMPLNLEVSSCI  74

Query  374   ITRAPIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVE  553
               +      +A      VIRPYTPI+  D +G+F++L+K Y   KM+ H  SLK GD +E
Sbjct  75    TAKYTGKNGEA------VIRPYTPINKSDQRGYFEILVKRYDNSKMTTHLFSLKKGDTLE  128

Query  554   VKGPIQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddil  733
              KGP  K+  + N  +HIGMIAGG+GITPM QV   +L+ P + T ISL+YAN   +D+L
Sbjct  129   FKGPWVKIPIKANQYRHIGMIAGGTGITPMYQVARNVLRVPKNTTAISLIYANTRKEDVL  188

Query  734   lkkkldVLAATHPNLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSD--DTLIFVCGP  907
             L  +L+ L  T P    +Y +     +W GG G+++K+M+   +PPPS   D++I VCGP
Sbjct  189   LGNELNELMETCPLFSPYYVLSQAPSDWMGGVGYVNKEMIKSVMPPPSSAADSIILVCGP  248

Query  908   PGMMTHVSGEKDKR----EQGELSGVLKEVGYTENMVYKF  1015
             P  M  +SG+KD +     QGEL G+LKE+GY + MV+KF
Sbjct  249   PPFMEAISGDKDFKTSPPSQGELKGMLKELGYMQKMVFKF  288



>ref|XP_003841091.1| hypothetical protein LEMA_P090210.1 [Leptosphaeria maculans JN3]
 emb|CBX97612.1| hypothetical protein LEMA_P090210.1 [Leptosphaeria maculans JN3]
Length=352

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 169/266 (64%), Gaps = 12/266 (5%)
 Frame = +2

Query  239   KTALNPNQ--WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAE  409
             K A N  +  ++   LE    V+HNT    F   +   + GL +AS +IT+    +  A 
Sbjct  92    KQAFNGGEQGFLSLMLEKSEVVNHNTKKLTFKLPEEDMESGLPVASAVITKY---KGPAM  148

Query  410   GKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRP  589
              KP  VIRPYTPISD D KG  D ++K YP G MS H  +++PG +++ KGPI K Q+ P
Sbjct  149   EKP--VIRPYTPISDVDQKGTVDFIVKQYPNGPMSTHMHNMEPGQRLDFKGPIPKYQWSP  206

Query  590   NMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATH  769
             N  +HI +IAGG+GITPM Q   AI KNP+D T+++L+Y N++  DILLKK+ + L  T+
Sbjct  207   NKHEHIALIAGGTGITPMWQTARAIFKNPEDKTKVTLIYGNLTEQDILLKKEWEELENTY  266

Query  770   P-NLKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPP--SDDTLIFVCGPPGMMTHVS-GE  937
             P   + FY +D P + W+GG G ++K+++   LP P   D   IFVCGPPGM   +S G+
Sbjct  267   PRRFRAFYVLDHPPEVWQGGKGHVTKELLKTVLPEPKEGDKIKIFVCGPPGMYKAISGGK  326

Query  938   KDKREQGELSGVLKEVGYTENMVYKF  1015
             K  ++QGEL G LKE+GY+++ VYKF
Sbjct  327   KSPQDQGELEGYLKELGYSKDQVYKF  352



>gb|KFY84413.1| hypothetical protein V500_09330 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
 gb|KFZ14462.1| hypothetical protein V502_06060 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=336

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 168/256 (66%), Gaps = 10/256 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W+  +L     V+HNT  F F   D     GL +AS I+T+    + +     K VIRPY
Sbjct  86    WVSLRLAKVENVNHNTKKFFFELPDEDHVSGLKVASAILTKYKGPEME-----KPVIRPY  140

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+SD D +GHF LL+K Y  G MS H   +KP  +++VKGPI K  +  N   HI ++A
Sbjct  141   TPVSDEDERGHFTLLVKKYANGPMSTHLHDMKPDQRLDVKGPIPKYPWAANKHDHIALVA  200

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  NP+D T+++L+Y NVS DDILLK++L+ L  T+P  L+VFYT+
Sbjct  201   GGTGITPMYQLTRAIFNNPEDKTKVTLVYGNVSEDDILLKRELEDLENTYPQRLRVFYTL  260

Query  797   DSPTKEWRG-GSGFISKDMVVKGLPPP-SDDTLIFVCGPPGMMTHVSGEKDK-REQGELS  967
             D+P K+      GFI+K+++   LP P S++  +FVCGPPGM   +SG+K   R+QGEL+
Sbjct  261   DNPPKDSTNFQKGFITKELLKTVLPEPKSENIKVFVCGPPGMYKAISGDKKSPRDQGELT  320

Query  968   GVLKEVGYTENMVYKF  1015
             G+L E+GY+++ VYKF
Sbjct  321   GILSELGYSKDQVYKF  336



>ref|XP_011122701.1| hypothetical protein AOL_s00080g24 [Arthrobotrys oligospora ATCC 
24927]
 gb|EGX48395.1| hypothetical protein AOL_s00080g24 [Arthrobotrys oligospora ATCC 
24927]
Length=337

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 168/263 (64%), Gaps = 14/263 (5%)
 Frame = +2

Query  245   ALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSA--KLGLDIASCIITR-APIGQQDAEGK  415
              L    W++ KL    P +HNT  F F   PS     GL  AS I+T+  P G     GK
Sbjct  83    TLTGEDWVDLKLIKVEPYNHNTKKFIFEL-PSEDHTSGLKTASAILTKFTPEG-----GK  136

Query  416   PKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNM  595
             P  VIRPYTPISD DA+G+  LL+K Y +G MS H   + P  ++  KGPI K  +  N 
Sbjct  137   P--VIRPYTPISDDDARGYMTLLVKQYEKGPMSTHLHEMAPEQRLLFKGPIPKYPWEANK  194

Query  596   KKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN  775
               HI +IAGG+GITPM Q+I AI KN +D T+I+L++ N++ +DILL+++L  L   +P 
Sbjct  195   HNHIALIAGGTGITPMWQLIRAIFKNKEDKTKITLVFGNIAEEDILLRQELAKLENEYPQ  254

Query  776   -LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSG-EKDK  946
               + FYT+D P KE+ G  GFI+K+++ + LP P +D + +FVCGPPG+M  +SG +K  
Sbjct  255   RFRAFYTLDKPPKEFVGNKGFITKELLKQVLPEPKEDNIKVFVCGPPGLMNVISGNKKSP  314

Query  947   REQGELSGVLKEVGYTENMVYKF  1015
             ++QGEL G+LKE+GYT   VYKF
Sbjct  315   KDQGELVGILKELGYTPEQVYKF  337



>gb|KHJ32156.1| putative nadh-cytochrome b5 reductase [Erysiphe necator]
Length=324

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 166/262 (63%), Gaps = 10/262 (4%)
 Frame = +2

Query  245   ALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPK  421
             A     + + KL+    ++HNT  FRF+     ++ GL+ ASC++TR      D E   K
Sbjct  68    AFTNQGYFDLKLDSVETINHNTKKFRFALPEKEQVSGLETASCLLTR--YKGPDME---K  122

Query  422   YVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKK  601
              VIRPYTP SD D  G+ DLL+K YP G MS HF  + PG  +E KGPI K  +  N   
Sbjct  123   AVIRPYTPTSDEDEIGYLDLLVKKYPTGIMSSHFHEMMPGQTLEFKGPIVKYPWTANKHN  182

Query  602   HIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-L  778
             HI +IAGG+GI PM Q+I AI KNP DNT+++L++ NV+ +DILL+K+L  L  T+P   
Sbjct  183   HIALIAGGTGIAPMYQLIRAIFKNPTDNTKVTLVFGNVTEEDILLRKELQELENTYPQRF  242

Query  779   KVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKRE  952
             + FY +D+P K W G  G+ISK ++   LP P ++ + IFVCGPP M   +SG K    +
Sbjct  243   RAFYVLDNPPKSWSGEKGYISKHLLKTVLPEPKEENIKIFVCGPPPMYKAISGAKISASD  302

Query  953   QGELSG-VLKEVGYTENMVYKF  1015
             QGEL G +L+++GY+++ V+KF
Sbjct  303   QGELDGSILEQLGYSKDQVFKF  324



>ref|XP_003071409.1| Oxidoreductase NAD-binding domain containing protein [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EER29264.1| Oxidoreductase NAD-binding domain containing protein [Coccidioides 
posadasii C735 delta SOWgp]
Length=325

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 167/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W++ KL     +SHN   FRF F DP +  GL IAS ++T+   G +D     K  IRPY
Sbjct  76    WVDLKLAGIETLSHNVKRFRFEFPDPESVSGLHIASALLTKYK-GPKDE----KPTIRPY  130

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+S+ +  G+ DL++K YP G MS H  ++  G ++  KGPI K  +  N   HI MIA
Sbjct  131   TPVSEEEQPGYLDLVVKQYPNGPMSTHLHNMAVGQQLSFKGPIPKYPWEENKHDHICMIA  190

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+I  I  NP+D T+++L++ N++ +DILLKK+LD+L  T+P   + FY +
Sbjct  191   GGTGITPMYQIIRKIFNNPNDKTKVTLVFGNITEEDILLKKELDILENTYPRRFRAFYLL  250

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEKDK-REQGELSG  970
             D P   W  G+G+++K+++   LP P  + + IFVCGPPGM   VSG K+  ++QGEL+G
Sbjct  251   DKPPAGWTQGTGYVTKELLKTVLPEPKTENIKIFVCGPPGMYKAVSGPKNSPKDQGELTG  310

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GY ++ VYKF
Sbjct  311   LLKELGYDKDQVYKF  325



>gb|EIE83495.1| hypothetical protein RO3G_08200 [Rhizopus delemar RA 99-880]
Length=342

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 167/274 (61%), Gaps = 11/274 (4%)
 Frame = +2

Query  209   LDQIN-EDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSFDPSAKLGLDIASCIITRA  385
             LDQ   E     T  N   +   KL     +SH+T +FRF+   +   GL +ASC+I R 
Sbjct  75    LDQAKAEAKPETTQFNAPDFTPLKLVSVQKISHDTSVFRFALPENQNAGLPVASCVIAR-  133

Query  386   PIGQQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGP  565
                    EG  K +IRPYTPIS  D   H D +IK Y  GKM+     +KPGD +E KGP
Sbjct  134   ----HQVEGD-KPIIRPYTPISYEDNIDHLDFVIKRYSTGKMTPIIHDMKPGDTLEFKGP  188

Query  566   IQKLQYRPNMKKHIGMIAGGSGITPMLQVIEAIL--KNPDDNTQISLLYANVSPddillk  739
             I K  +  + K ++GMIAGG+GITPMLQVI  +   K+ D  T+I+LL+ANVS +DIL+K
Sbjct  189   IPKYDWEKDQKTNVGMIAGGTGITPMLQVIHRVFHEKSTDKKTKITLLFANVSENDILMK  248

Query  740   kkldVLAATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSD-DTLIFVCGPPG  913
             ++LD  A  HP+  KV Y VD   + W G  G+I+ D++    P P D D++I VCGPP 
Sbjct  249   EELDKYAREHPDRFKVVYAVDKAPEGWTGVEGYITADVIKSHFPSPEDKDSIIMVCGPPP  308

Query  914   MMTHVSGEKDKREQGELSGVLKEVGYTENMVYKF  1015
             M+  ++G K   +QGELSG+LKE+GYTE  V+KF
Sbjct  309   MVASMAGPKKGMKQGELSGILKELGYTEENVFKF  342



>gb|KGO67103.1| Riboflavin synthase-like beta-barrel [Penicillium italicum]
Length=319

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/270 (42%), Positives = 170/270 (63%), Gaps = 9/270 (3%)
 Frame = +2

Query  218   INEDTSRKTALNPNQWIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIG  394
             + E   R    N   W++ KL +   +S NT   RF++ D  A  G+ +AS ++TR    
Sbjct  55    VAEPKDRPKVFNGEDWVDLKLTNIEVLSPNTKRLRFAYEDKEAVSGIPVASALLTRF---  111

Query  395   QQDAEGKPKYVIRPYTPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQK  574
                 EG  K V+RPYTP SD D  G+ +L++K YP G MS+H  S+    ++  KGPI K
Sbjct  112   --KPEGAEKNVLRPYTPTSDEDIPGYLELIVKAYPGGPMSEHMHSMNIDQRLSFKGPIVK  169

Query  575   LQYRPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldV  754
               +  N   HI +IAGG+GITPM Q+   I KNP+D T+++L++ NV+ +DILLKK+L+ 
Sbjct  170   YPWEANKHNHICLIAGGTGITPMYQLAREIFKNPEDKTKVTLVFGNVTEEDILLKKELNE  229

Query  755   LAATHPN-LKVFYTVDSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHV  928
             L  T+P   + FY +D P  EW GG GFI+K+++   LP P ++ + +FVCGPP M   +
Sbjct  230   LENTYPQRFRAFYVLDKPPAEWTGGKGFITKELLKTVLPEPKEENIKLFVCGPPPMYKAI  289

Query  929   SGEK-DKREQGELSGVLKEVGYTENMVYKF  1015
             SG K   ++QGEL+G+LK++GY+++ V+KF
Sbjct  290   SGGKISPKDQGELTGILKDLGYSKDQVFKF  319



>ref|XP_007816839.1| NADH-cytochrome b5 reductase [Metarhizium robertsii ARSEF 23]
 gb|EFZ03576.1| Ferredoxin reductase-type FAD-binding domain protein [Metarhizium 
robertsii ARSEF 23]
 gb|EXU99970.1| cytochrome b5 reductase [Metarhizium robertsii]
Length=326

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 165/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSFDPSAKL-GLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             ++  KL D   V+HNT   RF    S  + GL IAS I+T+   G  D     K  +RPY
Sbjct  77    FLSLKLADVDIVNHNTKRLRFELPESDMVSGLHIASAILTKFK-GPNDE----KATLRPY  131

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TPISD   KGH DLL+K YP+G MS H   L PG +++ KGP+ K  +  N   HI +IA
Sbjct  132   TPISDEGEKGHIDLLVKKYPDGPMSTHIHDLVPGQRLDFKGPLPKYSWSENKHDHIALIA  191

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHPN-LKVFYTV  796
             GG+GITPM Q+  AI  N +D T+++L++ NV+ +DILL+++L  L  T+P   + FY +
Sbjct  192   GGTGITPMYQLCRAIFNNSNDKTKVTLVFGNVTEEDILLRRELAELENTYPQRFRAFYVL  251

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEK-DKREQGELSG  970
             D   K+W+G +G+ISK+++   LP P ++ + +FVCGPPG+M  +SG K   ++QGELSG
Sbjct  252   DKAPKDWQGNTGYISKELLKTVLPEPKEENIKVFVCGPPGLMKAISGPKVSPKDQGELSG  311

Query  971   VLKEVGYTENMVYKF  1015
              LK++GY++  VYKF
Sbjct  312   SLKDLGYSQEQVYKF  326



>ref|XP_002583652.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gb|EEP81754.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
Length=327

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/255 (45%), Positives = 167/255 (65%), Gaps = 9/255 (4%)
 Frame = +2

Query  263   WIEFKLEDRAPVSHNTHLFRFSF-DPSAKLGLDIASCIITRAPIGQQDAEGKPKYVIRPY  439
             W++ +L D   +SHN   FRF F DP A  GL IAS ++T+   G +D     K  IRPY
Sbjct  78    WVDLRLVDIQMLSHNVKKFRFEFPDPEAVSGLHIASALLTKYK-GPKDE----KPTIRPY  132

Query  440   TPISDPDAKGHFDLLIKVYPEGKMSQHFASLKPGDKVEVKGPIQKLQYRPNMKKHIGMIA  619
             TP+S+    G+ +L+IK YP G MS H  ++  G ++  KGPI K  +  N   HI MIA
Sbjct  133   TPVSEEGQPGYLELVIKRYPNGPMSNHLHNMAVGQQLSFKGPIPKYPWERNKHDHICMIA  192

Query  620   GGSGITPMLQVIEAILKNPDDNTQISLLYANVSPddillkkkldVLAATHP-NLKVFYTV  796
             GG+GITPM Q+I  I  +P+D T+++L++ NV+ +DILLK + ++L  T+P   + FY +
Sbjct  193   GGTGITPMYQIIRKIFNDPEDKTKVTLVFGNVTEEDILLKNEFELLENTYPRRFRAFYLL  252

Query  797   DSPTKEWRGGSGFISKDMVVKGLPPPSDDTL-IFVCGPPGMMTHVSGEKDK-REQGELSG  970
             D+P  +W  G+G++SK+++   LP P  + + IFVCGPPGM   VSG K   ++QGEL+G
Sbjct  253   DNPPADWTQGTGYVSKELLKTVLPEPKTENIKIFVCGPPGMYKTVSGPKTSPKDQGELTG  312

Query  971   VLKEVGYTENMVYKF  1015
             +LKE+GY+++ VYKF
Sbjct  313   LLKELGYSKDQVYKF  327



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3261434872332