BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25363_g2_i4 len=2476 path=[2428:0-709 @3138@!:710-1105
3534:1106-1120 3549:1121-1148 3577:1149-1171 3600:1172-1263
3692:1264-1330 17173:1331-1344 3773:1345-1494 3923:1495-1524
3953:1525-1602 17938:1603-1614 17065:1615-1627 4056:1628-1674
10352:1675-1677 4106:1678-1704 4133:1705-1742 18031:1743-1743
4172:1744-1828 4257:1829-1890 6041:1891-1990 4419:1991-2016
7824:2017-2222 8030:2223-2225 18081:2226-2475]

Length=2476
                                                                      Score     E

emb|CDO98290.1|  unnamed protein product                                886   0.0      
ref|XP_009604830.1|  PREDICTED: calcium-binding mitochondrial car...    874   0.0      
ref|XP_009778498.1|  PREDICTED: calcium-binding mitochondrial car...    867   0.0      
ref|XP_009762426.1|  PREDICTED: calcium-binding mitochondrial car...    866   0.0      
ref|XP_004241649.1|  PREDICTED: calcium-binding mitochondrial car...    863   0.0      
ref|XP_009619643.1|  PREDICTED: calcium-binding mitochondrial car...    862   0.0      
ref|XP_010249328.1|  PREDICTED: calcium-binding mitochondrial car...    855   0.0      
ref|XP_010249330.1|  PREDICTED: calcium-binding mitochondrial car...    855   0.0      
gb|KHG21595.1|  Calcium-binding mitochondrial carrier SCaMC-1           849   0.0      
ref|XP_006341461.1|  PREDICTED: calcium-binding mitochondrial car...    847   0.0      
ref|XP_007038176.1|  Mitochondrial substrate carrier family prote...    838   0.0      
ref|XP_010907271.1|  PREDICTED: calcium-binding mitochondrial car...    837   0.0      
ref|XP_004235852.1|  PREDICTED: calcium-binding mitochondrial car...    835   0.0      
ref|XP_007038177.1|  Mitochondrial substrate carrier family prote...    834   0.0      
ref|XP_007032054.1|  Mitochondrial substrate carrier family prote...    832   0.0      
ref|XP_010663817.1|  PREDICTED: calcium-binding mitochondrial car...    833   0.0      
ref|XP_010663816.1|  PREDICTED: calcium-binding mitochondrial car...    831   0.0      
ref|XP_008805618.1|  PREDICTED: calcium-binding mitochondrial car...    829   0.0      
ref|XP_008792029.1|  PREDICTED: calcium-binding mitochondrial car...    828   0.0      
ref|XP_010925208.1|  PREDICTED: calcium-binding mitochondrial car...    823   0.0      
emb|CAN83157.1|  hypothetical protein VITISV_022552                     821   0.0      Vitis vinifera
ref|XP_010925207.1|  PREDICTED: calcium-binding mitochondrial car...    822   0.0      
gb|KHG06239.1|  Calcium-binding mitochondrial carrier SCaMC-1           818   0.0      
ref|XP_002318185.2|  mitochondrial substrate carrier family protein     813   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP41876.1|  hypothetical protein JCGZ_26894                         813   0.0      
ref|XP_009385809.1|  PREDICTED: calcium-binding mitochondrial car...    813   0.0      
ref|XP_011043020.1|  PREDICTED: calcium-binding mitochondrial car...    810   0.0      
ref|XP_011040298.1|  PREDICTED: calcium-binding mitochondrial car...    809   0.0      
ref|XP_006436988.1|  hypothetical protein CICLE_v10031301mg             808   0.0      
ref|XP_006485062.1|  PREDICTED: calcium-binding mitochondrial car...    807   0.0      
gb|EYU21768.1|  hypothetical protein MIMGU_mgv1a004864mg                806   0.0      
ref|XP_009415359.1|  PREDICTED: calcium-binding mitochondrial car...    806   0.0      
dbj|BAJ53112.1|  JHL07K02.2                                             805   0.0      
ref|XP_011084688.1|  PREDICTED: calcium-binding mitochondrial car...    803   0.0      
ref|XP_010099534.1|  Calcium-binding mitochondrial carrier protei...    805   0.0      
ref|XP_002511072.1|  Succinate/fumarate mitochondrial transporter...    801   0.0      Ricinus communis
ref|XP_008375423.1|  PREDICTED: calcium-binding mitochondrial car...    796   0.0      
ref|XP_009360281.1|  PREDICTED: calcium-binding mitochondrial car...    796   0.0      
ref|XP_007209924.1|  hypothetical protein PRUPE_ppa004514mg             795   0.0      
ref|XP_008245874.1|  PREDICTED: calcium-binding mitochondrial car...    795   0.0      
ref|XP_003524327.2|  PREDICTED: calcium-binding mitochondrial car...    794   0.0      
ref|XP_009399747.1|  PREDICTED: calcium-binding mitochondrial car...    794   0.0      
ref|XP_009373667.1|  PREDICTED: calcium-binding mitochondrial car...    793   0.0      
ref|XP_002277297.1|  PREDICTED: calcium-binding mitochondrial car...    790   0.0      Vitis vinifera
ref|XP_008389298.1|  PREDICTED: calcium-binding mitochondrial car...    790   0.0      
gb|KEH20957.1|  substrate carrier family protein                        788   0.0      
ref|XP_006468929.1|  PREDICTED: calcium-binding mitochondrial car...    788   0.0      
ref|XP_006446900.1|  hypothetical protein CICLE_v10015032mg             786   0.0      
gb|KHN16895.1|  Calcium-binding mitochondrial carrier protein SCa...    786   0.0      
ref|XP_003532301.1|  PREDICTED: calcium-binding mitochondrial car...    786   0.0      
ref|XP_002321765.1|  mitochondrial substrate carrier family protein     786   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007159945.1|  hypothetical protein PHAVU_002G280600g             786   0.0      
gb|ABK25206.1|  unknown                                                 786   0.0      Picea sitchensis
ref|XP_008449675.1|  PREDICTED: calcium-binding mitochondrial car...    785   0.0      
ref|XP_004140204.1|  PREDICTED: calcium-binding mitochondrial car...    785   0.0      
ref|XP_008231225.1|  PREDICTED: calcium-binding mitochondrial car...    784   0.0      
ref|XP_006844654.1|  hypothetical protein AMTR_s00016p00237360          783   0.0      
ref|XP_010066396.1|  PREDICTED: calcium-binding mitochondrial car...    778   0.0      
ref|XP_004503813.1|  PREDICTED: calcium-binding mitochondrial car...    778   0.0      
ref|XP_003553987.1|  PREDICTED: calcium-binding mitochondrial car...    775   0.0      
ref|XP_009619645.1|  PREDICTED: calcium-binding mitochondrial car...    770   0.0      
ref|XP_010090932.1|  Calcium-binding mitochondrial carrier protei...    771   0.0      
ref|XP_009415360.1|  PREDICTED: calcium-binding mitochondrial car...    771   0.0      
ref|XP_003548488.1|  PREDICTED: calcium-binding mitochondrial car...    768   0.0      
ref|XP_003526912.1|  PREDICTED: calcium-binding mitochondrial car...    766   0.0      
ref|XP_003523182.1|  PREDICTED: calcium-binding mitochondrial car...    765   0.0      
ref|XP_006402030.1|  hypothetical protein EUTSA_v10013343mg             765   0.0      
gb|KEH23500.1|  substrate carrier family protein                        762   0.0      
ref|XP_007217350.1|  hypothetical protein PRUPE_ppa021090mg             761   0.0      
ref|NP_199918.1|  mitochondrial substrate carrier family protein        761   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300380.1|  PREDICTED: calcium-binding mitochondrial car...    761   0.0      
ref|XP_004493102.1|  PREDICTED: calcium-binding mitochondrial car...    759   0.0      
emb|CBI15774.3|  unnamed protein product                                761   0.0      
ref|XP_004304572.1|  PREDICTED: calcium-binding mitochondrial car...    758   0.0      
ref|XP_009378058.1|  PREDICTED: calcium-binding mitochondrial car...    759   0.0      
gb|AFJ66167.1|  hypothetical protein 11M19.11                           759   0.0      
ref|XP_002437252.1|  hypothetical protein SORBIDRAFT_10g023640          759   0.0      Sorghum bicolor [broomcorn]
ref|XP_004503037.1|  PREDICTED: calcium-binding mitochondrial car...    758   0.0      
ref|XP_007137825.1|  hypothetical protein PHAVU_009G158900g             756   0.0      
ref|XP_008341208.1|  PREDICTED: calcium-binding mitochondrial car...    757   0.0      
ref|XP_003602734.1|  Calcium-binding mitochondrial carrier protei...    756   0.0      
ref|XP_010442859.1|  PREDICTED: calcium-binding mitochondrial car...    757   0.0      
ref|XP_009399748.1|  PREDICTED: calcium-binding mitochondrial car...    756   0.0      
ref|XP_010442584.1|  PREDICTED: calcium-binding mitochondrial car...    757   0.0      
ref|XP_007161553.1|  hypothetical protein PHAVU_001G079200g             755   0.0      
ref|XP_010482432.1|  PREDICTED: calcium-binding mitochondrial car...    755   0.0      
ref|XP_006281426.1|  hypothetical protein CARUB_v10027500mg             754   0.0      
ref|XP_002864093.1|  mitochondrial substrate carrier family protein     755   0.0      
ref|XP_010536573.1|  PREDICTED: calcium-binding mitochondrial car...    754   0.0      
gb|EPS59119.1|  hypothetical protein M569_15688                         754   0.0      
ref|XP_010695942.1|  PREDICTED: calcium-binding mitochondrial car...    754   0.0      
gb|KHN28603.1|  Calcium-binding mitochondrial carrier protein SCa...    775   0.0      
ref|XP_003563659.1|  PREDICTED: calcium-binding mitochondrial car...    754   0.0      
ref|XP_004965942.1|  PREDICTED: calcium-binding mitochondrial car...    754   0.0      
ref|XP_008658492.1|  PREDICTED: hypothetical protein isoform X1         753   0.0      
ref|NP_001058018.1|  Os06g0604500                                       751   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009140881.1|  PREDICTED: calcium-binding mitochondrial car...    750   0.0      
gb|EPS60241.1|  hypothetical protein M569_14562                         747   0.0      
emb|CDY05832.1|  BnaA10g05880D                                          746   0.0      
gb|KFK36750.1|  mitochondrial substrate carrier family protein          745   0.0      
ref|XP_006656221.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-bind...    742   0.0      
emb|CDX71683.1|  BnaC09g27240D                                          742   0.0      
gb|EAZ37576.1|  hypothetical protein OsJ_21908                          740   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010546110.1|  PREDICTED: calcium-binding mitochondrial car...    741   0.0      
ref|XP_006647043.1|  PREDICTED: calcium-binding mitochondrial car...    738   0.0      
gb|KHN31240.1|  Calcium-binding mitochondrial carrier protein SCa...    737   0.0      
ref|XP_003519937.1|  PREDICTED: calcium-binding mitochondrial car...    738   0.0      
ref|NP_001146297.1|  hypothetical protein                               736   0.0      Zea mays [maize]
dbj|BAJ86657.1|  predicted protein                                      734   0.0      
ref|XP_010546111.1|  PREDICTED: calcium-binding mitochondrial car...    731   0.0      
dbj|BAD15855.1|  putative Mcsc-pending-prov protein                     728   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007151708.1|  hypothetical protein PHAVU_004G069200g             727   0.0      
gb|EAZ22133.1|  hypothetical protein OsJ_05795                          728   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002871265.1|  mitochondrial substrate carrier family protein     717   0.0      
ref|XP_002453502.1|  hypothetical protein SORBIDRAFT_04g006930          719   0.0      Sorghum bicolor [broomcorn]
ref|XP_004951534.1|  PREDICTED: calcium-binding mitochondrial car...    717   0.0      
ref|NP_196349.1|  mitochondrial ATP-Mg/Pi transporter                   714   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001151180.1|  LOC100284813                                       716   0.0      Zea mays [maize]
ref|XP_010491336.1|  PREDICTED: calcium-binding mitochondrial car...    714   0.0      
ref|XP_010452689.1|  PREDICTED: calcium-binding mitochondrial car...    713   0.0      
ref|XP_010423224.1|  PREDICTED: calcium-binding mitochondrial car...    713   0.0      
ref|XP_006399214.1|  hypothetical protein EUTSA_v10013407mg             712   0.0      
emb|CDY14050.1|  BnaC02g01670D                                          710   0.0      
ref|XP_009125685.1|  PREDICTED: calcium-binding mitochondrial car...    709   0.0      
gb|KHG23948.1|  Calcium-binding mitochondrial carrier SCaMC-1           709   0.0      
gb|KHN09696.1|  Calcium-binding mitochondrial carrier protein SCa...    707   0.0      
ref|XP_006287636.1|  hypothetical protein CARUB_v10000847mg             706   0.0      
gb|EEC80932.1|  hypothetical protein OsI_23626                          702   0.0      Oryza sativa Indica Group [Indian rice]
gb|KFK25130.1|  hypothetical protein AALP_AA8G069900                    701   0.0      
ref|XP_010555591.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-bind...    697   0.0      
ref|XP_002866456.1|  mitochondrial substrate carrier family protein     687   0.0      
gb|KFK27926.1|  hypothetical protein AALP_AA8G448300                    684   0.0      
ref|XP_008231227.1|  PREDICTED: calcium-binding mitochondrial car...    677   0.0      
ref|XP_010444010.1|  PREDICTED: calcium-binding mitochondrial car...    678   0.0      
gb|KCW64286.1|  hypothetical protein EUGRSUZ_G01923                     676   0.0      
ref|XP_010444008.1|  PREDICTED: calcium-binding mitochondrial car...    677   0.0      
ref|XP_010483867.1|  PREDICTED: calcium-binding mitochondrial car...    676   0.0      
ref|NP_568940.1|  ATP-Mg/Pi transporter                                 674   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279765.1|  hypothetical protein CARUB_v10027755mg             673   0.0      
gb|KHN00632.1|  Calcium-binding mitochondrial carrier protein SCa...    671   0.0      
ref|XP_010457733.1|  PREDICTED: calcium-binding mitochondrial car...    672   0.0      
ref|XP_006394471.1|  hypothetical protein EUTSA_v10004107mg             667   0.0      
ref|XP_006578741.1|  PREDICTED: calcium-binding mitochondrial car...    663   0.0      
ref|XP_006581822.1|  PREDICTED: calcium-binding mitochondrial car...    663   0.0      
ref|XP_006446894.1|  hypothetical protein CICLE_v10015524mg             658   0.0      
ref|XP_008341210.1|  PREDICTED: calcium-binding mitochondrial car...    659   0.0      
ref|XP_009378060.1|  PREDICTED: calcium-binding mitochondrial car...    657   0.0      
ref|XP_007032055.1|  Mitochondrial substrate carrier family prote...    655   0.0      
ref|XP_006574741.1|  PREDICTED: calcium-binding mitochondrial car...    647   0.0      
ref|XP_009122351.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-bind...    643   0.0      
ref|XP_010452691.1|  PREDICTED: calcium-binding mitochondrial car...    637   0.0      
emb|CDX86953.1|  BnaC03g52230D                                          639   0.0      
emb|CDY00231.1|  BnaA06g21320D                                          636   0.0      
ref|XP_009150121.1|  PREDICTED: calcium-binding mitochondrial car...    635   0.0      
ref|XP_006287635.1|  hypothetical protein CARUB_v10000847mg             629   0.0      
ref|XP_010452692.1|  PREDICTED: calcium-binding mitochondrial car...    628   0.0      
ref|XP_010423227.1|  PREDICTED: calcium-binding mitochondrial car...    628   0.0      
ref|XP_008677345.1|  PREDICTED: LOC100284813 isoform X1                 630   0.0      
gb|AFW66147.1|  hypothetical protein ZEAMMB73_421477                    624   0.0      
gb|KEH23501.1|  substrate carrier family protein                        615   0.0      
ref|XP_006366294.1|  PREDICTED: calcium-binding mitochondrial car...    612   0.0      
ref|XP_010663818.1|  PREDICTED: calcium-binding mitochondrial car...    611   0.0      
ref|XP_010322634.1|  PREDICTED: calcium-binding mitochondrial car...    609   0.0      
ref|XP_006446899.1|  hypothetical protein CICLE_v10015032mg             601   0.0      
ref|XP_006581824.1|  PREDICTED: calcium-binding mitochondrial car...    602   0.0      
ref|XP_006578742.1|  PREDICTED: calcium-binding mitochondrial car...    601   0.0      
ref|XP_011073596.1|  PREDICTED: solute carrier family 25 member 41      603   0.0      
ref|XP_007137826.1|  hypothetical protein PHAVU_009G158900g             596   0.0      
ref|XP_002512812.1|  ADP,ATP carrier protein, putative                  595   0.0      Ricinus communis
ref|XP_006578743.1|  PREDICTED: calcium-binding mitochondrial car...    589   0.0      
gb|EMT02893.1|  Calcium-binding mitochondrial carrier protein SCa...    589   0.0      
ref|XP_006578744.1|  PREDICTED: calcium-binding mitochondrial car...    581   0.0      
ref|XP_006581825.1|  PREDICTED: calcium-binding mitochondrial car...    578   0.0      
ref|XP_011040299.1|  PREDICTED: calcium-binding mitochondrial car...    579   0.0      
gb|ACN33669.1|  unknown                                                 576   0.0      Zea mays [maize]
ref|XP_002866455.1|  hypothetical protein ARALYDRAFT_496347             610   0.0      
ref|XP_009360282.1|  PREDICTED: calcium-binding mitochondrial car...    574   0.0      
ref|XP_008375425.1|  PREDICTED: calcium-binding mitochondrial car...    573   0.0      
gb|EEC72696.1|  hypothetical protein OsI_06277                          579   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_002989097.1|  hypothetical protein SELMODRAFT_269471             576   0.0      
ref|XP_008245875.1|  PREDICTED: calcium-binding mitochondrial car...    568   0.0      
ref|XP_009373668.1|  PREDICTED: calcium-binding mitochondrial car...    567   0.0      
ref|XP_008389299.1|  PREDICTED: calcium-binding mitochondrial car...    563   0.0      
gb|AFJ66222.1|  hypothetical protein 34G24.27                           565   0.0      
ref|XP_002983817.1|  hypothetical protein SELMODRAFT_118883             558   0.0      
ref|XP_001769325.1|  predicted protein                                  548   0.0      
ref|XP_006394470.1|  hypothetical protein EUTSA_v10004107mg             544   0.0      
ref|XP_001777279.1|  predicted protein                                  545   0.0      
gb|EMS49732.1|  Calcium-binding mitochondrial carrier protein SCa...    535   1e-180   
ref|XP_006446898.1|  hypothetical protein CICLE_v10015032mg             521   9e-176   
ref|XP_006446893.1|  hypothetical protein CICLE_v10015524mg             517   4e-174   
ref|XP_010452693.1|  PREDICTED: calcium-binding mitochondrial car...    503   1e-168   
ref|XP_010423228.1|  PREDICTED: calcium-binding mitochondrial car...    503   1e-168   
ref|XP_010442585.1|  PREDICTED: calcium-binding mitochondrial car...    495   1e-165   
ref|XP_010442866.1|  PREDICTED: calcium-binding mitochondrial car...    494   5e-165   
ref|NP_001032121.1|  ATP-Mg/Pi transporter                              494   7e-165   Arabidopsis thaliana [mouse-ear cress]
gb|KDO45960.1|  hypothetical protein CISIN_1g039485mg                   466   2e-153   
ref|XP_007137827.1|  hypothetical protein PHAVU_009G158900g             429   2e-139   
ref|XP_010444015.1|  PREDICTED: calcium-binding mitochondrial car...    415   1e-134   
emb|CDX98981.1|  BnaC09g48540D                                          410   3e-131   
gb|KHN17449.1|  Calcium-binding mitochondrial carrier protein SCa...    393   4e-127   
gb|KHN46834.1|  Calcium-binding mitochondrial carrier protein SCa...    389   7e-126   
gb|ESA19406.1|  hypothetical protein GLOINDRAFT_135767                  398   4e-125   
ref|XP_004512666.1|  PREDICTED: calcium-binding mitochondrial car...    359   3e-114   
ref|XP_005520980.1|  PREDICTED: calcium-binding mitochondrial car...    364   8e-113   
ref|XP_006676546.1|  hypothetical protein BATDEDRAFT_9761               363   1e-112   
ref|XP_010224133.1|  PREDICTED: calcium-binding mitochondrial car...    363   5e-112   
gb|KGL84922.1|  Calcium-binding mitochondrial carrier protein SCa...    361   6e-112   
ref|XP_005050523.1|  PREDICTED: calcium-binding mitochondrial car...    358   2e-110   
emb|CDH53071.1|  mitochondrial substrate carrier family protein         357   4e-110   
ref|XP_006270480.1|  PREDICTED: calcium-binding mitochondrial car...    357   7e-110   
ref|XP_005487153.1|  PREDICTED: calcium-binding mitochondrial car...    357   7e-110   
ref|XP_002841552.1|  hypothetical protein                               357   1e-109   Tuber melanosporum Mel28
ref|XP_002195432.1|  PREDICTED: calcium-binding mitochondrial car...    356   1e-109   Taeniopygia guttata
ref|XP_009086732.1|  PREDICTED: calcium-binding mitochondrial car...    355   2e-109   
emb|CDS14214.1|  hypothetical protein LRAMOSA06384                      355   2e-109   
ref|XP_009899206.1|  PREDICTED: calcium-binding mitochondrial car...    355   2e-109   
ref|XP_005148139.1|  PREDICTED: calcium-binding mitochondrial car...    355   3e-109   
ref|XP_001519699.1|  PREDICTED: calcium-binding mitochondrial car...    354   4e-109   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_010561738.1|  PREDICTED: calcium-binding mitochondrial car...    354   6e-109   
gb|KFO72410.1|  Calcium-binding mitochondrial carrier protein SCa...    353   6e-109   
ref|XP_009468952.1|  PREDICTED: calcium-binding mitochondrial car...    354   7e-109   
ref|XP_009554122.1|  PREDICTED: calcium-binding mitochondrial car...    353   8e-109   
gb|EPB87242.1|  hypothetical protein HMPREF1544_05964                   353   3e-108   
ref|XP_005285526.1|  PREDICTED: calcium-binding mitochondrial car...    351   7e-108   
ref|XP_007662321.1|  PREDICTED: calcium-binding mitochondrial car...    351   7e-108   
ref|XP_006119851.1|  PREDICTED: calcium-binding mitochondrial car...    351   8e-108   
ref|XP_007055270.1|  PREDICTED: calcium-binding mitochondrial car...    351   8e-108   
ref|XP_008501525.1|  PREDICTED: calcium-binding mitochondrial car...    349   3e-107   
ref|NP_001038417.1|  solute carrier family 25, member 23                349   4e-107   Danio rerio [leopard danio]
gb|KFP84445.1|  Calcium-binding mitochondrial carrier protein SCa...    347   6e-107   
ref|XP_009077057.1|  PREDICTED: calcium-binding mitochondrial car...    347   7e-107   
ref|NP_001121016.1|  calcium-binding mitochondrial carrier protei...    347   2e-106   Rattus norvegicus [brown rat]
ref|XP_006170310.1|  PREDICTED: calcium-binding mitochondrial car...    346   4e-106   
ref|XP_007237962.1|  PREDICTED: calcium-binding mitochondrial car...    347   4e-106   
ref|XP_007431604.1|  PREDICTED: calcium-binding mitochondrial car...    346   5e-106   
ref|XP_008404488.1|  PREDICTED: calcium-binding mitochondrial car...    346   6e-106   
ref|XP_004079367.1|  PREDICTED: calcium-binding mitochondrial car...    346   7e-106   
ref|NP_001135638.1|  solute carrier family 25 (mitochondrial carr...    345   8e-106   Xenopus tropicalis [western clawed frog]
ref|XP_004689356.1|  PREDICTED: calcium-binding mitochondrial car...    345   8e-106   
ref|XP_005805271.1|  PREDICTED: calcium-binding mitochondrial car...    345   1e-105   
ref|XP_007058269.1|  PREDICTED: calcium-binding mitochondrial car...    345   2e-105   
ref|XP_004068093.1|  PREDICTED: calcium-binding mitochondrial car...    345   2e-105   
ref|NP_001011047.1|  calcium-binding mitochondrial carrier protei...    344   3e-105   Xenopus tropicalis [western clawed frog]
ref|XP_005310209.1|  PREDICTED: calcium-binding mitochondrial car...    344   3e-105   
ref|XP_007948134.1|  PREDICTED: calcium-binding mitochondrial car...    343   4e-105   
ref|XP_007423951.1|  PREDICTED: calcium-binding mitochondrial car...    344   4e-105   
ref|XP_010872642.1|  PREDICTED: calcium-binding mitochondrial car...    344   6e-105   
gb|KEQ89390.1|  mitochondrial carrier                                   344   6e-105   
ref|XP_006882527.1|  PREDICTED: calcium-binding mitochondrial car...    343   6e-105   
ref|XP_005076714.1|  PREDICTED: calcium-binding mitochondrial car...    343   7e-105   
ref|NP_001082444.1|  calcium-binding mitochondrial carrier protei...    343   7e-105   Xenopus laevis [clawed frog]
ref|XP_003421696.1|  PREDICTED: calcium-binding mitochondrial car...    343   9e-105   
ref|XP_002588184.1|  hypothetical protein BRAFLDRAFT_113822             343   1e-104   Branchiostoma floridae
gb|KFV78709.1|  Calcium-binding mitochondrial carrier protein SCa...    340   1e-104   
ref|XP_004378474.1|  PREDICTED: calcium-binding mitochondrial car...    342   1e-104   
ref|NP_001079858.1|  calcium-binding mitochondrial carrier protei...    342   1e-104   Xenopus laevis [clawed frog]
ref|XP_422180.4|  PREDICTED: calcium-binding mitochondrial carrie...    341   2e-104   Gallus gallus [bantam]
ref|XP_002733070.1|  PREDICTED: calcium-binding mitochondrial car...    342   2e-104   Saccoglossus kowalevskii
ref|XP_006814371.1|  PREDICTED: calcium-binding mitochondrial car...    342   2e-104   
ref|XP_010005087.1|  PREDICTED: calcium-binding mitochondrial car...    340   2e-104   
ref|XP_004714296.1|  PREDICTED: calcium-binding mitochondrial car...    342   2e-104   
ref|XP_010714181.1|  PREDICTED: calcium-binding mitochondrial car...    342   2e-104   
ref|XP_005923959.1|  PREDICTED: calcium-binding mitochondrial car...    342   3e-104   
ref|XP_007229593.1|  PREDICTED: calcium-binding mitochondrial car...    342   3e-104   
gb|AAH43993.1|  LOC398474 protein                                       343   3e-104   Xenopus laevis [clawed frog]
ref|XP_008332801.1|  PREDICTED: calcium-binding mitochondrial car...    342   3e-104   
ref|XP_008628690.1|  PREDICTED: calcium-binding mitochondrial car...    341   3e-104   
emb|CAF90629.1|  unnamed protein product                                342   3e-104   Tetraodon nigroviridis
ref|XP_004388109.1|  PREDICTED: calcium-binding mitochondrial car...    340   5e-104   
ref|XP_010407803.1|  PREDICTED: calcium-binding mitochondrial car...    340   5e-104   
ref|XP_008508979.1|  PREDICTED: calcium-binding mitochondrial car...    341   5e-104   
ref|XP_003965145.1|  PREDICTED: calcium-binding mitochondrial car...    342   5e-104   
ref|XP_010205326.1|  PREDICTED: calcium-binding mitochondrial car...    339   6e-104   
ref|XP_006170307.1|  PREDICTED: calcium-binding mitochondrial car...    346   6e-104   
ref|XP_009668135.1|  PREDICTED: calcium-binding mitochondrial car...    340   6e-104   
ref|XP_010147305.1|  PREDICTED: calcium-binding mitochondrial car...    338   7e-104   
gb|KFV92250.1|  Calcium-binding mitochondrial carrier protein SCa...    338   7e-104   
ref|XP_005737008.1|  PREDICTED: calcium-binding mitochondrial car...    340   7e-104   
gb|KFQ50595.1|  Calcium-binding mitochondrial carrier protein SCa...    338   8e-104   
gb|KEQ66613.1|  mitochondrial carrier                                   341   8e-104   
ref|XP_002761674.1|  PREDICTED: calcium-binding mitochondrial car...    340   8e-104   
ref|XP_007576953.1|  PREDICTED: calcium-binding mitochondrial car...    340   8e-104   
ref|XP_008280469.1|  PREDICTED: calcium-binding mitochondrial car...    340   9e-104   
ref|XP_009432750.1|  PREDICTED: calcium-binding mitochondrial car...    340   9e-104   
ref|XP_010736601.1|  PREDICTED: calcium-binding mitochondrial car...    340   9e-104   
ref|XP_003819385.1|  PREDICTED: calcium-binding mitochondrial car...    340   9e-104   
ref|XP_004388108.1|  PREDICTED: calcium-binding mitochondrial car...    340   1e-103   
ref|XP_010776298.1|  PREDICTED: calcium-binding mitochondrial car...    340   1e-103   
ref|XP_008985314.1|  PREDICTED: calcium-binding mitochondrial car...    342   1e-103   
gb|KFM10160.1|  Calcium-binding mitochondrial carrier protein SCa...    338   1e-103   
ref|XP_009281497.1|  PREDICTED: calcium-binding mitochondrial car...    338   1e-103   
ref|NP_077008.2|  calcium-binding mitochondrial carrier protein S...    340   1e-103   
gb|KFQ80479.1|  Calcium-binding mitochondrial carrier protein SCa...    338   1e-103   
ref|XP_004655065.1|  PREDICTED: calcium-binding mitochondrial car...    340   1e-103   
gb|KFQ13107.1|  Calcium-binding mitochondrial carrier protein SCa...    338   2e-103   
ref|XP_010365471.1|  PREDICTED: calcium-binding mitochondrial car...    339   2e-103   
ref|XP_009809002.1|  PREDICTED: calcium-binding mitochondrial car...    337   2e-103   
ref|XP_010013973.1|  PREDICTED: calcium-binding mitochondrial car...    337   2e-103   
ref|XP_010164949.1|  PREDICTED: calcium-binding mitochondrial car...    337   2e-103   
ref|XP_004059894.1|  PREDICTED: calcium-binding mitochondrial car...    339   2e-103   
ref|NP_001244844.1|  calcium-binding mitochondrial carrier protei...    339   2e-103   
gb|KFO56519.1|  Calcium-binding mitochondrial carrier protein SCa...    337   2e-103   
ref|XP_003458999.1|  PREDICTED: calcium-binding mitochondrial car...    339   2e-103   
gb|KFW67230.1|  Calcium-binding mitochondrial carrier protein SCa...    337   2e-103   
ref|XP_003438229.1|  PREDICTED: calcium-binding mitochondrial car...    339   2e-103   
ref|XP_006025721.1|  PREDICTED: calcium-binding mitochondrial car...    338   3e-103   
gb|KFP92547.1|  Calcium-binding mitochondrial carrier protein SCa...    337   3e-103   
ref|XP_009981294.1|  PREDICTED: calcium-binding mitochondrial car...    337   3e-103   
gb|KFO88882.1|  Calcium-binding mitochondrial carrier protein SCa...    337   3e-103   
gb|KGL93157.1|  Calcium-binding mitochondrial carrier protein SCa...    337   3e-103   
gb|KFQ87646.1|  Calcium-binding mitochondrial carrier protein SCa...    337   3e-103   
ref|XP_007948126.1|  PREDICTED: calcium-binding mitochondrial car...    339   3e-103   
ref|XP_005171964.1|  PREDICTED: calcium-binding mitochondrial car...    340   3e-103   
gb|KFQ02523.1|  Calcium-binding mitochondrial carrier protein SCa...    337   3e-103   
gb|KFP16197.1|  Calcium-binding mitochondrial carrier protein SCa...    337   3e-103   
ref|XP_009951895.1|  PREDICTED: calcium-binding mitochondrial car...    337   3e-103   
ref|XP_006882526.1|  PREDICTED: calcium-binding mitochondrial car...    339   3e-103   
ref|XP_007229594.1|  PREDICTED: calcium-binding mitochondrial car...    339   3e-103   
ref|XP_005499054.1|  PREDICTED: calcium-binding mitochondrial car...    337   3e-103   
ref|XP_004481286.1|  PREDICTED: calcium-binding mitochondrial car...    339   3e-103   
ref|XP_005423804.1|  PREDICTED: calcium-binding mitochondrial car...    339   3e-103   
ref|XP_010133042.1|  PREDICTED: calcium-binding mitochondrial car...    337   4e-103   
gb|KFQ59115.1|  Calcium-binding mitochondrial carrier protein SCa...    337   4e-103   
gb|KFQ39131.1|  Calcium-binding mitochondrial carrier protein SCa...    337   4e-103   
ref|XP_009961308.1|  PREDICTED: calcium-binding mitochondrial car...    337   4e-103   
gb|KFO12232.1|  Calcium-binding mitochondrial carrier protein SCa...    336   6e-103   
ref|XP_006982346.1|  PREDICTED: calcium-binding mitochondrial car...    338   6e-103   
ref|XP_003914810.1|  PREDICTED: calcium-binding mitochondrial car...    338   6e-103   
ref|XP_004277317.1|  PREDICTED: calcium-binding mitochondrial car...    338   6e-103   
ref|XP_003769760.1|  PREDICTED: calcium-binding mitochondrial car...    338   7e-103   
gb|EOA95020.1|  Calcium-binding mitochondrial carrier protein SCa...    336   7e-103   
gb|KFP35942.1|  Calcium-binding mitochondrial carrier protein SCa...    336   7e-103   
gb|KEQ72451.1|  mitochondrial carrier                                   338   7e-103   
ref|XP_003760690.1|  PREDICTED: calcium-binding mitochondrial car...    340   7e-103   
gb|KFW10052.1|  Calcium-binding mitochondrial carrier protein SCa...    336   7e-103   
ref|XP_005587762.1|  PREDICTED: calcium-binding mitochondrial car...    338   8e-103   
dbj|BAE41903.1|  unnamed protein product                                338   8e-103   
ref|XP_004329529.1|  PREDICTED: calcium-binding mitochondrial car...    338   8e-103   
ref|XP_010187810.1|  PREDICTED: calcium-binding mitochondrial car...    336   8e-103   
ref|XP_005587761.1|  PREDICTED: calcium-binding mitochondrial car...    338   9e-103   
ref|XP_006919642.1|  PREDICTED: calcium-binding mitochondrial car...    338   1e-102   
ref|XP_009875294.1|  PREDICTED: calcium-binding mitochondrial car...    336   1e-102   
ref|NP_766273.1|  calcium-binding mitochondrial carrier protein S...    337   1e-102   
ref|NP_080153.2|  calcium-binding mitochondrial carrier protein S...    337   1e-102   
ref|XP_010117712.1|  PREDICTED: calcium-binding mitochondrial car...    335   1e-102   
ref|XP_005542595.1|  PREDICTED: calcium-binding mitochondrial car...    337   1e-102   
ref|XP_004441303.1|  PREDICTED: calcium-binding mitochondrial car...    337   1e-102   
ref|XP_007229591.1|  PREDICTED: calcium-binding mitochondrial car...    338   1e-102   
ref|XP_007898469.1|  PREDICTED: calcium-binding mitochondrial car...    338   1e-102   
ref|XP_009915495.1|  PREDICTED: calcium-binding mitochondrial car...    337   1e-102   
ref|XP_008936640.1|  PREDICTED: calcium-binding mitochondrial car...    335   1e-102   
ref|XP_003892346.1|  PREDICTED: calcium-binding mitochondrial car...    337   1e-102   
gb|KFZ67894.1|  Calcium-binding mitochondrial carrier protein SCa...    335   1e-102   
ref|XP_007460633.1|  PREDICTED: calcium-binding mitochondrial car...    337   1e-102   
ref|XP_002131752.1|  PREDICTED: calcium-binding mitochondrial car...    337   2e-102   
ref|XP_009699441.1|  PREDICTED: calcium-binding mitochondrial car...    338   2e-102   
ref|XP_009322502.1|  PREDICTED: calcium-binding mitochondrial car...    337   2e-102   
ref|XP_006805080.1|  PREDICTED: calcium-binding mitochondrial car...    337   2e-102   
ref|XP_006149560.1|  PREDICTED: calcium-binding mitochondrial car...    336   2e-102   
gb|AAH55369.1|  Solute carrier family 25 (mitochondrial carrier, ...    337   2e-102   
ref|NP_001011052.1|  calcium-binding mitochondrial carrier protei...    338   2e-102   
ref|XP_010981654.1|  PREDICTED: calcium-binding mitochondrial car...    337   2e-102   
ref|XP_010743129.1|  PREDICTED: calcium-binding mitochondrial car...    337   2e-102   
emb|CEG67048.1|  hypothetical protein RMATCC62417_03526                 338   2e-102   
ref|XP_004562931.1|  PREDICTED: calcium-binding mitochondrial car...    337   2e-102   
ref|XP_005028604.1|  PREDICTED: calcium-binding mitochondrial car...    335   2e-102   
gb|KFQ27945.1|  Calcium-binding mitochondrial carrier protein SCa...    335   2e-102   
ref|XP_005237359.1|  PREDICTED: calcium-binding mitochondrial car...    338   3e-102   
ref|XP_006904205.1|  PREDICTED: calcium-binding mitochondrial car...    336   3e-102   
ref|XP_009637365.1|  PREDICTED: calcium-binding mitochondrial car...    335   3e-102   
ref|XP_005687233.1|  PREDICTED: calcium-binding mitochondrial car...    337   3e-102   
ref|XP_006979509.1|  PREDICTED: calcium-binding mitochondrial car...    336   3e-102   
dbj|BAE39810.1|  unnamed protein product                                336   3e-102   
ref|XP_005371175.1|  PREDICTED: calcium-binding mitochondrial car...    336   3e-102   
ref|XP_007528924.1|  PREDICTED: calcium-binding mitochondrial car...    337   3e-102   
ref|XP_010290967.1|  PREDICTED: calcium-binding mitochondrial car...    337   3e-102   
gb|EDL38228.1|  solute carrier family 25 (mitochondrial carrier; ...    337   3e-102   
ref|XP_005901808.1|  PREDICTED: calcium-binding mitochondrial car...    336   3e-102   
ref|NP_001004606.1|  calcium-binding mitochondrial carrier protei...    336   3e-102   
ref|XP_004512665.1|  PREDICTED: calcium-binding mitochondrial car...    328   4e-102   
ref|XP_005976818.1|  PREDICTED: calcium-binding mitochondrial car...    335   4e-102   
ref|XP_005976817.1|  PREDICTED: calcium-binding mitochondrial car...    336   4e-102   
ref|XP_003964423.1|  PREDICTED: calcium-binding mitochondrial car...    336   4e-102   
gb|KFR05875.1|  Calcium-binding mitochondrial carrier protein SCa...    334   4e-102   
gb|ELR52063.1|  Calcium-binding mitochondrial carrier protein SCa...    336   4e-102   
ref|XP_003798042.1|  PREDICTED: calcium-binding mitochondrial car...    336   4e-102   
ref|XP_007993181.1|  PREDICTED: calcium-binding mitochondrial car...    336   5e-102   
ref|XP_008835127.1|  PREDICTED: calcium-binding mitochondrial car...    335   5e-102   
ref|XP_006179989.1|  PREDICTED: calcium-binding mitochondrial car...    335   5e-102   
ref|XP_007993182.1|  PREDICTED: calcium-binding mitochondrial car...    335   5e-102   
ref|XP_004671679.1|  PREDICTED: calcium-binding mitochondrial car...    337   5e-102   
ref|XP_009929413.1|  PREDICTED: calcium-binding mitochondrial car...    333   5e-102   
ref|XP_010303574.1|  PREDICTED: calcium-binding mitochondrial car...    336   5e-102   
ref|XP_006868947.1|  PREDICTED: calcium-binding mitochondrial car...    335   6e-102   
ref|XP_004542599.1|  PREDICTED: calcium-binding mitochondrial car...    335   6e-102   
ref|XP_004699609.1|  PREDICTED: calcium-binding mitochondrial car...    335   6e-102   
ref|XP_006634939.1|  PREDICTED: calcium-binding mitochondrial car...    335   6e-102   
ref|XP_009476761.1|  PREDICTED: calcium-binding mitochondrial car...    335   7e-102   
ref|NP_001233175.1|  calcium-binding mitochondrial carrier protei...    335   7e-102   
ref|XP_001397133.2|  hypothetical protein ANI_1_814134                  336   7e-102   
ref|XP_006896421.1|  PREDICTED: calcium-binding mitochondrial car...    335   8e-102   
ref|XP_008291509.1|  PREDICTED: calcium-binding mitochondrial car...    336   8e-102   
ref|XP_006065469.1|  PREDICTED: calcium-binding mitochondrial car...    336   8e-102   
ref|XP_005213346.1|  PREDICTED: calcium-binding mitochondrial car...    336   8e-102   
ref|XP_004263158.1|  PREDICTED: calcium-binding mitochondrial car...    335   8e-102   
ref|XP_004002306.1|  PREDICTED: calcium-binding mitochondrial car...    335   8e-102   
ref|XP_007885489.1|  PREDICTED: calcium-binding mitochondrial car...    335   9e-102   
ref|XP_005920528.1|  PREDICTED: calcium-binding mitochondrial car...    335   9e-102   
ref|XP_003785387.1|  PREDICTED: calcium-binding mitochondrial car...    336   9e-102   
ref|XP_006205534.1|  PREDICTED: calcium-binding mitochondrial car...    336   9e-102   
ref|NP_001076246.1|  calcium-binding mitochondrial carrier protei...    335   1e-101   
ref|XP_005721255.1|  PREDICTED: calcium-binding mitochondrial car...    335   1e-101   
ref|XP_005321068.1|  PREDICTED: calcium-binding mitochondrial car...    336   1e-101   
ref|XP_007109423.1|  PREDICTED: calcium-binding mitochondrial car...    335   1e-101   
ref|XP_007952638.1|  PREDICTED: calcium-binding mitochondrial car...    335   1e-101   
ref|XP_009581801.1|  PREDICTED: calcium-binding mitochondrial car...    335   1e-101   
ref|XP_002751205.1|  PREDICTED: calcium-binding mitochondrial car...    335   1e-101   
ref|XP_003409580.1|  PREDICTED: calcium-binding mitochondrial car...    335   1e-101   
ref|XP_009883222.1|  PREDICTED: calcium-binding mitochondrial car...    335   1e-101   
ref|XP_005611836.1|  PREDICTED: calcium-binding mitochondrial car...    334   1e-101   
ref|XP_010886514.1|  PREDICTED: calcium-binding mitochondrial car...    335   1e-101   
ref|XP_005382442.1|  PREDICTED: calcium-binding mitochondrial car...    335   1e-101   
ref|XP_004423559.1|  PREDICTED: calcium-binding mitochondrial car...    335   1e-101   
ref|XP_006918067.1|  PREDICTED: calcium-binding mitochondrial car...    335   2e-101   
ref|XP_003639786.1|  PREDICTED: calcium-binding mitochondrial car...    334   2e-101   
ref|NP_001245014.1|  calcium-binding mitochondrial carrier protei...    335   2e-101   
ref|XP_862373.1|  PREDICTED: calcium-binding mitochondrial carrie...    335   2e-101   
ref|XP_004392595.1|  PREDICTED: calcium-binding mitochondrial car...    335   2e-101   
ref|XP_007229592.1|  PREDICTED: calcium-binding mitochondrial car...    335   2e-101   
ref|XP_005678069.1|  PREDICTED: calcium-binding mitochondrial car...    334   2e-101   
ref|NP_037518.3|  calcium-binding mitochondrial carrier protein S...    334   2e-101   
dbj|BAH14877.1|  unnamed protein product                                334   2e-101   
ref|XP_006749183.1|  PREDICTED: calcium-binding mitochondrial car...    334   2e-101   
ref|XP_006233994.1|  PREDICTED: calcium-binding mitochondrial car...    335   2e-101   
ref|XP_009859579.1|  PREDICTED: calcium-binding mitochondrial car...    339   2e-101   
ref|XP_004311306.1|  PREDICTED: calcium-binding mitochondrial car...    335   2e-101   
ref|XP_004269216.1|  PREDICTED: calcium-binding mitochondrial car...    335   2e-101   
ref|XP_010855171.1|  PREDICTED: calcium-binding mitochondrial car...    335   2e-101   
emb|CDQ79731.1|  unnamed protein product                                336   2e-101   
ref|NP_001157982.1|  calcium-binding mitochondrial carrier protei...    335   2e-101   
ref|XP_007612963.1|  PREDICTED: calcium-binding mitochondrial car...    334   2e-101   
emb|CDQ80277.1|  unnamed protein product                                334   2e-101   
ref|XP_004641586.1|  PREDICTED: calcium-binding mitochondrial car...    335   2e-101   
ref|XP_010974181.1|  PREDICTED: calcium-binding mitochondrial car...    334   2e-101   
ref|XP_004800118.1|  PREDICTED: calcium-binding mitochondrial car...    335   2e-101   
ref|XP_005633046.1|  PREDICTED: calcium-binding mitochondrial car...    335   3e-101   
ref|XP_690428.1|  PREDICTED: calcium-binding mitochondrial carrie...    334   3e-101   
ref|XP_008823518.1|  PREDICTED: calcium-binding mitochondrial car...    335   3e-101   
gb|EMF09222.1|  mitochondrial carrier                                   335   3e-101   
ref|XP_007194676.1|  PREDICTED: calcium-binding mitochondrial car...    335   3e-101   
ref|NP_998816.1|  calcium-binding mitochondrial carrier protein S...    333   3e-101   
ref|XP_003512626.1|  PREDICTED: calcium-binding mitochondrial car...    334   3e-101   
ref|XP_007471813.1|  PREDICTED: calcium-binding mitochondrial car...    335   3e-101   
ref|XP_005388884.1|  PREDICTED: calcium-binding mitochondrial car...    334   3e-101   
ref|XP_007942478.1|  PREDICTED: calcium-binding mitochondrial car...    335   3e-101   
ref|NP_001157829.1|  calcium-binding mitochondrial carrier protei...    335   3e-101   
ref|NP_001153492.1|  calcium-binding mitochondrial carrier protei...    333   3e-101   
ref|XP_006797433.1|  PREDICTED: calcium-binding mitochondrial car...    336   3e-101   
ref|XP_004572880.1|  PREDICTED: calcium-binding mitochondrial car...    336   3e-101   
gb|ETE71259.1|  Calcium-binding mitochondrial carrier protein SCa...    333   4e-101   
ref|XP_004453093.1|  PREDICTED: calcium-binding mitochondrial car...    334   4e-101   
ref|XP_004263157.1|  PREDICTED: calcium-binding mitochondrial car...    333   5e-101   
ref|XP_006136385.1|  PREDICTED: calcium-binding mitochondrial car...    334   5e-101   
ref|XP_005346114.1|  PREDICTED: calcium-binding mitochondrial car...    334   5e-101   
ref|XP_006197443.1|  PREDICTED: calcium-binding mitochondrial car...    332   5e-101   
ref|XP_001362852.1|  PREDICTED: calcium-binding mitochondrial car...    334   5e-101   
gb|ELR59586.1|  Calcium-binding mitochondrial carrier protein SCa...    333   5e-101   
gb|AAH68561.1|  Solute carrier family 25 (mitochondrial carrier; ...    333   5e-101   
ref|NP_001092536.1|  calcium-binding mitochondrial carrier protei...    333   6e-101   
ref|XP_004395339.1|  PREDICTED: calcium-binding mitochondrial car...    333   6e-101   
ref|XP_003407751.1|  PREDICTED: calcium-binding mitochondrial car...    334   6e-101   
ref|XP_003990438.1|  PREDICTED: calcium-binding mitochondrial car...    333   6e-101   
ref|XP_003385922.1|  PREDICTED: calcium-binding mitochondrial car...    333   6e-101   
ref|XP_010903205.1|  PREDICTED: calcium-binding mitochondrial car...    335   7e-101   
ref|XP_006045178.1|  PREDICTED: calcium-binding mitochondrial car...    332   7e-101   
ref|XP_010826532.1|  PREDICTED: calcium-binding mitochondrial car...    333   7e-101   
ref|XP_005293524.1|  PREDICTED: calcium-binding mitochondrial car...    333   7e-101   
ref|XP_006045192.1|  PREDICTED: calcium-binding mitochondrial car...    333   7e-101   
ref|XP_005891398.1|  PREDICTED: calcium-binding mitochondrial car...    332   8e-101   
ref|XP_008249236.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-bind...    333   8e-101   
ref|XP_004026281.1|  PREDICTED: calcium-binding mitochondrial car...    332   8e-101   
ref|XP_010750228.1|  PREDICTED: calcium-binding mitochondrial car...    333   8e-101   
gb|EPB83290.1|  hypothetical protein HMPREF1544_09936                   333   8e-101   
ref|XP_006102132.1|  PREDICTED: calcium-binding mitochondrial car...    333   9e-101   
ref|XP_006866045.1|  PREDICTED: calcium-binding mitochondrial car...    332   9e-101   
ref|XP_004593588.1|  PREDICTED: calcium-binding mitochondrial car...    333   9e-101   
ref|XP_514375.3|  PREDICTED: calcium-binding mitochondrial carrie...    332   9e-101   
gb|ELK05843.1|  Calcium-binding mitochondrial carrier protein SCa...    337   9e-101   
ref|XP_007975960.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-bind...    332   9e-101   
ref|XP_003933431.1|  PREDICTED: calcium-binding mitochondrial car...    332   1e-100   
ref|XP_010826530.1|  PREDICTED: calcium-binding mitochondrial car...    333   1e-100   
ref|XP_006045177.1|  PREDICTED: calcium-binding mitochondrial car...    333   1e-100   
ref|XP_008579444.1|  PREDICTED: calcium-binding mitochondrial car...    332   1e-100   
ref|XP_010965077.1|  PREDICTED: calcium-binding mitochondrial car...    337   1e-100   
ref|XP_007449404.1|  PREDICTED: calcium-binding mitochondrial car...    332   1e-100   
ref|XP_004375764.1|  PREDICTED: calcium-binding mitochondrial car...    333   1e-100   
ref|XP_004849336.1|  PREDICTED: calcium-binding mitochondrial car...    333   1e-100   
gb|EPB92030.1|  hypothetical protein HMPREF1544_01094                   333   1e-100   
ref|XP_010826531.1|  PREDICTED: calcium-binding mitochondrial car...    333   1e-100   



>emb|CDO98290.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/502 (85%), Positives = 457/502 (91%), Gaps = 0/502 (0%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSF  2009
             MSGAGEAVGHVNFPAM   D S CCNPV KPGPVSMDHVLAAL+ETKEERD RI+SLF+F
Sbjct  1     MSGAGEAVGHVNFPAMATNDPSGCCNPVKKPGPVSMDHVLAALRETKEERDSRIKSLFNF  60

Query  2008  FDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELE  1829
             FDS N GYLDY QIE+GLSA+QI A+YKFAKELL V DAN+DGRVDY EFRKYMDDKELE
Sbjct  61    FDSANVGYLDYTQIEKGLSALQIPAEYKFAKELLNVCDANRDGRVDYQEFRKYMDDKELE  120

Query  1828  LYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDF  1649
             LYRIFQAIDVEH+G ILPEELWDALV+AGIE+DDDELARFVEHVDKDN+G+ITFEEWRDF
Sbjct  121   LYRIFQAIDVEHNGCILPEELWDALVQAGIEMDDDELARFVEHVDKDNNGIITFEEWRDF  180

Query  1648  LLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATA  1469
             LLLYPHEATIENIY Y ERV LVDIGEQAVIPEGISKHVHA+KYLIAGGVAGAASRTATA
Sbjct  181   LLLYPHEATIENIYHYWERVYLVDIGEQAVIPEGISKHVHATKYLIAGGVAGAASRTATA  240

Query  1468  PLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLK  1289
             PLDRLKVVLQVQT+RASI PAVKSIWKEGG+ GFFRGNGINV KVAPESAIKFYTYEMLK
Sbjct  241   PLDRLKVVLQVQTSRASIAPAVKSIWKEGGLFGFFRGNGINVFKVAPESAIKFYTYEMLK  300

Query  1288  NAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLS  1109
             N IG  K D  DIGTSGRL+AGGLAGAVAQTAIYPMDLVKTRLQTY CE GKVP+LG+LS
Sbjct  301   NVIGGNKEDHRDIGTSGRLVAGGLAGAVAQTAIYPMDLVKTRLQTYACESGKVPNLGKLS  360

Query  1108  KDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSG  929
             KDI ++EGPRAFYRG+VPSLLGIIPYAGIDLA Y+ LK  ++TYIL DSEPGP VQLG G
Sbjct  361   KDILVQEGPRAFYRGLVPSLLGIIPYAGIDLAAYETLKEMSKTYILHDSEPGPFVQLGCG  420

Query  928   TISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLL  749
             TISGALGATCVYPLQVVRTRMQAQ  ++  AYKGM DVF RT +HEG RGFYKGLFPNLL
Sbjct  421   TISGALGATCVYPLQVVRTRMQAQRYNSDAAYKGMSDVFRRTIKHEGFRGFYKGLFPNLL  480

Query  748   KVVPAASITYLVYESMKKTLDL  683
             KVVPAASITYLVYE+MKK+LDL
Sbjct  481   KVVPAASITYLVYETMKKSLDL  502



>ref|XP_009604830.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like 
[Nicotiana tomentosiformis]
Length=489

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/489 (86%), Positives = 453/489 (93%), Gaps = 1/489 (0%)
 Frame = -1

Query  2143  MTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIE  1964
             M  KDR  CCNPV KPGPVSMDHVL+AL+ETKEERDIRIRSLFSFFDSDNAGYLDY +IE
Sbjct  1     MATKDRPGCCNPVKKPGPVSMDHVLSALRETKEERDIRIRSLFSFFDSDNAGYLDYTKIE  60

Query  1963  RGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGG  1784
             +GL AMQI ADYKFAKELL V D +KDGRVDY EF+KYMDDKELELYRIFQAIDVEH+G 
Sbjct  61    KGLFAMQIPADYKFAKELLTVCDKDKDGRVDYQEFKKYMDDKELELYRIFQAIDVEHNGC  120

Query  1783  ILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYR  1604
             ILPEELWDALVKAGIEIDDDELARFVEHVDKDN+G+ITFEEWR+FLLLYPHEAT+ENIYR
Sbjct  121   ILPEELWDALVKAGIEIDDDELARFVEHVDKDNNGIITFEEWRNFLLLYPHEATMENIYR  180

Query  1603  YLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTR  1424
             Y ERVCLVDIGEQAVIPEGISKHVHA+KYLIAGGVAGAASRTATAPLDRLKVVLQVQTTR
Sbjct  181   YWERVCLVDIGEQAVIPEGISKHVHAAKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTR  240

Query  1423  ASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE-GDIG  1247
             ASI PAVK+IWKEGG+  FFRGNG+NV+KVAPESAIKFYTYEMLKN I   KG+E GDIG
Sbjct  241   ASIGPAVKNIWKEGGLLSFFRGNGLNVMKVAPESAIKFYTYEMLKNVIARTKGEEQGDIG  300

Query  1246  TSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYR  1067
              SGRL+AGGLAGAVAQTAIYPMDLVKTRLQT++CEGGKVP+LG+LSKDIW++EG RAFYR
Sbjct  301   ASGRLVAGGLAGAVAQTAIYPMDLVKTRLQTHSCEGGKVPNLGKLSKDIWVKEGSRAFYR  360

Query  1066  GIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPL  887
             G++PSLLGIIPYAGIDLA Y+ LK+ ++ YIL DSEPGPLVQLG GTISGALGATCVYPL
Sbjct  361   GLIPSLLGIIPYAGIDLAAYETLKDLSKIYILHDSEPGPLVQLGCGTISGALGATCVYPL  420

Query  886   QVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYE  707
             QVVRTRMQAQPT+   AYKGM DVF RT +HEGLRGFYKGLFPNLLKVVPAASITYLVYE
Sbjct  421   QVVRTRMQAQPTNADAAYKGMSDVFRRTLQHEGLRGFYKGLFPNLLKVVPAASITYLVYE  480

Query  706   SMKKTLDLD  680
             SMKK+L+LD
Sbjct  481   SMKKSLELD  489



>ref|XP_009778498.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like 
[Nicotiana sylvestris]
Length=489

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/489 (85%), Positives = 448/489 (92%), Gaps = 1/489 (0%)
 Frame = -1

Query  2143  MTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIE  1964
             M  KDR  CCNPV KPGPVSMDHVL+AL+ET EERDIRIRSLF FFDSDNAGYLDY +I+
Sbjct  1     MATKDRPGCCNPVKKPGPVSMDHVLSALRETNEERDIRIRSLFGFFDSDNAGYLDYTKID  60

Query  1963  RGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGG  1784
             +GL AMQI ADYKFAKELLRV D +KDGRV Y EFRKYMDDKELELYRIFQAIDVEHSG 
Sbjct  61    KGLFAMQIPADYKFAKELLRVCDKDKDGRVGYQEFRKYMDDKELELYRIFQAIDVEHSGC  120

Query  1783  ILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYR  1604
             ILPEELWDALVKAGIEIDDDELARFVEHVDKDN+G+ITFEEWR+FLLLYPHE T+ENIYR
Sbjct  121   ILPEELWDALVKAGIEIDDDELARFVEHVDKDNNGIITFEEWRNFLLLYPHEVTMENIYR  180

Query  1603  YLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTR  1424
             Y ERVCLVDIGEQAVIPEGISKHVHA+KYLIAGGVAGAASRTATAPLDRLKVVLQVQTTR
Sbjct  181   YWERVCLVDIGEQAVIPEGISKHVHAAKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTR  240

Query  1423  ASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE-GDIG  1247
             ASI PAVK+IWKEGG+  FFRGNG+NV+KVAPESAIKFYTYEMLKN I   KG+E GDIG
Sbjct  241   ASIGPAVKNIWKEGGLLSFFRGNGLNVMKVAPESAIKFYTYEMLKNVIASTKGEEQGDIG  300

Query  1246  TSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYR  1067
              SGRL+AGGLAGAVAQTAIYPMDLVKTRLQT+ CEGGKVP+LG+LSKDIW++EG RAFYR
Sbjct  301   ASGRLVAGGLAGAVAQTAIYPMDLVKTRLQTHACEGGKVPNLGKLSKDIWVKEGSRAFYR  360

Query  1066  GIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPL  887
             G++PSLLGIIPYAGIDLA Y+ LK+ ++ YIL DSEPGPLVQLG GTISGALGATCVYPL
Sbjct  361   GLIPSLLGIIPYAGIDLAAYETLKDLSKIYILHDSEPGPLVQLGCGTISGALGATCVYPL  420

Query  886   QVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYE  707
             QVVRTRMQAQPT+   AYKGM DVF RT +HEG RGFYKGLFPNLLKVVPAASITYLVYE
Sbjct  421   QVVRTRMQAQPTNADAAYKGMSDVFRRTLQHEGFRGFYKGLFPNLLKVVPAASITYLVYE  480

Query  706   SMKKTLDLD  680
             SMKK+L+LD
Sbjct  481   SMKKSLELD  489



>ref|XP_009762426.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-B-like 
[Nicotiana sylvestris]
Length=500

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/505 (84%), Positives = 457/505 (90%), Gaps = 7/505 (1%)
 Frame = -1

Query  2188  MSGAGEA-VGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFS  2012
             MS AG+A V HVNFP M  KDR  CCNPV K GPVSMDHVL+AL ETKEER+ RIRSLFS
Sbjct  1     MSVAGKAAVEHVNFPGMGTKDRPGCCNPVKKSGPVSMDHVLSALGETKEERESRIRSLFS  60

Query  2011  FFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKEL  1832
             FFDSDNAGYLDY +IE+GLSAMQI A+YKFAKELL+  DANKDGRVDY EFRKYMDDKE+
Sbjct  61    FFDSDNAGYLDYVKIEKGLSAMQIPAEYKFAKELLKACDANKDGRVDYQEFRKYMDDKEM  120

Query  1831  ELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRD  1652
             ELY IFQAIDVEH+G ILPEELWDALVKAGIE+DDDELARFVEHVDKDN+G+ITFEEWRD
Sbjct  121   ELYGIFQAIDVEHNGCILPEELWDALVKAGIELDDDELARFVEHVDKDNNGIITFEEWRD  180

Query  1651  FLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTAT  1472
             FLLLYPHEATIENIY+YLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTAT
Sbjct  181   FLLLYPHEATIENIYQYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTAT  240

Query  1471  APLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEML  1292
             APLDRLKV+LQVQTTRASI PAVKSIWKEG + GFFRGNG+NV+KVAPESAIKFY YE L
Sbjct  241   APLDRLKVILQVQTTRASIGPAVKSIWKEGRLLGFFRGNGLNVMKVAPESAIKFYAYETL  300

Query  1291  KNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGR  1115
             KN IGHAKG D+ DIGTSGRL+AGG+AGAVAQTAIYPMDLVKTRLQT+ CEGGKVP+L +
Sbjct  301   KNVIGHAKGQDQRDIGTSGRLVAGGMAGAVAQTAIYPMDLVKTRLQTHACEGGKVPNLRK  360

Query  1114  LSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLG  935
             LSKDIW++EGPRAFYRG+VPSLLGIIPYAGIDLA Y+ LK+ ++ YIL DSE GPLVQLG
Sbjct  361   LSKDIWVQEGPRAFYRGLVPSLLGIIPYAGIDLAAYETLKDLSKIYILHDSEAGPLVQLG  420

Query  934   SGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPN  755
              GTISGALGATCVYPLQVVRTRMQA       AY+GM DVF +T + EG RGFYKGLFPN
Sbjct  421   CGTISGALGATCVYPLQVVRTRMQA-----DAAYEGMSDVFRKTLQREGFRGFYKGLFPN  475

Query  754   LLKVVPAASITYLVYESMKKTLDLD  680
             LLKVVPAASITYLVYESMKK+LDLD
Sbjct  476   LLKVVPAASITYLVYESMKKSLDLD  500



>ref|XP_004241649.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-B-like 
isoform X1 [Solanum lycopersicum]
Length=500

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/505 (83%), Positives = 456/505 (90%), Gaps = 7/505 (1%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSF  2009
             MS AGEAV HVNFPAM  KDRS CCNPV K GPVS+DHVL+AL ETKEER+ RIRSLFSF
Sbjct  1     MSVAGEAVEHVNFPAMATKDRSGCCNPVKKAGPVSLDHVLSALGETKEERESRIRSLFSF  60

Query  2008  FDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELE  1829
             FDSDNAGYLDYA+IE+GLSAMQI A+YKFAKELL   DANKDGRVDY EFRKYMDDKE+E
Sbjct  61    FDSDNAGYLDYAKIEKGLSAMQIPAEYKFAKELLNGCDANKDGRVDYQEFRKYMDDKEME  120

Query  1828  LYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDF  1649
             LYRIFQ IDVEHSG ILPEELWDALV AGIE+DDDELARFVEHVDKDN+G+ITFEEWRDF
Sbjct  121   LYRIFQDIDVEHSGCILPEELWDALVNAGIELDDDELARFVEHVDKDNNGIITFEEWRDF  180

Query  1648  LLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATA  1469
             LLLYPHEATIENIY+YLERVCLVDIGEQ VIPEGISKHVHASKYLIAGGVAGAASRTATA
Sbjct  181   LLLYPHEATIENIYQYLERVCLVDIGEQTVIPEGISKHVHASKYLIAGGVAGAASRTATA  240

Query  1468  PLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLK  1289
             PLDR+KV+LQVQTT ASI PAVKSIWKEGG+ GFFRGNG+NVLKVAPESAIKFY YE LK
Sbjct  241   PLDRVKVILQVQTTHASIGPAVKSIWKEGGLLGFFRGNGLNVLKVAPESAIKFYAYETLK  300

Query  1288  NAIGHAKG--DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGR  1115
             NAIG A+G  D+ DIGTSGRL+AGG+AGA+AQTAIYPMDLVKTRLQT++CE G VP L +
Sbjct  301   NAIGRARGVEDQRDIGTSGRLVAGGMAGAIAQTAIYPMDLVKTRLQTHSCESGSVPSLRK  360

Query  1114  LSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLG  935
             LSKDI+++EGPRAFYRG+VPSLLGIIPYAGIDLA Y+ LK+ ++ YIL DSE GPLVQLG
Sbjct  361   LSKDIFIQEGPRAFYRGLVPSLLGIIPYAGIDLAAYETLKDLSKVYILHDSEAGPLVQLG  420

Query  934   SGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPN  755
              GTISGALGATCVYPLQV+RTRMQA      +AY+GM DVF +T + EG RGFYKGLFPN
Sbjct  421   CGTISGALGATCVYPLQVIRTRMQA-----DSAYQGMADVFRKTVQREGFRGFYKGLFPN  475

Query  754   LLKVVPAASITYLVYESMKKTLDLD  680
             LLKVVPAASITYLVYESMKK+LDLD
Sbjct  476   LLKVVPAASITYLVYESMKKSLDLD  500



>ref|XP_009619643.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-B-like 
isoform X1 [Nicotiana tomentosiformis]
Length=500

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/505 (83%), Positives = 456/505 (90%), Gaps = 7/505 (1%)
 Frame = -1

Query  2188  MSGAGEA-VGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFS  2012
             MS AG+A V HVNFP M  KDR  CCNPV  PGPVSMDHVL+AL ETKEER+ RIRSLFS
Sbjct  1     MSVAGKAAVEHVNFPGMGTKDRPGCCNPVKNPGPVSMDHVLSALGETKEERESRIRSLFS  60

Query  2011  FFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKEL  1832
             FFDSDNAGYLDY +IE+GLSAMQI A+YKFAKELL+  DANKDGRVDY EFRKYMDDKE+
Sbjct  61    FFDSDNAGYLDYVKIEKGLSAMQIPAEYKFAKELLKACDANKDGRVDYQEFRKYMDDKEM  120

Query  1831  ELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRD  1652
             ELY IF+AIDVEH+G ILPEELWDALVKAGIE+DDDELARFVEHVDKDN+G+ITFEEWRD
Sbjct  121   ELYGIFEAIDVEHNGCILPEELWDALVKAGIELDDDELARFVEHVDKDNNGIITFEEWRD  180

Query  1651  FLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTAT  1472
             FLLLYPHEATIENIY+YLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTAT
Sbjct  181   FLLLYPHEATIENIYQYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTAT  240

Query  1471  APLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEML  1292
             APLDRLKV+LQVQTTRASI PAVKSIWKEG + GFFRGNG+NV+KVAPESAIKFY YE L
Sbjct  241   APLDRLKVILQVQTTRASIGPAVKSIWKEGRLLGFFRGNGLNVMKVAPESAIKFYAYETL  300

Query  1291  KNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGR  1115
             KN IG AKG D+ DIGTSGRL+AGG+AGAVAQTAIYPMDLVKTRLQT+ CEGGKVP+L +
Sbjct  301   KNVIGRAKGQDQRDIGTSGRLVAGGMAGAVAQTAIYPMDLVKTRLQTHACEGGKVPNLRK  360

Query  1114  LSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLG  935
             LSKDIW++EGPRAFYRG+VPSLLGIIPYAGIDLA Y+ LK+ ++ YIL DSE GPLVQLG
Sbjct  361   LSKDIWVQEGPRAFYRGLVPSLLGIIPYAGIDLAAYETLKDLSKIYILHDSEAGPLVQLG  420

Query  934   SGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPN  755
              GTISGALGATCVYPLQVVRTRMQA       AY+GM DVF +T + EG RGFYKGLFPN
Sbjct  421   CGTISGALGATCVYPLQVVRTRMQA-----DAAYEGMSDVFRKTLQREGFRGFYKGLFPN  475

Query  754   LLKVVPAASITYLVYESMKKTLDLD  680
             LLKVVPAASITYLVYESMKK+LDLD
Sbjct  476   LLKVVPAASITYLVYESMKKSLDLD  500



>ref|XP_010249328.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Nelumbo nucifera]
Length=510

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/510 (80%), Positives = 457/510 (90%), Gaps = 7/510 (1%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAKDRSE------CCNPVMKPGPVSMDHVLAALQETKEERDIRI  2027
             MSGAG+AV HV+F  M  K  SE      CCNPV   GPVSMDHVL AL+ETKEER++RI
Sbjct  1     MSGAGQAVKHVDFSKMETKKTSEDERRSGCCNPVKTSGPVSMDHVLLALRETKEERELRI  60

Query  2026  RSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYM  1847
             RSLF+FFD  + G+LDYAQIE GLSA+QI A+YK+AK+LL+V DAN+DGRVDY EFR+YM
Sbjct  61    RSLFNFFDVADVGFLDYAQIEAGLSALQIPAEYKYAKDLLKVCDANRDGRVDYQEFRRYM  120

Query  1846  DDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITF  1667
             DDKELELYRIFQAIDVEH+G ILPEELWDALV+AGIEIDD+ELARFVEHVDKDN+GVITF
Sbjct  121   DDKELELYRIFQAIDVEHNGCILPEELWDALVRAGIEIDDEELARFVEHVDKDNNGVITF  180

Query  1666  EEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAA  1487
             EEWRDFLLLYPHEATIENIY YLERVCLVDIGEQAVIPEGISKHVHAS+YLIAGGVAGA 
Sbjct  181   EEWRDFLLLYPHEATIENIYHYLERVCLVDIGEQAVIPEGISKHVHASRYLIAGGVAGAT  240

Query  1486  SRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFY  1307
             SRT TAPLDRLKVVLQVQTTRA IMP++K IW+EGG  GFFRGNG+NVLKV PESAI+FY
Sbjct  241   SRTVTAPLDRLKVVLQVQTTRACIMPSIKDIWREGGFLGFFRGNGLNVLKVTPESAIRFY  300

Query  1306  TYEMLKNAIGHAKGDEGD-IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKV  1130
             TYEMLKN I +AKG+E D IGTSG L+AGG+AGAVAQTAIYPMDLVKTRLQTY CEGGKV
Sbjct  301   TYEMLKNLIVNAKGEEKDGIGTSGCLVAGGIAGAVAQTAIYPMDLVKTRLQTYACEGGKV  360

Query  1129  PHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGP  950
             P L  L+KDIW++EGPRAFYRG+VPSLLGIIPYAGIDLA Y+ LK+ ++ YIL DSEPGP
Sbjct  361   PKLRALTKDIWIQEGPRAFYRGVVPSLLGIIPYAGIDLAAYETLKDMSKIYILHDSEPGP  420

Query  949   LVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYK  770
             LVQLG GTISGALGATCVYPLQV+RTRMQAQ ++T+ +YKGM DVF RTF+HEG RGFYK
Sbjct  421   LVQLGCGTISGALGATCVYPLQVIRTRMQAQRSNTAASYKGMSDVFWRTFKHEGFRGFYK  480

Query  769   GLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             G+FPNLLKVVP+ASITYLVYE+MKK+LDL+
Sbjct  481   GIFPNLLKVVPSASITYLVYETMKKSLDLE  510



>ref|XP_010249330.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Nelumbo nucifera]
 ref|XP_010249331.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Nelumbo nucifera]
 ref|XP_010249332.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Nelumbo nucifera]
Length=509

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/510 (80%), Positives = 456/510 (89%), Gaps = 8/510 (2%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAKDRSE------CCNPVMKPGPVSMDHVLAALQETKEERDIRI  2027
             MSGAG+AV HV+F  M  K  SE      CCNPV   GPVSMDHVL AL+ETKEER++RI
Sbjct  1     MSGAGQAVKHVDFSKMETKKTSEDEQRSGCCNPVKTSGPVSMDHVLLALRETKEERELRI  60

Query  2026  RSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYM  1847
             RSLF+FFD+ N GYLDYAQIE GLSA+QI A+YK+ K+LL+V DAN+DGRVDY EFR+YM
Sbjct  61    RSLFNFFDAANVGYLDYAQIEAGLSALQIPAEYKYGKDLLKVCDANRDGRVDYQEFRRYM  120

Query  1846  DDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITF  1667
             DDKELELYRIFQAIDVEH+G ILPEELWDALV+AGIEIDD+ELARFVEHVDKDN+G+ITF
Sbjct  121   DDKELELYRIFQAIDVEHNGCILPEELWDALVRAGIEIDDEELARFVEHVDKDNNGIITF  180

Query  1666  EEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAA  1487
             EEWRDFLLLYPHEATIENIY YLERVCLVDIGEQA IPEGISKHVHASKYLIAGGVAGA 
Sbjct  181   EEWRDFLLLYPHEATIENIYHYLERVCLVDIGEQAAIPEGISKHVHASKYLIAGGVAGAT  240

Query  1486  SRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFY  1307
             SRTATAPLDRLKVVLQVQT    +MPA+K IW+EGG  GFFRGNG+NVLKVAPESAI+FY
Sbjct  241   SRTATAPLDRLKVVLQVQTKCTRLMPAIKDIWREGGFLGFFRGNGLNVLKVAPESAIRFY  300

Query  1306  TYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKV  1130
             TYEMLKN I +AKG D+GDIGTSGRL+AGG+AGAVAQTAIYPMDLVKTRLQTY CEGGKV
Sbjct  301   TYEMLKNLIVNAKGEDKGDIGTSGRLVAGGIAGAVAQTAIYPMDLVKTRLQTYACEGGKV  360

Query  1129  PHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGP  950
             P L  L+KDIW++EGPRAFYRG+VPSLLGIIPYAGIDLA Y+ LK+ +RTY+L D+EPGP
Sbjct  361   PKLRALTKDIWIQEGPRAFYRGVVPSLLGIIPYAGIDLAAYETLKDMSRTYVLHDNEPGP  420

Query  949   LVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYK  770
             LVQLG GTISGALGATCVYPLQV+RTRMQAQ  + + AYKGM DVF RTF+HEG RGFYK
Sbjct  421   LVQLGCGTISGALGATCVYPLQVIRTRMQAQ-RYATAAYKGMSDVFWRTFKHEGFRGFYK  479

Query  769   GLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             G+FPNLLKVVP+ASITYLVYE+MKK+LDL+
Sbjct  480   GIFPNLLKVVPSASITYLVYETMKKSLDLE  509



>gb|KHG21595.1| Calcium-binding mitochondrial carrier SCaMC-1 [Gossypium arboreum]
Length=505

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/505 (80%), Positives = 456/505 (90%), Gaps = 2/505 (0%)
 Frame = -1

Query  2188  MSGA-GEAVGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFS  2012
             MSGA G+ V HV  P M AK +  CCNPV KPGPVSMDHVL ALQETKEERD+RIRSLF+
Sbjct  1     MSGAAGQGVEHVGLPKMEAKSKPGCCNPVKKPGPVSMDHVLLALQETKEERDLRIRSLFN  60

Query  2011  FFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKEL  1832
             FFD+ N G+LDYAQIE+GLSA+QI A+YK+A +LLRV DAN+DGRVDY EF++YMDDKEL
Sbjct  61    FFDAANVGFLDYAQIEKGLSALQIPAEYKYANDLLRVCDANRDGRVDYQEFKRYMDDKEL  120

Query  1831  ELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRD  1652
             ELYRIFQAIDVEH+G ILPEELWDALVKAGI+IDD+ELARFVEHVDKDN+G+ITFEEWRD
Sbjct  121   ELYRIFQAIDVEHNGCILPEELWDALVKAGIQIDDEELARFVEHVDKDNNGIITFEEWRD  180

Query  1651  FLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTAT  1472
             FLLLYPHEATIENIY + ERVCLVDIGE AVIP+GISKHV  SKY IAGG+AGAASRTAT
Sbjct  181   FLLLYPHEATIENIYHHWERVCLVDIGEHAVIPQGISKHVKRSKYFIAGGIAGAASRTAT  240

Query  1471  APLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEML  1292
             APLDRLKVVLQVQ TRASI+PAVK IWKE G+ GFFRGNG+NV+KVAPESAIKFY YEML
Sbjct  241   APLDRLKVVLQVQITRASILPAVKKIWKEDGVLGFFRGNGLNVVKVAPESAIKFYAYEML  300

Query  1291  KNAIGHAKGDE-GDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGR  1115
             KN IG + G++ GDIG SGRLIAGG+AGAVAQ+AIYPMDLVKTRLQT   EGG+ P+LG+
Sbjct  301   KNVIGDSMGNKNGDIGASGRLIAGGVAGAVAQSAIYPMDLVKTRLQTCASEGGRAPNLGK  360

Query  1114  LSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLG  935
             L+KDIW++EGPRAFY+G+VPSLLGIIPYAGIDLAVY+ LK+ +RTYILQDSEPGPLVQLG
Sbjct  361   LTKDIWVQEGPRAFYKGLVPSLLGIIPYAGIDLAVYETLKDLSRTYILQDSEPGPLVQLG  420

Query  934   SGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPN  755
              GTISGALGATCVYPLQV+RTR+QAQ T +  AYKGM DVF RTFR+EG RGFYKGLFPN
Sbjct  421   CGTISGALGATCVYPLQVIRTRLQAQRTTSEAAYKGMSDVFWRTFRNEGCRGFYKGLFPN  480

Query  754   LLKVVPAASITYLVYESMKKTLDLD  680
             LLKVVPAASITYLVYE+MKK+L+L+
Sbjct  481   LLKVVPAASITYLVYEAMKKSLELE  505



>ref|XP_006341461.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006341462.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006341463.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X3 [Solanum tuberosum]
Length=502

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/503 (80%), Positives = 448/503 (89%), Gaps = 3/503 (1%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSF  2009
             MSGA     HVN P M AKDRS CCNPV KPGPVS+DHVL+AL+ETKEERD+RIR LFSF
Sbjct  1     MSGA--VAEHVNHPVMAAKDRSGCCNPVKKPGPVSVDHVLSALRETKEERDLRIRGLFSF  58

Query  2008  FDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELE  1829
             FDSDN GYLD  +IE+GL AMQI ADYKFA+ELL   D NKDGRVDYPEFRKYMDDKELE
Sbjct  59    FDSDNVGYLDSVKIEKGLFAMQIPADYKFARELLTECDKNKDGRVDYPEFRKYMDDKELE  118

Query  1828  LYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDF  1649
             LYRIFQAIDVEH+G ILPEELWDALVKAGI+IDD+ELARFVEHVDKDN+G+ITFEEWR+F
Sbjct  119   LYRIFQAIDVEHNGCILPEELWDALVKAGIQIDDEELARFVEHVDKDNNGIITFEEWRNF  178

Query  1648  LLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATA  1469
             LLLYPHEAT+ENIYRY ERVCLVDIGEQAVIPEGI+KHVH +KY +AGGVAGA SRTATA
Sbjct  179   LLLYPHEATLENIYRYWERVCLVDIGEQAVIPEGINKHVHTAKYFLAGGVAGATSRTATA  238

Query  1468  PLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLK  1289
             PLDRLKVVLQVQT R+SI   V+ IWK+GG+  FFRGNG+NV+KVAPESAI+FY YE+LK
Sbjct  239   PLDRLKVVLQVQTNRSSIGSTVREIWKDGGVLSFFRGNGLNVMKVAPESAIRFYAYEILK  298

Query  1288  NAIGHAKGDE-GDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRL  1112
             N I H KG+E GDIG SGR +AGG+AGAVAQTAIYPMDLVKTRLQT+  EGGKVP+LG+L
Sbjct  299   NVIAHTKGEEQGDIGASGRFVAGGMAGAVAQTAIYPMDLVKTRLQTHASEGGKVPNLGKL  358

Query  1111  SKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGS  932
             SKDIW++EGPRAFY+G++PSLLGIIPY+GIDLAVY+ LK+ +R YILQD EPG LVQLG 
Sbjct  359   SKDIWIQEGPRAFYKGLIPSLLGIIPYSGIDLAVYETLKDLSRIYILQDREPGALVQLGC  418

Query  931   GTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNL  752
             GTISGALGATCVYPLQV+RTRMQAQPT+T  AY GM DVF RT +HEG RGFYKGLFPNL
Sbjct  419   GTISGALGATCVYPLQVIRTRMQAQPTNTEAAYNGMSDVFRRTLQHEGPRGFYKGLFPNL  478

Query  751   LKVVPAASITYLVYESMKKTLDL  683
             LKVVPAASITY+VYE MKK+LD+
Sbjct  479   LKVVPAASITYIVYEYMKKSLDI  501



>ref|XP_007038176.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma 
cacao]
 gb|EOY22677.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma 
cacao]
Length=504

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/504 (79%), Positives = 451/504 (89%), Gaps = 1/504 (0%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSF  2009
             MSGA   V HV  P M AK +  CCNPV KPGPVSMDHVL AL+ETKEERD+RIRSLF+F
Sbjct  1     MSGAAGPVEHVGLPKMEAKSKPGCCNPVKKPGPVSMDHVLLALRETKEERDLRIRSLFNF  60

Query  2008  FDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELE  1829
             FD+ N G+LDYAQIE+GLSA+QI A+YK+AK+LL+V DAN+DGRVDY EF++YMDDKELE
Sbjct  61    FDAANVGFLDYAQIEKGLSALQIPAEYKYAKDLLKVCDANRDGRVDYHEFKRYMDDKELE  120

Query  1828  LYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDF  1649
             LYRIFQAIDVEH+G ILPEELWDALVKAGIEIDD+ELARFVEHVDKDN+G+ITFEEWRDF
Sbjct  121   LYRIFQAIDVEHNGCILPEELWDALVKAGIEIDDEELARFVEHVDKDNNGIITFEEWRDF  180

Query  1648  LLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATA  1469
             LLLYPHEATIENIY + ERVCLVDIGEQAVIPEGISKHV  SKY IAGG+AGAASRTATA
Sbjct  181   LLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVKRSKYFIAGGIAGAASRTATA  240

Query  1468  PLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLK  1289
             PLDRLKVVLQVQTTRA I+PAVK IWK+ G+ GFFRGNG+NV+KVAPESAIKFY YEMLK
Sbjct  241   PLDRLKVVLQVQTTRACILPAVKKIWKQDGLLGFFRGNGLNVVKVAPESAIKFYAYEMLK  300

Query  1288  NAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRL  1112
             N +G + G  +GDIG SGRLIAGG+AGAVAQ+AIYPMDLVKTRLQT   EGG+ P LG+L
Sbjct  301   NVMGDSMGYKKGDIGASGRLIAGGVAGAVAQSAIYPMDLVKTRLQTCASEGGRAPKLGKL  360

Query  1111  SKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGS  932
             ++DIW++EGPRAFY+G+VPSLLGIIPYAGIDLA Y+ LK+F+RTYILQD +PGPLVQLG 
Sbjct  361   TRDIWVQEGPRAFYKGLVPSLLGIIPYAGIDLAAYETLKDFSRTYILQDGDPGPLVQLGC  420

Query  931   GTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNL  752
             GT+SGALGATCVYPLQV+RTR+QAQ   ++ AYKGM DVF RT ++EG RGFYKGL PNL
Sbjct  421   GTVSGALGATCVYPLQVIRTRLQAQHATSAAAYKGMSDVFWRTLQNEGYRGFYKGLVPNL  480

Query  751   LKVVPAASITYLVYESMKKTLDLD  680
             LKVVPAASITYLVYE+MKK+LDLD
Sbjct  481   LKVVPAASITYLVYEAMKKSLDLD  504



>ref|XP_010907271.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Elaeis guineensis]
Length=513

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/513 (79%), Positives = 459/513 (89%), Gaps = 10/513 (2%)
 Frame = -1

Query  2188  MSGAGEAV--GHVNFPA-MTAKDRSE------CCNPVMKPGPVSMDHVLAALQETKEERD  2036
             MSGAG+A    HV FPA M A+D  +       CNPV KPGPVSMDHVL AL+ETKEER+
Sbjct  1     MSGAGQAAVEQHVGFPAKMAAEDEQQQRRSVGGCNPVRKPGPVSMDHVLLALRETKEERE  60

Query  2035  IRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFR  1856
             +RIRSLF+FFD+   G+LDYAQIE GLSA++I A+YK+A++LL+V DAN+DGRVDY EFR
Sbjct  61    VRIRSLFNFFDAAGLGHLDYAQIEAGLSALRIPAEYKYARDLLKVCDANRDGRVDYQEFR  120

Query  1855  KYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGV  1676
             +YMDDKELELYRIFQAIDVEH+G ILPEELWDALVKAGIEIDD+ELARFVEHVDKDN+G+
Sbjct  121   RYMDDKELELYRIFQAIDVEHNGCILPEELWDALVKAGIEIDDEELARFVEHVDKDNNGI  180

Query  1675  ITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVA  1496
             ITFEEWRDFLLLYPHEATIENIY+Y ERVCLVDIGEQAVIPEGISKHV+ASKYLIAGGVA
Sbjct  181   ITFEEWRDFLLLYPHEATIENIYQYWERVCLVDIGEQAVIPEGISKHVNASKYLIAGGVA  240

Query  1495  GAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAI  1316
             GA SRTATAPLDRLKVV+QVQT RA I+ A+K IW+EG   GFFRGNGINV+KVAPESAI
Sbjct  241   GATSRTATAPLDRLKVVMQVQTKRAHIISAIKDIWREGHFLGFFRGNGINVMKVAPESAI  300

Query  1315  KFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEG  1139
             +FYTYEMLK+ I  AKG D+ +IG SGRL+AGGLAGAVAQTAIYPMDLVKTRLQTY+CEG
Sbjct  301   RFYTYEMLKDLIVKAKGEDKSNIGASGRLVAGGLAGAVAQTAIYPMDLVKTRLQTYSCEG  360

Query  1138  GKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSE  959
             GKVP+LG LSKDIWL EGPRAFYRG++PSLLGIIPYAGIDLA Y+ LK+ ++TY+L+DSE
Sbjct  361   GKVPNLGTLSKDIWLHEGPRAFYRGLIPSLLGIIPYAGIDLAAYETLKDMSKTYMLKDSE  420

Query  958   PGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRG  779
             PGPLVQLG GTISGALGATCVYPLQV+RTRMQAQ T+++TAY+GM DVF RT +HEG  G
Sbjct  421   PGPLVQLGCGTISGALGATCVYPLQVIRTRMQAQRTYSTTAYQGMSDVFWRTLQHEGFSG  480

Query  778   FYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             FYKG+FPNLLKVVP+ASITYLVYE+MKK+L LD
Sbjct  481   FYKGIFPNLLKVVPSASITYLVYETMKKSLSLD  513



>ref|XP_004235852.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Solanum lycopersicum]
Length=502

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/503 (79%), Positives = 443/503 (88%), Gaps = 3/503 (1%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSF  2009
             MSGA     HVN P M AKD S CCNPV KPGPVS+DHVL+AL+ETKEERD+R+R LFSF
Sbjct  1     MSGA--VAEHVNHPVMAAKDPSGCCNPVKKPGPVSVDHVLSALRETKEERDLRMRGLFSF  58

Query  2008  FDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELE  1829
             FDSDN GYLD  +I +GL AMQI ADYKFA+ELL   D NKDGRVDYPEFRKYMDDKELE
Sbjct  59    FDSDNVGYLDSVKIGKGLFAMQIPADYKFARELLTECDKNKDGRVDYPEFRKYMDDKELE  118

Query  1828  LYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDF  1649
             LYRIFQAIDVEH+G ILPEELWDAL+KAGI+IDDDELARFVEHVDKDN+G+ITFEEWR+F
Sbjct  119   LYRIFQAIDVEHNGCILPEELWDALIKAGIQIDDDELARFVEHVDKDNNGIITFEEWRNF  178

Query  1648  LLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATA  1469
             LLLYPHEAT+ENIY+Y ERVCLVDIGEQAVIPEGI+KHVH  KY +AGGVAGA SRT TA
Sbjct  179   LLLYPHEATLENIYKYWERVCLVDIGEQAVIPEGINKHVHTVKYFLAGGVAGATSRTFTA  238

Query  1468  PLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLK  1289
             PLDRLKVVLQVQT RASI   ++ IWK+GG   FFRGNG+NV+KVAPESAI+FY YE+LK
Sbjct  239   PLDRLKVVLQVQTNRASIGSTIREIWKDGGFLSFFRGNGLNVMKVAPESAIRFYAYEILK  298

Query  1288  NAIGHAKGDE-GDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRL  1112
             N I H +G+E GD+G SGR +AGG+AGAVAQTAIYPMDLVKTRLQT+  EGGKVP+LG+L
Sbjct  299   NVIAHTQGEEQGDLGASGRFVAGGMAGAVAQTAIYPMDLVKTRLQTHASEGGKVPNLGKL  358

Query  1111  SKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGS  932
             SKDIW++EGPRAFY+G++PSLLGIIPY+GIDLAVY+ LK+ +RTYILQD EPG LVQLG 
Sbjct  359   SKDIWIQEGPRAFYKGLIPSLLGIIPYSGIDLAVYETLKDLSRTYILQDREPGALVQLGC  418

Query  931   GTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNL  752
             GTISGALGATCVYPLQV+RTRMQAQPT+T  AY GM DVF RT +HEG RGFYKGLFPNL
Sbjct  419   GTISGALGATCVYPLQVIRTRMQAQPTNTEAAYSGMSDVFRRTLQHEGPRGFYKGLFPNL  478

Query  751   LKVVPAASITYLVYESMKKTLDL  683
             LKVVPAASITY+VYE MKK LDL
Sbjct  479   LKVVPAASITYIVYEYMKKNLDL  501



>ref|XP_007038177.1| Mitochondrial substrate carrier family protein isoform 2 [Theobroma 
cacao]
 gb|EOY22678.1| Mitochondrial substrate carrier family protein isoform 2 [Theobroma 
cacao]
Length=505

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/505 (79%), Positives = 451/505 (89%), Gaps = 2/505 (0%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSF  2009
             MSGA   V HV  P M AK +  CCNPV KPGPVSMDHVL AL+ETKEERD+RIRSLF+F
Sbjct  1     MSGAAGPVEHVGLPKMEAKSKPGCCNPVKKPGPVSMDHVLLALRETKEERDLRIRSLFNF  60

Query  2008  FDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELE  1829
             FD+ N G+LDYAQIE+GLSA+QI A+YK+AK+LL+V DAN+DGRVDY EF++YMDDKELE
Sbjct  61    FDAANVGFLDYAQIEKGLSALQIPAEYKYAKDLLKVCDANRDGRVDYHEFKRYMDDKELE  120

Query  1828  LYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDF  1649
             LYRIFQAIDVEH+G ILPEELWDALVKAGIEIDD+ELARFVEHVDKDN+G+ITFEEWRDF
Sbjct  121   LYRIFQAIDVEHNGCILPEELWDALVKAGIEIDDEELARFVEHVDKDNNGIITFEEWRDF  180

Query  1648  LLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATA  1469
             LLLYPHEATIENIY + ERVCLVDIGEQAVIPEGISKHV  SKY IAGG+AGAASRTATA
Sbjct  181   LLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVKRSKYFIAGGIAGAASRTATA  240

Query  1468  PLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLK  1289
             PLDRLKVVLQVQTTRA I+PAVK IWK+ G+ GFFRGNG+NV+KVAPESAIKFY YEMLK
Sbjct  241   PLDRLKVVLQVQTTRACILPAVKKIWKQDGLLGFFRGNGLNVVKVAPESAIKFYAYEMLK  300

Query  1288  NAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRL  1112
             N +G + G  +GDIG SGRLIAGG+AGAVAQ+AIYPMDLVKTRLQT   EGG+ P LG+L
Sbjct  301   NVMGDSMGYKKGDIGASGRLIAGGVAGAVAQSAIYPMDLVKTRLQTCASEGGRAPKLGKL  360

Query  1111  SKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSE-PGPLVQLG  935
             ++DIW++EGPRAFY+G+VPSLLGIIPYAGIDLA Y+ LK+F+RTYILQD E PGPLVQLG
Sbjct  361   TRDIWVQEGPRAFYKGLVPSLLGIIPYAGIDLAAYETLKDFSRTYILQDGEDPGPLVQLG  420

Query  934   SGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPN  755
              GT+SGALGATCVYPLQV+RTR+QAQ   ++ AYKGM DVF RT ++EG RGFYKGL PN
Sbjct  421   CGTVSGALGATCVYPLQVIRTRLQAQHATSAAAYKGMSDVFWRTLQNEGYRGFYKGLVPN  480

Query  754   LLKVVPAASITYLVYESMKKTLDLD  680
             LLKVVPAASITYLVYE+MKK+LDLD
Sbjct  481   LLKVVPAASITYLVYEAMKKSLDLD  505



>ref|XP_007032054.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma 
cacao]
 gb|EOY02980.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma 
cacao]
Length=496

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/492 (81%), Positives = 447/492 (91%), Gaps = 2/492 (0%)
 Frame = -1

Query  2149  PAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQ  1970
             P    + R+  CNPV KPGPV+MDHVL AL+ETKEERD RIRSLF+FFDS NAG+LDYAQ
Sbjct  5     PTKAKEQRARGCNPVKKPGPVTMDHVLLALEETKEERDQRIRSLFNFFDSANAGFLDYAQ  64

Query  1969  IERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHS  1790
             IE GLSA+QI ++YK+AK+LL V DAN DGRVDY EFR+YMDDKELELYRIFQAIDVEH+
Sbjct  65    IEAGLSALQIPSEYKYAKDLLDVCDANMDGRVDYQEFRRYMDDKELELYRIFQAIDVEHN  124

Query  1789  GGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENI  1610
             G ILPEEL+DAL++AGIEIDD+ELA FVE VD+DN+GVITF+EWRDFLLLYPHEATIENI
Sbjct  125   GCILPEELYDALLRAGIEIDDEELALFVERVDQDNNGVITFKEWRDFLLLYPHEATIENI  184

Query  1609  YRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQT  1430
             Y YLERVCLVDIGEQAVIPEGISKHVHAS+YLIAGGVAGAASRTATAPLDRLKVVLQVQT
Sbjct  185   YHYLERVCLVDIGEQAVIPEGISKHVHASRYLIAGGVAGAASRTATAPLDRLKVVLQVQT  244

Query  1429  TRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEG  1256
             TRA IMPA++ IW+EGGI GFFRGNG+NVLKVAPESAIKFY YEMLK  I  AKG  D+ 
Sbjct  245   TRAHIMPAIRDIWREGGILGFFRGNGLNVLKVAPESAIKFYMYEMLKEFIIKAKGGKDKA  304

Query  1255  DIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRA  1076
             +IG +GRLIAGGLAGAV+QTAIYPMDLVKTRLQTY+CEGGK+P+LG LSKDIW++EGPRA
Sbjct  305   EIGAAGRLIAGGLAGAVSQTAIYPMDLVKTRLQTYSCEGGKIPNLGALSKDIWIQEGPRA  364

Query  1075  FYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCV  896
             FYRG+VPSLLGIIPYAGIDLA Y+ LK+ ++ YILQDSEPGPLVQLG GTISGALGATCV
Sbjct  365   FYRGLVPSLLGIIPYAGIDLAAYETLKDMSKKYILQDSEPGPLVQLGCGTISGALGATCV  424

Query  895   YPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYL  716
             YPLQVVRTRMQAQ  +T  AYKGM D+F RTF+HEG+RGFYKGLFPNLLKVVP+ASITYL
Sbjct  425   YPLQVVRTRMQAQCPNTGAAYKGMSDMFKRTFQHEGIRGFYKGLFPNLLKVVPSASITYL  484

Query  715   VYESMKKTLDLD  680
             VYESMK++LDL+
Sbjct  485   VYESMKRSLDLE  496



>ref|XP_010663817.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Vitis vinifera]
Length=518

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/511 (78%), Positives = 452/511 (88%), Gaps = 8/511 (2%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAKDRSE-------CCNPVMKPGPVSMDHVLAALQETKEERDIR  2030
             MSGAG+AV  V F  M  +  S        CCNPV K GPV MDHVL ALQE+KEERD+R
Sbjct  8     MSGAGQAVERVGFGKMEKRRASSDSESETGCCNPVRKGGPVGMDHVLLALQESKEERDVR  67

Query  2029  IRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKY  1850
             IRSLF+FFDS N GYLDYAQIE GLSA+QI  +YK+AK+LL+V D+N DGRVDY EFR+Y
Sbjct  68    IRSLFNFFDSANLGYLDYAQIEGGLSALQIPPEYKYAKDLLKVCDSNSDGRVDYQEFRRY  127

Query  1849  MDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVIT  1670
             MDDKELELYRIFQAIDV+H+G ILPEELWDAL+KAGIEIDD+ELARFVE+VDKDN+G+IT
Sbjct  128   MDDKELELYRIFQAIDVKHNGCILPEELWDALLKAGIEIDDEELARFVENVDKDNNGIIT  187

Query  1669  FEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGA  1490
             FEEWRDFLLLYPHEATIENIY+Y  RVCLVDIGEQAVIPEGISKHVHASKYL+AGGVAGA
Sbjct  188   FEEWRDFLLLYPHEATIENIYQYWGRVCLVDIGEQAVIPEGISKHVHASKYLLAGGVAGA  247

Query  1489  ASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKF  1310
             ASRTATAPLDRLKVVLQVQTT A I+PA+K+IWKEGG+ GFFRGNG+NV+KVAPESAIKF
Sbjct  248   ASRTATAPLDRLKVVLQVQTTHARIVPAIKNIWKEGGLLGFFRGNGLNVVKVAPESAIKF  307

Query  1309  YTYEMLKNAIGHAKGD-EGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGK  1133
             YTYEM KN +  AKG+ + DIG +GRL AGG+AGAVAQTAIYP+DLVKTRLQTYTCEGGK
Sbjct  308   YTYEMFKNVVRDAKGEAKDDIGAAGRLFAGGMAGAVAQTAIYPLDLVKTRLQTYTCEGGK  367

Query  1132  VPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPG  953
             VP+L  L+++IW +EGP+ FYRG+VPS+LGIIPYAGIDLA Y+ LK+ ++TY+L DSEPG
Sbjct  368   VPYLKTLARNIWFQEGPQGFYRGLVPSVLGIIPYAGIDLAAYETLKDMSKTYLLHDSEPG  427

Query  952   PLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFY  773
             PLVQLGSGTISGALGATCVYPLQV+RTRMQAQ T+T  +Y GM DVF RT +HEG RGFY
Sbjct  428   PLVQLGSGTISGALGATCVYPLQVIRTRMQAQRTNTDASYNGMSDVFRRTLQHEGFRGFY  487

Query  772   KGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             KGLFPNLLKVVP+ASITYLVYE+MKK+LDLD
Sbjct  488   KGLFPNLLKVVPSASITYLVYETMKKSLDLD  518



>ref|XP_010663816.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Vitis vinifera]
Length=529

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/511 (78%), Positives = 452/511 (88%), Gaps = 8/511 (2%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAKDRSE-------CCNPVMKPGPVSMDHVLAALQETKEERDIR  2030
             MSGAG+AV  V F  M  +  S        CCNPV K GPV MDHVL ALQE+KEERD+R
Sbjct  19    MSGAGQAVERVGFGKMEKRRASSDSESETGCCNPVRKGGPVGMDHVLLALQESKEERDVR  78

Query  2029  IRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKY  1850
             IRSLF+FFDS N GYLDYAQIE GLSA+QI  +YK+AK+LL+V D+N DGRVDY EFR+Y
Sbjct  79    IRSLFNFFDSANLGYLDYAQIEGGLSALQIPPEYKYAKDLLKVCDSNSDGRVDYQEFRRY  138

Query  1849  MDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVIT  1670
             MDDKELELYRIFQAIDV+H+G ILPEELWDAL+KAGIEIDD+ELARFVE+VDKDN+G+IT
Sbjct  139   MDDKELELYRIFQAIDVKHNGCILPEELWDALLKAGIEIDDEELARFVENVDKDNNGIIT  198

Query  1669  FEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGA  1490
             FEEWRDFLLLYPHEATIENIY+Y  RVCLVDIGEQAVIPEGISKHVHASKYL+AGGVAGA
Sbjct  199   FEEWRDFLLLYPHEATIENIYQYWGRVCLVDIGEQAVIPEGISKHVHASKYLLAGGVAGA  258

Query  1489  ASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKF  1310
             ASRTATAPLDRLKVVLQVQTT A I+PA+K+IWKEGG+ GFFRGNG+NV+KVAPESAIKF
Sbjct  259   ASRTATAPLDRLKVVLQVQTTHARIVPAIKNIWKEGGLLGFFRGNGLNVVKVAPESAIKF  318

Query  1309  YTYEMLKNAIGHAKGD-EGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGK  1133
             YTYEM KN +  AKG+ + DIG +GRL AGG+AGAVAQTAIYP+DLVKTRLQTYTCEGGK
Sbjct  319   YTYEMFKNVVRDAKGEAKDDIGAAGRLFAGGMAGAVAQTAIYPLDLVKTRLQTYTCEGGK  378

Query  1132  VPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPG  953
             VP+L  L+++IW +EGP+ FYRG+VPS+LGIIPYAGIDLA Y+ LK+ ++TY+L DSEPG
Sbjct  379   VPYLKTLARNIWFQEGPQGFYRGLVPSVLGIIPYAGIDLAAYETLKDMSKTYLLHDSEPG  438

Query  952   PLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFY  773
             PLVQLGSGTISGALGATCVYPLQV+RTRMQAQ T+T  +Y GM DVF RT +HEG RGFY
Sbjct  439   PLVQLGSGTISGALGATCVYPLQVIRTRMQAQRTNTDASYNGMSDVFRRTLQHEGFRGFY  498

Query  772   KGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             KGLFPNLLKVVP+ASITYLVYE+MKK+LDLD
Sbjct  499   KGLFPNLLKVVPSASITYLVYETMKKSLDLD  529



>ref|XP_008805618.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Phoenix dactylifera]
Length=514

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/514 (79%), Positives = 456/514 (89%), Gaps = 11/514 (2%)
 Frame = -1

Query  2188  MSGAGEAV--GHVNFP-AMTAKDRSEC-------CNPVMKPGPVSMDHVLAALQETKEER  2039
             MSGAG+A    HV FP  +TA+   +        CNPV KPGPVSMDHVL AL+ETKEER
Sbjct  1     MSGAGQAAVEQHVGFPPKLTAEGEQQQQQRSGGGCNPVRKPGPVSMDHVLLALRETKEER  60

Query  2038  DIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEF  1859
             ++RIRSLF+FFD+   G LDYAQIE GLSA++I A+YK+A++LL+V DAN+DGRVDY EF
Sbjct  61    EVRIRSLFNFFDASGLGPLDYAQIEAGLSALRIPAEYKYARDLLKVCDANRDGRVDYQEF  120

Query  1858  RKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDG  1679
             R+YMDDKELELYRIFQAIDVEHSG ILPEELWDALVKAGIEIDD+ELARFVEHVDKDN+G
Sbjct  121   RRYMDDKELELYRIFQAIDVEHSGCILPEELWDALVKAGIEIDDEELARFVEHVDKDNNG  180

Query  1678  VITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGV  1499
             +ITFEEWRDFLLLYPHEATIENIY+Y ERVCLVDIGEQAVIP+GISKHV+ASKYLIAGGV
Sbjct  181   IITFEEWRDFLLLYPHEATIENIYQYWERVCLVDIGEQAVIPQGISKHVNASKYLIAGGV  240

Query  1498  AGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESA  1319
             AGAASRTATAPLDRLKVVLQVQTTRA ++PA+K IW+EG   GFFRGNG+NV+KVAPESA
Sbjct  241   AGAASRTATAPLDRLKVVLQVQTTRAHVIPAIKDIWREGHFLGFFRGNGLNVMKVAPESA  300

Query  1318  IKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCE  1142
             I+FYTYEMLK+ I  A G D+  IG SGRL++GGLAGAVAQT IYPMDLVKTRLQTY CE
Sbjct  301   IRFYTYEMLKDFIVKANGEDKSQIGASGRLVSGGLAGAVAQTVIYPMDLVKTRLQTYACE  360

Query  1141  GGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDS  962
             GGKVP+LG LSKDIWL EGPRAFYRG+VPSLLGIIPYAGIDLA Y+ LK+ ++T+IL+DS
Sbjct  361   GGKVPNLGTLSKDIWLHEGPRAFYRGLVPSLLGIIPYAGIDLAAYETLKDISKTHILKDS  420

Query  961   EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLR  782
             EPGPLVQLG GTISGALGATCVYPLQV+RTRMQAQ T+++TAYKGM DVF RT +HEG  
Sbjct  421   EPGPLVQLGCGTISGALGATCVYPLQVIRTRMQAQCTYSTTAYKGMSDVFWRTLQHEGFL  480

Query  781   GFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             GFYKG+FPNLLKVVP+ASITYLVYE+MKK+L LD
Sbjct  481   GFYKGIFPNLLKVVPSASITYLVYETMKKSLSLD  514



>ref|XP_008792029.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Phoenix dactylifera]
 ref|XP_008792031.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Phoenix dactylifera]
 ref|XP_008792032.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Phoenix dactylifera]
 ref|XP_008792033.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Phoenix dactylifera]
 ref|XP_008792034.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Phoenix dactylifera]
 ref|XP_008792035.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Phoenix dactylifera]
Length=513

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/513 (79%), Positives = 451/513 (88%), Gaps = 10/513 (2%)
 Frame = -1

Query  2188  MSGAGEAV--GHVNFPAMTAKDRSE-------CCNPVMKPGPVSMDHVLAALQETKEERD  2036
             MSGAG+A    HV FPA  A +  +        CNPV KPGPVSMDHVL AL ETKEER+
Sbjct  1     MSGAGQAAVEQHVGFPAKMAAEGEQQQRRSVGGCNPVRKPGPVSMDHVLLALHETKEERE  60

Query  2035  IRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFR  1856
             +RIRSLF+FFD+   G+LDYAQIE GL A++I A+YK+A++LL+V DAN+DGRVDY EFR
Sbjct  61    VRIRSLFNFFDAAGLGHLDYAQIEAGLLALRIPAEYKYARDLLKVCDANRDGRVDYQEFR  120

Query  1855  KYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGV  1676
             +YMDDKELELYRIFQAIDVEH+G ILPEELWDALV+AGIEIDD+ELARFVEHVDKDN+G+
Sbjct  121   RYMDDKELELYRIFQAIDVEHNGCILPEELWDALVQAGIEIDDEELARFVEHVDKDNNGI  180

Query  1675  ITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVA  1496
             ITFEEWRDFLLLYPHEATIENIY+Y ERVCLVDIGEQAVIPEGISKHV+ASKYLIAGGVA
Sbjct  181   ITFEEWRDFLLLYPHEATIENIYQYWERVCLVDIGEQAVIPEGISKHVNASKYLIAGGVA  240

Query  1495  GAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAI  1316
             GAASRTATAPLDRLKVV+QVQT RA I  A+K IW+EG   GFFRGN +NV+KVAPESAI
Sbjct  241   GAASRTATAPLDRLKVVMQVQTNRAHISSAIKDIWREGHFLGFFRGNALNVMKVAPESAI  300

Query  1315  KFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEG  1139
             KFYTYEMLK+ I  AKG DE  IG SGRLIAGGLAGAVAQTAIYPMDLVKTRLQTY CEG
Sbjct  301   KFYTYEMLKDLIVKAKGEDESGIGASGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYACEG  360

Query  1138  GKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSE  959
             GKVP+LG LSKDIW+ EGPRAFYRGI+PSLLGIIPYAGIDLA Y+ LK+ ++TYIL+DSE
Sbjct  361   GKVPNLGTLSKDIWVHEGPRAFYRGIIPSLLGIIPYAGIDLAAYETLKDMSKTYILKDSE  420

Query  958   PGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRG  779
             PGPLVQLG GTISGALGATCVYPLQV+RTRMQAQ ++++TAY+GM DVF RT +HEG  G
Sbjct  421   PGPLVQLGCGTISGALGATCVYPLQVIRTRMQAQRSNSTTAYQGMSDVFWRTLQHEGFSG  480

Query  778   FYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             FYKG+FPNLLKVVP+ASITYLVYE+MKK L LD
Sbjct  481   FYKGIFPNLLKVVPSASITYLVYETMKKNLFLD  513



>ref|XP_010925208.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Elaeis guineensis]
Length=515

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/515 (78%), Positives = 454/515 (88%), Gaps = 12/515 (2%)
 Frame = -1

Query  2188  MSGAGEAV--GHVNFPA-MTAKDRSE--------CCNPVMKPGPVSMDHVLAALQETKEE  2042
             MSGAG+A    HV FPA MTA+   +         CNPV KPGPVSMDHVL AL+ETKEE
Sbjct  1     MSGAGQAAVEQHVGFPAKMTAESEHQQQRRRSGGGCNPVRKPGPVSMDHVLLALRETKEE  60

Query  2041  RDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPE  1862
             R++RIRSLF+FFD+   G+LDYAQIE GLSA++I A+YK+A++LL+V DAN+DGRVDY E
Sbjct  61    REVRIRSLFNFFDASGLGHLDYAQIEAGLSALRIPAEYKYARDLLKVCDANRDGRVDYQE  120

Query  1861  FRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDND  1682
             FR+YMDDKELELYRIFQAIDVEH+G ILPEELWDALVKAGIEIDD+ELA FVEHVDKDN+
Sbjct  121   FRRYMDDKELELYRIFQAIDVEHNGCILPEELWDALVKAGIEIDDEELACFVEHVDKDNN  180

Query  1681  GVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGG  1502
             G+ITFEEWRDFLLLYPHEATIENIY+Y ERVCLVDIGEQAVIP+GISKH++ASKYLIAGG
Sbjct  181   GIITFEEWRDFLLLYPHEATIENIYQYWERVCLVDIGEQAVIPQGISKHMNASKYLIAGG  240

Query  1501  VAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPES  1322
             VAGAASRT TAPLDRLKVV+QVQT  A ++PA+K IW++G   GFFRGNG+NV+KVAPES
Sbjct  241   VAGAASRTVTAPLDRLKVVMQVQTNCAHVIPAIKDIWRQGHFLGFFRGNGLNVMKVAPES  300

Query  1321  AIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTC  1145
             AI+FYTYEMLK+ I  A G D+ DIG SGRLIAGGLAGAVAQTAIYPMDLVKTRLQTY C
Sbjct  301   AIRFYTYEMLKDFIVKANGEDKSDIGASGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYAC  360

Query  1144  EGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQD  965
             EGGKVP LG LSKDIW+ EGPRAFYRG+VPSLLGIIPYAGIDLA Y+ LK+ +RTY+L+D
Sbjct  361   EGGKVPSLGTLSKDIWVHEGPRAFYRGLVPSLLGIIPYAGIDLAAYETLKDMSRTYVLKD  420

Query  964   SEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGL  785
             SEPGPLVQLG GTISGALGAT VYPLQV+RTRMQAQ T+++TAYKGM DVF RT +HEG 
Sbjct  421   SEPGPLVQLGCGTISGALGATFVYPLQVIRTRMQAQYTNSTTAYKGMSDVFWRTLQHEGF  480

Query  784   RGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
              GFYKG+FPNLLKVVP+ASITYLVYE+MKK+L LD
Sbjct  481   SGFYKGIFPNLLKVVPSASITYLVYETMKKSLSLD  515



>emb|CAN83157.1| hypothetical protein VITISV_022552 [Vitis vinifera]
Length=496

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/487 (80%), Positives = 442/487 (91%), Gaps = 1/487 (0%)
 Frame = -1

Query  2137  AKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERG  1958
             ++  + CCNPV K GPV MDHVL ALQE+KEERD+RIRSLF+FFDS N GYLDYAQIE G
Sbjct  10    SESETGCCNPVRKGGPVGMDHVLLALQESKEERDVRIRSLFNFFDSANLGYLDYAQIEGG  69

Query  1957  LSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGIL  1778
             LSA+QI  +YK+AK+LL+V D+N DGRVDY EFR+YMDDKELELYRIFQAIDV+H+G IL
Sbjct  70    LSALQIPPEYKYAKDLLKVCDSNSDGRVDYQEFRRYMDDKELELYRIFQAIDVKHNGCIL  129

Query  1777  PEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYL  1598
             PEELWDAL+KAGIEIDD+ELARFVE+VDKDN+G+ITFEEWRDFLLLYPHEATIENIY+Y 
Sbjct  130   PEELWDALLKAGIEIDDEELARFVENVDKDNNGIITFEEWRDFLLLYPHEATIENIYQYW  189

Query  1597  ERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRAS  1418
              RVCLVDIGEQAVIPEGISKHVHASKYL+AGGVAGAASRTATAPLDRLKVVLQVQTT A 
Sbjct  190   GRVCLVDIGEQAVIPEGISKHVHASKYLLAGGVAGAASRTATAPLDRLKVVLQVQTTHAR  249

Query  1417  IMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGD-EGDIGTS  1241
             I+PA+K+IWKEGG+ GFFRGNG+NV+KVAPESAIKFYTYEM KN +  AKG+ + DIG +
Sbjct  250   IVPAIKNIWKEGGLLGFFRGNGLNVVKVAPESAIKFYTYEMFKNVVRDAKGEAKDDIGAA  309

Query  1240  GRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGI  1061
             GRL AGG+AGAVAQTAIYP+DLVKTRLQTYTCEGGKVP+L  L+++IW +EGP+ FYRG+
Sbjct  310   GRLFAGGMAGAVAQTAIYPLDLVKTRLQTYTCEGGKVPYLKTLARNIWFQEGPQGFYRGL  369

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQV  881
             VPS+LGIIPYAGIDLA Y+ LK+ ++TY+L DSEPGPLVQLGSGTISGALGATCVYPLQV
Sbjct  370   VPSVLGIIPYAGIDLAAYETLKDMSKTYLLHDSEPGPLVQLGSGTISGALGATCVYPLQV  429

Query  880   VRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESM  701
             +RTRMQAQ T+T  +Y GM DVF RT +HEG RGFYKGLFPNLLKVVP+ASITYLVYE+M
Sbjct  430   IRTRMQAQRTNTDASYNGMSDVFRRTLQHEGFRGFYKGLFPNLLKVVPSASITYLVYETM  489

Query  700   KKTLDLD  680
             KK+LDLD
Sbjct  490   KKSLDLD  496



>ref|XP_010925207.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Elaeis guineensis]
Length=531

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/520 (77%), Positives = 455/520 (88%), Gaps = 12/520 (2%)
 Frame = -1

Query  2203  GFLAAMSGAGEAV--GHVNFPA-MTAKDRSE--------CCNPVMKPGPVSMDHVLAALQ  2057
             G    MSGAG+A    HV FPA MTA+   +         CNPV KPGPVSMDHVL AL+
Sbjct  12    GLRRRMSGAGQAAVEQHVGFPAKMTAESEHQQQRRRSGGGCNPVRKPGPVSMDHVLLALR  71

Query  2056  ETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGR  1877
             ETKEER++RIRSLF+FFD+   G+LDYAQIE GLSA++I A+YK+A++LL+V DAN+DGR
Sbjct  72    ETKEEREVRIRSLFNFFDASGLGHLDYAQIEAGLSALRIPAEYKYARDLLKVCDANRDGR  131

Query  1876  VDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHV  1697
             VDY EFR+YMDDKELELYRIFQAIDVEH+G ILPEELWDALVKAGIEIDD+ELA FVEHV
Sbjct  132   VDYQEFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDALVKAGIEIDDEELACFVEHV  191

Query  1696  DKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKY  1517
             DKDN+G+ITFEEWRDFLLLYPHEATIENIY+Y ERVCLVDIGEQAVIP+GISKH++ASKY
Sbjct  192   DKDNNGIITFEEWRDFLLLYPHEATIENIYQYWERVCLVDIGEQAVIPQGISKHMNASKY  251

Query  1516  LIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLK  1337
             LIAGGVAGAASRT TAPLDRLKVV+QVQT  A ++PA+K IW++G   GFFRGNG+NV+K
Sbjct  252   LIAGGVAGAASRTVTAPLDRLKVVMQVQTNCAHVIPAIKDIWRQGHFLGFFRGNGLNVMK  311

Query  1336  VAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRL  1160
             VAPESAI+FYTYEMLK+ I  A G D+ DIG SGRLIAGGLAGAVAQTAIYPMDLVKTRL
Sbjct  312   VAPESAIRFYTYEMLKDFIVKANGEDKSDIGASGRLIAGGLAGAVAQTAIYPMDLVKTRL  371

Query  1159  QTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFART  980
             QTY CEGGKVP LG LSKDIW+ EGPRAFYRG+VPSLLGIIPYAGIDLA Y+ LK+ +RT
Sbjct  372   QTYACEGGKVPSLGTLSKDIWVHEGPRAFYRGLVPSLLGIIPYAGIDLAAYETLKDMSRT  431

Query  979   YILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTF  800
             Y+L+DSEPGPLVQLG GTISGALGAT VYPLQV+RTRMQAQ T+++TAYKGM DVF RT 
Sbjct  432   YVLKDSEPGPLVQLGCGTISGALGATFVYPLQVIRTRMQAQYTNSTTAYKGMSDVFWRTL  491

Query  799   RHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             +HEG  GFYKG+FPNLLKVVP+ASITYLVYE+MKK+L LD
Sbjct  492   QHEGFSGFYKGIFPNLLKVVPSASITYLVYETMKKSLSLD  531



>gb|KHG06239.1| Calcium-binding mitochondrial carrier SCaMC-1 [Gossypium arboreum]
Length=505

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/501 (78%), Positives = 443/501 (88%), Gaps = 1/501 (0%)
 Frame = -1

Query  2179  AGEAVGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDS  2000
             AG+ V HV  P M AK ++ C NPV K GPVSMDHVL AL+ETKEERD+RIRSLF+FFD+
Sbjct  5     AGQGVEHVGLPKMEAKSKAGCSNPVKKKGPVSMDHVLLALRETKEERDLRIRSLFNFFDA  64

Query  1999  DNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYR  1820
              N G+LDY QIE+GLSA+QI A+YK+A +LL+V DAN+DGRVDY EF++YMDDKELELYR
Sbjct  65    ANVGFLDYGQIEKGLSALQIPAEYKYANDLLKVCDANRDGRVDYQEFKRYMDDKELELYR  124

Query  1819  IFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLL  1640
             IFQAIDVEH+G ILPEELWDALVKAGI IDD+ELARFVEHVDKDN+G+ITFEEWRDFLLL
Sbjct  125   IFQAIDVEHNGCILPEELWDALVKAGICIDDEELARFVEHVDKDNNGIITFEEWRDFLLL  184

Query  1639  YPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLD  1460
             YPHEAT+ENIY + E+VCLVDIGE AVIP+GIS HV  SKY IAGG+AGAASRTATAPLD
Sbjct  185   YPHEATMENIYHHWEKVCLVDIGETAVIPQGISTHVKRSKYFIAGGIAGAASRTATAPLD  244

Query  1459  RLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAI  1280
             RLKVVLQVQTT A I+PAV+ I KE GI GFFRGNG+NV+KVAPESAIKFY YEMLK  I
Sbjct  245   RLKVVLQVQTTNADILPAVRKILKEDGILGFFRGNGLNVVKVAPESAIKFYAYEMLKTVI  304

Query  1279  GHAKGD-EGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKD  1103
             G ++GD +GDIG SGRL AGG+AGAVAQ AIYPMDLVKTRLQT   EGGK P LG+L+KD
Sbjct  305   GDSRGDKKGDIGASGRLFAGGVAGAVAQCAIYPMDLVKTRLQTCASEGGKPPKLGKLTKD  364

Query  1102  IWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTI  923
             IW++EGPRAFY+G+VPSLLGIIPYAGIDL VY+ LK+F+R+YILQDSEPGPLVQLG GTI
Sbjct  365   IWVQEGPRAFYKGLVPSLLGIIPYAGIDLTVYETLKDFSRSYILQDSEPGPLVQLGCGTI  424

Query  922   SGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKV  743
             SGALGATCVYPLQV+RTRMQAQ T +  AY GM DVF +TFR+EG RGFYKGLFPNLLKV
Sbjct  425   SGALGATCVYPLQVIRTRMQAQRTTSGVAYNGMSDVFWKTFRNEGYRGFYKGLFPNLLKV  484

Query  742   VPAASITYLVYESMKKTLDLD  680
             VPAASITYLVYE+MKK+L+LD
Sbjct  485   VPAASITYLVYEAMKKSLELD  505



>ref|XP_002318185.2| mitochondrial substrate carrier family protein [Populus trichocarpa]
 gb|EEE96405.2| mitochondrial substrate carrier family protein [Populus trichocarpa]
Length=494

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/485 (79%), Positives = 435/485 (90%), Gaps = 1/485 (0%)
 Frame = -1

Query  2131  DRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLS  1952
             ++++CCNPV KPGPVS+DHVL AL+ETKEERD+RIRSLFSFFD+ N GYLD AQIE GLS
Sbjct  10    NQTDCCNPVKKPGPVSIDHVLLALRETKEERDVRIRSLFSFFDAANLGYLDCAQIEAGLS  69

Query  1951  AMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPE  1772
              +QI A YK+AKELL V DAN+DGRVDY EFR+YMDDKE+ELYRIFQAIDVEH+G ILPE
Sbjct  70    GLQIPAGYKYAKELLEVCDANRDGRVDYQEFRRYMDDKEMELYRIFQAIDVEHNGCILPE  129

Query  1771  ELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLER  1592
             ELWDALVKAGIEID++ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ER
Sbjct  130   ELWDALVKAGIEIDEEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWER  189

Query  1591  VCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIM  1412
             VC VDIGEQAVIPEGISKHVH SKY IAGG+AGAASR+ATAPLDRLKVVLQVQTTRA ++
Sbjct  190   VCHVDIGEQAVIPEGISKHVHRSKYFIAGGIAGAASRSATAPLDRLKVVLQVQTTRACMV  249

Query  1411  PAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAK-GDEGDIGTSGR  1235
             PA+  IWKE G  GFFRGNG+NVLKVAPESAIKFY YEMLKNAIG  K GD+ DIG  GR
Sbjct  250   PAINKIWKEEGFLGFFRGNGLNVLKVAPESAIKFYAYEMLKNAIGEVKGGDKVDIGPGGR  309

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVP  1055
             L+AGG+AGAVAQTAIYP+DLVKTRLQTY CEGGK PHLG L+KDIW++EGPRAFY+G+VP
Sbjct  310   LLAGGMAGAVAQTAIYPLDLVKTRLQTYVCEGGKAPHLGALTKDIWIQEGPRAFYKGLVP  369

Query  1054  SLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVR  875
             SLLGIIPYAGIDLA Y+ LK+ ++TYIL DSEPGPLVQL  GTISG++GATCVYPLQV+R
Sbjct  370   SLLGIIPYAGIDLAAYETLKDMSKTYILHDSEPGPLVQLCCGTISGSVGATCVYPLQVIR  429

Query  874   TRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKK  695
             TRMQAQP   +  YKG+ DVF RTF++EG  GFYKG+FPNLLKVVPA SITY+VYE+MKK
Sbjct  430   TRMQAQPPSNAAPYKGISDVFWRTFQNEGYGGFYKGIFPNLLKVVPAVSITYMVYEAMKK  489

Query  694   TLDLD  680
             +L+LD
Sbjct  490   SLELD  494



>gb|KDP41876.1| hypothetical protein JCGZ_26894 [Jatropha curcas]
Length=497

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/488 (78%), Positives = 442/488 (91%), Gaps = 3/488 (1%)
 Frame = -1

Query  2134  KDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGL  1955
             + R+ CCNPV K GPV+MDHVL AL ETKEER+ RIRSLF+FFD  N+GYLDY QIE+GL
Sbjct  10    EQRANCCNPVKKQGPVTMDHVLLALGETKEEREQRIRSLFNFFDVTNSGYLDYNQIEKGL  69

Query  1954  SAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILP  1775
             SA+QI A+YK+AK+LL VVDANKDGRVDY EF++YMDDKELELYRIFQAIDVEH+G ILP
Sbjct  70    SALQIPAEYKYAKDLLNVVDANKDGRVDYQEFKRYMDDKELELYRIFQAIDVEHNGCILP  129

Query  1774  EELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLE  1595
             EEL+DAL++AGIEIDD+ELARFVE VDKDN+GVITFEEWRDFLLLYPHEATIENIY YLE
Sbjct  130   EELYDALLRAGIEIDDEELARFVERVDKDNNGVITFEEWRDFLLLYPHEATIENIYHYLE  189

Query  1594  RVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASI  1415
             RVCLVDIGEQAV+PEGISKH+HA +YLIAGGVAGA SRTATAPLDRLKVVLQVQTT A +
Sbjct  190   RVCLVDIGEQAVVPEGISKHIHAYRYLIAGGVAGATSRTATAPLDRLKVVLQVQTTHARL  249

Query  1414  MPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAK--GDEGDIGTS  1241
             MPA++ IWKEGG+  FFRGNG+NVLKVAPESAI+FYTYE+LK+ I  AK  G++ DIGT+
Sbjct  250   MPAIRDIWKEGGVLAFFRGNGLNVLKVAPESAIRFYTYEILKDFIVKAKGQGNKADIGTT  309

Query  1240  GRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGI  1061
             GRL AGGLAGAVAQTAIYPMDLVKTRLQT  CE GK+P+LG +++DIW++EGPRAFYRG+
Sbjct  310   GRLFAGGLAGAVAQTAIYPMDLVKTRLQTQACENGKIPNLGSMTRDIWVQEGPRAFYRGL  369

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQV  881
             +PSLLGIIPYAGIDLA Y+ LK+ ++ YILQDSEPGPL+QLG GT+SGALGATCVYPLQV
Sbjct  370   IPSLLGIIPYAGIDLAAYETLKDMSKKYILQDSEPGPLIQLGCGTLSGALGATCVYPLQV  429

Query  880   VRTRMQAQ-PTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYES  704
             VRTRMQAQ  ++T  AY GM DVF +TF+HEG+RGFYKG+FPN+LKVVP+ASITY+VYE+
Sbjct  430   VRTRMQAQRRSNTGAAYNGMSDVFRKTFQHEGIRGFYKGIFPNMLKVVPSASITYMVYEA  489

Query  703   MKKTLDLD  680
             MKK+LDL+
Sbjct  490   MKKSLDLE  497



>ref|XP_009385809.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Musa acuminata subsp. malaccensis]
Length=514

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/515 (77%), Positives = 450/515 (87%), Gaps = 13/515 (3%)
 Frame = -1

Query  2188  MSGAGEAVGH-VNFPA-MTA---------KDRSECCNPVMKPGPVSMDHVLAALQETKEE  2042
             MSGA +AV H + FP  M A         + R   CNPV KPGPVSMDHVL AL+ETKEE
Sbjct  1     MSGAAKAVEHRIGFPTKMEATAPAADGEQQRRPGGCNPVKKPGPVSMDHVLLALRETKEE  60

Query  2041  RDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPE  1862
             R++RIRSLF+FFD+   G LDYAQIE GLSA++I  +YK+A++LL+V DAN+DGRVDY E
Sbjct  61    REVRIRSLFNFFDAAGVGQLDYAQIEAGLSALRIPTEYKYARDLLKVCDANRDGRVDYQE  120

Query  1861  FRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDND  1682
             FR+YMDDKELELYRIFQAIDVEH+G ILPEELWDAL+KAGIEIDD+ELARFVEHVDKDN+
Sbjct  121   FRRYMDDKELELYRIFQAIDVEHNGCILPEELWDALIKAGIEIDDEELARFVEHVDKDNN  180

Query  1681  GVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGG  1502
             G+ITFEEWRDFLLLYPHEATIENIY+Y ERVCLVDIGEQA IPEGISKHV+AS+YLIAGG
Sbjct  181   GIITFEEWRDFLLLYPHEATIENIYQYWERVCLVDIGEQAAIPEGISKHVNASQYLIAGG  240

Query  1501  VAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPES  1322
             VAGAASRTATAPLDRLKVVLQVQTT+A I+PA+K IW+EG   GFFRGNG+NV+KVAPES
Sbjct  241   VAGAASRTATAPLDRLKVVLQVQTTQARIVPAIKDIWREGHFLGFFRGNGLNVMKVAPES  300

Query  1321  AIKFYTYEMLKNAIGHAKGDE-GDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTC  1145
             AIKFYT+EMLK+ I   KG+E  DIG SGRL AGGLAGAVAQTAIYP+DLVKTRLQTY C
Sbjct  301   AIKFYTFEMLKDFIVKTKGEEKSDIGASGRLTAGGLAGAVAQTAIYPLDLVKTRLQTYAC  360

Query  1144  EGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQD  965
             EGGKVP+L  L+KDIW+ EGPRAFYRG+VPSLLGIIPYAGIDL  Y+ LK+ +RTYIL+D
Sbjct  361   EGGKVPNLTTLTKDIWVHEGPRAFYRGLVPSLLGIIPYAGIDLTAYETLKDMSRTYILKD  420

Query  964   SEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGL  785
             SEPGPLVQLG GTISGALGATCVYPLQV+RTRMQA  T++STAY GM DVF +T R+EG 
Sbjct  421   SEPGPLVQLGCGTISGALGATCVYPLQVIRTRMQAH-TNSSTAYNGMSDVFWKTLRNEGF  479

Query  784   RGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
              GFYKG+FPNLLKVVP+ASITYLVYE+MKK+L LD
Sbjct  480   SGFYKGIFPNLLKVVPSASITYLVYETMKKSLTLD  514



>ref|XP_011043020.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Populus euphratica]
Length=494

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/485 (80%), Positives = 429/485 (88%), Gaps = 1/485 (0%)
 Frame = -1

Query  2131  DRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLS  1952
             +++ CCNPV K GPVS+DHVL AL+ETKEERD+RIRSLFSFFD+ N GYLDYAQIE GLS
Sbjct  10    NQTGCCNPVKKSGPVSIDHVLLALRETKEERDVRIRSLFSFFDAGNLGYLDYAQIEAGLS  69

Query  1951  AMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPE  1772
              +QI A YK+AKELL V DAN DGRVDY +FR YMDDKE+ELYRIFQAIDVEH+G ILPE
Sbjct  70    GLQIPAGYKYAKELLEVCDANCDGRVDYQDFRSYMDDKEMELYRIFQAIDVEHNGCILPE  129

Query  1771  ELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLER  1592
             ELWDALVKAGIEID++ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ER
Sbjct  130   ELWDALVKAGIEIDEEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWER  189

Query  1591  VCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIM  1412
             VC VDIGEQAVIPEGISKHVH SKY IAGGVAGAASRTATAPLDRLKVVLQVQTTRA ++
Sbjct  190   VCHVDIGEQAVIPEGISKHVHRSKYFIAGGVAGAASRTATAPLDRLKVVLQVQTTRACMV  249

Query  1411  PAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAK-GDEGDIGTSGR  1235
             PA+  IWKE G  GFFRGNG+NVLKVAPESAIKFY YEMLKNAIG  K GD+ DIG  GR
Sbjct  250   PAINKIWKEEGFLGFFRGNGLNVLKVAPESAIKFYAYEMLKNAIGEVKGGDKVDIGPGGR  309

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVP  1055
             L+AGG+AGAVAQTAIYP+DLVKTRLQTY CEGGK PHLG L+KDIW++EGPRAFY+G+VP
Sbjct  310   LLAGGMAGAVAQTAIYPLDLVKTRLQTYVCEGGKAPHLGALTKDIWIQEGPRAFYKGLVP  369

Query  1054  SLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVR  875
             SLLGIIPYAGIDLA Y+ LK+ ++TY+L DSEPGPLVQL  GTISG+LGATCVYPLQV+R
Sbjct  370   SLLGIIPYAGIDLAAYETLKDMSKTYMLHDSEPGPLVQLCCGTISGSLGATCVYPLQVIR  429

Query  874   TRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKK  695
             TRMQAQP      YKGM DVF RTF++EG  GFYKG+FPNLLKVVPA SITY+VYE+ KK
Sbjct  430   TRMQAQPPSNGAPYKGMSDVFWRTFQNEGYSGFYKGIFPNLLKVVPAVSITYMVYEATKK  489

Query  694   TLDLD  680
              LDLD
Sbjct  490   KLDLD  494



>ref|XP_011040298.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Populus euphratica]
Length=514

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/514 (76%), Positives = 441/514 (86%), Gaps = 11/514 (2%)
 Frame = -1

Query  2188  MSGAGEAV-----GHVNFPAMTAK-----DRSECCNPVMKPGPVSMDHVLAALQETKEER  2039
             M+GAG AV      HVN P M        +++ CCNPV KPGPVS+DHVL AL+ETKEER
Sbjct  1     MAGAGNAVEHHRRHHVNLPKMETDTNPNPNQTGCCNPVKKPGPVSLDHVLLALRETKEER  60

Query  2038  DIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEF  1859
             D+RIRSLFSFFD+ N GYLDYAQIE GLS +QI A+YK+AK+LL+V DAN+DGRVDY EF
Sbjct  61    DVRIRSLFSFFDAANLGYLDYAQIEAGLSGLQIPAEYKYAKDLLKVCDANRDGRVDYQEF  120

Query  1858  RKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDG  1679
             R+YMDDKE+ELYRIFQAIDVEH+G ILPEELWDALVKAGIEIDD+ELA FVEHVDKDN+G
Sbjct  121   RRYMDDKEMELYRIFQAIDVEHNGCILPEELWDALVKAGIEIDDEELAHFVEHVDKDNNG  180

Query  1678  VITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGV  1499
             +ITFEEWRDFLLLYPHEATIENIY + ERVC VDIGEQAVIPEGISK VH SKY IAGG+
Sbjct  181   IITFEEWRDFLLLYPHEATIENIYHHWERVCHVDIGEQAVIPEGISKQVHRSKYFIAGGI  240

Query  1498  AGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESA  1319
             AGAASRTATAPLDRLKV LQ+QT+ A + P +  IWKE G  GFFRGNG+NV+KVAPESA
Sbjct  241   AGAASRTATAPLDRLKVFLQIQTSCARLAPIINKIWKEEGFLGFFRGNGLNVVKVAPESA  300

Query  1318  IKFYTYEMLKNAIGHAK-GDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCE  1142
             IKFY YEMLK+ IG  K GD+ DIG  GRL+AGG+AGAVAQTAIYPMDLVKTRLQT  CE
Sbjct  301   IKFYAYEMLKDVIGDVKGGDKVDIGPGGRLLAGGMAGAVAQTAIYPMDLVKTRLQTGVCE  360

Query  1141  GGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDS  962
             GGK P LG L KDIW+ EGPRAFYRG+VPSLLGIIPYAGIDLA Y+ LK+ ++TYILQDS
Sbjct  361   GGKAPKLGVLMKDIWVLEGPRAFYRGLVPSLLGIIPYAGIDLAAYETLKDMSKTYILQDS  420

Query  961   EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLR  782
              PGPLVQL  GTISGALGATCVYPLQV+RTRMQAQP + +  YKGM DVF RTF++EG R
Sbjct  421   APGPLVQLCCGTISGALGATCVYPLQVIRTRMQAQPPNDARPYKGMSDVFWRTFQNEGCR  480

Query  781   GFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             GFYKG+FPNLLKVVPAASITY+VYE+MKK+L+LD
Sbjct  481   GFYKGIFPNLLKVVPAASITYMVYEAMKKSLELD  514



>ref|XP_006436988.1| hypothetical protein CICLE_v10031301mg [Citrus clementina]
 gb|ESR50228.1| hypothetical protein CICLE_v10031301mg [Citrus clementina]
 gb|KDO57644.1| hypothetical protein CISIN_1g040619mg [Citrus sinensis]
Length=504

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/502 (77%), Positives = 440/502 (88%), Gaps = 2/502 (0%)
 Frame = -1

Query  2185  SGAGEAVGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFF  2006
             +GAG AV  V  P M +  RS  CNPV K GPV+MDHVL AL+E+KEERDIRIRSLF+FF
Sbjct  4     AGAGHAVERVGLPKMEST-RSASCNPVRKSGPVTMDHVLLALRESKEERDIRIRSLFNFF  62

Query  2005  DSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELEL  1826
             D+ N+GYLDYAQIE GLSA+QI A YK+AK+L +V DAN+DGRVDY EFR+YMD KE+EL
Sbjct  63    DAANSGYLDYAQIESGLSALQIPAQYKYAKDLFKVCDANRDGRVDYQEFRRYMDIKEMEL  122

Query  1825  YRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFL  1646
             Y+IFQ IDVEH+G ILPEELWDALVKAGIEI D+ELARFVEHVDKDN+G+ITFEEWRDFL
Sbjct  123   YKIFQTIDVEHNGCILPEELWDALVKAGIEISDEELARFVEHVDKDNNGIITFEEWRDFL  182

Query  1645  LLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAP  1466
             LLYPHEATIENIY + ERVCLVDIGEQAVIPEGISKHV  SKY IAGG+AGAASRTATAP
Sbjct  183   LLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVQRSKYFIAGGIAGAASRTATAP  242

Query  1465  LDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKN  1286
             LDRLKVVLQVQT +A ++P ++ IWKE G  GFFRGNG+NVLKVAPESAIKF+ YE+LKN
Sbjct  243   LDRLKVVLQVQTAQARLVPTIRKIWKEEGFLGFFRGNGLNVLKVAPESAIKFHAYELLKN  302

Query  1285  AIGHAKGDE-GDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLS  1109
             AIG   G+E  DIG  GRL+AGG+AGAVAQTAIYP+DLVKTRLQT+ CEGGK P+LG L+
Sbjct  303   AIGDYIGEEKDDIGAFGRLLAGGMAGAVAQTAIYPLDLVKTRLQTHACEGGKAPNLGTLT  362

Query  1108  KDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSG  929
             KDI + EGPRAFY+G+VPSLLGIIPYAGIDLA Y+ LK+ +RTYIL DSEPGPLVQLG G
Sbjct  363   KDILVHEGPRAFYKGLVPSLLGIIPYAGIDLAAYETLKDLSRTYILTDSEPGPLVQLGCG  422

Query  928   TISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLL  749
             TISGALGATCVYPLQV+RTRMQAQ + ++ AYKGM DVF RT ++EG RGFYKG+FPNLL
Sbjct  423   TISGALGATCVYPLQVIRTRMQAQRSKSAAAYKGMSDVFWRTLQNEGYRGFYKGIFPNLL  482

Query  748   KVVPAASITYLVYESMKKTLDL  683
             KVVPAASITY+VYE+MKKTLDL
Sbjct  483   KVVPAASITYMVYETMKKTLDL  504



>ref|XP_006485062.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Citrus sinensis]
Length=504

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/502 (77%), Positives = 440/502 (88%), Gaps = 2/502 (0%)
 Frame = -1

Query  2185  SGAGEAVGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFF  2006
             +GAG AV  V  P M +  RS  CNPV K GPV+MDHVL AL+E+KEERDIRIRSLF+FF
Sbjct  4     AGAGHAVERVGLPKMEST-RSASCNPVRKSGPVTMDHVLLALRESKEERDIRIRSLFNFF  62

Query  2005  DSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELEL  1826
             D+ N+GYLDYAQIE GLSA+QI A YK+AK+L +V DAN+DGRVDY EFR+YMD KE+EL
Sbjct  63    DAANSGYLDYAQIESGLSALQIPAQYKYAKDLFKVCDANRDGRVDYQEFRRYMDIKEMEL  122

Query  1825  YRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFL  1646
             Y+IFQ IDVEH+G ILPEELWDALVKAGIEI D+ELARFVEHVDKDN+G+ITFEEWRDFL
Sbjct  123   YKIFQTIDVEHNGCILPEELWDALVKAGIEISDEELARFVEHVDKDNNGIITFEEWRDFL  182

Query  1645  LLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAP  1466
             LLYPHEATIENIY + ERVCLVDIGEQAVIPEGISKHV  SKY IAGG+AGAASRTATAP
Sbjct  183   LLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVQRSKYFIAGGIAGAASRTATAP  242

Query  1465  LDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKN  1286
             LDRLKVVLQVQT +A ++P ++ IWKE G  GFFRGNG+NVLKVAPESAIKF+ YE+LKN
Sbjct  243   LDRLKVVLQVQTAQARLVPTIRKIWKEEGFLGFFRGNGLNVLKVAPESAIKFHAYELLKN  302

Query  1285  AIGHAKGDE-GDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLS  1109
             AIG   G+E  DIG  GRL+AGG+AGAVAQTAIYP+DLVKTRLQT+ CEGGK P+LG L+
Sbjct  303   AIGDYIGEEKDDIGAFGRLLAGGMAGAVAQTAIYPLDLVKTRLQTHACEGGKAPNLGTLT  362

Query  1108  KDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSG  929
             KDI + EGPRAFY+G+VPSLLGIIPYAGIDLA Y+ LK+ +RTYIL DSEPGPLVQLG G
Sbjct  363   KDILVHEGPRAFYKGLVPSLLGIIPYAGIDLAAYETLKDLSRTYILTDSEPGPLVQLGCG  422

Query  928   TISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLL  749
             TISGALGATCVYPLQV+RTRMQAQ + ++ +YKGM DVF RT ++EG RGFYKG+FPNLL
Sbjct  423   TISGALGATCVYPLQVIRTRMQAQRSKSAASYKGMSDVFWRTLQNEGYRGFYKGIFPNLL  482

Query  748   KVVPAASITYLVYESMKKTLDL  683
             KVVPAASITY+VYE+MKKTLDL
Sbjct  483   KVVPAASITYMVYETMKKTLDL  504



>gb|EYU21768.1| hypothetical protein MIMGU_mgv1a004864mg [Erythranthe guttata]
Length=507

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/482 (81%), Positives = 432/482 (90%), Gaps = 8/482 (2%)
 Frame = -1

Query  2125  SECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAM  1946
             S CCNPV KPGPVS+DHVL+AL+ETKEER+ RIRSLF FFDS+NAGYLD A IE+GLSAM
Sbjct  34    SGCCNPVKKPGPVSLDHVLSALRETKEERESRIRSLFGFFDSNNAGYLDSALIEKGLSAM  93

Query  1945  QIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEEL  1766
             QI ADYKFAKELL V DAN+DGRVDY EFRKYMDDKELELYRIFQAIDVEH+G ILPEEL
Sbjct  94    QIPADYKFAKELLSVCDANRDGRVDYQEFRKYMDDKELELYRIFQAIDVEHNGCILPEEL  153

Query  1765  WDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVC  1586
             WDALVKAGIE+DDDELA FVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIYRY ERV 
Sbjct  154   WDALVKAGIELDDDELASFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYRYFERVY  213

Query  1585  LVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPA  1406
             LVDIGE AVIPEGIS+HV ASKYLIAGGVAGAASRTATAPLDRLKV+LQVQTTRASI PA
Sbjct  214   LVDIGEHAVIPEGISRHVDASKYLIAGGVAGAASRTATAPLDRLKVILQVQTTRASIGPA  273

Query  1405  VKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIA  1226
             V+SIWKEGG+ GFFRGNGINVLKVAPESAIKFYTYE LK+ IG +    GDIGT GRL +
Sbjct  274   VQSIWKEGGLLGFFRGNGINVLKVAPESAIKFYTYEKLKSVIGDSN---GDIGTLGRLAS  330

Query  1225  GGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLL  1046
             GGLAGAVAQT+IYPMDLVKTRLQTY CE GKVP+LG+LS++IW++EGPRA Y+G++PSLL
Sbjct  331   GGLAGAVAQTSIYPMDLVKTRLQTYVCESGKVPNLGKLSREIWVKEGPRALYKGLIPSLL  390

Query  1045  GIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRM  866
             GIIPYAGIDLA Y+ LK+ +R +ILQD EPGPLVQL  GT+SGALGATCVYPLQVVRTRM
Sbjct  391   GIIPYAGIDLAAYETLKDMSRKHILQDGEPGPLVQLSCGTVSGALGATCVYPLQVVRTRM  450

Query  865   QAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLD  686
             QA+    S     M +VF RTF+ EGLRGFYKG+FPNLLKVVP+ASITYLVYE+MKK+L 
Sbjct  451   QAERIRCS-----MSEVFRRTFQMEGLRGFYKGIFPNLLKVVPSASITYLVYEAMKKSLA  505

Query  685   LD  680
             LD
Sbjct  506   LD  507



>ref|XP_009415359.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=515

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/515 (76%), Positives = 451/515 (88%), Gaps = 12/515 (2%)
 Frame = -1

Query  2188  MSGAGEAVGH-VNFPAMT-----AKD-----RSECCNPVMKPGPVSMDHVLAALQETKEE  2042
             MSGA +AV   + FPA       A D     R   CNPV KPGPVSMDHVL AL+ETKEE
Sbjct  1     MSGATKAVEERILFPAKMEEAAPASDGEQWRRPGGCNPVKKPGPVSMDHVLLALRETKEE  60

Query  2041  RDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPE  1862
             R++RIRSLF+FFD+   G+LDY QIE GLSA+ I A+YK+A++LL+V DAN+DGRVDY E
Sbjct  61    REVRIRSLFNFFDAAGVGHLDYVQIEAGLSALCIPAEYKYARDLLKVCDANRDGRVDYQE  120

Query  1861  FRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDND  1682
             FR+Y+DDKELELYRIFQAIDVEH+G ILPEELWDAL+KAGIEIDD+EL RFVEHVDKDN+
Sbjct  121   FRRYLDDKELELYRIFQAIDVEHNGCILPEELWDALIKAGIEIDDEELVRFVEHVDKDNN  180

Query  1681  GVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGG  1502
             G+ITFEEWRDFLLLYPHEATIENIY+Y E+VCLVDIGEQAVIPEGISKHV+ASKYLIAGG
Sbjct  181   GIITFEEWRDFLLLYPHEATIENIYQYWEKVCLVDIGEQAVIPEGISKHVNASKYLIAGG  240

Query  1501  VAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPES  1322
             +AGAASRT TAPLDRLKVVLQV+TT+A IMPA+K IW++G   GFFRGNG+NV+KVAPES
Sbjct  241   LAGAASRTVTAPLDRLKVVLQVRTTQARIMPAIKDIWRDGRFLGFFRGNGLNVMKVAPES  300

Query  1321  AIKFYTYEMLKNAIGHAKGDE-GDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTC  1145
             AIKFYT+EMLK+ I  AKG+E  DIG SGRLIAGGLAGAVAQTAIYP+DLVKTRLQTY C
Sbjct  301   AIKFYTFEMLKDFIVTAKGEEKSDIGASGRLIAGGLAGAVAQTAIYPLDLVKTRLQTYAC  360

Query  1144  EGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQD  965
             EGGKVP+L  L+KDIW+ EGPRAFY+G++PSLLGIIPYAGIDL+ Y+ LK+ +RTYIL+D
Sbjct  361   EGGKVPNLATLTKDIWVHEGPRAFYKGLIPSLLGIIPYAGIDLSAYETLKDMSRTYILKD  420

Query  964   SEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGL  785
             SEPGPLVQLG GTISGALGATCVYPLQV+RTRMQAQ T++S+AY GM DVF +T R+EG 
Sbjct  421   SEPGPLVQLGCGTISGALGATCVYPLQVIRTRMQAQHTNSSSAYNGMSDVFWKTLRNEGF  480

Query  784   RGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
              GFYKG+ PNLLKV+P+ASITYLVYE+MKK+L LD
Sbjct  481   SGFYKGIIPNLLKVMPSASITYLVYETMKKSLYLD  515



>dbj|BAJ53112.1| JHL07K02.2 [Jatropha curcas]
 gb|KDP22518.1| hypothetical protein JCGZ_26349 [Jatropha curcas]
Length=505

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/505 (77%), Positives = 443/505 (88%), Gaps = 3/505 (1%)
 Frame = -1

Query  2188  MSGAGEAVGH-VNFPAMTAK-DRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLF  2015
             MSGAG AV   V FP M A  D   CCNPV KPGP++MDHVL AL+ETKEERD+RIRSLF
Sbjct  1     MSGAGHAVERRVPFPEMEANSDSCGCCNPVKKPGPITMDHVLLALRETKEERDVRIRSLF  60

Query  2014  SFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKE  1835
             +FFD+ N GYLDYAQIE GLSA+QI A+YK+AK+LL+V DA++DGRV+Y EFR+YMDDKE
Sbjct  61    NFFDAGNTGYLDYAQIEAGLSALQIPAEYKYAKDLLKVCDADRDGRVNYQEFRRYMDDKE  120

Query  1834  LELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWR  1655
             LELYRIFQAIDVEH+G ILPEEL+DALVKAGIEIDD+ELARFVEHVDKDN+G+ITFEEWR
Sbjct  121   LELYRIFQAIDVEHNGCILPEELYDALVKAGIEIDDEELARFVEHVDKDNNGIITFEEWR  180

Query  1654  DFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTA  1475
             DFLLLYPHEATIENIY++ ERVCLVDIGEQAVIPEGISKHVH SKY IAGG+AGAASRTA
Sbjct  181   DFLLLYPHEATIENIYQHWERVCLVDIGEQAVIPEGISKHVHRSKYFIAGGIAGAASRTA  240

Query  1474  TAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEM  1295
             TAPLDRLKVVLQVQTT A I+PA+K I +E G  GFFRGNG+NV+KVAPESAIKFY YE+
Sbjct  241   TAPLDRLKVVLQVQTTHAHIVPAIKKILREDGFLGFFRGNGLNVVKVAPESAIKFYAYEL  300

Query  1294  LKNAIGHAKGDEGD-IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLG  1118
             LKN IG  KG   D IG + RL AGG+AGAVAQT IYP+DLVKTRLQTY  +GGK P +G
Sbjct  301   LKNVIGDIKGGSQDVIGPAERLFAGGMAGAVAQTVIYPLDLVKTRLQTYVSKGGKAPKVG  360

Query  1117  RLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQL  938
              L+KDIW++EGPRAFY+G+VPSLLGIIPYAGIDLA Y+ LK+ ++ YI+ DSEPG LVQL
Sbjct  361   ALTKDIWVQEGPRAFYKGLVPSLLGIIPYAGIDLAAYETLKDMSKKYIVHDSEPGQLVQL  420

Query  937   GSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFP  758
             G GTISGALGATCVYPLQV+RTR+QAQ ++++ AYKGM DVF RT  +EG RGFYKGLFP
Sbjct  421   GCGTISGALGATCVYPLQVIRTRLQAQHSNSAAAYKGMSDVFWRTLENEGYRGFYKGLFP  480

Query  757   NLLKVVPAASITYLVYESMKKTLDL  683
             NLLKVVPAASITYLVYE+MKK+LDL
Sbjct  481   NLLKVVPAASITYLVYEAMKKSLDL  505



>ref|XP_011084688.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-A 
[Sesamum indicum]
Length=491

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/504 (79%), Positives = 430/504 (85%), Gaps = 30/504 (6%)
 Frame = -1

Query  2161  HVNFPA-------MTAKD---RSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFS  2012
             H NFPA         AKD   R  CCNPV KPGP+S+DHVL+A                 
Sbjct  8     HANFPAPAAATMASEAKDTQARPGCCNPVKKPGPISLDHVLSAF----------------  51

Query  2011  FFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKEL  1832
             FFDS+N GYLDYA IE+GLSAMQI ADYKFAKELL V D+N+DGRVDY EFRKYMDDKEL
Sbjct  52    FFDSNNVGYLDYALIEKGLSAMQIPADYKFAKELLEVCDSNQDGRVDYQEFRKYMDDKEL  111

Query  1831  ELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRD  1652
             ELYRIFQAIDVEH+G I+PEELWDALVK+GIEIDDDELA FVEHVDKDN+G+ITFEEWRD
Sbjct  112   ELYRIFQAIDVEHNGCIMPEELWDALVKSGIEIDDDELASFVEHVDKDNNGIITFEEWRD  171

Query  1651  FLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTAT  1472
             FLLLYPHEATIENIYRY ERV LVDIGE AVIPEGISKHVHA+KYLIAGGVAGAASRTAT
Sbjct  172   FLLLYPHEATIENIYRYWERVYLVDIGEHAVIPEGISKHVHATKYLIAGGVAGAASRTAT  231

Query  1471  APLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEML  1292
             APLDRLKV+LQVQTT+ASI PAVK+IWKEGG+ GFFRGNGINVLKVAPESAIKFYTYE+L
Sbjct  232   APLDRLKVILQVQTTQASIGPAVKNIWKEGGLLGFFRGNGINVLKVAPESAIKFYTYELL  291

Query  1291  KNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRL  1112
             KN I    GD GDIGT GRL+AGGLAGAVAQTAIYPMDLVKTRLQTY+CE G VP LG+L
Sbjct  292   KNFI----GDSGDIGTPGRLVAGGLAGAVAQTAIYPMDLVKTRLQTYSCEKGNVPKLGKL  347

Query  1111  SKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGS  932
             SKDI ++EGPRAFYRG+VPSLLGIIPYAGIDLA Y+ALK+ +R YIL D EPGPLVQL  
Sbjct  348   SKDILIQEGPRAFYRGLVPSLLGIIPYAGIDLAAYEALKDMSRKYILHDGEPGPLVQLSC  407

Query  931   GTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNL  752
             GTISGALGATCVYPLQVVRTRMQAQ T +   Y  M DVF RT+ HEGLRGFYKGLFPNL
Sbjct  408   GTISGALGATCVYPLQVVRTRMQAQHTTSGAPYSSMSDVFWRTYNHEGLRGFYKGLFPNL  467

Query  751   LKVVPAASITYLVYESMKKTLDLD  680
             LKVVPAASITYLVYE+MKK+LDLD
Sbjct  468   LKVVPAASITYLVYEAMKKSLDLD  491



>ref|XP_010099534.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Morus 
notabilis]
 gb|EXB79414.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Morus 
notabilis]
Length=517

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/517 (76%), Positives = 443/517 (86%), Gaps = 14/517 (3%)
 Frame = -1

Query  2188  MSGAGEAVGHVN-FPAM-----------TAKDRSECCNPVMKPGPVSMDHVLAALQETKE  2045
             MSG G AV HV  FP M           +A     CCNPV KPGP +MDHVL AL+ETKE
Sbjct  1     MSGPGPAVEHVGGFPKMEPKPKPKSPSSSAGAGDGCCNPVKKPGPATMDHVLLALRETKE  60

Query  2044  ERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYP  1865
             ERD+RIRSLF FFD+ N GYLDYAQIE GLSA+QI  +YK+A++L RV DAN+DGRVDY 
Sbjct  61    ERDLRIRSLFGFFDATNLGYLDYAQIEAGLSALQIPGEYKYARDLFRVCDANRDGRVDYC  120

Query  1864  EFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDN  1685
             EFR+YMD KELELYRIFQAIDVEH+G ILPEELWDALVKAGI++DD+ELARFVEHVDKDN
Sbjct  121   EFRRYMDAKELELYRIFQAIDVEHNGCILPEELWDALVKAGIQMDDEELARFVEHVDKDN  180

Query  1684  DGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAG  1505
             +G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGE AVIPEGI+KHVH S+Y IAG
Sbjct  181   NGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEHAVIPEGIAKHVHRSRYFIAG  240

Query  1504  GVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPE  1325
             G+AGAASRTATAPLDRLKV+LQVQ T A I PA+K I KEGG  GFFRGNGINV+KVAPE
Sbjct  241   GIAGAASRTATAPLDRLKVILQVQKTNAHIGPAIKKILKEGGFLGFFRGNGINVVKVAPE  300

Query  1324  SAIKFYTYEMLKNAIGHAK-GDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYT  1148
             SAIKFY YEMLK+ IG  K GD+GDIG +GRL+AGG+AGAVAQTAIYP+DLVKTRLQTY 
Sbjct  301   SAIKFYVYEMLKSVIGDFKGGDKGDIGATGRLLAGGMAGAVAQTAIYPLDLVKTRLQTYA  360

Query  1147  CEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQ  968
             CEGGKVP L +L+KDIW++EGPRAFY+G++PSLLG+IPYAGIDLA Y+ LK+ ++TYIL 
Sbjct  361   CEGGKVPKLTKLTKDIWVQEGPRAFYKGLLPSLLGMIPYAGIDLAAYETLKDMSKTYILH  420

Query  967   D-SEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHE  791
             + SEPGPL QLG GTISGA GATCVYPLQV+RTRMQAQ + ++ AYKGM DVF RT R E
Sbjct  421   NSSEPGPLFQLGCGTISGAAGATCVYPLQVIRTRMQAQQSSSADAYKGMADVFWRTLREE  480

Query  790   GLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             G RGFYKGLFPNLLKVVPAASITYLVYE+MKK+LDLD
Sbjct  481   GYRGFYKGLFPNLLKVVPAASITYLVYETMKKSLDLD  517



>ref|XP_002511072.1| Succinate/fumarate mitochondrial transporter, putative [Ricinus 
communis]
 gb|EEF51674.1| Succinate/fumarate mitochondrial transporter, putative [Ricinus 
communis]
Length=510

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/510 (76%), Positives = 444/510 (87%), Gaps = 8/510 (2%)
 Frame = -1

Query  2188  MSGAGEAVGH-VNFPAMTAK-----DRSECCNPVMKPGPVSMDHVLAALQETKEERDIRI  2027
             MSGAG AV H V  P M        +RS CCNPV KPGP++MDHVL AL+ETKEERD+R+
Sbjct  1     MSGAGHAVDHRVGLPEMEKNQNPNPNRSGCCNPVKKPGPITMDHVLLALRETKEERDLRL  60

Query  2026  RSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYM  1847
             RSLF+FFD+ N GYLDYAQIE GLSA+QI  +YK+AK+LL+V DAN+DGRVDY EFR+YM
Sbjct  61    RSLFNFFDAKNIGYLDYAQIEVGLSALQIPGEYKYAKDLLKVCDANRDGRVDYQEFRRYM  120

Query  1846  DDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITF  1667
             DDKELELYRIFQAIDVEH+G ILPEELWDALVKAGIEIDD+ELARFVEHVDKDN+G+ITF
Sbjct  121   DDKELELYRIFQAIDVEHNGCILPEELWDALVKAGIEIDDEELARFVEHVDKDNNGIITF  180

Query  1666  EEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAA  1487
             EEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVIPEGISKHVH SKY IAGG+AGAA
Sbjct  181   EEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVHRSKYFIAGGIAGAA  240

Query  1486  SRTATAPLDRLKVVLQVQTTRASIMPAVKSIW-KEGGISGFFRGNGINVLKVAPESAIKF  1310
             SRTATAPLDRLKVVLQVQT  A ++PA+K IW K+GG  GFFRGNG+NV+KVAPESAIKF
Sbjct  241   SRTATAPLDRLKVVLQVQTEDARLVPAIKKIWKKDGGFLGFFRGNGLNVVKVAPESAIKF  300

Query  1309  YTYEMLKNAIGHAKGDEGD-IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGK  1133
             Y YE+LKN I    G + D IG   RL+AGG+AGAVAQTAIYP+DLVKTRLQT+ CEGGK
Sbjct  301   YAYELLKNVIVDINGGDKDVIGPGERLLAGGMAGAVAQTAIYPLDLVKTRLQTHPCEGGK  360

Query  1132  VPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPG  953
             VP +G L++DI ++EGPRAFY+G+VPSLLGIIPYAGIDLA Y+ LK+ ++TY L+D+EPG
Sbjct  361   VPKVGALTRDILVQEGPRAFYKGLVPSLLGIIPYAGIDLAAYETLKDMSKTYFLRDTEPG  420

Query  952   PLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFY  773
             PLVQLG G  SGALGATCVYPLQV+RTRMQAQ  +++ AYKGM DVF RT ++EG +GFY
Sbjct  421   PLVQLGCGMFSGALGATCVYPLQVIRTRMQAQHYNSAAAYKGMSDVFWRTLQNEGYKGFY  480

Query  772   KGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             KGLFPNLLKVVPAASITYLVYE+MKK+LDL
Sbjct  481   KGLFPNLLKVVPAASITYLVYEAMKKSLDL  510



>ref|XP_008375423.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X1 [Malus domestica]
Length=511

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/508 (76%), Positives = 442/508 (87%), Gaps = 5/508 (1%)
 Frame = -1

Query  2191  AMSGAGEAVGHVNFPA--MTAKDRSE-CCNPVMKPGPVSMDHVLAALQETKEERDIRIRS  2021
             A   A E VG  N  A   TA  ++E CCNPV K GP+SMDHVL AL+ETKE+RD+RIRS
Sbjct  4     AKPAAAEHVGFANVDANKSTATAKAEGCCNPVKKSGPISMDHVLLALRETKEDRDVRIRS  63

Query  2020  LFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDD  1841
             LF+FFD+++ GYLDY+QIE GLSA+QI  +YK+A +LL+V DAN+DGRVDY EFR+YMDD
Sbjct  64    LFNFFDAEDLGYLDYSQIEAGLSALQIPPEYKYANDLLKVCDANRDGRVDYLEFRRYMDD  123

Query  1840  KELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEE  1661
             KELELYRIFQAIDVEH+G ILPEELWDALVKAGIE+DD+ELARFVEHVDKDN+G+ITFEE
Sbjct  124   KELELYRIFQAIDVEHNGCILPEELWDALVKAGIEMDDEELARFVEHVDKDNNGIITFEE  183

Query  1660  WRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASR  1481
             WRDFLLLYPHEATIENIY + ERV LVDIGEQAVIPEGI +HVH S+Y IAG VAGAASR
Sbjct  184   WRDFLLLYPHEATIENIYHHWERVFLVDIGEQAVIPEGIGRHVHRSRYFIAGAVAGAASR  243

Query  1480  TATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTY  1301
             TATAPLDRLKVVLQVQT+RAS++PA+K I K+ GI GFFRGNGINV+KVAPESAIKFYTY
Sbjct  244   TATAPLDRLKVVLQVQTSRASVVPAIKKILKDDGILGFFRGNGINVVKVAPESAIKFYTY  303

Query  1300  EMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPH  1124
             EMLK  IG   G DE DIGT+GRL+AGG+AGAVAQT+IYP+DLVKTRLQT T E GK P 
Sbjct  304   EMLKKVIGDNMGADESDIGTAGRLLAGGMAGAVAQTSIYPLDLVKTRLQTCTSEAGKSPQ  363

Query  1123  LGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQD-SEPGPL  947
             L  L+K+IW+ EGPRAFY+G+ PSLLGI+PYAGIDLA Y+ LK+ ++TY L D SEPGPL
Sbjct  364   LRTLTKEIWIHEGPRAFYKGLFPSLLGIVPYAGIDLAAYETLKDMSKTYFLHDNSEPGPL  423

Query  946   VQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKG  767
             +QLG GTISGALGATCVYPLQV+RTR+QAQ ++T+TAYKGM DVF RT +HEG RGFYKG
Sbjct  424   IQLGCGTISGALGATCVYPLQVIRTRLQAQRSNTATAYKGMSDVFWRTIQHEGYRGFYKG  483

Query  766   LFPNLLKVVPAASITYLVYESMKKTLDL  683
             LFPNLLKVVPAASITY+VYE+MKK LDL
Sbjct  484   LFPNLLKVVPAASITYMVYEAMKKKLDL  511



>ref|XP_009360281.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009360283.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Pyrus x bretschneideri]
Length=511

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/511 (75%), Positives = 443/511 (87%), Gaps = 9/511 (2%)
 Frame = -1

Query  2188  MSGAGEAVG-HVNFPAMTAKDRSE------CCNPVMKPGPVSMDHVLAALQETKEERDIR  2030
             MSGA  A   HV FP + A   +       CCNPV K GP+SMDHVL AL+ETKE+R++R
Sbjct  1     MSGAKPAAAEHVGFPNVDANKSTAIAKGEGCCNPVKKSGPISMDHVLLALRETKEDREVR  60

Query  2029  IRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKY  1850
             IRSLF+FFD+++ GYLDY+QIE GLSA+QI  +YK+A +LL+V DAN+DGRVDY EFR+Y
Sbjct  61    IRSLFNFFDAEDLGYLDYSQIEAGLSALQIPPEYKYANDLLKVCDANRDGRVDYLEFRRY  120

Query  1849  MDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVIT  1670
             MDDKELELYRIFQAIDVEH+G ILPEELWDALVKAGIE+DD+ELARFVEHVDKDN+G+IT
Sbjct  121   MDDKELELYRIFQAIDVEHNGCILPEELWDALVKAGIEMDDEELARFVEHVDKDNNGIIT  180

Query  1669  FEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGA  1490
             FEEWRDFLLLYPHEATIENIY + ERV LVDIGEQAVIPEGI +HVH S+Y IAG VAGA
Sbjct  181   FEEWRDFLLLYPHEATIENIYHHWERVFLVDIGEQAVIPEGIGRHVHRSRYFIAGAVAGA  240

Query  1489  ASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKF  1310
             ASRTATAPLDRLKVVLQVQT+RAS++PA+K I K+ GI GFFRGNGINV+KVAPESAIKF
Sbjct  241   ASRTATAPLDRLKVVLQVQTSRASVVPAIKKILKDDGILGFFRGNGINVVKVAPESAIKF  300

Query  1309  YTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGK  1133
             YTYEMLK  IG   G DEGDIGT+GRL+AGG+AGAVAQT+IYP+DLVKTRLQT T E GK
Sbjct  301   YTYEMLKKVIGDNMGADEGDIGTAGRLLAGGMAGAVAQTSIYPLDLVKTRLQTCTSEAGK  360

Query  1132  VPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQD-SEP  956
              P L  L+K+IW+ EGPRAFY+G+ PSLLGI+PYAGIDLA Y+ LK+ ++TY L D SEP
Sbjct  361   SPRLRTLTKEIWIHEGPRAFYKGLCPSLLGIVPYAGIDLATYETLKDMSKTYFLHDNSEP  420

Query  955   GPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGF  776
             GPL+QLG GT+SGALGATCVYPLQV+RTR+QAQ ++T+TAYKGM DVF RT +HEG RGF
Sbjct  421   GPLIQLGCGTVSGALGATCVYPLQVIRTRLQAQRSNTATAYKGMSDVFWRTLQHEGYRGF  480

Query  775   YKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             YKGLFPNLLKVVPAASITY+VYE+MKK LDL
Sbjct  481   YKGLFPNLLKVVPAASITYMVYEAMKKKLDL  511



>ref|XP_007209924.1| hypothetical protein PRUPE_ppa004514mg [Prunus persica]
 gb|EMJ11123.1| hypothetical protein PRUPE_ppa004514mg [Prunus persica]
Length=505

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/505 (78%), Positives = 441/505 (87%), Gaps = 3/505 (1%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAKDRSE--CCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLF  2015
             MSGA  A  HV FP   A   S   CCNPV K GP+SMDHVL AL+ETKEER+IR+RSLF
Sbjct  1     MSGAKPAAEHVGFPNGDANKPSADGCCNPVKKSGPISMDHVLLALRETKEEREIRLRSLF  60

Query  2014  SFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKE  1835
             +FFD+ N GYLDY QIE GLSA+QI  +YK+AK+LL+V DAN+DGRVDY EFR+YMDDKE
Sbjct  61    NFFDATNLGYLDYPQIEAGLSALQIPPEYKYAKDLLKVCDANRDGRVDYLEFRRYMDDKE  120

Query  1834  LELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWR  1655
             LELYRIFQAIDVEH+G ILPEELWDALVKAGIE+DD+ELARFVEHVDKDN+G+ITFEEWR
Sbjct  121   LELYRIFQAIDVEHNGCILPEELWDALVKAGIEMDDEELARFVEHVDKDNNGIITFEEWR  180

Query  1654  DFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTA  1475
             DFLLLYPHEATIENIY + ERVCLVDIGEQAVIPEGIS+HVH S+Y IAG +AGAASRTA
Sbjct  181   DFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISRHVHRSRYFIAGAIAGAASRTA  240

Query  1474  TAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEM  1295
             TAPLDRLKVVLQVQT RAS++PA+K I KE GI GFFRGNGINV+KVAPESAIKFYTYEM
Sbjct  241   TAPLDRLKVVLQVQTARASVVPAIKKILKEDGILGFFRGNGINVVKVAPESAIKFYTYEM  300

Query  1294  LKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLG  1118
             LK  IG + G D GDIGTSGRL+AGG+AGAVAQT+IYP+DLVKTRLQT T E GK P L 
Sbjct  301   LKKVIGDSMGADSGDIGTSGRLLAGGIAGAVAQTSIYPLDLVKTRLQTCTSEAGKSPQLR  360

Query  1117  RLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQL  938
              L+K+IW+ EGPRAFY+G+ PSLLGIIPYAGIDL  Y+ LK+ +RTYILQDSEPGPL+QL
Sbjct  361   TLTKEIWIHEGPRAFYKGLFPSLLGIIPYAGIDLTAYETLKDMSRTYILQDSEPGPLIQL  420

Query  937   GSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFP  758
             G GTISGALGATCVYPLQV+RTR+QAQ ++T+ AYKGM DVF RT ++EG  GFYKGLFP
Sbjct  421   GCGTISGALGATCVYPLQVIRTRLQAQRSNTAAAYKGMSDVFWRTLQNEGYTGFYKGLFP  480

Query  757   NLLKVVPAASITYLVYESMKKTLDL  683
             NLLKVVPAASITY+VYE+MKK LDL
Sbjct  481   NLLKVVPAASITYMVYEAMKKKLDL  505



>ref|XP_008245874.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X1 [Prunus mume]
Length=505

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/505 (78%), Positives = 441/505 (87%), Gaps = 3/505 (1%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAKDRSE--CCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLF  2015
             MSGA  A  HV FP   A   S   CCNPV K GP+SMDHVL AL+ETKEER+IR+RSLF
Sbjct  1     MSGAKPASEHVGFPNGDANKPSADGCCNPVKKSGPISMDHVLLALRETKEEREIRLRSLF  60

Query  2014  SFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKE  1835
             +FFD+ N GYLDY QIE GLSA+QI  +YK+AK+LL+V DAN+DGRVDY EFR+YMDDKE
Sbjct  61    NFFDATNLGYLDYPQIEAGLSALQIPPEYKYAKDLLKVCDANRDGRVDYLEFRRYMDDKE  120

Query  1834  LELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWR  1655
             LELYRIFQAIDVEH+G ILPEELWDALVKAGIE+DD+ELARFVEHVDKDN+G+ITFEEWR
Sbjct  121   LELYRIFQAIDVEHNGCILPEELWDALVKAGIEMDDEELARFVEHVDKDNNGIITFEEWR  180

Query  1654  DFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTA  1475
             DFLLLYPHEATIENIY + ERVCLVDIGEQAVIPEGIS+HVH S+Y IAG +AGAASRTA
Sbjct  181   DFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISRHVHRSRYFIAGAIAGAASRTA  240

Query  1474  TAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEM  1295
             TAPLDRLKVVLQVQT RAS++PA+K I KE GI GFFRGNGINV+KVAPESAIKFYTYEM
Sbjct  241   TAPLDRLKVVLQVQTARASVVPAIKKILKEDGILGFFRGNGINVVKVAPESAIKFYTYEM  300

Query  1294  LKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLG  1118
             LK  IG   G D GDIGTSGRL+AGG+AGAVAQT+IYP+DLVKTRLQT T E GK P L 
Sbjct  301   LKKVIGDGMGEDSGDIGTSGRLLAGGIAGAVAQTSIYPLDLVKTRLQTCTSEAGKSPQLR  360

Query  1117  RLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQL  938
              L+K+IW+ EGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ +RTYILQDSEPGPL+QL
Sbjct  361   TLTKEIWIHEGPRAFYKGLFPSLLGIIPYAGIDLAAYETLKDMSRTYILQDSEPGPLIQL  420

Query  937   GSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFP  758
             G GTISGALGATCVYPLQV+RTR+QAQ ++T+ AYKGM DVF RT ++EG  GFYKGLFP
Sbjct  421   GCGTISGALGATCVYPLQVIRTRLQAQRSNTAAAYKGMSDVFWRTLQNEGYTGFYKGLFP  480

Query  757   NLLKVVPAASITYLVYESMKKTLDL  683
             NLLKVVPAASITY+VYE+MKK LDL
Sbjct  481   NLLKVVPAASITYMVYEAMKKKLDL  505



>ref|XP_003524327.2| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like 
isoform X1 [Glycine max]
 ref|XP_006580382.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like 
isoform X2 [Glycine max]
Length=500

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/506 (76%), Positives = 438/506 (87%), Gaps = 9/506 (2%)
 Frame = -1

Query  2188  MSGAGEAVG--HVNFPAMTAKD-RSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSL  2018
             MSGAG+A+   HV F    A   R +      K GPVSMDHVL AL+ETKEERD+RIRSL
Sbjct  1     MSGAGQAIDMEHVGFSKAKADHGRGK------KTGPVSMDHVLLALRETKEERDLRIRSL  54

Query  2017  FSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDK  1838
             F+FFD+ N GYLDYA IE GLSA+QI  +YK+AKEL +V DA++DGR+DY +FR+YMDDK
Sbjct  55    FNFFDAANNGYLDYAHIEAGLSALQIPPEYKYAKELFKVCDADRDGRIDYRDFRRYMDDK  114

Query  1837  ELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEW  1658
             ELELYRIFQAIDVEH+G ILPEELWDALVKAGIEID++ELARFVEHVDKDN+G+ITFEEW
Sbjct  115   ELELYRIFQAIDVEHNGCILPEELWDALVKAGIEIDEEELARFVEHVDKDNNGIITFEEW  174

Query  1657  RDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRT  1478
             RDFLLLYPHEATIENIY + ERVCLVDIGEQAVIPEGISKHVH S+Y IAGG+AGAASRT
Sbjct  175   RDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVHRSRYFIAGGIAGAASRT  234

Query  1477  ATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYE  1298
             ATAPLDRLKVVLQVQT RASIMPAV  IWK+ G+ GFFRGNG+NV+KVAPESAIKFY YE
Sbjct  235   ATAPLDRLKVVLQVQTGRASIMPAVMKIWKQDGLLGFFRGNGLNVVKVAPESAIKFYAYE  294

Query  1297  MLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLG  1118
             MLKN IG A+  + DIGT+GRL AGG+AGAVAQ AIYPMDLVKTRLQT   +GG+VP L 
Sbjct  295   MLKNVIGDAQDGKSDIGTAGRLFAGGMAGAVAQMAIYPMDLVKTRLQTCASDGGRVPKLV  354

Query  1117  RLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQL  938
              L+KDIW+ EGPRAFYRG+VPSLLG+IPYAGIDL  YD LK+ ++ YIL DS+PGPLVQL
Sbjct  355   TLTKDIWVHEGPRAFYRGLVPSLLGMIPYAGIDLTAYDTLKDLSKRYILYDSDPGPLVQL  414

Query  937   GSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFP  758
             G GT+SGALGATCVYPLQV+RTR+QAQP ++++AYKGM DVF +T + EG RGFYKGL P
Sbjct  415   GCGTVSGALGATCVYPLQVIRTRLQAQPANSTSAYKGMSDVFWKTLKDEGFRGFYKGLIP  474

Query  757   NLLKVVPAASITYLVYESMKKTLDLD  680
             NLLKVVPAASITY+VYESMKK+LDLD
Sbjct  475   NLLKVVPAASITYMVYESMKKSLDLD  500



>ref|XP_009399747.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=514

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/512 (75%), Positives = 441/512 (86%), Gaps = 8/512 (2%)
 Frame = -1

Query  2212  EGSGFLAAMSGAGEAVGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDI  2033
             E SGF A M  A  A G         + R + CNPV KPGPVSMDHVL AL+ET EER++
Sbjct  10    ERSGFSAKMDAAPAAEGE-------QRRRPDGCNPVKKPGPVSMDHVLLALRETGEEREV  62

Query  2032  RIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRK  1853
             R+RSLF+FFD+   G+LDYAQI+ GLSA+++ A+YK+A++LL+V DAN+DGRVDY EFR+
Sbjct  63    RVRSLFNFFDAAGVGHLDYAQIDSGLSALRVPAEYKYARDLLKVCDANRDGRVDYQEFRR  122

Query  1852  YMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVI  1673
             YMDDKELELYRIFQAIDVEH+G ILPEELWDAL+KAGI+IDD+ELARFVEHVDKDN+G+I
Sbjct  123   YMDDKELELYRIFQAIDVEHNGCILPEELWDALIKAGIDIDDEELARFVEHVDKDNNGII  182

Query  1672  TFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAG  1493
             TFEEWRDFLLLYPHEATIENIY+Y ERVCLVDIGEQAVIPEGISKHV+ SKYLIAGGVAG
Sbjct  183   TFEEWRDFLLLYPHEATIENIYQYWERVCLVDIGEQAVIPEGISKHVNPSKYLIAGGVAG  242

Query  1492  AASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIK  1313
             AASRTATAPLDRLKV LQVQTTRA I+PA+K IW+EGG   FFRGNG+NV+KV PESAIK
Sbjct  243   AASRTATAPLDRLKVALQVQTTRARILPAIKDIWREGGFLSFFRGNGLNVIKVTPESAIK  302

Query  1312  FYTYEMLKNAIGHAKGDE-GDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG  1136
             FYT+E+LK+ I   KG+E  +IG S RLIAGG+AGAV+QT IYPMDLVKTRLQTY CE G
Sbjct  303   FYTFEILKDFIVKGKGEEKSNIGASERLIAGGIAGAVSQTVIYPMDLVKTRLQTYACEAG  362

Query  1135  KVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEP  956
             KVP+L  L++DIW+ EGPRAFYRGIVPSLLGIIP+AGIDLA Y+ LK+ +RTYIL++S+P
Sbjct  363   KVPNLAMLTRDIWVHEGPRAFYRGIVPSLLGIIPFAGIDLAAYETLKDMSRTYILKNSDP  422

Query  955   GPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGF  776
             GPL+QLG GTIS ALGATCVYPLQV+RTRMQAQ T+ S  Y GM DVF RT ++EGL GF
Sbjct  423   GPLMQLGCGTISSALGATCVYPLQVIRTRMQAQRTNPSNNYYGMSDVFWRTLKNEGLLGF  482

Query  775   YKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             YKG+ PNLLKVVPAA ITYLVYE+MKK+L LD
Sbjct  483   YKGIIPNLLKVVPAAGITYLVYETMKKSLSLD  514



>ref|XP_009373667.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X1 [Pyrus x bretschneideri]
Length=513

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/513 (76%), Positives = 446/513 (87%), Gaps = 11/513 (2%)
 Frame = -1

Query  2188  MSGAGEAVG-HVNFPAMTAKDRSE--------CCNPVMKPGPVSMDHVLAALQETKEERD  2036
             MSGA  A   HV FP + A   +         CCNPV K GP+SMDHVL AL+ETKE+R+
Sbjct  1     MSGAKPAAAEHVGFPNVDANKSNASATARADGCCNPVKKTGPISMDHVLLALRETKEDRE  60

Query  2035  IRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFR  1856
             +RIRSLF+FFD+ N GYLDY+QIE GLSA+QI  +YK+AK+LL+V DAN+DGRVDY EFR
Sbjct  61    VRIRSLFNFFDAKNLGYLDYSQIEAGLSALQIPPEYKYAKDLLKVCDANRDGRVDYLEFR  120

Query  1855  KYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGV  1676
             +YMDDKELELYRIFQAIDVEH+G ILPEELWDALVKAGIE+DD ELARFVEHVDKDN+G+
Sbjct  121   RYMDDKELELYRIFQAIDVEHNGCILPEELWDALVKAGIEMDDKELARFVEHVDKDNNGI  180

Query  1675  ITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVA  1496
             ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVIPEGI KHVH S+Y IAG +A
Sbjct  181   ITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGIGKHVHRSRYFIAGAIA  240

Query  1495  GAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAI  1316
             GAASRTATAPLDRLKVVLQVQT+RAS++PA+K I KE GI GFFRGNGINV+KVAPESAI
Sbjct  241   GAASRTATAPLDRLKVVLQVQTSRASVVPAIKKILKEDGILGFFRGNGINVVKVAPESAI  300

Query  1315  KFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEG  1139
             KFYTYEMLK  IG   G DEGDIGT+GRL+AGG+AGAVAQT+IYP+DLVKTRLQT T E 
Sbjct  301   KFYTYEMLKKVIGDNMGADEGDIGTAGRLLAGGMAGAVAQTSIYPLDLVKTRLQTCTSEA  360

Query  1138  GKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQD-S  962
             GK P LG L+++IW+ EGPRAFYRG++PS+LGI+PY GIDLA Y+ALK+ ++TY L D S
Sbjct  361   GKSPQLGTLTREIWIHEGPRAFYRGLLPSVLGIVPYTGIDLAAYEALKDMSKTYFLHDNS  420

Query  961   EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLR  782
             EPGPL+QLG GTISGALGATCVYPLQV+RTR+QAQ ++T+TAYKGM DVF RT +HEG+R
Sbjct  421   EPGPLIQLGCGTISGALGATCVYPLQVIRTRLQAQRSNTATAYKGMSDVFWRTLQHEGVR  480

Query  781   GFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             GFYKGLFPNLLKVVPAASITY+VYE+MKK LDL
Sbjct  481   GFYKGLFPNLLKVVPAASITYMVYEAMKKKLDL  513



>ref|XP_002277297.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Vitis vinifera]
 emb|CBI21256.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/485 (79%), Positives = 431/485 (89%), Gaps = 2/485 (0%)
 Frame = -1

Query  2128  RSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSA  1949
             RS  CNPV KPGPVSM+HVL AL+ET+E+R+ RIRSLF+FFD+ NAGYLDYAQIE GLSA
Sbjct  5     RSSGCNPVRKPGPVSMEHVLLALRETEEQREQRIRSLFNFFDAANAGYLDYAQIEAGLSA  64

Query  1948  MQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEE  1769
             + I A+YK+A +LL V DAN+DGRVDY EFR+YMDDKELELYRIFQAIDVEH+G I PE 
Sbjct  65    LCIPAEYKYANDLLNVCDANRDGRVDYQEFRRYMDDKELELYRIFQAIDVEHNGCISPEG  124

Query  1768  LWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERV  1589
             L+DALV+AGI+IDD+ELARFVE VDKDN+GVITFEEWRDFLLL PHEATIENIY YLERV
Sbjct  125   LFDALVRAGIKIDDEELARFVERVDKDNNGVITFEEWRDFLLLCPHEATIENIYHYLERV  184

Query  1588  CLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMP  1409
             CLVDIGEQ VIPEGISKHVH S+YLIAGGVAGA SRTATAPLDRLKVVLQVQTT A I+P
Sbjct  185   CLVDIGEQTVIPEGISKHVHPSRYLIAGGVAGATSRTATAPLDRLKVVLQVQTTEARILP  244

Query  1408  AVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAK--GDEGDIGTSGR  1235
             A+K IWKEG   GFFRGNG+NV+KVAPESAI+FYTYEMLK  + +AK  GD+ +IG  GR
Sbjct  245   ALKDIWKEGRFLGFFRGNGLNVMKVAPESAIRFYTYEMLKTFVVNAKGGGDKAEIGIMGR  304

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVP  1055
             L +GGLAGAVAQTAIYPMDLVKTRLQT   EGGKVP+LG LSKDI + EGPRAFYRG+VP
Sbjct  305   LFSGGLAGAVAQTAIYPMDLVKTRLQTCALEGGKVPNLGALSKDILVHEGPRAFYRGLVP  364

Query  1054  SLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVR  875
             SL+GIIPYAGIDL  Y++LK+ ++TYI  D+EPGPL+QLG GTISGALGATCVYPLQV+R
Sbjct  365   SLIGIIPYAGIDLTAYESLKDLSKTYIFHDTEPGPLLQLGCGTISGALGATCVYPLQVIR  424

Query  874   TRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKK  695
             TRMQAQPT+ + AYKGM DVF +TF+HEG RGFYKGLFPNLLKVVP+ASITYLVYE+MKK
Sbjct  425   TRMQAQPTNKADAYKGMSDVFRKTFQHEGFRGFYKGLFPNLLKVVPSASITYLVYETMKK  484

Query  694   TLDLD  680
             +L+LD
Sbjct  485   SLELD  489



>ref|XP_008389298.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Malus domestica]
Length=513

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/513 (76%), Positives = 449/513 (88%), Gaps = 11/513 (2%)
 Frame = -1

Query  2188  MSGAGEAVG-HVNFPAM-------TAKDRSE-CCNPVMKPGPVSMDHVLAALQETKEERD  2036
             MSGA  A   HV+F  +       +A  R++ CCNPV K GP+SMDHVL AL+ETKE+R+
Sbjct  1     MSGAKPAAAEHVSFSKVDVNKSTASATARADGCCNPVKKTGPISMDHVLLALRETKEDRE  60

Query  2035  IRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFR  1856
             +RIRSLF+FFD++N GYLDY+QIE GLSA+QI  +YK+AK+LL+V DAN+DGRVDYPEFR
Sbjct  61    VRIRSLFNFFDAENLGYLDYSQIEAGLSALQIPPEYKYAKDLLKVCDANRDGRVDYPEFR  120

Query  1855  KYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGV  1676
             +YMDDKELELYRIFQAIDVEH+G ILPEELWDALVKAGIE+DD+ELARFVEHVDKDN+G+
Sbjct  121   RYMDDKELELYRIFQAIDVEHNGCILPEELWDALVKAGIEMDDEELARFVEHVDKDNNGI  180

Query  1675  ITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVA  1496
             ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVIPEGI KHVH S+Y IAG +A
Sbjct  181   ITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGIGKHVHRSRYFIAGAIA  240

Query  1495  GAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAI  1316
             GAASRTATAPLDRLKVVLQVQT+RAS++PA+K I KE GI GFFRGNG NV+KVAPESAI
Sbjct  241   GAASRTATAPLDRLKVVLQVQTSRASVVPAIKKILKEDGILGFFRGNGXNVVKVAPESAI  300

Query  1315  KFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEG  1139
             KFYTYEMLK  IG   G +EGDIGT+GRL+AGG+AGAVAQT+IYP+DLVKTRLQT T E 
Sbjct  301   KFYTYEMLKKVIGDNMGABEGDIGTAGRLLAGGMAGAVAQTSIYPLDLVKTRLQTCTSEA  360

Query  1138  GKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQD-S  962
             GK P LG L+++IW+ EGPRAFY+G++PSLLGI+PYAGIDL  Y+ LK+ ++TY L D S
Sbjct  361   GKSPRLGTLTREIWIHEGPRAFYKGLLPSLLGIVPYAGIDLTAYETLKDMSKTYFLHDNS  420

Query  961   EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLR  782
             EPGPL+QLG GTISGALGATCVYPLQV+RTR+QAQ ++T+TAYKGM DVF RT +HEG R
Sbjct  421   EPGPLIQLGCGTISGALGATCVYPLQVIRTRLQAQRSNTATAYKGMSDVFWRTLQHEGYR  480

Query  781   GFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             GFYKGLFPNLLKVVPAASITY+VYE+MKK LDL
Sbjct  481   GFYKGLFPNLLKVVPAASITYMVYEAMKKKLDL  513



>gb|KEH20957.1| substrate carrier family protein [Medicago truncatula]
Length=505

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/474 (77%), Positives = 425/474 (90%), Gaps = 0/474 (0%)
 Frame = -1

Query  2101  KPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKF  1922
             KPG +SMDHVL AL+ETKEERD+RIRSLF+FFD+ N GYLDYA IE GLSA+QI  +YK+
Sbjct  32    KPGSISMDHVLLALRETKEERDVRIRSLFNFFDATNKGYLDYANIEAGLSALQIPPEYKY  91

Query  1921  AKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAG  1742
             AKEL ++ DA++DGR+DY +FR+YMDDKELELYRIFQAIDVEH+G ILPEELWDALVKAG
Sbjct  92    AKELFKICDADRDGRIDYHDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDALVKAG  151

Query  1741  IEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQA  1562
             IEID+ ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEAT+ENIY++ ERVCLVDIGEQA
Sbjct  152   IEIDEVELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATLENIYQHWERVCLVDIGEQA  211

Query  1561  VIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEG  1382
             VIPEGISKHVH S+Y IAGG+AGAASRTATAPLDRLKVVLQ+QT +ASIMPAV  IW+  
Sbjct  212   VIPEGISKHVHRSRYFIAGGIAGAASRTATAPLDRLKVVLQIQTGKASIMPAVMKIWQRD  271

Query  1381  GISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVA  1202
             G+ GFFRGNG+NV+KVAPESAIKFY YEMLKN IG  +G++ DIGT+GRL AGG+AGA+A
Sbjct  272   GLLGFFRGNGLNVVKVAPESAIKFYAYEMLKNVIGDRQGNKSDIGTAGRLFAGGMAGAIA  331

Query  1201  QTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGI  1022
             Q AIYP+DL+KTRLQT   EGG+ P+LG L+KDIW++EGPRAFYRG+VPSLLG+IPYAGI
Sbjct  332   QIAIYPLDLIKTRLQTCASEGGRAPNLGTLTKDIWIQEGPRAFYRGLVPSLLGMIPYAGI  391

Query  1021  DLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTS  842
             DL  YD LK+ ++ YI+ D EPGPLVQLG GT+SGALGATCVYPLQV+RTR+QAQPT+TS
Sbjct  392   DLTAYDTLKDISKKYIISDHEPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQAQPTNTS  451

Query  841   TAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             +AYKGM DVF +T + EG RGFYKGL PNLLKVVPAASITY+VYE+MKK LDLD
Sbjct  452   SAYKGMSDVFWKTLKDEGFRGFYKGLIPNLLKVVPAASITYMVYENMKKNLDLD  505



>ref|XP_006468929.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Citrus sinensis]
Length=490

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/489 (77%), Positives = 431/489 (88%), Gaps = 3/489 (1%)
 Frame = -1

Query  2137  AKDRSECCNPVMKPG-PVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIER  1961
             A  +S   NPV K G  V+M+HVL AL E+KEER+ RIR+LF+FFD +N+GYLDYA+IE 
Sbjct  2     ATQQSNGINPVKKAGTSVTMEHVLLALGESKEEREQRIRALFNFFDVNNSGYLDYAKIEA  61

Query  1960  GLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGI  1781
             GLS++ I ++YK+A++LL V D+N+DGRV+Y EFR+YMDDKELELYRIFQAIDVEH+GGI
Sbjct  62    GLSSLNIPSEYKYARDLLNVCDSNQDGRVEYQEFRRYMDDKELELYRIFQAIDVEHNGGI  121

Query  1780  LPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRY  1601
             LPEEL+ ALVKAGIEIDD+ELA FVE VDKDN+GVITFEEWRDFLLLYPHEAT+ENIY Y
Sbjct  122   LPEELYHALVKAGIEIDDEELATFVERVDKDNNGVITFEEWRDFLLLYPHEATMENIYHY  181

Query  1600  LERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA  1421
             LERVCLVDIGEQA IPEGISKHVHA++YLIAGGVAGA SRTATAPLDRLKVVLQVQTTRA
Sbjct  182   LERVCLVDIGEQAAIPEGISKHVHANRYLIAGGVAGATSRTATAPLDRLKVVLQVQTTRA  241

Query  1420  SIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE--GDIG  1247
              IMPA++ IW++GGISGFFRGNG+NVLKVAPESAI+FYTYE LK  I   KGDE   +IG
Sbjct  242   HIMPAIRDIWRDGGISGFFRGNGLNVLKVAPESAIRFYTYERLKKLIAKVKGDEEKANIG  301

Query  1246  TSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYR  1067
              SGRL AGGLAGAVAQTAIYPMDLVKTRLQTY CEGGKVP +G +S+DI ++EGPRAFYR
Sbjct  302   ASGRLFAGGLAGAVAQTAIYPMDLVKTRLQTYVCEGGKVPKIGAMSRDILVQEGPRAFYR  361

Query  1066  GIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPL  887
             G+VPSLLGIIPYAGIDLA Y++ K  ++ YIL DSEPGPLVQLG GT SGALGATCVYPL
Sbjct  362   GLVPSLLGIIPYAGIDLAAYESFKEMSKKYILHDSEPGPLVQLGCGTFSGALGATCVYPL  421

Query  886   QVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYE  707
             QVVRTRMQAQ  +T  AY GM DVF RTF+ EGLRGFYKGLFPNLLKVVP+ASITY+VYE
Sbjct  422   QVVRTRMQAQRMNTEGAYAGMSDVFKRTFKSEGLRGFYKGLFPNLLKVVPSASITYMVYE  481

Query  706   SMKKTLDLD  680
             +MKK+L+L+
Sbjct  482   AMKKSLELE  490



>ref|XP_006446900.1| hypothetical protein CICLE_v10015032mg [Citrus clementina]
 gb|ESR60140.1| hypothetical protein CICLE_v10015032mg [Citrus clementina]
Length=490

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/489 (77%), Positives = 432/489 (88%), Gaps = 3/489 (1%)
 Frame = -1

Query  2137  AKDRSECCNPVMKPG-PVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIER  1961
             A  +S   NPV K G  V+M+HVL AL E+KEER+ RIR+LF+FFD +N+GYLDYA+IE 
Sbjct  2     ATQQSNGSNPVKKAGTSVTMEHVLLALGESKEEREQRIRALFNFFDVNNSGYLDYAKIEA  61

Query  1960  GLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGI  1781
             GLS++ I ++YK+A++LL V D+N+DGRV+Y EFR+YMDDKELELYRIFQAIDVEH+GGI
Sbjct  62    GLSSLNIPSEYKYARDLLNVCDSNQDGRVEYQEFRRYMDDKELELYRIFQAIDVEHNGGI  121

Query  1780  LPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRY  1601
             LPEEL+ ALVKAGIEIDD+ELA FVE VDKDN+GVITFEEWRDFLLLYPHEAT+ENIY Y
Sbjct  122   LPEELYHALVKAGIEIDDEELATFVERVDKDNNGVITFEEWRDFLLLYPHEATMENIYHY  181

Query  1600  LERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA  1421
             LERVCLVDIGEQA IPEGISKHVHA++YLI+GGVAGA SRTATAPLDRLKVVLQVQTTRA
Sbjct  182   LERVCLVDIGEQAAIPEGISKHVHANRYLISGGVAGATSRTATAPLDRLKVVLQVQTTRA  241

Query  1420  SIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE--GDIG  1247
              IMPA++ IW++GGISGFFRGNG+NV+KVAPESAIKFYTYE LK  I   +GDE   +IG
Sbjct  242   HIMPAIRDIWRDGGISGFFRGNGLNVIKVAPESAIKFYTYERLKKLIAKVEGDEEKTNIG  301

Query  1246  TSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYR  1067
              SGRL AGGLAGAVAQTAIYPMDLVKTRLQTY CEGGKVP +G +S+DI ++EGPRAFYR
Sbjct  302   ASGRLFAGGLAGAVAQTAIYPMDLVKTRLQTYVCEGGKVPKIGAMSRDILVQEGPRAFYR  361

Query  1066  GIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPL  887
             G+VPSLLGIIPYAGIDLA Y++ K  ++ YIL DSEPGPLVQLG GT SGALGATCVYPL
Sbjct  362   GLVPSLLGIIPYAGIDLAAYESFKEMSKKYILHDSEPGPLVQLGCGTFSGALGATCVYPL  421

Query  886   QVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYE  707
             QVVRTRMQAQ  +T +AY GM DVF RTF+ EGLRGFYKGLFPNLLKVVP+ASITY+VYE
Sbjct  422   QVVRTRMQAQRMNTESAYTGMSDVFKRTFKSEGLRGFYKGLFPNLLKVVPSASITYMVYE  481

Query  706   SMKKTLDLD  680
             +MKK+L+L+
Sbjct  482   AMKKSLELE  490



>gb|KHN16895.1| Calcium-binding mitochondrial carrier protein SCaMC-2 [Glycine 
soja]
Length=492

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/494 (76%), Positives = 429/494 (87%), Gaps = 4/494 (1%)
 Frame = -1

Query  2161  HVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYL  1982
             HV F      D         K GPVSMDHVL AL+ETK+ERD+RIRSLF+FFD+ N GYL
Sbjct  3     HVGFSKAAITDHGRG----KKTGPVSMDHVLLALRETKDERDLRIRSLFNFFDAANNGYL  58

Query  1981  DYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAID  1802
             DYA IE GLSA+QI  +YK+AKEL +V DA++DGR+DY +FR+YMDDKELELYRIFQAID
Sbjct  59    DYAHIEAGLSALQIPPEYKYAKELFKVCDADRDGRIDYRDFRRYMDDKELELYRIFQAID  118

Query  1801  VEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEAT  1622
             VEH+G ILPEELWDALVKAGIEID++ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEAT
Sbjct  119   VEHNGCILPEELWDALVKAGIEIDEEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEAT  178

Query  1621  IENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVL  1442
             IENIY + ERVCLVDIGEQAVIPEGISKHVH S+Y IAGG+AGAASRTATAPLDRLKV+L
Sbjct  179   IENIYHHWERVCLVDIGEQAVIPEGISKHVHRSRYFIAGGIAGAASRTATAPLDRLKVLL  238

Query  1441  QVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGD  1262
             QVQT RASIMPAV  IW++ G+ GFFRGNG+NV+KVAPESAIKFY YEMLKN IG A+  
Sbjct  239   QVQTGRASIMPAVMKIWRQDGLLGFFRGNGLNVVKVAPESAIKFYAYEMLKNVIGDAQDG  298

Query  1261  EGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGP  1082
             + DIGT+GRL AGG+AGAVAQ AIYPMDLVKTRLQT   +GG+VP LG L+KDIW+ EGP
Sbjct  299   KSDIGTAGRLFAGGMAGAVAQMAIYPMDLVKTRLQTCASDGGRVPKLGTLTKDIWVHEGP  358

Query  1081  RAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGAT  902
             RAFYRG+VPSLLG+IPYAGIDL  YD LK+ ++ YIL DS+PGPLVQLG GT+SGALGAT
Sbjct  359   RAFYRGLVPSLLGMIPYAGIDLTAYDTLKDLSKRYILYDSDPGPLVQLGCGTVSGALGAT  418

Query  901   CVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASIT  722
             CVYPLQV+RTR+QAQP ++++AYKGM DVF +T + EG RGFYKGL PNLLKVVPAASIT
Sbjct  419   CVYPLQVIRTRLQAQPANSTSAYKGMSDVFWKTLKDEGFRGFYKGLIPNLLKVVPAASIT  478

Query  721   YLVYESMKKTLDLD  680
             Y+VYESMKK+LDL+
Sbjct  479   YMVYESMKKSLDLE  492



>ref|XP_003532301.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like 
[Glycine max]
Length=492

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/494 (76%), Positives = 429/494 (87%), Gaps = 4/494 (1%)
 Frame = -1

Query  2161  HVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYL  1982
             HV F      D         K GPVSMDHVL AL+ETK+ERD+RIRSLF+FFD+ N GYL
Sbjct  3     HVGFSKAAIADHGRG----KKTGPVSMDHVLLALRETKDERDLRIRSLFNFFDAANNGYL  58

Query  1981  DYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAID  1802
             DYA IE GLSA+QI  +YK+AKEL +V DA++DGR+DY +FR+YMDDKELELYRIFQAID
Sbjct  59    DYAHIEAGLSALQIPPEYKYAKELFKVCDADRDGRIDYRDFRRYMDDKELELYRIFQAID  118

Query  1801  VEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEAT  1622
             VEH+G ILPEELWDALVKAGIEID++ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEAT
Sbjct  119   VEHNGCILPEELWDALVKAGIEIDEEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEAT  178

Query  1621  IENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVL  1442
             IENIY + ERVCLVDIGEQAVIPEGISKHVH S+Y IAGG+AGAASRTATAPLDRLKV+L
Sbjct  179   IENIYHHWERVCLVDIGEQAVIPEGISKHVHRSRYFIAGGIAGAASRTATAPLDRLKVLL  238

Query  1441  QVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGD  1262
             QVQT RASIMPAV  IW++ G+ GFFRGNG+NV+KVAPESAIKFY YEMLKN IG A+  
Sbjct  239   QVQTGRASIMPAVMKIWRQDGLLGFFRGNGLNVVKVAPESAIKFYAYEMLKNVIGDAQDG  298

Query  1261  EGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGP  1082
             + DIGT+GRL AGG+AGAVAQ AIYPMDLVKTRLQT   +GG+VP LG L+KDIW+ EGP
Sbjct  299   KSDIGTAGRLFAGGMAGAVAQMAIYPMDLVKTRLQTCASDGGRVPKLGTLTKDIWVHEGP  358

Query  1081  RAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGAT  902
             RAFYRG+VPSLLG+IPYAGIDL  YD LK+ ++ YIL DS+PGPLVQLG GT+SGALGAT
Sbjct  359   RAFYRGLVPSLLGMIPYAGIDLTAYDTLKDLSKRYILYDSDPGPLVQLGCGTVSGALGAT  418

Query  901   CVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASIT  722
             CVYPLQV+RTR+QAQP ++++AYKGM DVF +T + EG RGFYKGL PNLLKVVPAASIT
Sbjct  419   CVYPLQVIRTRLQAQPANSTSAYKGMSDVFWKTLKDEGFRGFYKGLIPNLLKVVPAASIT  478

Query  721   YLVYESMKKTLDLD  680
             Y+VYESMKK+LDL+
Sbjct  479   YMVYESMKKSLDLE  492



>ref|XP_002321765.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
 gb|EEF05892.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
Length=505

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/496 (77%), Positives = 428/496 (86%), Gaps = 12/496 (2%)
 Frame = -1

Query  2131  DRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLS  1952
             +++ CCNPV KPGPVS+DHVL AL+ETKEERD+RIRSLFSFFD+ N GYLDYAQIE GLS
Sbjct  10    NQTGCCNPVKKPGPVSLDHVLLALRETKEERDVRIRSLFSFFDAANLGYLDYAQIEAGLS  69

Query  1951  AMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPE  1772
              +QI A+YK+AK+LL+V DAN+DGRVDY EFR+YMDDKE+ELYRIFQAIDVEH+G ILPE
Sbjct  70    GLQIPAEYKYAKDLLKVCDANRDGRVDYQEFRRYMDDKEMELYRIFQAIDVEHNGCILPE  129

Query  1771  ELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLER  1592
             ELWDALVK GIEIDD+ELA FVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ER
Sbjct  130   ELWDALVKDGIEIDDEELAHFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWER  189

Query  1591  VCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIM  1412
             VC VDIGEQAVIPEGISK VH SKY IAGG+AGAASRTATAPLDRLKV LQ+QT+ A + 
Sbjct  190   VCHVDIGEQAVIPEGISKQVHRSKYFIAGGIAGAASRTATAPLDRLKVFLQIQTSCARLA  249

Query  1411  PAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAK-GDEGDIGTSGR  1235
             P +  IWKE G  GFFRGNG+NV+KVAPESAIKFY YEMLK+ IG  K GD+ DIG  GR
Sbjct  250   PIINKIWKEEGFLGFFRGNGLNVVKVAPESAIKFYAYEMLKDVIGDFKGGDKVDIGPGGR  309

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVP  1055
             L+AGG+AGAVAQTAIYPMDLVKTRLQT  CEGGK P LG L KDIW+ EGPRAFYRG+VP
Sbjct  310   LLAGGMAGAVAQTAIYPMDLVKTRLQTGVCEGGKAPKLGVLMKDIWVLEGPRAFYRGLVP  369

Query  1054  SLLGIIPYAGIDLAVYDALKNFARTYILQDS-----------EPGPLVQLGSGTISGALG  908
             SLLGIIPYAGIDLA Y+ LK+ ++TYILQDS            PGPLVQL  GTISGALG
Sbjct  370   SLLGIIPYAGIDLAAYETLKDMSKTYILQDSGLCSENFAFSTAPGPLVQLCCGTISGALG  429

Query  907   ATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAAS  728
             ATCVYPLQV+RTRMQAQP + +  YKGM DVF RTF++EG RGFYKG+FPNLLKVVPAAS
Sbjct  430   ATCVYPLQVIRTRMQAQPPNDARPYKGMSDVFWRTFQNEGCRGFYKGIFPNLLKVVPAAS  489

Query  727   ITYLVYESMKKTLDLD  680
             ITY+VYE+MKK+L+LD
Sbjct  490   ITYMVYEAMKKSLELD  505



>ref|XP_007159945.1| hypothetical protein PHAVU_002G280600g [Phaseolus vulgaris]
 gb|ESW31939.1| hypothetical protein PHAVU_002G280600g [Phaseolus vulgaris]
Length=500

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/504 (75%), Positives = 436/504 (87%), Gaps = 5/504 (1%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAK-DRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFS  2012
             MSGAG+A+   N     AK D         K GPVSMDHVL AL+ETK+ERD+RIRSLF+
Sbjct  1     MSGAGQAIDMENVGFSKAKADHGRG----KKTGPVSMDHVLLALRETKDERDLRIRSLFN  56

Query  2011  FFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKEL  1832
             FFD+ N GYLDYA IE GLSA+QI  +YK+AKEL +V DA++DGR+DY +FR+YMDDKEL
Sbjct  57    FFDAANNGYLDYAHIEAGLSALQIPPEYKYAKELFKVCDADRDGRIDYRDFRRYMDDKEL  116

Query  1831  ELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRD  1652
             ELYRIFQAIDVEH+G ILPEELWDALV+AGIEID++ELARFVEHVDKDN+G+ITFEEWRD
Sbjct  117   ELYRIFQAIDVEHNGCILPEELWDALVRAGIEIDEEELARFVEHVDKDNNGIITFEEWRD  176

Query  1651  FLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTAT  1472
             FLLLYPHEATIENIY++ ERVCLVDIGEQAVIPEGI KHVH S+Y IAGG+AGAASRTAT
Sbjct  177   FLLLYPHEATIENIYQHWERVCLVDIGEQAVIPEGIGKHVHRSRYFIAGGIAGAASRTAT  236

Query  1471  APLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEML  1292
             APLDRLKVVLQ+QT RASIMPAV  IW+  G+ GFFRGNG+NV+KVAPESAIKFY YEML
Sbjct  237   APLDRLKVVLQIQTGRASIMPAVMKIWQRDGLLGFFRGNGLNVVKVAPESAIKFYAYEML  296

Query  1291  KNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRL  1112
             KN IG A+  + DIGT+GRL+AGG+AGAVAQ AIYPMDLVKTRLQT   +GG+VP LG L
Sbjct  297   KNVIGDAQQGKKDIGTAGRLLAGGMAGAVAQIAIYPMDLVKTRLQTCASDGGRVPKLGTL  356

Query  1111  SKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGS  932
             +KDIW+ EGPRAFYRG+VPSLLG+IPYAGIDL  YD LK+ ++ YIL DS+PGPLVQLG 
Sbjct  357   TKDIWVHEGPRAFYRGLVPSLLGMIPYAGIDLTAYDTLKDLSKRYILYDSDPGPLVQLGC  416

Query  931   GTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNL  752
             GTISGALGATCVYPLQV+RTR+QAQP +++ AYKGM DVF +T R EG RGFYKGL PNL
Sbjct  417   GTISGALGATCVYPLQVIRTRLQAQPINSTGAYKGMSDVFWKTLRDEGFRGFYKGLIPNL  476

Query  751   LKVVPAASITYLVYESMKKTLDLD  680
             LKVVPAASITY+VYE+MKK+LDL+
Sbjct  477   LKVVPAASITYMVYENMKKSLDLE  500



>gb|ABK25206.1| unknown [Picea sitchensis]
Length=511

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/511 (72%), Positives = 439/511 (86%), Gaps = 8/511 (2%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAM-----TAKD--RSECCNPVMKPGPVSMDHVLAALQETKEERDIR  2030
             MSGAG+AV  + F  M     T +D  R+ECCNPV   G  S++HV+ AL+ETKEER++R
Sbjct  1     MSGAGQAVDQIPFSKMESIPKTQQDNRRAECCNPVRNSGEASLEHVMLALRETKEERELR  60

Query  2029  IRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKY  1850
             IR LF+FFD+ N+G+LD +QIERGL A++I A+YK+AK+LL V D+N+DGRV+Y EFR+Y
Sbjct  61    IRCLFNFFDAMNSGHLDNSQIERGLQALRIPAEYKYAKDLLNVCDSNQDGRVEYQEFRRY  120

Query  1849  MDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVIT  1670
             MDDKELELYRIFQAIDVEH+G ILPEELW+ALVKAGIE+ D+ELARFVEH+DKDN+G+IT
Sbjct  121   MDDKELELYRIFQAIDVEHNGCILPEELWEALVKAGIEMSDEELARFVEHIDKDNNGIIT  180

Query  1669  FEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGA  1490
             FEEWRDFLLLYPHEATIENIYRY ERVC +DIGEQAVIPEGI++H HAS YLIAGGVAGA
Sbjct  181   FEEWRDFLLLYPHEATIENIYRYWERVCPIDIGEQAVIPEGINRHTHASNYLIAGGVAGA  240

Query  1489  ASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKF  1310
              SRTATAPLDRLKV+LQVQT+ A ++PA+ +I++EGG+ GFFRGNGINVLKVAPESAIKF
Sbjct  241   LSRTATAPLDRLKVILQVQTSGAHVIPAINNIFREGGLKGFFRGNGINVLKVAPESAIKF  300

Query  1309  YTYEMLKNAIGHAKGDEG-DIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGK  1133
             + YEM+KN + +  G+E  DIG  GRL AGG AGA+AQ  IYPMDLVKTRLQTYTCEGGK
Sbjct  301   FAYEMMKNFVVNINGEEKEDIGAFGRLFAGGTAGAIAQAVIYPMDLVKTRLQTYTCEGGK  360

Query  1132  VPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPG  953
             VP L +LSKDIW+ EGPRAFYRG++PSLLG+IPYAGIDLAVY+ LK+ +R Y+L+D +PG
Sbjct  361   VPKLSKLSKDIWVHEGPRAFYRGLLPSLLGMIPYAGIDLAVYETLKDMSRQYMLKDKDPG  420

Query  952   PLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFY  773
             P+VQLG GT+SGALGATCVYPLQ++RTR+QAQ  ++ + YKGM DVF +T +HEG  GFY
Sbjct  421   PIVQLGCGTVSGALGATCVYPLQLIRTRLQAQSMNSPSRYKGMSDVFWKTLQHEGFSGFY  480

Query  772   KGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             KGLFPNLLKV PAASITYLVYE MKK L LD
Sbjct  481   KGLFPNLLKVAPAASITYLVYEKMKKVLQLD  511



>ref|XP_008449675.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Cucumis melo]
 ref|XP_008449677.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Cucumis melo]
 ref|XP_008449678.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Cucumis melo]
 ref|XP_008449679.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Cucumis melo]
 ref|XP_008449680.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Cucumis melo]
 ref|XP_008449681.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Cucumis melo]
 ref|XP_008449682.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Cucumis melo]
 ref|XP_008449683.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Cucumis melo]
 ref|XP_008449684.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Cucumis melo]
Length=496

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/491 (76%), Positives = 432/491 (88%), Gaps = 3/491 (1%)
 Frame = -1

Query  2146  AMTAKDR--SECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYA  1973
             A+T   R  S CCNPV + GP+S++HVL AL+E+KEERD+RIRSLFSFFD+ N G+LDYA
Sbjct  7     ALTENPRRPSNCCNPVKQLGPISLEHVLLALRESKEERDLRIRSLFSFFDAANLGHLDYA  66

Query  1972  QIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEH  1793
             QIE GL A+QI A+YK+AK+LL+V DAN+DGRVDY EFR+YMDDKELELYRIFQAIDVEH
Sbjct  67    QIEAGLLALQIPAEYKYAKDLLKVCDANRDGRVDYNEFRRYMDDKELELYRIFQAIDVEH  126

Query  1792  SGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIEN  1613
             +G ILPEELWDALVKAGIEIDD+ELARFVEHVDKDN+G+ITFEEWRDFLL YPHEATIEN
Sbjct  127   NGCILPEELWDALVKAGIEIDDEELARFVEHVDKDNNGIITFEEWRDFLLFYPHEATIEN  186

Query  1612  IYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQ  1433
             IY + ERVCLVDIGEQAVIPEGISK+VH  +Y IAGG+AGAASRTATAPLDRLKV LQVQ
Sbjct  187   IYHHWERVCLVDIGEQAVIPEGISKYVHPFRYFIAGGIAGAASRTATAPLDRLKVALQVQ  246

Query  1432  TTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGD  1253
             TTRA I+PA+K IWKE  + GFFRGNG+NV+KVAPESAIKFYTYEMLK  I + + D+ D
Sbjct  247   TTRAWIIPAIKKIWKEDRLLGFFRGNGLNVVKVAPESAIKFYTYEMLKGMIANGE-DKHD  305

Query  1252  IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAF  1073
             IGT+GRL +GG+AGAVAQTAIYP+DL+KTRLQT++CEG KVP LG+L+KDIW+ EGPR F
Sbjct  306   IGTAGRLFSGGIAGAVAQTAIYPLDLLKTRLQTFSCEGEKVPRLGKLTKDIWVHEGPRVF  365

Query  1072  YRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVY  893
             Y+G+VPSLLGIIPYAGIDLA Y+ LK+ ++TYIL DS+PGPL QL  GTISGALGATCVY
Sbjct  366   YKGLVPSLLGIIPYAGIDLAAYETLKDVSKTYILHDSDPGPLTQLACGTISGALGATCVY  425

Query  892   PLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLV  713
             PLQV+RTRMQAQ ++   AY+GM DVF +T +HEG  GFYKGL PNLLKVVPAASITYLV
Sbjct  426   PLQVIRTRMQAQSSNRGAAYQGMSDVFRQTLKHEGYGGFYKGLLPNLLKVVPAASITYLV  485

Query  712   YESMKKTLDLD  680
             YE MKK L+LD
Sbjct  486   YERMKKWLELD  496



>ref|XP_004140204.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Cucumis sativus]
 ref|XP_004171411.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Cucumis sativus]
 gb|KGN48111.1| hypothetical protein Csa_6G434310 [Cucumis sativus]
Length=496

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/491 (76%), Positives = 434/491 (88%), Gaps = 3/491 (1%)
 Frame = -1

Query  2146  AMTAKDR--SECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYA  1973
             A+T   R  S CCNPV + GP+S++HVL AL+E+KEERD+RIRSLF+FFD+ N G+LDYA
Sbjct  7     ALTGNPRRPSNCCNPVKQLGPISLEHVLLALRESKEERDLRIRSLFNFFDAANLGHLDYA  66

Query  1972  QIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEH  1793
             QIE GL A+QI A+YK+AK+LL+V DAN+DGRVDY EFR+YMDDKELELYRIFQAIDVEH
Sbjct  67    QIEAGLLALQIPAEYKYAKDLLKVCDANRDGRVDYNEFRRYMDDKELELYRIFQAIDVEH  126

Query  1792  SGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIEN  1613
             +G ILPEELWDALVKAGIEIDD+ELARFVEHVDKDN+G+ITFEEWRDFLL YPHEATIEN
Sbjct  127   NGCILPEELWDALVKAGIEIDDEELARFVEHVDKDNNGIITFEEWRDFLLFYPHEATIEN  186

Query  1612  IYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQ  1433
             IY + ERVCLVDIGEQAVIPEGISK+VH  +Y IAGG+AGAASRTATAPLDRLKV LQVQ
Sbjct  187   IYHHWERVCLVDIGEQAVIPEGISKYVHPFRYFIAGGIAGAASRTATAPLDRLKVALQVQ  246

Query  1432  TTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGD  1253
             TT+A I+PA+K IWKE  + GFFRGNG+NV+KVAPESAIKFYTYEMLK+ I + + D+ D
Sbjct  247   TTQAWIIPAIKKIWKEDRLLGFFRGNGLNVVKVAPESAIKFYTYEMLKSMIANGE-DKHD  305

Query  1252  IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAF  1073
             IGT+GRL +GG+AGAVAQTAIYP+DL+KTRLQT++CEG KVP LG+L+KDIW+ EGPR F
Sbjct  306   IGTAGRLFSGGIAGAVAQTAIYPLDLLKTRLQTFSCEGEKVPRLGKLTKDIWVHEGPRVF  365

Query  1072  YRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVY  893
             Y+G+VPSLLGIIPYAGIDLA Y+ LK+ ++TYILQDS+PGPL QL  GTISGALGATCVY
Sbjct  366   YKGLVPSLLGIIPYAGIDLAAYETLKDVSKTYILQDSDPGPLTQLACGTISGALGATCVY  425

Query  892   PLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLV  713
             PLQV+RTRMQAQ ++   AY+GM DVF +T ++EG  GFYKGL PNLLKVVPAASITYLV
Sbjct  426   PLQVIRTRMQAQSSNKGAAYQGMSDVFRQTLKNEGYSGFYKGLLPNLLKVVPAASITYLV  485

Query  712   YESMKKTLDLD  680
             YE MKK L+LD
Sbjct  486   YERMKKWLELD  496



>ref|XP_008231225.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
isoform X1 [Prunus mume]
 ref|XP_008231226.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
isoform X1 [Prunus mume]
Length=495

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/493 (76%), Positives = 432/493 (88%), Gaps = 10/493 (2%)
 Frame = -1

Query  2146  AMTAKD---RSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDY  1976
             AM +K+   R   CNPV K GP+SMDHVL AL ETKE+R++RIR+LF+FFD+ N GYLDY
Sbjct  7     AMQSKEKAGRRNGCNPVTKGGPLSMDHVLLALGETKEQRELRIRNLFNFFDTANIGYLDY  66

Query  1975  AQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVE  1796
              QIE  LS +QI ++YK+AK+LL V DAN+DGRVDY EF++YMDDKELELY IFQAIDVE
Sbjct  67    TQIEAALSTLQIPSEYKYAKDLLNVCDANQDGRVDYQEFKRYMDDKELELYCIFQAIDVE  126

Query  1795  HSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIE  1616
             H+G ILPEELWDALV+AGIEIDD+ELARFVE VDKDN+GVITFEEWRDFLLL+PHEATIE
Sbjct  127   HNGCILPEELWDALVRAGIEIDDEELARFVERVDKDNNGVITFEEWRDFLLLFPHEATIE  186

Query  1615  NIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQV  1436
             NIY YLERVCLVDIGEQ VIPE ISKHVHAS+YLIAG VAGA SRTATAPLDRLKVVLQV
Sbjct  187   NIYHYLERVCLVDIGEQTVIPEVISKHVHASRYLIAGAVAGATSRTATAPLDRLKVVLQV  246

Query  1435  QTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--D  1262
             QT +A IMPA++ I++EGG+ GFFRGNG+NVLKVAPESAI+FYTYEMLKN I HA G  D
Sbjct  247   QTKQARIMPAIRDIFREGGLLGFFRGNGLNVLKVAPESAIRFYTYEMLKNFIVHANGEED  306

Query  1261  EGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGP  1082
             + +IGT+ RL++GGLAGAVAQT IYPMDLVKTR+QTY  EGG++P LG LS++IW++EG 
Sbjct  307   QANIGTATRLVSGGLAGAVAQTVIYPMDLVKTRIQTYAGEGGRIPSLGTLSREIWVQEGS  366

Query  1081  RAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGAT  902
             RAFYRG+VPSLLGI+PYAGIDLA Y+ LK+ ++ YIL D EPGPLVQLG GT+SGALGAT
Sbjct  367   RAFYRGLVPSLLGIVPYAGIDLAAYETLKDMSKKYILHDGEPGPLVQLGCGTVSGALGAT  426

Query  901   CVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASIT  722
             CVYPLQVVRTRMQA      TAYKGM DVF RTF+HEGLRGFYKG+FPNLLKVVP+ASIT
Sbjct  427   CVYPLQVVRTRMQAH-----TAYKGMGDVFRRTFQHEGLRGFYKGIFPNLLKVVPSASIT  481

Query  721   YLVYESMKKTLDL  683
             Y+VYESMKK+LDL
Sbjct  482   YMVYESMKKSLDL  494



>ref|XP_006844654.1| hypothetical protein AMTR_s00016p00237360 [Amborella trichopoda]
 gb|ERN06329.1| hypothetical protein AMTR_s00016p00237360 [Amborella trichopoda]
Length=469

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/469 (80%), Positives = 419/469 (89%), Gaps = 1/469 (0%)
 Frame = -1

Query  2083  MDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLR  1904
             MDHVL A +ETKEER++R+RSLF+FFDS N GYLDYAQIE GL A+QI A+YK+AK+LLR
Sbjct  1     MDHVLLASRETKEEREMRLRSLFNFFDSQNTGYLDYAQIEAGLMALQIPAEYKYAKDLLR  60

Query  1903  VVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDD  1724
             V D N+DGRVDY EFR+YMDDKELELYRIFQAIDVEH+G ILPEEL DAL+KAGIEIDD+
Sbjct  61    VCDMNRDGRVDYQEFRRYMDDKELELYRIFQAIDVEHNGCILPEELLDALLKAGIEIDDE  120

Query  1723  ELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGI  1544
             ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY+Y ERVCLVDIGEQAVIPEGI
Sbjct  121   ELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYQYWERVCLVDIGEQAVIPEGI  180

Query  1543  SKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFF  1364
             SKHVHASKYLIAGGVAGA SRTATAPLDR+KV LQVQTTRA +MPA+K IW+EG   GFF
Sbjct  181   SKHVHASKYLIAGGVAGATSRTATAPLDRIKVKLQVQTTRAHLMPAIKDIWREGRFLGFF  240

Query  1363  RGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIY  1187
             RGNGINVLKVAPESAIKFY YEMLK  + +A+G ++ DIGT+GRL +GGLAGAVAQTAIY
Sbjct  241   RGNGINVLKVAPESAIKFYAYEMLKTFVVNARGENKSDIGTAGRLFSGGLAGAVAQTAIY  300

Query  1186  PMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVY  1007
             PMDLVKTRLQT  CE GK P LG LS+DIW+ EGPRAFYRG+ PSLLGIIPYAGIDLA Y
Sbjct  301   PMDLVKTRLQTCACENGKPPKLGALSRDIWVHEGPRAFYRGLFPSLLGIIPYAGIDLAAY  360

Query  1006  DALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKG  827
             + LK+ +R ++L DSEPGPLVQLG GTISGALGATCVYPLQV+RTRMQAQ T T+  YKG
Sbjct  361   ETLKDLSRIHLLHDSEPGPLVQLGCGTISGALGATCVYPLQVIRTRMQAQYTKTTEGYKG  420

Query  826   MFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             M DVF RT +HEG+ GFYKG+FPN+LKVVP+ASITYLVYESMKK LDL+
Sbjct  421   MSDVFWRTLKHEGISGFYKGIFPNMLKVVPSASITYLVYESMKKNLDLE  469



>ref|XP_010066396.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
[Eucalyptus grandis]
 gb|KCW64285.1| hypothetical protein EUGRSUZ_G01923 [Eucalyptus grandis]
Length=496

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/485 (76%), Positives = 427/485 (88%), Gaps = 2/485 (0%)
 Frame = -1

Query  2128  RSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSA  1949
             RS+ CNPV KPGPV+MDHVL A  ETKE+R++RIR +F  FD+   GYLDYAQIE GLSA
Sbjct  12    RSDGCNPVRKPGPVTMDHVLLASGETKEKRELRIRGMFDSFDTAKVGYLDYAQIETGLSA  71

Query  1948  MQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEE  1769
             + I  +YK+AK+LL V DANKDGRVDY EF++YMDDKELELYRIFQAIDVEH+G ILPEE
Sbjct  72    LHIPPEYKYAKDLLNVCDANKDGRVDYQEFKRYMDDKELELYRIFQAIDVEHNGCILPEE  131

Query  1768  LWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERV  1589
             L+DAL++AGIEIDD+ELA FVE VDKD++GVITFEEWR+FLLLYPHEAT+ENIYRYLERV
Sbjct  132   LYDALLRAGIEIDDEELAHFVERVDKDSNGVITFEEWREFLLLYPHEATMENIYRYLERV  191

Query  1588  CLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMP  1409
             CLVDIGEQAV+PEGISKHVH S+YLIAG VAGAASRT TAPLDRLKV+LQVQTTRAS+MP
Sbjct  192   CLVDIGEQAVVPEGISKHVHTSRYLIAGAVAGAASRTVTAPLDRLKVILQVQTTRASLMP  251

Query  1408  AVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE--GDIGTSGR  1235
             A+KSIWK+GG+ GFFRGNG+NV+KVAPESA++FYTYEMLK  I  A+G E   +IG  GR
Sbjct  252   AIKSIWKDGGLRGFFRGNGLNVVKVAPESALRFYTYEMLKRVIVTAQGGEEKAEIGPMGR  311

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVP  1055
             L+AGG+AGAVAQT +YPMDLVKTRLQT+  +GGK+P LG++++DIW++EGPRAFYRG+VP
Sbjct  312   LLAGGVAGAVAQTTVYPMDLVKTRLQTHVSDGGKIPSLGQMTRDIWVQEGPRAFYRGVVP  371

Query  1054  SLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVR  875
             SL+GIIPYAGIDLA Y+  K+ ++ YILQD EPGPLVQL  G  SGALGA+CVYPLQVVR
Sbjct  372   SLIGIIPYAGIDLAAYETFKDLSKKYILQDGEPGPLVQLVCGMTSGALGASCVYPLQVVR  431

Query  874   TRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKK  695
             TRMQAQ   T  AYKGM DVF RTF+HEGLRGFYKG+FPNLLKVVP+ASITY+VYE+MKK
Sbjct  432   TRMQAQRPDTDAAYKGMSDVFRRTFKHEGLRGFYKGIFPNLLKVVPSASITYMVYETMKK  491

Query  694   TLDLD  680
              L L+
Sbjct  492   RLQLE  496



>ref|XP_004503813.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like 
isoform X1 [Cicer arietinum]
 ref|XP_004503814.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like 
isoform X2 [Cicer arietinum]
Length=498

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/506 (74%), Positives = 436/506 (86%), Gaps = 11/506 (2%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPA---MTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSL  2018
             MS AG+A+  ++F       A D     NP        MDHVL AL+ETKEER++RIRSL
Sbjct  1     MSEAGQAM-DMSFSKPKPSPAADHGRGTNP-------PMDHVLLALRETKEERELRIRSL  52

Query  2017  FSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDK  1838
             F+FFD+ N GYLDYA IE GLSA+QI  +YK+AKEL +V DA++DGR+DY +FR+YMDDK
Sbjct  53    FNFFDAANNGYLDYAHIEAGLSALQIPPEYKYAKELFKVCDADRDGRIDYHDFRRYMDDK  112

Query  1837  ELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEW  1658
             ELELYRIFQAIDVEH+G ILPEELWDALVKAGIEID+ ELARFVEHVDKDN+G+ITFEEW
Sbjct  113   ELELYRIFQAIDVEHNGCILPEELWDALVKAGIEIDEAELARFVEHVDKDNNGIITFEEW  172

Query  1657  RDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRT  1478
             RDFLLLYPHEAT+ENIY++ ERVCLVDIGEQAVIPEGISKHVH S+Y IAGG+AGAASRT
Sbjct  173   RDFLLLYPHEATMENIYQHWERVCLVDIGEQAVIPEGISKHVHRSRYFIAGGIAGAASRT  232

Query  1477  ATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYE  1298
             ATAPLDRLKV+LQ+QT RASIMPAV  IW+  G+ GFFRGNG+NV+KVAPESAIKFY YE
Sbjct  233   ATAPLDRLKVILQIQTGRASIMPAVMKIWQRDGLLGFFRGNGLNVVKVAPESAIKFYAYE  292

Query  1297  MLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLG  1118
             MLKN IG ++G++ DIGT+GRL AGG+AGA+AQ AIYP+DL+KTRLQT   E GK P LG
Sbjct  293   MLKNVIGDSQGNKSDIGTAGRLFAGGMAGAIAQIAIYPLDLIKTRLQTCVSEDGKGPKLG  352

Query  1117  RLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQL  938
             +L+KDIW++EGPRAFYRG+VPSLLG+IPYAGIDL  YD LK+ ++ YI+ DSEPGPL+QL
Sbjct  353   KLTKDIWVQEGPRAFYRGLVPSLLGMIPYAGIDLTAYDTLKDVSKKYIIHDSEPGPLIQL  412

Query  937   GSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFP  758
             G GT+SGALGATCVYPLQV+RTR+QAQPT+TS+AY+GM DVF +T + EG RGFYKGL P
Sbjct  413   GCGTVSGALGATCVYPLQVIRTRLQAQPTNTSSAYRGMSDVFWKTLKDEGFRGFYKGLIP  472

Query  757   NLLKVVPAASITYLVYESMKKTLDLD  680
             NLLKVVPAASITY+VYE+MKK+LDLD
Sbjct  473   NLLKVVPAASITYMVYENMKKSLDLD  498



>ref|XP_003553987.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Glycine max]
Length=477

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/473 (78%), Positives = 417/473 (88%), Gaps = 8/473 (2%)
 Frame = -1

Query  2089  VSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKEL  1910
             V+MDHVL A QETKE R+ RIRSLF FFD +N G+LDY+ IE GLSA+QI A+YK+AK+L
Sbjct  10    VTMDHVLLASQETKEAREARIRSLFDFFDRENLGFLDYSHIEAGLSALQIPAEYKYAKDL  69

Query  1909  LRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEID  1730
             L   DANKDGRVD+ EFRKYMDDKELELYRIFQAIDV H+G ILPEELW+ALV+AGI+ID
Sbjct  70    LNACDANKDGRVDFQEFRKYMDDKELELYRIFQAIDVAHNGCILPEELWEALVRAGIKID  129

Query  1729  DDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPE  1550
             D+ELARFVE VDKDN+GVITF+EWRDFLLLYPHEATIENIY YLER+C+VDIGEQ VIP 
Sbjct  130   DEELARFVERVDKDNNGVITFQEWRDFLLLYPHEATIENIYHYLERMCMVDIGEQTVIPA  189

Query  1549  GISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISG  1370
             GI KH+HAS+YLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA IMPA+K IWKEGG+ G
Sbjct  190   GIGKHIHASRYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRAQIMPAIKDIWKEGGLLG  249

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE---GDIGTSGRLIAGGLAGAVAQ  1199
             FFRGNG+NVLKVAPESAI+FY+YEMLK  I  AKG+E    DIG  GRL+AGG+AGAVAQ
Sbjct  250   FFRGNGLNVLKVAPESAIRFYSYEMLKTFIVRAKGEEAKAADIGAMGRLLAGGIAGAVAQ  309

Query  1198  TAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGID  1019
             TAIYPMDLVKTRLQTY C+ G++P LG LSKDIW++EGPRAFYRG++PSLLGIIPYAGID
Sbjct  310   TAIYPMDLVKTRLQTYACKSGRIPSLGTLSKDIWVQEGPRAFYRGLIPSLLGIIPYAGID  369

Query  1018  LAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTST  839
             LA Y+ LK+ ++ YIL D EPGPLVQLG GT+SGALGATCVYPLQVVRTRMQAQ      
Sbjct  370   LAAYETLKDMSKQYILHDGEPGPLVQLGCGTVSGALGATCVYPLQVVRTRMQAQ-----R  424

Query  838   AYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             +YKGM DVF +T  HEGLRGFYKG+FPNLLKVVP+ASITY+VYESMKK LDL+
Sbjct  425   SYKGMADVFRKTLEHEGLRGFYKGIFPNLLKVVPSASITYMVYESMKKNLDLE  477



>ref|XP_009619645.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like 
isoform X2 [Nicotiana tomentosiformis]
Length=457

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/450 (83%), Positives = 407/450 (90%), Gaps = 2/450 (0%)
 Frame = -1

Query  2188  MSGAGEA-VGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFS  2012
             MS AG+A V HVNFP M  KDR  CCNPV  PGPVSMDHVL+AL ETKEER+ RIRSLFS
Sbjct  1     MSVAGKAAVEHVNFPGMGTKDRPGCCNPVKNPGPVSMDHVLSALGETKEERESRIRSLFS  60

Query  2011  FFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKEL  1832
             FFDSDNAGYLDY +IE+GLSAMQI A+YKFAKELL+  DANKDGRVDY EFRKYMDDKE+
Sbjct  61    FFDSDNAGYLDYVKIEKGLSAMQIPAEYKFAKELLKACDANKDGRVDYQEFRKYMDDKEM  120

Query  1831  ELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRD  1652
             ELY IF+AIDVEH+G ILPEELWDALVKAGIE+DDDELARFVEHVDKDN+G+ITFEEWRD
Sbjct  121   ELYGIFEAIDVEHNGCILPEELWDALVKAGIELDDDELARFVEHVDKDNNGIITFEEWRD  180

Query  1651  FLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTAT  1472
             FLLLYPHEATIENIY+YLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTAT
Sbjct  181   FLLLYPHEATIENIYQYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTAT  240

Query  1471  APLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEML  1292
             APLDRLKV+LQVQTTRASI PAVKSIWKEG + GFFRGNG+NV+KVAPESAIKFY YE L
Sbjct  241   APLDRLKVILQVQTTRASIGPAVKSIWKEGRLLGFFRGNGLNVMKVAPESAIKFYAYETL  300

Query  1291  KNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGR  1115
             KN IG AKG D+ DIGTSGRL+AGG+AGAVAQTAIYPMDLVKTRLQT+ CEGGKVP+L +
Sbjct  301   KNVIGRAKGQDQRDIGTSGRLVAGGMAGAVAQTAIYPMDLVKTRLQTHACEGGKVPNLRK  360

Query  1114  LSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLG  935
             LSKDIW++EGPRAFYRG+VPSLLGIIPYAGIDLA Y+ LK+ ++ YIL DSE GPLVQLG
Sbjct  361   LSKDIWVQEGPRAFYRGLVPSLLGIIPYAGIDLAAYETLKDLSKIYILHDSEAGPLVQLG  420

Query  934   SGTISGALGATCVYPLQVVRTRMQAQPTHT  845
              GTISGALGATCVYPLQVVRT ++     T
Sbjct  421   CGTISGALGATCVYPLQVVRTSVKVSGAST  450


 Score = 95.1 bits (235),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 97/188 (52%), Gaps = 10/188 (5%)
 Frame = -1

Query  1252  IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAF  1073
             +  S  LIAGG+AGA ++TA  P+D +K  LQ  T        +G   K IW       F
Sbjct  220   VHASKYLIAGGVAGAASRTATAPLDRLKVILQVQTTRAS----IGPAVKSIWKEGRLLGF  275

Query  1072  YRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDS-EPGPLVQLGSGTISGALGATCV  896
             +RG   +++ + P + I    Y+ LKN       QD  + G   +L +G ++GA+  T +
Sbjct  276   FRGNGLNVMKVAPESAIKFYAYETLKNVIGRAKGQDQRDIGTSGRLVAGGMAGAVAQTAI  335

Query  895   YPLQVVRTRMQAQPTHTSTAYK--GMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASIT  722
             YP+ +V+TR+Q   TH     K   +  +    +  EG R FY+GL P+LL ++P A I 
Sbjct  336   YPMDLVKTRLQ---THACEGGKVPNLRKLSKDIWVQEGPRAFYRGLVPSLLGIIPYAGID  392

Query  721   YLVYESMK  698
                YE++K
Sbjct  393   LAAYETLK  400



>ref|XP_010090932.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Morus 
notabilis]
 gb|EXB41417.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Morus 
notabilis]
Length=490

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/472 (79%), Positives = 421/472 (89%), Gaps = 3/472 (1%)
 Frame = -1

Query  2089  VSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKEL  1910
             +SMDHVL AL+ETKEER++RIRSLF++FD+ NAGYLDY  IE GL ++QI +DYK+AK+L
Sbjct  20    ISMDHVLMALRETKEEREMRIRSLFNYFDASNAGYLDYGSIEEGLKSLQIPSDYKYAKDL  79

Query  1909  LRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEID  1730
             L V DAN+DG+VDY EF++YMDDKELELYRIFQAID+EH+G ILPEEL DAL+ AGIEID
Sbjct  80    LNVCDANQDGQVDYQEFKRYMDDKELELYRIFQAIDIEHNGCILPEELSDALLGAGIEID  139

Query  1729  DDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPE  1550
             D+ELA FVE VDKDN+GVITFEEWRDFLLLYPHEATIENIY YLERVCLVDIGEQAVIPE
Sbjct  140   DEELALFVERVDKDNNGVITFEEWRDFLLLYPHEATIENIYHYLERVCLVDIGEQAVIPE  199

Query  1549  GISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISG  1370
             GISKHVHAS+YLIAGGVAGA SRTATAPLDRLKVVLQVQ  +A IMPAV+ IWKEGG+ G
Sbjct  200   GISKHVHASRYLIAGGVAGATSRTATAPLDRLKVVLQVQMGQARIMPAVRDIWKEGGLLG  259

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE--GDIGTSGRLIAGGLAGAVAQT  1196
             FFRGNG+NVLKVAPESAI+FYTYEM K  I  AKG+E   DIGT GRL+AGG AGAVAQT
Sbjct  260   FFRGNGLNVLKVAPESAIRFYTYEMFKGFIASAKGNEDKADIGTLGRLLAGGFAGAVAQT  319

Query  1195  AIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDL  1016
              IYPMDLVKTRLQT++ EGG+VP+LG LS+DIW++EGPRAFYRG+ PS+LGIIPYAGIDL
Sbjct  320   TIYPMDLVKTRLQTFSGEGGRVPNLGTLSRDIWVQEGPRAFYRGLFPSVLGIIPYAGIDL  379

Query  1015  AVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTA  836
             A Y+ LK+ ++ YIL D E GPLVQLG GTISGALGATCVYPLQVVRTRMQAQ  +T +A
Sbjct  380   AAYETLKDLSKKYIL-DGEAGPLVQLGCGTISGALGATCVYPLQVVRTRMQAQRCNTDSA  438

Query  835   YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             YKGM DVF RTF+ EG RGFYKG+FPN+LKVVP+ASITYLVYESMKK+LDL+
Sbjct  439   YKGMGDVFRRTFQREGFRGFYKGIFPNMLKVVPSASITYLVYESMKKSLDLE  490



>ref|XP_009415360.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=497

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/494 (76%), Positives = 430/494 (87%), Gaps = 12/494 (2%)
 Frame = -1

Query  2188  MSGAGEAVGH-VNFPAMT-----AKD-----RSECCNPVMKPGPVSMDHVLAALQETKEE  2042
             MSGA +AV   + FPA       A D     R   CNPV KPGPVSMDHVL AL+ETKEE
Sbjct  1     MSGATKAVEERILFPAKMEEAAPASDGEQWRRPGGCNPVKKPGPVSMDHVLLALRETKEE  60

Query  2041  RDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPE  1862
             R++RIRSLF+FFD+   G+LDY QIE GLSA+ I A+YK+A++LL+V DAN+DGRVDY E
Sbjct  61    REVRIRSLFNFFDAAGVGHLDYVQIEAGLSALCIPAEYKYARDLLKVCDANRDGRVDYQE  120

Query  1861  FRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDND  1682
             FR+Y+DDKELELYRIFQAIDVEH+G ILPEELWDAL+KAGIEIDD+EL RFVEHVDKDN+
Sbjct  121   FRRYLDDKELELYRIFQAIDVEHNGCILPEELWDALIKAGIEIDDEELVRFVEHVDKDNN  180

Query  1681  GVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGG  1502
             G+ITFEEWRDFLLLYPHEATIENIY+Y E+VCLVDIGEQAVIPEGISKHV+ASKYLIAGG
Sbjct  181   GIITFEEWRDFLLLYPHEATIENIYQYWEKVCLVDIGEQAVIPEGISKHVNASKYLIAGG  240

Query  1501  VAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPES  1322
             +AGAASRT TAPLDRLKVVLQV+TT+A IMPA+K IW++G   GFFRGNG+NV+KVAPES
Sbjct  241   LAGAASRTVTAPLDRLKVVLQVRTTQARIMPAIKDIWRDGRFLGFFRGNGLNVMKVAPES  300

Query  1321  AIKFYTYEMLKNAIGHAKGDE-GDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTC  1145
             AIKFYT+EMLK+ I  AKG+E  DIG SGRLIAGGLAGAVAQTAIYP+DLVKTRLQTY C
Sbjct  301   AIKFYTFEMLKDFIVTAKGEEKSDIGASGRLIAGGLAGAVAQTAIYPLDLVKTRLQTYAC  360

Query  1144  EGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQD  965
             EGGKVP+L  L+KDIW+ EGPRAFY+G++PSLLGIIPYAGIDL+ Y+ LK+ +RTYIL+D
Sbjct  361   EGGKVPNLATLTKDIWVHEGPRAFYKGLIPSLLGIIPYAGIDLSAYETLKDMSRTYILKD  420

Query  964   SEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGL  785
             SEPGPLVQLG GTISGALGATCVYPLQV+RTRMQAQ T++S+AY GM DVF +T R+EG 
Sbjct  421   SEPGPLVQLGCGTISGALGATCVYPLQVIRTRMQAQHTNSSSAYNGMSDVFWKTLRNEGF  480

Query  784   RGFYKGLFPNLLKV  743
              GFYKG+ PNLLK 
Sbjct  481   SGFYKGIIPNLLKC  494


 Score =   101 bits (252),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 102/192 (53%), Gaps = 6/192 (3%)
 Frame = -1

Query  1270  KGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLR  1091
             +G    +  S  LIAGGLAGA ++T   P+D +K  LQ  T +   +P +    KDIW  
Sbjct  224   EGISKHVNASKYLIAGGLAGAASRTVTAPLDRLKVVLQVRTTQARIMPAI----KDIWRD  279

Query  1090  EGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQD-SEPGPLVQLGSGTISGA  914
                  F+RG   +++ + P + I    ++ LK+F  T   ++ S+ G   +L +G ++GA
Sbjct  280   GRFLGFFRGNGLNVMKVAPESAIKFYTFEMLKDFIVTAKGEEKSDIGASGRLIAGGLAGA  339

Query  913   LGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPA  734
             +  T +YPL +V+TR+Q            +  +    + HEG R FYKGL P+LL ++P 
Sbjct  340   VAQTAIYPLDLVKTRLQTYACEGGKV-PNLATLTKDIWVHEGPRAFYKGLIPSLLGIIPY  398

Query  733   ASITYLVYESMK  698
             A I    YE++K
Sbjct  399   AGIDLSAYETLK  410



>ref|XP_003548488.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Glycine max]
 ref|XP_006598992.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Glycine max]
Length=473

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/472 (77%), Positives = 418/472 (89%), Gaps = 8/472 (2%)
 Frame = -1

Query  2086  SMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELL  1907
             +MDHVL A QETKE R++RIRSLF FFD +N G+LDY+ IE GLSA+QI ++YK+AK+LL
Sbjct  7     TMDHVLLASQETKETREVRIRSLFDFFDRENLGFLDYSHIEAGLSALQIPSEYKYAKDLL  66

Query  1906  RVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDD  1727
                DANKDGRVD+ EFRKYMDDKELELYRIFQAIDV H+G ILPEELW+ALV+AGI+IDD
Sbjct  67    NACDANKDGRVDFQEFRKYMDDKELELYRIFQAIDVAHNGCILPEELWEALVRAGIKIDD  126

Query  1726  DELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEG  1547
             +ELARFVE VDKDN+GVITFEEWRDFLLLYPHEATIENIY YLER+C+VDIGEQ VIP G
Sbjct  127   EELARFVERVDKDNNGVITFEEWRDFLLLYPHEATIENIYHYLERICVVDIGEQTVIPAG  186

Query  1546  ISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGF  1367
             I KH+HAS+YLIAGGVAGAASRTATAPLDRLKVVLQ+QTT++ IMPA+K IWK+GG+ GF
Sbjct  187   IGKHIHASRYLIAGGVAGAASRTATAPLDRLKVVLQIQTTQSHIMPAIKDIWKKGGLLGF  246

Query  1366  FRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE---GDIGTSGRLIAGGLAGAVAQT  1196
             FRGNG+NVLKVAPESAI+FY+YEMLK+ I  AKGDE    +IG  GRL+AGG+AGAVAQT
Sbjct  247   FRGNGLNVLKVAPESAIRFYSYEMLKSFITRAKGDEAKAANIGAMGRLLAGGIAGAVAQT  306

Query  1195  AIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDL  1016
             AIYPMDLVKTRLQT+ C+ G++P LG LSKDIW++EGPRAFYRG++PSLLGIIPYAGIDL
Sbjct  307   AIYPMDLVKTRLQTHACKSGRIPSLGTLSKDIWVQEGPRAFYRGLIPSLLGIIPYAGIDL  366

Query  1015  AVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTA  836
             A Y+ LK+ ++ YIL D EPGPLVQLG GT+SG LGATCVYPLQVVRTRMQAQ      +
Sbjct  367   AAYETLKDMSKQYILHDGEPGPLVQLGCGTVSGTLGATCVYPLQVVRTRMQAQ-----RS  421

Query  835   YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             YKGM DVF +T  HEGLRGFYKG+FPNLLKVVP+ASITY+VYESMKK+LDL+
Sbjct  422   YKGMADVFRKTLEHEGLRGFYKGIFPNLLKVVPSASITYMVYESMKKSLDLE  473



>ref|XP_003526912.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like 
isoform X1 [Glycine max]
Length=476

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/472 (77%), Positives = 417/472 (88%), Gaps = 0/472 (0%)
 Frame = -1

Query  2095  GPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAK  1916
             G VSMDHVL AL ETKEER++RIRSLF+FFD+ N GYLDYAQIE GLSA+QI  +YK+A+
Sbjct  5     GVVSMDHVLVALGETKEEREVRIRSLFNFFDAANNGYLDYAQIEAGLSALQIPPEYKYAR  64

Query  1915  ELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIE  1736
             EL  V DAN DGRV+Y EFR+YMDDKELELYRIFQ+IDVEH G ILPEEL++AL+KAGIE
Sbjct  65    ELCEVCDANSDGRVEYHEFRRYMDDKELELYRIFQSIDVEHDGTILPEELYEALLKAGIE  124

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             ++D+ELA FVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVI
Sbjct  125   MNDEELAHFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVI  184

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             PEGISKHV+ SKY +AGG+AG  SRTATAPLDRLKVVLQVQ+  ASIMPAV  IWK+ G+
Sbjct  185   PEGISKHVNRSKYFLAGGIAGGISRTATAPLDRLKVVLQVQSEPASIMPAVTKIWKQDGL  244

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQT  1196
              GFFRGNG+NV+KV+PESAIKFY +EMLK  IG A G++ DIGT+GRL+AGG AGA+AQ 
Sbjct  245   LGFFRGNGLNVVKVSPESAIKFYAFEMLKKVIGEAHGNKSDIGTAGRLVAGGTAGAIAQA  304

Query  1195  AIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDL  1016
             AIYPMDL+KTRLQT   EGGKVP LG L+ +IW++EGPRAFYRG+VPSLLG+IPYA IDL
Sbjct  305   AIYPMDLIKTRLQTCPSEGGKVPKLGTLTMNIWVQEGPRAFYRGLVPSLLGMIPYAAIDL  364

Query  1015  AVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTA  836
               YD +K+ ++ YILQDSEPGPLVQLG GTISGA+GATCVYPLQV+RTR+QAQP++TS A
Sbjct  365   TAYDTMKDISKRYILQDSEPGPLVQLGCGTISGAVGATCVYPLQVIRTRLQAQPSNTSDA  424

Query  835   YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             YKGMFD F RTF+ EG  GFYKGLFPNLLKVVPAASITY+VYES+KKTLDLD
Sbjct  425   YKGMFDAFRRTFQLEGFIGFYKGLFPNLLKVVPAASITYVVYESLKKTLDLD  476



>ref|XP_003523182.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like 
isoform X1 [Glycine max]
Length=468

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/468 (77%), Positives = 413/468 (88%), Gaps = 0/468 (0%)
 Frame = -1

Query  2083  MDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLR  1904
             MDHVL AL ETKEER++RIRSLF+FFD+ N GYLDYAQIE GLSA+QI  +YK+A+EL  
Sbjct  1     MDHVLVALGETKEEREVRIRSLFNFFDAANNGYLDYAQIEAGLSALQIPPEYKYARELCE  60

Query  1903  VVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDD  1724
             V DAN DGRV+Y EFR+YMDDKELELYRIFQAIDVEH G ILPEEL++AL+KAGIE++D+
Sbjct  61    VCDANSDGRVEYHEFRRYMDDKELELYRIFQAIDVEHDGTILPEELYEALLKAGIEMNDE  120

Query  1723  ELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGI  1544
             ELA FVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVIPEGI
Sbjct  121   ELAHFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGI  180

Query  1543  SKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFF  1364
             SKH + SKY +AGG+AG  SRTATAPLDRLKVVLQVQ+ RASIMPAV  IWK+ G+ GFF
Sbjct  181   SKHANRSKYFLAGGIAGGISRTATAPLDRLKVVLQVQSERASIMPAVTRIWKQDGLLGFF  240

Query  1363  RGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYP  1184
             RGNG+NV+KVAPESAIKFY +EMLK  IG A+G++ DIGT+GRL+AGG AGA+AQ AIYP
Sbjct  241   RGNGLNVVKVAPESAIKFYAFEMLKKVIGEAQGNKSDIGTAGRLVAGGTAGAIAQAAIYP  300

Query  1183  MDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYD  1004
             MDL+KTRLQT   EGGKVP LG L+ +IW +EGPRAFYRG+VPSLLG+IPYA IDL  YD
Sbjct  301   MDLIKTRLQTCPSEGGKVPKLGTLTMNIWFQEGPRAFYRGLVPSLLGMIPYAAIDLTAYD  360

Query  1003  ALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGM  824
              LK+ ++ YILQDSEPGPLVQLG GTISGA+GATCVYPLQV+RTR+QAQP++TS AYKGM
Sbjct  361   TLKDMSKRYILQDSEPGPLVQLGCGTISGAVGATCVYPLQVIRTRLQAQPSNTSDAYKGM  420

Query  823   FDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             FD F RTF+ EG  GFYKGLFPNLLKVVPAASITY+VYES+KK LDLD
Sbjct  421   FDAFRRTFQLEGFIGFYKGLFPNLLKVVPAASITYVVYESLKKNLDLD  468



>ref|XP_006402030.1| hypothetical protein EUTSA_v10013343mg [Eutrema salsugineum]
 gb|ESQ43483.1| hypothetical protein EUTSA_v10013343mg [Eutrema salsugineum]
Length=497

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/498 (75%), Positives = 421/498 (85%), Gaps = 9/498 (2%)
 Frame = -1

Query  2167  VGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAG  1988
             V HV  P  T  +  +CCNPV KPGPVSMDHVL AL+ET+EERD+RIRSLF+FFDS+N G
Sbjct  7     VEHVGLP--TKIEAKKCCNPVKKPGPVSMDHVLLALRETREERDVRIRSLFNFFDSENVG  64

Query  1987  YLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQA  1808
             YLD AQIE+GL A+QI + YK+AKEL RV DAN+DGRVDY EFR+YMDDKELELYRIFQA
Sbjct  65    YLDCAQIEKGLIALQIPSGYKYAKELFRVCDANRDGRVDYHEFRRYMDDKELELYRIFQA  124

Query  1807  IDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHE  1628
             IDVEH+G I PE LWD+LVKAGIEI+D+ELARFVEHVDKDNDG+I FEEWRDFLLLYPHE
Sbjct  125   IDVEHNGCISPEGLWDSLVKAGIEINDEELARFVEHVDKDNDGIIMFEEWRDFLLLYPHE  184

Query  1627  ATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKV  1448
             ATIENIY + ERVCLVDIGEQAVIPEGISKHV  S Y IAGG+AGAASRTATAPLDRLKV
Sbjct  185   ATIENIYHHWERVCLVDIGEQAVIPEGISKHVKRSNYFIAGGIAGAASRTATAPLDRLKV  244

Query  1447  VLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAK  1268
             +LQ+Q T A I  AVK+IWK+GG+ GFFRGNG+N++KVAPESAIKFY YE+ KNAIG   
Sbjct  245   LLQIQKTDAKIREAVKTIWKQGGVRGFFRGNGLNIVKVAPESAIKFYAYELFKNAIGENM  304

Query  1267  G-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKV-PHLGRLSKDIWL  1094
             G D+ DIGT  RL AGG+AGAVAQ +IYP+DLVKTRLQT T E G V P LG L+KDI +
Sbjct  305   GEDKADIGTVARLFAGGMAGAVAQASIYPLDLVKTRLQTCTSEAGVVGPRLGTLTKDILV  364

Query  1093  REGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGA  914
              EGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ +RTYILQD+EPGPLVQLG GTISGA
Sbjct  365   HEGPRAFYKGLFPSLLGIIPYAGIDLAAYETLKDLSRTYILQDAEPGPLVQLGCGTISGA  424

Query  913   LGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPA  734
             LGATCVYPLQVVRTRMQA+ T TS     M  VF RT   EG R  YKGL PNLLKVVPA
Sbjct  425   LGATCVYPLQVVRTRMQAERTRTS-----MSGVFRRTISEEGYRALYKGLLPNLLKVVPA  479

Query  733   ASITYLVYESMKKTLDLD  680
             ASITY+VYE+MKK+L+LD
Sbjct  480   ASITYMVYEAMKKSLELD  497



>gb|KEH23500.1| substrate carrier family protein [Medicago truncatula]
Length=488

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/491 (74%), Positives = 422/491 (86%), Gaps = 13/491 (3%)
 Frame = -1

Query  2128  RSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSA  1949
             + E  NPV KPGPV+MDHVL A QETKEERD RIRS+F+FFD +N GYL+++ IE G  A
Sbjct  3     KEERTNPVKKPGPVTMDHVLLASQETKEERDERIRSIFAFFDKENRGYLEFSHIEAGYLA  62

Query  1948  MQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEE  1769
             ++I ++YK+A +LL   D NKDGRVD+ EF+KYMDDKELELYRIFQAIDVEH+GGILPEE
Sbjct  63    LEIPSEYKYATDLLNACDVNKDGRVDFVEFKKYMDDKELELYRIFQAIDVEHNGGILPEE  122

Query  1768  LWDALVKAGI------EIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIY  1607
             LW+ALV+AGI      +IDD+ELA FVE VDKD++GVITFEEWRDFLLLYPHEATIENIY
Sbjct  123   LWEALVRAGILSISGIKIDDEELAHFVERVDKDHNGVITFEEWRDFLLLYPHEATIENIY  182

Query  1606  RYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTT  1427
              YLER+C+VDIGE  VIP G+ KHVHA +YLIAGGVAGAASRTATAPLDRLKVVLQVQTT
Sbjct  183   HYLERICMVDIGEHTVIPAGVGKHVHAYRYLIAGGVAGAASRTATAPLDRLKVVLQVQTT  242

Query  1426  RASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE--GD  1253
              A IMPAVK++WKEGG+ GFFRGNG+NVLKVAPESAI+FYTYEM+K  I  AKG E   D
Sbjct  243   SARIMPAVKTLWKEGGLVGFFRGNGLNVLKVAPESAIRFYTYEMMKTFIVDAKGGEEKAD  302

Query  1252  IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAF  1073
             IG  GRL+AGG+AGAVAQT IYPMDLVKTRLQTYT   GK+P LG LSKDIW++EGPRAF
Sbjct  303   IGGMGRLLAGGIAGAVAQTLIYPMDLVKTRLQTYTHASGKIPSLGTLSKDIWVQEGPRAF  362

Query  1072  YRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVY  893
             YRG++PS++GIIPYAGIDLA Y+ LK  ++ YI+Q+ EPGPLVQLG GT+SGALGATCVY
Sbjct  363   YRGLIPSIVGIIPYAGIDLAAYETLKEMSKKYIIQEGEPGPLVQLGCGTVSGALGATCVY  422

Query  892   PLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLV  713
             PLQVVRTRMQAQ     ++YKGM DVF +T +HEG RGFYKG+FPNLLKVVP+ASITY+V
Sbjct  423   PLQVVRTRMQAQ-----SSYKGMADVFRKTLKHEGFRGFYKGIFPNLLKVVPSASITYMV  477

Query  712   YESMKKTLDLD  680
             YESMKK+LDL+
Sbjct  478   YESMKKSLDLE  488



>ref|XP_007217350.1| hypothetical protein PRUPE_ppa021090mg [Prunus persica]
 gb|EMJ18549.1| hypothetical protein PRUPE_ppa021090mg [Prunus persica]
Length=465

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/469 (78%), Positives = 417/469 (89%), Gaps = 7/469 (1%)
 Frame = -1

Query  2083  MDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLR  1904
             MDHVL AL ETKE+R++RIRSLF+FFD+ + GYLDY  IE  LSA+QI ++YK+AK+LL 
Sbjct  1     MDHVLLALGETKEQRELRIRSLFNFFDTASIGYLDYTLIEAALSALQIPSEYKYAKDLLN  60

Query  1903  VVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDD  1724
             V DAN+DGRVDY EF++YMDDKELELY IFQAIDVEH+G ILPEELWDALV+AGIEIDD+
Sbjct  61    VCDANQDGRVDYQEFKRYMDDKELELYCIFQAIDVEHNGCILPEELWDALVRAGIEIDDE  120

Query  1723  ELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGI  1544
             ELARFVE VDKDN+GVITFEEWRDFLLL+PHEATIENIY YLERVCLVDIGEQ VIPE I
Sbjct  121   ELARFVERVDKDNNGVITFEEWRDFLLLFPHEATIENIYHYLERVCLVDIGEQTVIPEVI  180

Query  1543  SKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFF  1364
             SKHVHAS+YLIAG VAGA SRTATAPLDRLKVVLQVQT +A IMPA++ I++EGG+ GFF
Sbjct  181   SKHVHASRYLIAGAVAGATSRTATAPLDRLKVVLQVQTKQARIMPAIRDIFREGGLLGFF  240

Query  1363  RGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEGDIGTSGRLIAGGLAGAVAQTAI  1190
             RGNG+NVLKVAPESAI+FYTYEMLKN I HA G  D+ +IGT+ RL++GGLAGAVAQT I
Sbjct  241   RGNGLNVLKVAPESAIRFYTYEMLKNFIVHANGEEDQANIGTATRLVSGGLAGAVAQTVI  300

Query  1189  YPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAV  1010
             YPMDLVKTR+QTY  EGG++P LG LS++IW++EG RAFYRG+VPSLLGI+PYAGIDLA 
Sbjct  301   YPMDLVKTRIQTYAGEGGRIPSLGNLSREIWVQEGSRAFYRGLVPSLLGIVPYAGIDLAA  360

Query  1009  YDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYK  830
             Y+ LK+ ++ YIL D EPGPLVQLG GT+SGALGATCVYPLQVVRTRMQA      TAYK
Sbjct  361   YETLKDMSKKYILHDGEPGPLVQLGCGTVSGALGATCVYPLQVVRTRMQAH-----TAYK  415

Query  829   GMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             GM DVF RTF+HEGLRGFYKG+FPNLLKVVP+ASITY+VYESMKK+LDL
Sbjct  416   GMGDVFRRTFQHEGLRGFYKGIFPNLLKVVPSASITYMVYESMKKSLDL  464



>ref|NP_199918.1| mitochondrial substrate carrier family protein [Arabidopsis thaliana]
 dbj|BAB08751.1| calcium-binding transporter-like protein [Arabidopsis thaliana]
 gb|AED96027.1| mitochondrial substrate carrier family protein [Arabidopsis thaliana]
Length=487

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/489 (75%), Positives = 415/489 (85%), Gaps = 7/489 (1%)
 Frame = -1

Query  2140  TAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIER  1961
             T   +  CCNPV KPGPVS+DHVL AL+ET+EERD+RIRSLFSFFDS+N GYLD AQIE+
Sbjct  4     TKSSKQNCCNPVKKPGPVSIDHVLLALRETREERDLRIRSLFSFFDSENVGYLDCAQIEK  63

Query  1960  GLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGI  1781
             GL A+QI + YK+AKEL RV DAN+DGRVDY EFR+YMDDKELELYRIFQAIDVEH+G I
Sbjct  64    GLCALQIPSGYKYAKELFRVCDANRDGRVDYHEFRRYMDDKELELYRIFQAIDVEHNGCI  123

Query  1780  LPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRY  1601
              PE LWD+LVKAGIEI D+ELARFVEHVDKDNDG+I FEEWRDFLLLYPHEATIENIY +
Sbjct  124   SPEGLWDSLVKAGIEIKDEELARFVEHVDKDNDGIIMFEEWRDFLLLYPHEATIENIYHH  183

Query  1600  LERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA  1421
              ERVCLVDIGEQAVIPEGISKH+  S Y IAGG+AGAASRTATAPLDRLKV+LQ+Q T A
Sbjct  184   WERVCLVDIGEQAVIPEGISKHIKRSNYFIAGGIAGAASRTATAPLDRLKVLLQIQKTDA  243

Query  1420  SIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGT  1244
              I  A+K IWK+GG+ GFFRGNG+N++KVAPESAIKFY YE+ KNAIG   G D+ DIGT
Sbjct  244   RIREAIKLIWKQGGVRGFFRGNGLNIVKVAPESAIKFYAYELFKNAIGENMGEDKADIGT  303

Query  1243  SGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG-KVPHLGRLSKDIWLREGPRAFYR  1067
             + RL AGG+AGAVAQ +IYP+DLVKTRLQTYT + G  VP LG L+KDI + EGPRAFY+
Sbjct  304   TVRLFAGGMAGAVAQASIYPLDLVKTRLQTYTSQAGVAVPRLGTLTKDILVHEGPRAFYK  363

Query  1066  GIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPL  887
             G+ PSLLGIIPYAGIDLA Y+ LK+ +RTYILQD+EPGPLVQLG GTISGALGATCVYPL
Sbjct  364   GLFPSLLGIIPYAGIDLAAYETLKDLSRTYILQDAEPGPLVQLGCGTISGALGATCVYPL  423

Query  886   QVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYE  707
             QVVRTRMQA+   TS     M  VF RT   EG R  YKGL PNLLKVVPAASITY+VYE
Sbjct  424   QVVRTRMQAERARTS-----MSGVFRRTISEEGYRALYKGLLPNLLKVVPAASITYMVYE  478

Query  706   SMKKTLDLD  680
             +MKK+L+LD
Sbjct  479   AMKKSLELD  487



>ref|XP_004300380.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Fragaria vesca subsp. vesca]
Length=502

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/504 (74%), Positives = 437/504 (87%), Gaps = 4/504 (1%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSF  2009
             MSGA  A  HV FP   AK  ++       PGP++MDHVL AL+ETKEER++RIRSLF+F
Sbjct  1     MSGAKPAADHVGFPTTAAKPVADSVKKA--PGPITMDHVLLALRETKEERELRIRSLFNF  58

Query  2008  FDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELE  1829
             FD+ N GYLDYAQIE GLSA+QI  +YK+AK+LL+V DA++DGRV+Y EFR+YMDDKELE
Sbjct  59    FDAANLGYLDYAQIEAGLSALQIPGEYKYAKDLLKVCDADRDGRVNYSEFRQYMDDKELE  118

Query  1828  LYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDF  1649
             LYRIFQAIDVEH+G ILPEELW+ALVKAGIE+DD+ELA FVEHVDKDN+G+ITFEEWRDF
Sbjct  119   LYRIFQAIDVEHNGCILPEELWEALVKAGIEMDDEELAHFVEHVDKDNNGIITFEEWRDF  178

Query  1648  LLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATA  1469
             LLLYPHEATIENIY + ERVCLVDIGEQAVIPEGISKHVH S+Y IAG +AGAASRTATA
Sbjct  179   LLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVHRSRYFIAGAIAGAASRTATA  238

Query  1468  PLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLK  1289
             PLDRLKVVLQVQT+RAS++PA++ I+KE G  GFFRGNGINV+KVAPESAIKFYTYE+LK
Sbjct  239   PLDRLKVVLQVQTSRASVVPAIRKIFKEDGFLGFFRGNGINVVKVAPESAIKFYTYELLK  298

Query  1288  NAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRL  1112
             N IG   G ++ DIGT+GRL+AGG+AGAVAQTAIYP+DLVKTRLQT   E GK P LG L
Sbjct  299   NVIGENMGENKDDIGTAGRLLAGGMAGAVAQTAIYPLDLVKTRLQTCASEAGKGPRLGIL  358

Query  1111  SKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQD-SEPGPLVQLG  935
             +K+I   EGPRAFY+G++PSLLGI+PYAGIDLA Y+ LK+ ++TY L D S+PGPL+QLG
Sbjct  359   TKEILTHEGPRAFYKGLLPSLLGIVPYAGIDLAAYETLKDMSKTYFLHDKSDPGPLIQLG  418

Query  934   SGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPN  755
              GT+SGALGATCVYPLQV+RTRMQAQ ++T+ AY+GM DVF RT + EG RGFYKGLFPN
Sbjct  419   CGTVSGALGATCVYPLQVIRTRMQAQRSNTAEAYRGMSDVFWRTLQREGYRGFYKGLFPN  478

Query  754   LLKVVPAASITYLVYESMKKTLDL  683
             LLKVVPAASITY+VYE+MKK LDL
Sbjct  479   LLKVVPAASITYMVYEAMKKKLDL  502



>ref|XP_004493102.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Cicer arietinum]
Length=465

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/470 (77%), Positives = 412/470 (88%), Gaps = 7/470 (1%)
 Frame = -1

Query  2083  MDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLR  1904
             MDHVL A QETKEERD RIRSLF+FFD +N GYL+++ IE GLSA++I ++YK+A +LL 
Sbjct  1     MDHVLLASQETKEERDKRIRSLFNFFDKENRGYLEFSHIEAGLSALEIPSEYKYATDLLN  60

Query  1903  VVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDD  1724
               DANKD RVD+ EF+KYMDDKE+ELYRIFQAIDVEH+G ILPEELW+ALV+AGI+IDD 
Sbjct  61    ACDANKDNRVDFVEFKKYMDDKEVELYRIFQAIDVEHNGCILPEELWEALVRAGIKIDDK  120

Query  1723  ELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGI  1544
             ELA FVE VDKD++GVITFEEWRDFLLLYPHEATIENIY YLER+C+VDIGE  VIP G+
Sbjct  121   ELAHFVERVDKDHNGVITFEEWRDFLLLYPHEATIENIYHYLERICMVDIGEHTVIPAGV  180

Query  1543  SKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFF  1364
              KH+HAS+YLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA IMPAVK IWKEGGI  FF
Sbjct  181   GKHIHASRYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRARIMPAVKDIWKEGGIVAFF  240

Query  1363  RGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE--GDIGTSGRLIAGGLAGAVAQTAI  1190
             RGNG+NVLKVAPESAI+FYTYEM+K  I  AKG E   DIG  GRL+AGG+AGAVAQTAI
Sbjct  241   RGNGLNVLKVAPESAIRFYTYEMMKTFIVDAKGGEVKADIGGMGRLLAGGIAGAVAQTAI  300

Query  1189  YPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAV  1010
             YPMDLVKTRLQT+TC  GK+P LG LSKDIW++EGPRAFYRG++PS+LGIIPYAGIDLA 
Sbjct  301   YPMDLVKTRLQTFTCASGKIPSLGTLSKDIWVQEGPRAFYRGLIPSILGIIPYAGIDLAA  360

Query  1009  YDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYK  830
             Y+ LK  ++ YI+QD EPGPLVQLG GT+SGALGATCVYPLQVVRTRMQAQ     ++YK
Sbjct  361   YETLKEMSKKYIIQDGEPGPLVQLGCGTVSGALGATCVYPLQVVRTRMQAQ-----SSYK  415

Query  829   GMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             GM DVF +T  HEG RGFYKG+FPNLLKVVP+ASITY+VYESMKK+LDL+
Sbjct  416   GMADVFRKTLEHEGFRGFYKGIFPNLLKVVPSASITYMVYESMKKSLDLE  465



>emb|CBI15774.3| unnamed protein product [Vitis vinifera]
Length=509

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/510 (73%), Positives = 419/510 (82%), Gaps = 45/510 (9%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAMTAKDRSE-------CCNPVMKPGPVSMDHVLAALQETKEERDIR  2030
             MSGAG+AV  V F  M  +  S        CCNPV K GPV MDHVL ALQE+KEERD+R
Sbjct  38    MSGAGQAVERVGFGKMEKRRASSDSESETGCCNPVRKGGPVGMDHVLLALQESKEERDVR  97

Query  2029  IRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKY  1850
             IRSLF+FFDS N GYLDYAQIE GLSA+QI  +YK+AK+LL+V D+N DGRVDY EFR+Y
Sbjct  98    IRSLFNFFDSANLGYLDYAQIEGGLSALQIPPEYKYAKDLLKVCDSNSDGRVDYQEFRRY  157

Query  1849  MDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVIT  1670
             MDDKELELYRIFQAIDV+H+G ILPEELWDAL+KAGIEIDD+ELARFVE+VDKDN+G+IT
Sbjct  158   MDDKELELYRIFQAIDVKHNGCILPEELWDALLKAGIEIDDEELARFVENVDKDNNGIIT  217

Query  1669  FEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGA  1490
             FEEWRDFLLLYPHEATIENIY+Y  RVCLVDIGEQAVIPEGISKHVHASKYL+AGGVAGA
Sbjct  218   FEEWRDFLLLYPHEATIENIYQYWGRVCLVDIGEQAVIPEGISKHVHASKYLLAGGVAGA  277

Query  1489  ASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKF  1310
             ASRTATAPLDRLKVVLQVQTT A I+PA+K+IWKEGG+ GFFRGNG+NV+KVAPESAIKF
Sbjct  278   ASRTATAPLDRLKVVLQVQTTHARIVPAIKNIWKEGGLLGFFRGNGLNVVKVAPESAIKF  337

Query  1309  YTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKV  1130
             YTYEM KN                                       TRLQTYTCEGGKV
Sbjct  338   YTYEMFKNV--------------------------------------TRLQTYTCEGGKV  359

Query  1129  PHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGP  950
             P+L  L+++IW +EGP+ FYRG+VPS+LGIIPYAGIDLA Y+ LK+ ++TY+L DSEPGP
Sbjct  360   PYLKTLARNIWFQEGPQGFYRGLVPSVLGIIPYAGIDLAAYETLKDMSKTYLLHDSEPGP  419

Query  949   LVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYK  770
             LVQLGSGTISGALGATCVYPLQV+RTRMQAQ T+T  +Y GM DVF RT +HEG RGFYK
Sbjct  420   LVQLGSGTISGALGATCVYPLQVIRTRMQAQRTNTDASYNGMSDVFRRTLQHEGFRGFYK  479

Query  769   GLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             GLFPNLLKVVP+ASITYLVYE+MKK+LDLD
Sbjct  480   GLFPNLLKVVPSASITYLVYETMKKSLDLD  509



>ref|XP_004304572.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Fragaria vesca subsp. vesca]
Length=481

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/471 (76%), Positives = 413/471 (88%), Gaps = 2/471 (0%)
 Frame = -1

Query  2089  VSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKEL  1910
             V++DHVL AL ETKEER++RIR+LF+ FD+ NAGYLDYA IE GLSA+QI  +YKFAK+L
Sbjct  11    VTLDHVLLALGETKEERELRIRNLFNLFDTANAGYLDYALIEAGLSALQIPPEYKFAKDL  70

Query  1909  LRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEID  1730
             L V DAN+DGRVDY +F+ YMDDKELELY IFQAIDV+H G ILPEELWDALV+AGIEID
Sbjct  71    LNVCDANRDGRVDYQDFKHYMDDKELELYAIFQAIDVKHHGCILPEELWDALVRAGIEID  130

Query  1729  DDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPE  1550
             D+ELA FVE VDKDN+GVITFEEWRDFLLLYP EATIENIY YLERVCLVDIGEQ V PE
Sbjct  131   DEELALFVERVDKDNNGVITFEEWRDFLLLYPQEATIENIYHYLERVCLVDIGEQTVTPE  190

Query  1549  GISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISG  1370
              ++KH+HAS+YLIAG VAGA SRTATAPLDRLKVVLQVQT +A IMPAV+ IW++GG+ G
Sbjct  191   VMNKHIHASRYLIAGAVAGATSRTATAPLDRLKVVLQVQTQQARIMPAVRDIWRQGGLLG  250

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEGDIGTSGRLIAGGLAGAVAQT  1196
             FFRGNG+NV KVAPESAI+FYTYEMLK+ I HA G  D+ +IG + RL++GGLAGAVAQ 
Sbjct  251   FFRGNGLNVFKVAPESAIRFYTYEMLKSYILHANGEEDKANIGMTTRLVSGGLAGAVAQA  310

Query  1195  AIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDL  1016
             AIYPMDLVKTR+QTY CEGG+ P +G LSK IW++EGPRAFYRG+VPSLLGI+PYAGIDL
Sbjct  311   AIYPMDLVKTRIQTYACEGGRTPSVGSLSKQIWVQEGPRAFYRGLVPSLLGIVPYAGIDL  370

Query  1015  AVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTA  836
             A YD LK+ ++ YIL D+EPGPLVQLG GT+SGALGA+CVYPLQVVRTRMQAQ  +  +A
Sbjct  371   AAYDTLKDMSKKYILHDTEPGPLVQLGCGTVSGALGASCVYPLQVVRTRMQAQRINKDSA  430

Query  835   YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             Y+GM DVF RT +HEG RG YKG+FPNLLKVVP+ASITY+VYESMKKTLDL
Sbjct  431   YEGMADVFRRTLQHEGFRGLYKGIFPNLLKVVPSASITYMVYESMKKTLDL  481



>ref|XP_009378058.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009378059.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
isoform X1 [Pyrus x bretschneideri]
Length=497

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/480 (75%), Positives = 416/480 (87%), Gaps = 7/480 (1%)
 Frame = -1

Query  2116  CNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ  1937
             CNP+ K GPVSMDHVL AL ETKE+R++RIR+LF+FFD+ N GYLDYA IE GLSA+ I 
Sbjct  22    CNPIKKTGPVSMDHVLLALGETKEQRELRIRTLFNFFDTANVGYLDYAHIEAGLSALDIP  81

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
             + YK+A +LL V DAN+DGRVDY +F++YMDDKELELYRIFQAIDVEH+G ILPEELWDA
Sbjct  82    SQYKYANDLLNVCDANRDGRVDYQDFKRYMDDKELELYRIFQAIDVEHNGCILPEELWDA  141

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             LV+AGIEIDD+ELA FVE VDKDN+GVITFEEWRDFLLLYP EATIENIY YLERVCLVD
Sbjct  142   LVRAGIEIDDEELALFVERVDKDNNGVITFEEWRDFLLLYPQEATIENIYHYLERVCLVD  201

Query  1576  IGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS  1397
             IGEQ ++P    KHVHAS+YLIAG VAGA SRTATAPLDRLKV+LQVQT RA IMPAVK 
Sbjct  202   IGEQTIVPGVTGKHVHASRYLIAGAVAGATSRTATAPLDRLKVILQVQTKRARIMPAVKD  261

Query  1396  IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEGDIGTSGRLIAG  1223
             IW+EGG+ GFFRGNG+NVLKVAPESAI+FYTYEMLK  I HA G  D+ ++ T+ RL++G
Sbjct  262   IWREGGLLGFFRGNGLNVLKVAPESAIRFYTYEMLKRFIVHANGEEDKANVSTATRLVSG  321

Query  1222  GLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLG  1043
             GLAGAVAQT +YPMDLVKTR+QTYT EG ++P L  LS+DIW++EGPRAFY+G+VPSLLG
Sbjct  322   GLAGAVAQTVVYPMDLVKTRIQTYTGEGRRIPSLRTLSRDIWVQEGPRAFYKGVVPSLLG  381

Query  1042  IIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQ  863
             I+PYAGIDLA Y+ +K+ ++ YI+ + EPG LVQLG GT+SGALGATCVYPLQVVRTRMQ
Sbjct  382   IVPYAGIDLAAYETMKDMSKKYIVHEGEPGALVQLGCGTVSGALGATCVYPLQVVRTRMQ  441

Query  862   AQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             A      T Y GM DVF RTF+HEGLRGFYKG+FPNLLKVVP+ASITY+VYESMKK+LDL
Sbjct  442   AH-----TEYMGMGDVFRRTFQHEGLRGFYKGIFPNLLKVVPSASITYMVYESMKKSLDL  496



>gb|AFJ66167.1| hypothetical protein 11M19.11 [Arabidopsis halleri]
Length=502

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/501 (74%), Positives = 418/501 (83%), Gaps = 10/501 (2%)
 Frame = -1

Query  2167  VGHVNFPA---MTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSD  1997
             V HV  P     T   +  CCNPV KPGPVSMDHVL AL+ET+EERD+RIRSLF+FFDS+
Sbjct  7     VEHVGLPTKMEATKSSKHGCCNPVKKPGPVSMDHVLLALRETREERDLRIRSLFNFFDSE  66

Query  1996  NAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRI  1817
             N GYLD AQIE+GL A+QI + YK+AKEL RV DAN+DGRVDY EFR+YMDDKELELYRI
Sbjct  67    NVGYLDCAQIEKGLCALQIPSGYKYAKELFRVCDANRDGRVDYHEFRRYMDDKELELYRI  126

Query  1816  FQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLY  1637
             FQAIDVEH+G I PE LWD+LVKAGIEI+D+ELARFVEHVDKDNDG+I FEEWRDFLLLY
Sbjct  127   FQAIDVEHNGCISPEGLWDSLVKAGIEINDEELARFVEHVDKDNDGIIMFEEWRDFLLLY  186

Query  1636  PHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDR  1457
             PHEATIENIY + ERVCLVDIGEQAVIPEGISKHV  S Y IAGG+AGAASRTATAPLDR
Sbjct  187   PHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVKRSNYFIAGGIAGAASRTATAPLDR  246

Query  1456  LKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIG  1277
             LKV+LQ+Q T A I  A+K IWK+ G+ GFFRGNG+N++KVAPESAIKFY YE+ KNAIG
Sbjct  247   LKVLLQIQKTDAKIREAIKLIWKQDGVRGFFRGNGLNIVKVAPESAIKFYAYELFKNAIG  306

Query  1276  HAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG-KVPHLGRLSKD  1103
                G D+ DIGT+ RL AGG+AGAVAQ +IYP+DLVKTRLQT T + G  VP LG L+KD
Sbjct  307   ENMGEDKADIGTTARLFAGGMAGAVAQASIYPLDLVKTRLQTCTSQAGVVVPRLGTLTKD  366

Query  1102  IWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTI  923
             I + EGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ +RTYILQD+EPGPLVQLG GTI
Sbjct  367   ILVHEGPRAFYKGLFPSLLGIIPYAGIDLAAYETLKDLSRTYILQDAEPGPLVQLGCGTI  426

Query  922   SGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKV  743
             SGALGATCVYPLQVVRTRMQA+   TS     M  VF RT   EG R  YKGL PNLLKV
Sbjct  427   SGALGATCVYPLQVVRTRMQAERARTS-----MSGVFRRTISEEGYRALYKGLLPNLLKV  481

Query  742   VPAASITYLVYESMKKTLDLD  680
             VPAASITY+VYE+MKK+L+LD
Sbjct  482   VPAASITYMVYEAMKKSLELD  502



>ref|XP_002437252.1| hypothetical protein SORBIDRAFT_10g023640 [Sorghum bicolor]
 gb|EER88619.1| hypothetical protein SORBIDRAFT_10g023640 [Sorghum bicolor]
Length=518

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/480 (74%), Positives = 425/480 (89%), Gaps = 1/480 (0%)
 Frame = -1

Query  2116  CNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ  1937
             C PV K GPV+M+HVL AL ET+ ER+ RIR +F+FFD++  G LDYAQIE GL+A+Q+ 
Sbjct  39    CEPVRKAGPVTMEHVLLALHETEAEREARIRDMFAFFDTEGRGQLDYAQIEAGLAALQVP  98

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
             A+ K+A+ELLR  D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELWDA
Sbjct  99    AECKYARELLRACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDA  158

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             LVKAGIEI+D+ELARFVEHVDKDN+G+ITFEEWRDFLLLYP+EATIENIY + ERVCLVD
Sbjct  159   LVKAGIEINDEELARFVEHVDKDNNGIITFEEWRDFLLLYPNEATIENIYHHWERVCLVD  218

Query  1576  IGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS  1397
             IGE A IPEGISKHV+ASKYLIAGG+AGAASRTATAPLDRLKV++QVQTTR ++M A+K 
Sbjct  219   IGEHAAIPEGISKHVNASKYLIAGGIAGAASRTATAPLDRLKVIMQVQTTRTTVMHAIKD  278

Query  1396  IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGG  1220
             IW +GG+ GFFRGNG+NV+KVAPESAI+FY YEMLK  I  +KG ++ +IG S RL+AGG
Sbjct  279   IWTKGGMLGFFRGNGLNVVKVAPESAIRFYAYEMLKEYIMKSKGENKSEIGASERLVAGG  338

Query  1219  LAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGI  1040
             LAGAVAQTAIYP+DLVKTRLQTY+ EGGKVP +G+LS+DI + EGPRAFYRG+VPSLLGI
Sbjct  339   LAGAVAQTAIYPIDLVKTRLQTYSGEGGKVPRIGQLSRDILVHEGPRAFYRGLVPSLLGI  398

Query  1039  IPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQA  860
             +PYAGIDLAVY+ LK+ ++TYIL+DS+PGPLVQLG GT+SGALGATCVYPLQV+RTR+QA
Sbjct  399   VPYAGIDLAVYETLKDVSKTYILKDSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQA  458

Query  859   QPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             Q  ++ +AY+GM DVF RT +HEG+ GFYKG+ PNLLKVVPAASITY+VYE+MKK L LD
Sbjct  459   QQANSESAYRGMSDVFWRTLQHEGVSGFYKGILPNLLKVVPAASITYIVYEAMKKNLSLD  518



>ref|XP_004503037.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like 
[Cicer arietinum]
Length=480

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/474 (74%), Positives = 411/474 (87%), Gaps = 0/474 (0%)
 Frame = -1

Query  2101  KPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKF  1922
              P  VSMDHVL AL ETKEER+IRIRSLF+FFD+ + GYLDY QIE GLSA+QI A+YK+
Sbjct  7     NPRNVSMDHVLVALGETKEEREIRIRSLFNFFDAGSNGYLDYGQIETGLSALQIPAEYKY  66

Query  1921  AKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAG  1742
             A+EL +V D+N DGRVDY EFR+YMDDKELELY IFQAIDVEH+G ILPEELWDAL +AG
Sbjct  67    ARELFKVCDSNSDGRVDYNEFRRYMDDKELELYCIFQAIDVEHNGSILPEELWDALDRAG  126

Query  1741  IEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQA  1562
             IE++D+ELARFVEHVDKDN+G ITFEEWRDFLLLYPHEATIENIY + ERV  VDIGEQA
Sbjct  127   IEMNDEELARFVEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHHWERVYHVDIGEQA  186

Query  1561  VIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEG  1382
             VIPE ISKH + SKY IAGG+AGA SRTATAPLDRLKVVLQVQTT +S M AV  IWK+ 
Sbjct  187   VIPEDISKHAYRSKYFIAGGIAGATSRTATAPLDRLKVVLQVQTTHSSAMSAVAKIWKQD  246

Query  1381  GISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVA  1202
              + GFFRGNG+N++KV+PESAIKFY +EMLKN IG  +G++ DIG +GRL+AGG+AG +A
Sbjct  247   SLKGFFRGNGLNIVKVSPESAIKFYAFEMLKNVIGDVEGNKSDIGAAGRLVAGGVAGGIA  306

Query  1201  QTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGI  1022
             QTAIYP+DL+KTRLQT   EGGK P +G L+K+IW++EGPRAFYRG++PS++G+IPYAGI
Sbjct  307   QTAIYPLDLIKTRLQTCASEGGKAPKIGTLTKNIWIQEGPRAFYRGLLPSVIGMIPYAGI  366

Query  1021  DLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTS  842
             DLAVYD LK+ ++ YI+ D+EPGPL+QLG GTISG LGATCVYPLQV+RTR+QAQP++ S
Sbjct  367   DLAVYDTLKDMSKRYIIHDNEPGPLIQLGCGTISGTLGATCVYPLQVIRTRLQAQPSNAS  426

Query  841   TAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
              AYKGMFD F RTF+HEG RG YKGL PNLLKVVPAASITY+VYE MKK LDLD
Sbjct  427   DAYKGMFDAFFRTFQHEGFRGLYKGLLPNLLKVVPAASITYMVYERMKKNLDLD  480



>ref|XP_007137825.1| hypothetical protein PHAVU_009G158900g [Phaseolus vulgaris]
 gb|ESW09819.1| hypothetical protein PHAVU_009G158900g [Phaseolus vulgaris]
Length=476

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/472 (76%), Positives = 412/472 (87%), Gaps = 0/472 (0%)
 Frame = -1

Query  2095  GPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAK  1916
             G VSMDH+LAAL ETKEER++RIRSLF+FFD+ N GYLD AQIE GLSA+QI  +YK+A+
Sbjct  5     GVVSMDHLLAALGETKEEREVRIRSLFNFFDAANNGYLDVAQIEVGLSALQIPPEYKYAR  64

Query  1915  ELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIE  1736
             EL  V DAN DGRV+Y EFR+YMDDKELELYRIFQAIDVEH G I+PEEL++AL+KAGIE
Sbjct  65    ELCEVCDANSDGRVEYHEFRRYMDDKELELYRIFQAIDVEHDGNIIPEELYEALLKAGIE  124

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             +DD+ELARFV+HVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVI
Sbjct  125   MDDEELARFVDHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVI  184

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             PEGISKH + +KY +AGGVAG+ SRT TAPLDRLKVVLQVQT  ASIMPAV  I K+ G+
Sbjct  185   PEGISKHANRTKYFLAGGVAGSISRTVTAPLDRLKVVLQVQTAHASIMPAVTKILKQDGL  244

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQT  1196
             SGFFRGNG+NV+KV PESAIKFY +EMLK  +G A+G + DIGT+GRL AGG+AGAVAQ 
Sbjct  245   SGFFRGNGLNVVKVTPESAIKFYAFEMLKKVVGEAQGSKSDIGTAGRLFAGGMAGAVAQA  304

Query  1195  AIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDL  1016
             AIYPMDL+KTRLQT   EGGKVP LG L+ +IW++EGPRAFYRG+VPSLLG+IPYA IDL
Sbjct  305   AIYPMDLIKTRLQTCPSEGGKVPKLGTLTMNIWVQEGPRAFYRGLVPSLLGMIPYAAIDL  364

Query  1015  AVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTA  836
               YD LK+ ++ +ILQD EPGPLVQLG GTISGA+GATCVYPLQV+RTR+QAQ ++ S A
Sbjct  365   TAYDTLKDMSKRHILQDREPGPLVQLGCGTISGAVGATCVYPLQVIRTRLQAQSSNASDA  424

Query  835   YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             YKGMFD F RTF+ EG  GFYKGLFPNLLKVVPAASITY+VYESMKK LDLD
Sbjct  425   YKGMFDAFRRTFQLEGFIGFYKGLFPNLLKVVPAASITYVVYESMKKNLDLD  476



>ref|XP_008341208.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
isoform X1 [Malus domestica]
 ref|XP_008341209.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
isoform X1 [Malus domestica]
Length=497

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/480 (75%), Positives = 415/480 (86%), Gaps = 7/480 (1%)
 Frame = -1

Query  2116  CNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ  1937
             CNP+ K GPV+MDHVL AL ETKE+R++RIR+LF+FFD+ N GYLDYA IE GLSA+ I 
Sbjct  22    CNPIKKTGPVTMDHVLLALGETKEQRELRIRTLFNFFDTANVGYLDYAHIEAGLSALDIP  81

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
             + YK+A +LL V DAN+DGRVDY +F++YMDDKELELYRIFQAIDVEH+G ILPEELWDA
Sbjct  82    SQYKYANDLLNVCDANQDGRVDYQDFKRYMDDKELELYRIFQAIDVEHNGCILPEELWDA  141

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             LV+AGIEIDD+ELA FVE VDKDN+GVITFEEWRDFLLLYP EATIENIY YLERVCLVD
Sbjct  142   LVRAGIEIDDEELALFVERVDKDNNGVITFEEWRDFLLLYPQEATIENIYHYLERVCLVD  201

Query  1576  IGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS  1397
             IGEQ ++P   SKHVHAS+YLIAG VAGA SRTATAPLDRLKV+LQVQT RA IMPAVK 
Sbjct  202   IGEQTIVPGVTSKHVHASRYLIAGAVAGATSRTATAPLDRLKVILQVQTKRARIMPAVKD  261

Query  1396  IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEGDIGTSGRLIAG  1223
             IW+EGG+ GFFRGNG+NVLKVAPESAI+FYTYEMLK  I HA G  D+ ++ T+ RL++G
Sbjct  262   IWREGGLLGFFRGNGLNVLKVAPESAIRFYTYEMLKRFIVHANGEEDKANVSTATRLVSG  321

Query  1222  GLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLG  1043
             GLAGAVAQT +YPMDLVKTR+QTYT EG ++P L  LS+DIW++EGPRA Y+G+VPSLLG
Sbjct  322   GLAGAVAQTVVYPMDLVKTRIQTYTGEGRRIPSLXTLSRDIWVQEGPRAXYKGVVPSLLG  381

Query  1042  IIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQ  863
             I+PYAGIDLA Y+ LK+ ++ YI+ D EPG LVQLG GT+SGALGATCVYPLQVVRTRMQ
Sbjct  382   IVPYAGIDLAAYETLKDMSKKYIVHDGEPGALVQLGCGTVSGALGATCVYPLQVVRTRMQ  441

Query  862   AQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             A      T Y GM DVF RTF+HEGL GFYKG+FPNLLKVVP+ASITY+VYESMKK+LDL
Sbjct  442   AH-----TEYMGMGDVFRRTFQHEGLIGFYKGIFPNLLKVVPSASITYMVYESMKKSLDL  496



>ref|XP_003602734.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Medicago 
truncatula]
 gb|AES72985.1| substrate carrier family protein [Medicago truncatula]
Length=483

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/470 (75%), Positives = 412/470 (88%), Gaps = 0/470 (0%)
 Frame = -1

Query  2089  VSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKEL  1910
             +S+DHVL AL ETKEER+IRIRSLF+FFD  N GY+DY QIE+GLSA+QI A+YK+A+EL
Sbjct  14    ISLDHVLEALGETKEEREIRIRSLFNFFDGGNNGYIDYIQIEKGLSALQIPAEYKYAREL  73

Query  1909  LRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEID  1730
               V DAN DGRVDY EFR+YMDDKELELY IFQAIDVEHSG ILPEELWDAL +AGIE+D
Sbjct  74    FMVCDANSDGRVDYNEFRRYMDDKELELYCIFQAIDVEHSGSILPEELWDALDRAGIEMD  133

Query  1729  DDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPE  1550
             ++ELARFVEHVDKDN+G ITFEEWRDFLLLYPHEATIENIY + ERV  VDIG+QAVIPE
Sbjct  134   EEELARFVEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHHWERVYHVDIGDQAVIPE  193

Query  1549  GISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISG  1370
              ISKH + SKY IAGG+AGA SRTATAPLDRLKV+LQVQTTR+S++ AV +IWK+  I G
Sbjct  194   DISKHANRSKYFIAGGIAGATSRTATAPLDRLKVMLQVQTTRSSVVSAVTTIWKQDNIRG  253

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAI  1190
             FFRGNG+NV+KV+PESAIKFY +EMLK  IG A+G+  DIG +GRL+AGG+AG +AQTAI
Sbjct  254   FFRGNGLNVVKVSPESAIKFYAFEMLKKVIGEAQGNNSDIGAAGRLLAGGVAGGIAQTAI  313

Query  1189  YPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAV  1010
             YPMDL+KTRLQT   EGG+ P LG L+K+IW++EGPRAFYRG++PS++G+IPYAGIDLA 
Sbjct  314   YPMDLIKTRLQTCASEGGRAPKLGTLTKNIWVQEGPRAFYRGLLPSVIGMIPYAGIDLAF  373

Query  1009  YDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYK  830
             YD LK+ ++ YI+ DS+PGPLVQLG GTISG LGATCVYPLQV+RTR+QAQP ++S AYK
Sbjct  374   YDTLKDMSKKYIIHDSDPGPLVQLGCGTISGTLGATCVYPLQVIRTRLQAQPLNSSDAYK  433

Query  829   GMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             GMFD F RTF+HEG RGFYKGL PNLLKVVPAASITY+VYESMKK LDL+
Sbjct  434   GMFDAFCRTFQHEGFRGFYKGLLPNLLKVVPAASITYMVYESMKKNLDLE  483



>ref|XP_010442859.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Camelina sativa]
Length=505

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/502 (74%), Positives = 421/502 (84%), Gaps = 11/502 (2%)
 Frame = -1

Query  2167  VGHVNFPA--MTAKDRSE--CCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDS  2000
             V HV  P   + AK   +  CCNPV KPGPVSMDHVL AL+ET+EERD+RIRSLFSFFDS
Sbjct  9     VEHVGLPTKKIEAKKSKQGSCCNPVKKPGPVSMDHVLLALRETREERDLRIRSLFSFFDS  68

Query  1999  DNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYR  1820
             +N GYLD AQIE+GL A+QI ++YK+AKEL RV DAN+DGRVDY EFR+YMDDKELELYR
Sbjct  69    ENVGYLDVAQIEKGLCALQIPSEYKYAKELFRVCDANRDGRVDYNEFRRYMDDKELELYR  128

Query  1819  IFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLL  1640
             IFQAIDVEH+G I PE LWD+LVKAGIEI+D+ELARFVEHVDKDNDG+I FEEWRDFLLL
Sbjct  129   IFQAIDVEHNGCISPEGLWDSLVKAGIEINDEELARFVEHVDKDNDGIIMFEEWRDFLLL  188

Query  1639  YPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLD  1460
             YPHEATIENIY + ERVCLVDIGEQAVIP+GISKHV  S Y IAGG+AGAASRTATAPLD
Sbjct  189   YPHEATIENIYHHWERVCLVDIGEQAVIPQGISKHVKRSNYFIAGGIAGAASRTATAPLD  248

Query  1459  RLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAI  1280
             RLKV+LQ+Q T A I  A+K IWK+ G+ GFFRGNG+ ++KVAPESAIKFY YE+ KNAI
Sbjct  249   RLKVLLQIQKTDAKIREAIKMIWKQDGVRGFFRGNGLIIVKVAPESAIKFYAYELFKNAI  308

Query  1279  GHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG-KVPHLGRLSK  1106
             G   G D+ DIGT+GRL AGG+AGAVAQ +IYP+DLVKTRLQT T + G  VP LG L+K
Sbjct  309   GENMGEDKADIGTTGRLFAGGMAGAVAQASIYPLDLVKTRLQTCTSQAGVVVPKLGSLTK  368

Query  1105  DIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGT  926
             DI + EGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ +RTYILQD+EPGPLVQLG GT
Sbjct  369   DILVHEGPRAFYKGLFPSLLGIIPYAGIDLAAYEKLKDLSRTYILQDAEPGPLVQLGCGT  428

Query  925   ISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLK  746
             ISGALGATCVYPLQVVRTRMQA+   TS     M  VF RT   EG +  YKGL PNLLK
Sbjct  429   ISGALGATCVYPLQVVRTRMQAERERTS-----MSGVFRRTISEEGYKALYKGLLPNLLK  483

Query  745   VVPAASITYLVYESMKKTLDLD  680
             VVPAASITY+VYE+MKK+L+LD
Sbjct  484   VVPAASITYMVYEAMKKSLELD  505



>ref|XP_009399748.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=478

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/478 (76%), Positives = 419/478 (88%), Gaps = 10/478 (2%)
 Frame = -1

Query  2083  MDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLR  1904
             MDHVL AL+ET EER++R+RSLF+FFD+   G+LDYAQI+ GLSA+++ A+YK+A++LL+
Sbjct  1     MDHVLLALRETGEEREVRVRSLFNFFDAAGVGHLDYAQIDSGLSALRVPAEYKYARDLLK  60

Query  1903  VVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDD  1724
             V DAN+DGRVDY EFR+YMDDKELELYRIFQAIDVEH+G ILPEELWDAL+KAGI+IDD+
Sbjct  61    VCDANRDGRVDYQEFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDALIKAGIDIDDE  120

Query  1723  ELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGI  1544
             ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY+Y ERVCLVDIGEQAVIPEGI
Sbjct  121   ELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYQYWERVCLVDIGEQAVIPEGI  180

Query  1543  SKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFF  1364
             SKHV+ SKYLIAGGVAGAASRTATAPLDRLKV LQVQTTRA I+PA+K IW+EGG   FF
Sbjct  181   SKHVNPSKYLIAGGVAGAASRTATAPLDRLKVALQVQTTRARILPAIKDIWREGGFLSFF  240

Query  1363  RGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE-GDIGTSGRLIAGGLAGAVAQTAIY  1187
             RGNG+NV+KV PESAIKFYT+E+LK+ I   KG+E  +IG S RLIAGG+AGAV+QT IY
Sbjct  241   RGNGLNVIKVTPESAIKFYTFEILKDFIVKGKGEEKSNIGASERLIAGGIAGAVSQTVIY  300

Query  1186  PMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVY  1007
             PMDLVKTRLQTY CE GKVP+L  L++DIW+ EGPRAFYRGIVPSLLGIIP+AGIDLA Y
Sbjct  301   PMDLVKTRLQTYACEAGKVPNLAMLTRDIWVHEGPRAFYRGIVPSLLGIIPFAGIDLAAY  360

Query  1006  DALKNFARTYILQDS---------EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQP  854
             + LK+ +RTYIL+++         +PGPL+QLG GTIS ALGATCVYPLQV+RTRMQAQ 
Sbjct  361   ETLKDMSRTYILKNTRSDSLKCYADPGPLMQLGCGTISSALGATCVYPLQVIRTRMQAQR  420

Query  853   THTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             T+ S  Y GM DVF RT ++EGL GFYKG+ PNLLKVVPAA ITYLVYE+MKK+L LD
Sbjct  421   TNPSNNYYGMSDVFWRTLKNEGLLGFYKGIIPNLLKVVPAAGITYLVYETMKKSLSLD  478



>ref|XP_010442584.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Camelina sativa]
Length=505

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/502 (73%), Positives = 418/502 (83%), Gaps = 11/502 (2%)
 Frame = -1

Query  2167  VGHVNFPA----MTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDS  2000
             V HV  P      T   +  CCNPV KPGPVSMDHVL AL+ET+EERD+RIRSLF+FFDS
Sbjct  9     VEHVGLPTKKMEATKSKQGSCCNPVKKPGPVSMDHVLLALRETREERDLRIRSLFNFFDS  68

Query  1999  DNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYR  1820
             +N GYL+ AQIE+GL A+QI + YK+AKEL RV DAN+DGRVDY EFR+YMDDKELELYR
Sbjct  69    ENVGYLECAQIEKGLCALQIPSGYKYAKELFRVCDANRDGRVDYNEFRRYMDDKELELYR  128

Query  1819  IFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLL  1640
             IFQAIDVEH+G I PE LWD+LVKAGIEI+D+ELARFVEHVDKDNDG+I FEEWRDFLLL
Sbjct  129   IFQAIDVEHNGCISPEGLWDSLVKAGIEINDEELARFVEHVDKDNDGIIMFEEWRDFLLL  188

Query  1639  YPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLD  1460
             YPHEATIENIY + ERVCLVDIGEQAVIP+GISKHV  S Y IAGG+AGAASRTATAPLD
Sbjct  189   YPHEATIENIYHHWERVCLVDIGEQAVIPQGISKHVKRSNYFIAGGIAGAASRTATAPLD  248

Query  1459  RLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAI  1280
             RLKV+LQ+Q T A I  A+K IWK+ G+ GFFRGNG+N++KVAPESAIKFY YE+ KNAI
Sbjct  249   RLKVLLQIQKTDAKIREAIKMIWKQDGVRGFFRGNGLNIVKVAPESAIKFYAYELFKNAI  308

Query  1279  GHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG-KVPHLGRLSK  1106
             G   G D+ DIGT+ RL AGG+AGAVAQ +IYP+DLVKTRLQT T + G  VP LG L+K
Sbjct  309   GENMGEDKADIGTTARLFAGGMAGAVAQASIYPLDLVKTRLQTCTSQAGVVVPKLGTLTK  368

Query  1105  DIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGT  926
             DI + EGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ +RTYILQD+EPGPLVQLG GT
Sbjct  369   DILVHEGPRAFYKGLFPSLLGIIPYAGIDLAAYEKLKDLSRTYILQDAEPGPLVQLGCGT  428

Query  925   ISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLK  746
             ISGALGATCVYPLQVVRTRMQA+   TS     M  VF RT   EG +  YKGL PNLLK
Sbjct  429   ISGALGATCVYPLQVVRTRMQAERERTS-----MSGVFRRTISEEGYKALYKGLLPNLLK  483

Query  745   VVPAASITYLVYESMKKTLDLD  680
             VVPAASITY+VYE+MKK+L+LD
Sbjct  484   VVPAASITYMVYEAMKKSLELD  505



>ref|XP_007161553.1| hypothetical protein PHAVU_001G079200g [Phaseolus vulgaris]
 gb|ESW33547.1| hypothetical protein PHAVU_001G079200g [Phaseolus vulgaris]
Length=473

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/476 (76%), Positives = 412/476 (87%), Gaps = 7/476 (1%)
 Frame = -1

Query  2101  KPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKF  1922
             K  PV+MDHVL A QETKEER++RIR LF FFD DN G+LDYA IE GLSA+QI ++YK+
Sbjct  3     KASPVTMDHVLLASQETKEEREVRIRGLFEFFDRDNHGFLDYANIEAGLSALQIPSEYKY  62

Query  1921  AKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAG  1742
             AK+LL   D NKDGRVD+ EF+ YMDDKEL++YRIFQAIDV H+G ILPEEL +ALVKAG
Sbjct  63    AKDLLNACDENKDGRVDFQEFKSYMDDKELDIYRIFQAIDVAHNGCILPEELLEALVKAG  122

Query  1741  IEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQA  1562
             I+IDD+ELARFVEHVDKDN+GVITFEEWRDFLLLYPHEATIENIY YLER+C+VDIGEQ+
Sbjct  123   IKIDDEELARFVEHVDKDNNGVITFEEWRDFLLLYPHEATIENIYHYLERICMVDIGEQS  182

Query  1561  VIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEG  1382
             VIP GISKH+ A++YLIAGGVAGA SRTATAPLDRLKVVLQVQT RA I PA+K+IWKEG
Sbjct  183   VIPAGISKHIDATRYLIAGGVAGATSRTATAPLDRLKVVLQVQTARAHITPAIKAIWKEG  242

Query  1381  GISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE--GDIGTSGRLIAGGLAGA  1208
             G+ GFFRGNG+NVLKVAPESAI+FY+YEMLK  I  AKG+E    IG  GRL+AGG+AGA
Sbjct  243   GLLGFFRGNGLNVLKVAPESAIRFYSYEMLKTFIVRAKGEETQAGIGAMGRLLAGGIAGA  302

Query  1207  VAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYA  1028
             +AQTAIYPMDLVKTRLQTY CE   +P LG LSKDIWL+EGPRAFYRG++PSLLGIIPYA
Sbjct  303   IAQTAIYPMDLVKTRLQTYVCESRGIPSLGTLSKDIWLQEGPRAFYRGLIPSLLGIIPYA  362

Query  1027  GIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTH  848
             GIDLA Y+ LK+ ++ YIL D EPG LVQLG GT+SGALGATCVYPLQVVRTRMQAQ   
Sbjct  363   GIDLAAYETLKDMSKMYILHDGEPGALVQLGCGTVSGALGATCVYPLQVVRTRMQAQ---  419

Query  847   TSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
                +YKGM DVF +T  +EG RGFYKG+FPNLLKVVP+ASITY+VYESMKK+L L+
Sbjct  420   --RSYKGMADVFRKTLENEGFRGFYKGIFPNLLKVVPSASITYMVYESMKKSLHLN  473



>ref|XP_010482432.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Camelina sativa]
Length=505

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/502 (74%), Positives = 418/502 (83%), Gaps = 11/502 (2%)
 Frame = -1

Query  2167  VGHVNFPAMTAKD----RSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDS  2000
             V HV  P    +     +  CCNPV KPGPVSMDHVL AL+ET+EERD+RIRSLFSFFDS
Sbjct  9     VEHVGLPKKKMEAKKSKQGSCCNPVKKPGPVSMDHVLLALRETREERDLRIRSLFSFFDS  68

Query  1999  DNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYR  1820
             +N GYLD AQIE+GL A+QI + YK+AKEL RV DAN+DGRVDY EFR+YMDDKELELYR
Sbjct  69    ENVGYLDCAQIEKGLCALQIPSGYKYAKELFRVCDANRDGRVDYNEFRRYMDDKELELYR  128

Query  1819  IFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLL  1640
             IFQAIDVEH+G I PE LWD+LVKAGIEI+D+ELARFVEHVDKDNDG+I FEEWRDFLLL
Sbjct  129   IFQAIDVEHNGCISPEGLWDSLVKAGIEINDEELARFVEHVDKDNDGIIMFEEWRDFLLL  188

Query  1639  YPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLD  1460
             YPHEATIENIY + ERVCLVDIGEQAVIP+GISKHV  S Y IAGG+AGAASRTATAPLD
Sbjct  189   YPHEATIENIYHHWERVCLVDIGEQAVIPQGISKHVKRSNYFIAGGIAGAASRTATAPLD  248

Query  1459  RLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAI  1280
             RLKV+LQ+Q T A I  A+K IWK+ G+ GFFRGNG+N++KVAPESAIKFY YE+ KNAI
Sbjct  249   RLKVLLQIQKTDAKIREAIKMIWKQDGVRGFFRGNGLNIVKVAPESAIKFYAYELFKNAI  308

Query  1279  GHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG-KVPHLGRLSK  1106
             G   G D+ DIGT+ RL AGG+AGAVAQ +IYP+DLVKTRLQT T + G  VP LG L+K
Sbjct  309   GENMGEDKADIGTTARLFAGGMAGAVAQASIYPLDLVKTRLQTCTSQAGVVVPKLGTLTK  368

Query  1105  DIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGT  926
             DI + EGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ +RTYILQD+EPGPLVQLG GT
Sbjct  369   DILVHEGPRAFYKGLFPSLLGIIPYAGIDLAAYEKLKDLSRTYILQDAEPGPLVQLGCGT  428

Query  925   ISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLK  746
             ISGALGATCVYPLQVVRTRMQA+   TS     M  VF RT   EG +  YKGL PNLLK
Sbjct  429   ISGALGATCVYPLQVVRTRMQAERERTS-----MSGVFRRTISEEGYKALYKGLLPNLLK  483

Query  745   VVPAASITYLVYESMKKTLDLD  680
             VVPAASITY+VYE+MKK+L+LD
Sbjct  484   VVPAASITYMVYEAMKKSLELD  505



>ref|XP_006281426.1| hypothetical protein CARUB_v10027500mg [Capsella rubella]
 gb|EOA14324.1| hypothetical protein CARUB_v10027500mg [Capsella rubella]
Length=486

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/487 (75%), Positives = 413/487 (85%), Gaps = 7/487 (1%)
 Frame = -1

Query  2134  KDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGL  1955
             K +  CCNPV KPGPVSMDHVL AL+ET+EERD+RIRSLF+FFDS+N GYLD AQIE+GL
Sbjct  5     KSKQGCCNPVKKPGPVSMDHVLLALRETREERDLRIRSLFNFFDSENVGYLDCAQIEKGL  64

Query  1954  SAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILP  1775
              A+QI + YK+AKEL RV DAN+DGRVDY EFR+YMDDKELELYRIFQAIDVEH+G I P
Sbjct  65    CALQIPSGYKYAKELFRVCDANRDGRVDYHEFRRYMDDKELELYRIFQAIDVEHNGCISP  124

Query  1774  EELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLE  1595
             E LWD+LVKAGIEI+D+ELARFVEHVDKDNDG+I FEEWRDFLLLYPHEATIENIY + E
Sbjct  125   EGLWDSLVKAGIEINDEELARFVEHVDKDNDGIILFEEWRDFLLLYPHEATIENIYHHWE  184

Query  1594  RVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASI  1415
             RVCLVDIGEQAVIPEGISKHV  S Y IAGG+AGAASRTATAPLDRLKV+LQ+Q T A I
Sbjct  185   RVCLVDIGEQAVIPEGISKHVKRSNYFIAGGIAGAASRTATAPLDRLKVLLQIQKTDAKI  244

Query  1414  MPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSG  1238
               A+K IWK+ G+ GFFRGNG+N++KVAPESAIKFY YE+ KNAIG   G D+ DIGT+ 
Sbjct  245   REAIKMIWKQDGVRGFFRGNGLNIVKVAPESAIKFYAYELFKNAIGENMGEDKADIGTTA  304

Query  1237  RLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG-KVPHLGRLSKDIWLREGPRAFYRGI  1061
             RL AGG+AGAVAQ +IYP+DLVKTRLQT T + G  VP LG L+KDI + EGPRAFY+G+
Sbjct  305   RLFAGGMAGAVAQASIYPLDLVKTRLQTCTSQAGVAVPKLGTLTKDILVHEGPRAFYKGL  364

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQV  881
              PSLLGIIPYAGIDLA Y+ LK+ +R YILQD+EPGPLVQLG GTISGALGATCVYPLQV
Sbjct  365   FPSLLGIIPYAGIDLAAYEKLKDLSRIYILQDAEPGPLVQLGCGTISGALGATCVYPLQV  424

Query  880   VRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESM  701
             VRTRMQA+   TS     M  VF RT   EG +  YKGL PNLLKVVPAASITY+VYE+M
Sbjct  425   VRTRMQAERERTS-----MSGVFRRTISEEGYKALYKGLLPNLLKVVPAASITYMVYEAM  479

Query  700   KKTLDLD  680
             KK+L+LD
Sbjct  480   KKSLELD  486



>ref|XP_002864093.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH40352.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=502

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/501 (73%), Positives = 416/501 (83%), Gaps = 10/501 (2%)
 Frame = -1

Query  2167  VGHVNFPA---MTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSD  1997
             V HV  P     T   +  CCNPV KPGPVSMDHVL AL+ET+EERD+R+RSLF+FFDS+
Sbjct  7     VEHVGLPTKIEATKSSKQGCCNPVKKPGPVSMDHVLLALRETREERDLRVRSLFNFFDSE  66

Query  1996  NAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRI  1817
             N GYLD AQIE+GL A+QI + YK+AKEL RV DAN+DGRVDY EFR+YMDDKELELYRI
Sbjct  67    NVGYLDCAQIEKGLCALQIPSGYKYAKELFRVCDANRDGRVDYHEFRRYMDDKELELYRI  126

Query  1816  FQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLY  1637
             FQAIDVEH+G I PE LWD+LVKAGIEI+D+ELARFVEHVDKDNDG+I FEEWRDFLLLY
Sbjct  127   FQAIDVEHNGCISPEGLWDSLVKAGIEINDEELARFVEHVDKDNDGIIMFEEWRDFLLLY  186

Query  1636  PHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDR  1457
             PHEATIENIY + ERVCLVDIGEQAVIPEGISKHV  S Y IAGG+AGAASRTATAPLDR
Sbjct  187   PHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVKRSNYFIAGGIAGAASRTATAPLDR  246

Query  1456  LKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIG  1277
             LKV+LQ+Q T A I   +K IWK+ G+ GFFRGNG+N++KVAPESAIKFY YE+ KNAIG
Sbjct  247   LKVLLQIQKTDAKIREGIKLIWKQDGVRGFFRGNGLNIVKVAPESAIKFYAYELFKNAIG  306

Query  1276  HAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG-KVPHLGRLSKD  1103
                G D+ DIGT+ RL AGG+AGAVAQ +IYP+DLVKTRLQT T +    VP LG L+KD
Sbjct  307   ENMGEDKADIGTTARLFAGGMAGAVAQASIYPLDLVKTRLQTCTSQADVVVPRLGTLTKD  366

Query  1102  IWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTI  923
             I + EGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ +RTYILQD+EPGPLVQLG GTI
Sbjct  367   ILVHEGPRAFYKGLFPSLLGIIPYAGIDLAAYETLKDLSRTYILQDAEPGPLVQLGCGTI  426

Query  922   SGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKV  743
             SGALGATCVYPLQVVRTRMQA+   TS     M  VF RT   EG R  YKGL PNLLKV
Sbjct  427   SGALGATCVYPLQVVRTRMQAERARTS-----MSGVFRRTISEEGYRALYKGLLPNLLKV  481

Query  742   VPAASITYLVYESMKKTLDLD  680
             VPAASITY+VYE+MKK+L+LD
Sbjct  482   VPAASITYMVYEAMKKSLELD  502



>ref|XP_010536573.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Tarenaya hassleriana]
Length=501

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/505 (74%), Positives = 423/505 (84%), Gaps = 10/505 (2%)
 Frame = -1

Query  2179  AGEAVGHVNFPAM--TAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFF  2006
             +G  VGHV  P     AK +  C NP  KPGPVSMDHVL AL+ET+EERD+RIRSLF FF
Sbjct  2     SGHGVGHVGLPTKMEAAKSKHGCSNPAKKPGPVSMDHVLLALRETREERDVRIRSLFDFF  61

Query  2005  DSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELEL  1826
             DSDN GYLD   IE+GLSA+QI + YK+AK+L RV DAN+DGRVDY EFR+YMDDKELEL
Sbjct  62    DSDNVGYLDCGHIEKGLSALQIPSGYKYAKDLFRVCDANRDGRVDYHEFRRYMDDKELEL  121

Query  1825  YRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFL  1646
             YRIFQAIDVEH+G I PE LWDALVKAGIEI+D+ELARFVEHVDKDN+G+ITFEEWRDFL
Sbjct  122   YRIFQAIDVEHNGCISPEGLWDALVKAGIEINDEELARFVEHVDKDNNGIITFEEWRDFL  181

Query  1645  LLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAP  1466
             LLYPHEATIENIY + ERVCLVDIGEQAVIPEGISK+V  SK+ IAGG+AGAASRTATAP
Sbjct  182   LLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKNVKRSKFFIAGGIAGAASRTATAP  241

Query  1465  LDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKN  1286
             LDRLKV+LQ+Q T A+I  A++ IWK+ G  GFFRGNG+NV+KVAPESAIKFY YE+ K 
Sbjct  242   LDRLKVLLQIQKTDANIREAIRMIWKQDGFWGFFRGNGLNVVKVAPESAIKFYAYELFKT  301

Query  1285  AIGHAKGD-EGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKV-PHLGRL  1112
              IG   G+ +GDIGTSGRL AGG+AGAVAQ AIYP+DLVKTRLQT + +GG   P LG L
Sbjct  302   VIGDKMGEAKGDIGTSGRLFAGGMAGAVAQAAIYPLDLVKTRLQTCSGQGGGAGPRLGAL  361

Query  1111  SKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSE-PGPLVQLG  935
             +K+IW+ EGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ ++TYILQDSE PGPL+QLG
Sbjct  362   TKEIWVHEGPRAFYKGLFPSLLGIIPYAGIDLAAYEKLKDLSKTYILQDSEQPGPLIQLG  421

Query  934   SGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPN  755
              GTISGALGATCVYPLQVVRTRMQA+   TS     M  VF RT R EG R FYKGL PN
Sbjct  422   CGTISGALGATCVYPLQVVRTRMQAERETTS-----MSGVFRRTLREEGYRAFYKGLIPN  476

Query  754   LLKVVPAASITYLVYESMKKTLDLD  680
             LLKVVPAASITYLVYE+MKK+L+L+
Sbjct  477   LLKVVPAASITYLVYEAMKKSLELE  501



>gb|EPS59119.1| hypothetical protein M569_15688 [Genlisea aurea]
Length=503

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/505 (76%), Positives = 429/505 (85%), Gaps = 18/505 (4%)
 Frame = -1

Query  2164  GHVNFPAMTA----------KDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLF  2015
              H  FPA  A          K RS  CNPV  PGPVS+DHVL+AL+ETKEERD RIRSLF
Sbjct  7     AHSKFPAPPAPSVASESSNPKARSSGCNPVKSPGPVSLDHVLSALRETKEERDSRIRSLF  66

Query  2014  SFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKE  1835
             SFFDS N GYLDYAQIE+GLSAM I ADYKFAKELL V D+N+DGRVDY EFRKYMDDKE
Sbjct  67    SFFDSGNVGYLDYAQIEKGLSAMLIPADYKFAKELLEVCDSNQDGRVDYQEFRKYMDDKE  126

Query  1834  LELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWR  1655
             LELYRIFQAIDVEH+G ILPEELWDAL+KAGIE++DDELA FV+HVDKDN+G+ITFEEWR
Sbjct  127   LELYRIFQAIDVEHNGCILPEELWDALLKAGIELEDDELAHFVDHVDKDNNGIITFEEWR  186

Query  1654  DFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTA  1475
             DFLL YPHEATIENIYRY E+V LVDIGEQAVIPEGI+KH +ASKYL+AGGVAGA SRTA
Sbjct  187   DFLLFYPHEATIENIYRYWEKVYLVDIGEQAVIPEGITKHANASKYLVAGGVAGATSRTA  246

Query  1474  TAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEM  1295
             TAPLDRLKV+LQV+T  AS+  AV+SIWKEGG  GFFRGNGINV+KVAPESAIKFYT+EM
Sbjct  247   TAPLDRLKVMLQVETAHASVGAAVRSIWKEGGALGFFRGNGINVMKVAPESAIKFYTFEM  306

Query  1294  LKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGR  1115
             LK   G   G +G+IGT+GRL AGGLAGAVAQT IYPMDLVKTRLQT+ CE  +VP L R
Sbjct  307   LKGIFG---GADGEIGTAGRLAAGGLAGAVAQTVIYPMDLVKTRLQTHVCERAEVPSLRR  363

Query  1114  LSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLG  935
             LSKDI  +EGPRAFYRG++PSLLGIIPYAGIDLAVY+ LK+ ++ Y+LQD EPGPLVQL 
Sbjct  364   LSKDILFQEGPRAFYRGLIPSLLGIIPYAGIDLAVYETLKDMSKKYVLQDGEPGPLVQLS  423

Query  934   SGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPN  755
              GT+SGALGATCVYPLQVVRTRMQA+       Y  M +VF RT++ EG+RGFYKGLFPN
Sbjct  424   CGTVSGALGATCVYPLQVVRTRMQAR-----RGYSSMSEVFWRTYQREGVRGFYKGLFPN  478

Query  754   LLKVVPAASITYLVYESMKKTLDLD  680
             LLKVVPAASITYLVYE+MKK+L L+
Sbjct  479   LLKVVPAASITYLVYEAMKKSLHLN  503



>ref|XP_010695942.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Beta vulgaris subsp. vulgaris]
Length=491

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/484 (75%), Positives = 418/484 (86%), Gaps = 6/484 (1%)
 Frame = -1

Query  2128  RSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSA  1949
             R E CNPV KPGPVSMDHVL ALQETK+ER++RIRSLF+FFD  + G+LDYAQIE GL+A
Sbjct  13    RCEGCNPVRKPGPVSMDHVLLALQETKDERELRIRSLFNFFDKLSTGFLDYAQIESGLTA  72

Query  1948  MQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEE  1769
             + I +DYK+A++LL V DANKDGRVDY EFR+YMDDKELELYRIFQ IDVEH+G ILPEE
Sbjct  73    LHIPSDYKYARDLLHVCDANKDGRVDYEEFRRYMDDKELELYRIFQTIDVEHNGCILPEE  132

Query  1768  LWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERV  1589
             L+DALVKAGIEI+D+ELA FVE VDKDN+GVITFEEWRDFLLLYPHE TI NIY Y ERV
Sbjct  133   LYDALVKAGIEINDEELALFVERVDKDNNGVITFEEWRDFLLLYPHEVTIANIYHYWERV  192

Query  1588  CLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMP  1409
             CLVDIGEQ VIPEG+S+H+HA +YLIAGG+AGAASRTATAPLDRLKV+LQVQT  A IMP
Sbjct  193   CLVDIGEQTVIPEGVSRHLHAGRYLIAGGIAGAASRTATAPLDRLKVLLQVQTKDACIMP  252

Query  1408  AVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE-GDIGTSGRL  1232
             AV  IWKEG +  FFRGNG+NV+KVAPESAI+FYTYE+LK  I  A+G E  DIG  GRL
Sbjct  253   AVSKIWKEGKVFAFFRGNGLNVVKVAPESAIRFYTYELLKGVIMDARGGEKADIGGMGRL  312

Query  1231  IAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPS  1052
             +AGGLAGA+AQTAIYP+DLVKTRLQT+ C GGKVP LG L+K+IW++EG RAFY+G+ PS
Sbjct  313   VAGGLAGAIAQTAIYPIDLVKTRLQTHECVGGKVPGLGTLTKNIWVKEGSRAFYKGLFPS  372

Query  1051  LLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRT  872
             LLGIIPYAGIDLA Y+ LK+ A+ +ILQDSEPGPLVQLG GTISGA+GATCVYPLQVVRT
Sbjct  373   LLGIIPYAGIDLAAYETLKDMAKLHILQDSEPGPLVQLGCGTISGAVGATCVYPLQVVRT  432

Query  871   RMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKT  692
             RMQA     S +   M +VF  T++ E LRGFYKGLFPNLLKV+P+ASITYLVYE+MKK 
Sbjct  433   RMQA-----SQSKARMSEVFWTTYQKERLRGFYKGLFPNLLKVIPSASITYLVYEAMKKR  487

Query  691   LDLD  680
             L+L+
Sbjct  488   LELE  491



>gb|KHN28603.1| Calcium-binding mitochondrial carrier protein SCaMC-1-A [Glycine 
soja]
Length=1040

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/475 (78%), Positives = 417/475 (88%), Gaps = 10/475 (2%)
 Frame = -1

Query  2089  VSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKEL  1910
             V+MDHVL A QETKE R+ RIRSLF FFD +N G+LDY+ IE GLSA+QI A+YK+AK+L
Sbjct  571   VTMDHVLLASQETKEAREARIRSLFDFFDRENLGFLDYSHIEAGLSALQIPAEYKYAKDL  630

Query  1909  LRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAG--IE  1736
             L   DANKDGRVD+ EFRKYMDDKELELYRIFQAIDV H+G ILPEELW+ALV+AG  I+
Sbjct  631   LNACDANKDGRVDFQEFRKYMDDKELELYRIFQAIDVAHNGCILPEELWEALVRAGMCIK  690

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             IDD+ELARFVE VDKDN+GVITF+EWRDFLLLYPHEATIENIY YLER+C+VDIGEQ VI
Sbjct  691   IDDEELARFVERVDKDNNGVITFQEWRDFLLLYPHEATIENIYHYLERMCMVDIGEQTVI  750

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             P GI KH+HAS+YLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA IMPA+K IWKEGG+
Sbjct  751   PAGIGKHIHASRYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRAQIMPAIKDIWKEGGL  810

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE---GDIGTSGRLIAGGLAGAV  1205
              GFFRGNG+NVLKVAPESAI+FY+YEMLK  I  AKG+E    DIG  GRL+AGG+AGAV
Sbjct  811   LGFFRGNGLNVLKVAPESAIRFYSYEMLKTFIVRAKGEEAKAADIGAMGRLLAGGIAGAV  870

Query  1204  AQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAG  1025
             AQTAIYPMDLVKTRLQTY C+ G++P LG LSKDIW++EGPRAFYRG++PSLLGIIPYAG
Sbjct  871   AQTAIYPMDLVKTRLQTYACKSGRIPSLGTLSKDIWVQEGPRAFYRGLIPSLLGIIPYAG  930

Query  1024  IDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHT  845
             IDLA Y+ LK+ ++ YIL D EPGPLVQLG GT+SGALGATCVYPLQVVRTRMQAQ    
Sbjct  931   IDLAAYETLKDMSKQYILHDGEPGPLVQLGCGTVSGALGATCVYPLQVVRTRMQAQ----  986

Query  844   STAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
               +YKGM DVF +T  HEGLRGFYKG+FPNLLKVVP+ASITY+VYESMKK LDL+
Sbjct  987   -RSYKGMADVFRKTLEHEGLRGFYKGIFPNLLKVVPSASITYMVYESMKKNLDLE  1040


 Score =   132 bits (331),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  2086  SMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELL  1907
             +MDHVL A QETKE R++RIRSLF FFD +N G+LDY+ IE GLSA+QI ++YK+AK+LL
Sbjct  434   TMDHVLLASQETKETREVRIRSLFDFFDRENLGFLDYSHIEAGLSALQIPSEYKYAKDLL  493

Query  1906  RVVDANKDGRVDYPEFRKYMDDKELE  1829
                DANKDGRVD+ EFRKYMDDKEL+
Sbjct  494   NACDANKDGRVDFQEFRKYMDDKELD  519



>ref|XP_003563659.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like 
[Brachypodium distachyon]
Length=515

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/480 (74%), Positives = 420/480 (88%), Gaps = 1/480 (0%)
 Frame = -1

Query  2116  CNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ  1937
             C P  K GPV+M+HVL AL ET+ ER+ RIR +F+FFD+   G LDYAQIE GL+A+Q+ 
Sbjct  36    CEPARKAGPVTMEHVLLALHETEAEREARIRDMFAFFDTSGRGQLDYAQIEAGLAALQVP  95

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
             A+ K+A+ELLR  D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELWDA
Sbjct  96    AECKYARELLRACDRDRDGRVGYEDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDA  155

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             LVKAGIEIDD+ELARFVEHVDKDN+G+ITFEEWRDFL+LYP+EATIENIY + ERVCLVD
Sbjct  156   LVKAGIEIDDEELARFVEHVDKDNNGIITFEEWRDFLMLYPNEATIENIYHHWERVCLVD  215

Query  1576  IGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS  1397
             IGEQA IPEG+SKHV ASKYLIAGG+AGAASRTATAPLDRLKV++QVQTTR ++  AVK 
Sbjct  216   IGEQAAIPEGLSKHVSASKYLIAGGIAGAASRTATAPLDRLKVIMQVQTTRTTVAHAVKD  275

Query  1396  IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGG  1220
             I+  GG+ GFFRGNG+NV+KVAPESAI+FY YE LK  I ++KG ++  +G S RL+AGG
Sbjct  276   IFIRGGLLGFFRGNGLNVVKVAPESAIRFYAYETLKEYIMNSKGENKSAVGASERLVAGG  335

Query  1219  LAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGI  1040
             LAGAVAQTAIYP+DLVKTRLQT++C GGKVP LG LS+DIW+ EGPRAFYRG+VPSLLGI
Sbjct  336   LAGAVAQTAIYPIDLVKTRLQTFSCVGGKVPSLGTLSRDIWMHEGPRAFYRGLVPSLLGI  395

Query  1039  IPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQA  860
             +PYAGIDLAVY+ LK+ +RTYIL+DS+PGPLVQLG GT+SGALGATCVYPLQV+RTR+QA
Sbjct  396   VPYAGIDLAVYETLKDASRTYILKDSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQA  455

Query  859   QPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             Q  ++ +AY+GM DVF RT +HEG+ GFYKG+ PNLLKVVPAASITYLVYE+MKK L LD
Sbjct  456   QRANSESAYRGMSDVFWRTLQHEGISGFYKGILPNLLKVVPAASITYLVYEAMKKNLSLD  515



>ref|XP_004965942.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like 
isoform X1 [Setaria italica]
Length=521

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/475 (75%), Positives = 419/475 (88%), Gaps = 1/475 (0%)
 Frame = -1

Query  2101  KPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKF  1922
             K  PV+M+HVL AL ET+ ER+ RIR +F+FFD+   G LDYAQIE GL+A+Q+ A+ K+
Sbjct  47    KAAPVTMEHVLLALHETEAERESRIRDMFAFFDATGRGQLDYAQIEAGLAALQVPAECKY  106

Query  1921  AKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAG  1742
             A+ELLR  D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELWDAL+KAG
Sbjct  107   ARELLRACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDALIKAG  166

Query  1741  IEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQA  1562
             IEI+D+ELARFVEHVDKDN+G+ITFEEWRDFLLLYP+E TIENIY + ERVCLVDIGEQA
Sbjct  167   IEINDEELARFVEHVDKDNNGIITFEEWRDFLLLYPNEVTIENIYHHWERVCLVDIGEQA  226

Query  1561  VIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEG  1382
              IPEGISKHV+ASKYLIAGG+AGAASRTATAPLDRLKV++QVQTTR ++M A+K IW +G
Sbjct  227   AIPEGISKHVNASKYLIAGGIAGAASRTATAPLDRLKVIMQVQTTRTTVMHAIKDIWAKG  286

Query  1381  GISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAV  1205
             G+ GFFRGNG+NV+KVAPESAI+FY YEMLK  I  +KG ++ ++G S RLIAGGLAGAV
Sbjct  287   GMLGFFRGNGLNVVKVAPESAIRFYAYEMLKEYIMKSKGENKSEVGASERLIAGGLAGAV  346

Query  1204  AQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAG  1025
             AQTAIYP+DLVKTRLQTY+CEGGKVP +G LS+DI + EGPRAFYRG+VPSLLGI+PYAG
Sbjct  347   AQTAIYPIDLVKTRLQTYSCEGGKVPRIGALSRDILMHEGPRAFYRGLVPSLLGIVPYAG  406

Query  1024  IDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHT  845
             IDLAVY+ LK+ ++TYIL+DS+PGPLVQLG GT+SGALGATCVYPLQV+RTR+QAQ  ++
Sbjct  407   IDLAVYETLKDMSKTYILKDSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQAQQANS  466

Query  844   STAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
               AY+GM DVF RT +HEG+ GFYKG+ PNLLKVVPAASITYLVYE+MKK L LD
Sbjct  467   EAAYRGMSDVFWRTLQHEGVSGFYKGIIPNLLKVVPAASITYLVYEAMKKNLSLD  521



>ref|XP_008658492.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW87190.1| hypothetical protein ZEAMMB73_723355 [Zea mays]
 gb|AFW87191.1| hypothetical protein ZEAMMB73_723355 [Zea mays]
Length=511

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/480 (74%), Positives = 422/480 (88%), Gaps = 1/480 (0%)
 Frame = -1

Query  2116  CNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ  1937
             C PV K GPV+M+HVL AL ET+ ER+ RIR +F+FFD+  +G LDYAQIE GL+A+Q+ 
Sbjct  32    CEPVRKAGPVTMEHVLLALHETEAEREARIRDMFAFFDTAGSGQLDYAQIEAGLAALQVP  91

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
             A+ K+A+ELLR  D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELWDA
Sbjct  92    AECKYARELLRACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDA  151

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             L+KAGIEI+D+ELARFVEHVDKDN+G+ITFEEWRDFLLLYP+EATIENIY + ERVCLVD
Sbjct  152   LIKAGIEINDEELARFVEHVDKDNNGIITFEEWRDFLLLYPNEATIENIYHHWERVCLVD  211

Query  1576  IGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS  1397
             IGEQA IPEGISKHV+ASKYLIAGG+AGAASRTATAPLDRLKV++QVQTTR S+M A+K 
Sbjct  212   IGEQAAIPEGISKHVNASKYLIAGGIAGAASRTATAPLDRLKVIMQVQTTRTSVMHAIKD  271

Query  1396  IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGG  1220
             IW +GG+ GFFRGNG+NV+KVAPESAI+FY YEMLK  I   KG ++ ++G S RLIAGG
Sbjct  272   IWTKGGMLGFFRGNGLNVVKVAPESAIRFYAYEMLKEYIMKRKGENKSEVGASERLIAGG  331

Query  1219  LAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGI  1040
             LAGAVAQTAIYP++LVKTRLQTY+ E G VP +G+LS+DI + EGPRAFYRG+VPSLLGI
Sbjct  332   LAGAVAQTAIYPIELVKTRLQTYSGEVGYVPRIGQLSRDILVHEGPRAFYRGLVPSLLGI  391

Query  1039  IPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQA  860
             +PYAGIDLAVY+ LK+ ++TYIL+DS+PGPLVQLG GT+SGALGATCVYPLQV+RTR+QA
Sbjct  392   VPYAGIDLAVYETLKDVSKTYILKDSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQA  451

Query  859   QPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             Q  ++ +AY+GM DVF RT  HEG+ GFYKG+ PNLLKVVPAASITYLVYE+MKK L LD
Sbjct  452   QQANSESAYRGMSDVFWRTLHHEGVSGFYKGILPNLLKVVPAASITYLVYEAMKKNLSLD  511



>ref|NP_001058018.1| Os06g0604500 [Oryza sativa Japonica Group]
 dbj|BAD35532.1| putative small calcium-binding mitochondrial carrier 2 [Oryza 
sativa Japonica Group]
 dbj|BAF19932.1| Os06g0604500 [Oryza sativa Japonica Group]
 dbj|BAG91818.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92821.1| unnamed protein product [Oryza sativa Japonica Group]
Length=515

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/480 (74%), Positives = 419/480 (87%), Gaps = 1/480 (0%)
 Frame = -1

Query  2116  CNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ  1937
             C P  K G V+M+HVL AL ET+ ER+ RIR +F+FFD D  G LDYAQIE GL+A+QI 
Sbjct  36    CEPARKAGAVTMEHVLLALHETEAEREARIREMFAFFDVDGRGQLDYAQIEAGLAALQIP  95

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
             A+ K+A+ELLR  D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELWDA
Sbjct  96    AECKYARELLRACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDA  155

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             LVKAGIEIDD+ELARFVEHVDKDN+G+ITFEEWRDFLLLYP+E TIENIY + ERVCLVD
Sbjct  156   LVKAGIEIDDEELARFVEHVDKDNNGIITFEEWRDFLLLYPNEVTIENIYHHWERVCLVD  215

Query  1576  IGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS  1397
             IGEQAVIPEGISK V+ASKYLIAGG+AGAASRTATAPLDRLKV++QVQTTR ++M ++K 
Sbjct  216   IGEQAVIPEGISKSVNASKYLIAGGIAGAASRTATAPLDRLKVIMQVQTTRTTVMHSIKD  275

Query  1396  IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGG  1220
             IW +GG+  FFRGNG+NV+KVAPESAI+FY YEMLK  I  +KG ++ ++G S RL+AGG
Sbjct  276   IWSQGGMLAFFRGNGLNVVKVAPESAIRFYAYEMLKEYIMKSKGENKSEVGPSERLVAGG  335

Query  1219  LAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGI  1040
             LAGAVAQTAIYP+DLVKTRLQTY+C  GKVP LG LS+DI + EGPRAFYRG+VPSLLGI
Sbjct  336   LAGAVAQTAIYPVDLVKTRLQTYSCVDGKVPSLGALSRDILMHEGPRAFYRGLVPSLLGI  395

Query  1039  IPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQA  860
             +PYAGIDLAVY+ LK+ ++TYIL+DS+PGPLVQLG GT+SGALGATCVYPLQV+RTR+QA
Sbjct  396   VPYAGIDLAVYETLKDVSKTYILKDSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQA  455

Query  859   QPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             Q  ++ +AY+GM DVF RT +HEG+ GFYKG+ PNLLKVVPAASITYLVYE+MKK L LD
Sbjct  456   QRANSESAYRGMSDVFWRTLQHEGVSGFYKGILPNLLKVVPAASITYLVYEAMKKNLSLD  515



>ref|XP_009140881.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Brassica rapa]
Length=499

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/499 (74%), Positives = 418/499 (84%), Gaps = 9/499 (2%)
 Frame = -1

Query  2167  VGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAG  1988
             V HV  P    K +   CNP  KPGPVSMDHVL AL+ET+EERD+RIRSLF+FFDS+NAG
Sbjct  7     VEHVGLPTQM-KSKQGSCNPFKKPGPVSMDHVLLALRETREERDVRIRSLFNFFDSENAG  65

Query  1987  YLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQA  1808
             YLD AQIE+GL A+QI + YK+AKEL RV DAN+DGRVDY EFR+YMDDKELELYRIFQA
Sbjct  66    YLDCAQIEKGLVALQIPSGYKYAKELFRVCDANRDGRVDYHEFRRYMDDKELELYRIFQA  125

Query  1807  IDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHE  1628
             IDVEH+G I PE LWD+LVKAGIEI+D+ELARFVEHVDKDNDG+I FEEWRDFLLLYPHE
Sbjct  126   IDVEHNGCISPEGLWDSLVKAGIEINDEELARFVEHVDKDNDGIILFEEWRDFLLLYPHE  185

Query  1627  ATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKV  1448
             ATIENIY + ERVCLVDIGEQAVIPEG+SKHV  S Y IAGG+AGAASRTATAPLDRLKV
Sbjct  186   ATIENIYHHWERVCLVDIGEQAVIPEGMSKHVKRSNYFIAGGIAGAASRTATAPLDRLKV  245

Query  1447  VLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAK  1268
             +LQ+Q T A I  AVK+IW +GG+ GFFRGNG+N++KVAPESAIKFY YE+ KNAIG   
Sbjct  246   LLQIQKTDAKIRDAVKAIWNQGGVRGFFRGNGLNIVKVAPESAIKFYAYELFKNAIGENM  305

Query  1267  G-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCE-GGKVPHLGRLSKDIWL  1094
             G D+ DIGT+ RL AGG+AGAVAQ +IYP+DLVKTRLQT T + G   P +G L+KDI +
Sbjct  306   GEDKADIGTTARLFAGGMAGAVAQASIYPLDLVKTRLQTCTSQAGAACPRIGTLTKDILV  365

Query  1093  REGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQ-DSEPGPLVQLGSGTISG  917
              EGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ +RTYILQ D+EPGPL+QLG GTISG
Sbjct  366   HEGPRAFYKGLFPSLLGIIPYAGIDLAAYEKLKDLSRTYILQEDAEPGPLIQLGCGTISG  425

Query  916   ALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVP  737
             ALGATCVYPLQVVRTRMQA+ T TS     M  VF RT   EG +  YKGL PNLLKVVP
Sbjct  426   ALGATCVYPLQVVRTRMQAERTRTS-----MSGVFRRTVSEEGYKALYKGLLPNLLKVVP  480

Query  736   AASITYLVYESMKKTLDLD  680
             AASITY+VYE+MKK+L+LD
Sbjct  481   AASITYMVYEAMKKSLELD  499



>gb|EPS60241.1| hypothetical protein M569_14562, partial [Genlisea aurea]
Length=466

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/474 (76%), Positives = 410/474 (86%), Gaps = 8/474 (2%)
 Frame = -1

Query  2110  PVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQAD  1931
             PV KP  VS+DHVL+AL+ETKEER+ RI  LF+FFDS   G+LD+  IE GLSA++I AD
Sbjct  1     PVKKPASVSLDHVLSALRETKEEREARIGDLFAFFDSGRGGFLDFTHIEEGLSALEIPAD  60

Query  1930  YKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALV  1751
             +KFA E  R  DAN+DG+VDY EFRKYMDDKELELYRIFQAIDVEHSG ILPEEL DAL+
Sbjct  61    HKFANEFFRACDANRDGKVDYQEFRKYMDDKELELYRIFQAIDVEHSGCILPEELMDALI  120

Query  1750  KAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIG  1571
              AGI+ID DE A FV+HVDKDN+G+ITF EWRDFLL YPHE TIE+IYRY ER+ LVDIG
Sbjct  121   NAGIQIDGDEFASFVDHVDKDNNGIITFPEWRDFLLFYPHEVTIESIYRYWERLYLVDIG  180

Query  1570  EQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIW  1391
             EQA IPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKV+LQVQT +A I PAVK+IW
Sbjct  181   EQAAIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVILQVQTAKAHIGPAVKNIW  240

Query  1390  KEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAG  1211
             +EGG+SGFFRGNGINVLKVAPESAIKFY YEMLK+ +G    + GD+GTSGRL+AGGLAG
Sbjct  241   REGGVSGFFRGNGINVLKVAPESAIKFYAYEMLKDVMGD---ENGDVGTSGRLVAGGLAG  297

Query  1210  AVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPY  1031
             AVAQ +IYPMDLVKTRLQT++ E G +P LG+LSKDI ++EGPRAFYRG+VPSLLGIIPY
Sbjct  298   AVAQASIYPMDLVKTRLQTFSAETGSIPSLGKLSKDILVQEGPRAFYRGLVPSLLGIIPY  357

Query  1030  AGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPT  851
             AGIDLA Y+ LK+ ++ YI+QD EPGPLVQL  GTISGALGATCVYPLQ+VRTRMQA+ +
Sbjct  358   AGIDLAAYETLKDMSKKYIVQDGEPGPLVQLTCGTISGALGATCVYPLQLVRTRMQAERS  417

Query  850   HTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
              +      M DVF+RT+R EGLRGFYKGLFPNLLKVVPAASITYLVYE+MKK+L
Sbjct  418   ESR-----MLDVFVRTYRREGLRGFYKGLFPNLLKVVPAASITYLVYETMKKSL  466



>emb|CDY05832.1| BnaA10g05880D [Brassica napus]
Length=500

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/500 (73%), Positives = 418/500 (84%), Gaps = 10/500 (2%)
 Frame = -1

Query  2167  VGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAG  1988
             V HV  P    K +   CNP  KPGPVSMDHVL AL+ET+EERD+RIRSLF+FFDS+NAG
Sbjct  7     VEHVGLPTQM-KSKQGSCNPFKKPGPVSMDHVLLALRETREERDVRIRSLFNFFDSENAG  65

Query  1987  YLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQA  1808
             YLD AQIE+GL A+QI + YK+AKEL RV DAN+DGRVDY EFR+YMDDKELELYRIFQA
Sbjct  66    YLDCAQIEKGLVALQIPSGYKYAKELFRVCDANRDGRVDYHEFRRYMDDKELELYRIFQA  125

Query  1807  IDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHE  1628
             IDVEH+G I PE LWD+LVKAGIEI+D+ELARFVEHVDKDNDG+I FEEWRDFLLLYPHE
Sbjct  126   IDVEHNGCISPEGLWDSLVKAGIEINDEELARFVEHVDKDNDGIILFEEWRDFLLLYPHE  185

Query  1627  ATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKV  1448
             ATIENIY + ERVCLVDIGEQAVIPEG+SKHV  S Y IAGG+AGAASRTATAPLDRLKV
Sbjct  186   ATIENIYHHWERVCLVDIGEQAVIPEGMSKHVKRSNYFIAGGIAGAASRTATAPLDRLKV  245

Query  1447  VLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAK  1268
             +LQ+Q T A I  AVK+IW +GG+ GFFRGNG+N++KVAPESAIKFY YE+ KNAIG   
Sbjct  246   LLQIQKTDAKIRDAVKAIWNQGGVRGFFRGNGLNIVKVAPESAIKFYAYELFKNAIGENM  305

Query  1267  G-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCE-GGKVPHLGRLSKDIWL  1094
             G D+ DIGT+ RL AGG+AGAVAQ +IYP+DLVKTRLQT T + G   P +G L+KDI +
Sbjct  306   GEDKADIGTTARLFAGGMAGAVAQASIYPLDLVKTRLQTCTSQAGAACPRIGTLTKDILV  365

Query  1093  REGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQ-DSEPGPLVQLGSGTISG  917
              EGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ +RTYILQ D+EPGPL+QLG GTISG
Sbjct  366   HEGPRAFYKGLFPSLLGIIPYAGIDLAAYEKLKDLSRTYILQEDAEPGPLIQLGCGTISG  425

Query  916   ALGATCVYPLQVVRT-RMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVV  740
             ALGATCVYPLQVVRT RMQA+ T TS     M  VF RT   EG +  YKGL PNLLKVV
Sbjct  426   ALGATCVYPLQVVRTSRMQAERTRTS-----MSGVFRRTVSEEGYKALYKGLLPNLLKVV  480

Query  739   PAASITYLVYESMKKTLDLD  680
             PAASITY+VYE+MKK+L+LD
Sbjct  481   PAASITYMVYEAMKKSLELD  500



>gb|KFK36750.1| mitochondrial substrate carrier family protein [Arabis alpina]
Length=496

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/487 (75%), Positives = 411/487 (84%), Gaps = 9/487 (2%)
 Frame = -1

Query  2134  KDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGL  1955
             K +  CCNPV K GPVSMDHVL AL+ETKEERD+RIRSLF+FFDS N GYLD  QIE+GL
Sbjct  17    KSKQGCCNPVKKSGPVSMDHVLLALRETKEERDLRIRSLFNFFDSQNIGYLDCPQIEKGL  76

Query  1954  SAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILP  1775
              A+QI + YK+AKEL RV DAN+DGRVDY EFR+YMDDKELELYRIFQAIDVEH+G I P
Sbjct  77    IALQIPSGYKYAKELFRVCDANRDGRVDYHEFRRYMDDKELELYRIFQAIDVEHNGCISP  136

Query  1774  EELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLE  1595
             E LWD+LVKAGIEI+D+ELARFVEHVDKDNDG+I FEEWRDFLLLYPHEATIENIY + E
Sbjct  137   EGLWDSLVKAGIEINDEELARFVEHVDKDNDGIIMFEEWRDFLLLYPHEATIENIYHHWE  196

Query  1594  RVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASI  1415
             RVCLVDIGEQAVIPEGISKHV  S Y IAGG+AGAASRTATAPLDRLKV+LQ+Q T A I
Sbjct  197   RVCLVDIGEQAVIPEGISKHVKRSNYFIAGGIAGAASRTATAPLDRLKVLLQIQKTDARI  256

Query  1414  MPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSG  1238
               AVK+IWK+GG+  FFRGNG+N++KVAPESAIKFY YE+ KNAIG   G D+ DIGT+ 
Sbjct  257   REAVKTIWKQGGVRAFFRGNGLNIVKVAPESAIKFYAYELFKNAIGENMGEDKADIGTTA  316

Query  1237  RLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG-KVPHLGRLSKDIWLREGPRAFYRGI  1061
             RL AGG+AGAVAQ +IYP+DLVKTRLQT T + G  VP LG L+KDI + EGPRAFY+G+
Sbjct  317   RLFAGGMAGAVAQASIYPLDLVKTRLQTCTSQAGVVVPRLGTLTKDILVHEGPRAFYKGL  376

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQV  881
              PSLLGIIPYAGIDLA Y+ LK+ +RTYILQD+  GPLVQLG GTISGALGATCVYPLQV
Sbjct  377   FPSLLGIIPYAGIDLAAYEKLKDLSRTYILQDA--GPLVQLGCGTISGALGATCVYPLQV  434

Query  880   VRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESM  701
             VRTRMQA+ T TS     M  VF RT   EG +  YKGL PNLLKVVPAASITY+VYE+M
Sbjct  435   VRTRMQAERTRTS-----MSGVFRRTISEEGYKALYKGLLPNLLKVVPAASITYMVYEAM  489

Query  700   KKTLDLD  680
             KK+L+LD
Sbjct  490   KKSLELD  496



>ref|XP_006656221.1| PREDICTED: LOW QUALITY PROTEIN: calcium-binding mitochondrial 
carrier protein SCaMC-1-like [Oryza brachyantha]
Length=478

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/478 (74%), Positives = 416/478 (87%), Gaps = 10/478 (2%)
 Frame = -1

Query  2083  MDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLR  1904
             M+HVL AL ET+ ER+ RIR +F+FFD D  G LDYA+IE GL+A+QI A+ K+A+ELLR
Sbjct  1     MEHVLLALHETEAEREARIRDMFAFFDVDGRGQLDYARIEAGLAALQIPAECKYARELLR  60

Query  1903  VVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDD  1724
               D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELWDALVKAGIEIDD+
Sbjct  61    ACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDALVKAGIEIDDE  120

Query  1723  ELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGI  1544
             ELARFVEHVDKDN+G+ITFEEWRDFLLLYP+EATIENIY + ERVCLVDIGEQAVIPEGI
Sbjct  121   ELARFVEHVDKDNNGIITFEEWRDFLLLYPNEATIENIYHHWERVCLVDIGEQAVIPEGI  180

Query  1543  SKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFF  1364
             SKHV+ASKYLIAGG+AGAASRTATAPLDRLKV++QVQTTR +++ ++K IW +GG+  FF
Sbjct  181   SKHVNASKYLIAGGIAGAASRTATAPLDRLKVIMQVQTTRTTVLHSIKDIWSQGGMVAFF  240

Query  1363  RGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAG--------  1211
             RGNG+NV+KVAPESAI+FY YEMLK  I  +KG ++ ++G S RL+AGGLAG        
Sbjct  241   RGNGLNVVKVAPESAIRFYAYEMLKEYIMKSKGENKSEVGPSERLVAGGLAGSSTNSNLS  300

Query  1210  -AVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
              AVAQTAIYP+DLVKTRLQTY+C  GKVP LG LS+DIW+ EGPRAFYRG+VPSLLGI+P
Sbjct  301   CAVAQTAIYPVDLVKTRLQTYSCVDGKVPSLGALSRDIWMHEGPRAFYRGLVPSLLGIVP  360

Query  1033  YAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQP  854
             YAGIDLAVY+ LK+ ++TYIL+DSEPGPLVQLG GT+SGALGATCVYPLQV+RTR+QAQ 
Sbjct  361   YAGIDLAVYETLKDVSKTYILKDSEPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQAQR  420

Query  853   THTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
              ++ +AY+GM DVF RT +HEG+ GFYKG+ PNLLKVVPAASITYLVYE+MKK L LD
Sbjct  421   ANSESAYRGMSDVFWRTLQHEGVSGFYKGILPNLLKVVPAASITYLVYEAMKKNLSLD  478



>emb|CDX71683.1| BnaC09g27240D [Brassica napus]
Length=500

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/500 (73%), Positives = 417/500 (83%), Gaps = 10/500 (2%)
 Frame = -1

Query  2167  VGHVNFPAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAG  1988
             V HV  P    K +   CNP  KPGPVSMDHVL AL+ET+EERD+RIRSLF+FFDS+N G
Sbjct  7     VEHVGLPTQM-KSKQGSCNPFKKPGPVSMDHVLLALRETREERDLRIRSLFNFFDSENVG  65

Query  1987  YLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQA  1808
             YLD AQIE+GL A+QI + YK+AKEL RV DAN+DGRVDY EFR+YMDDKELELYRIFQA
Sbjct  66    YLDCAQIEKGLIALQIPSGYKYAKELFRVCDANRDGRVDYHEFRRYMDDKELELYRIFQA  125

Query  1807  IDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHE  1628
             IDVEH+G I PE LWD+LVKAGIEI+D+ELARFVEHVDKDNDG+I FEEWRDFLLLYPHE
Sbjct  126   IDVEHNGCISPEGLWDSLVKAGIEINDEELARFVEHVDKDNDGIILFEEWRDFLLLYPHE  185

Query  1627  ATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKV  1448
             ATIENIY + ERVCLVDIGEQAVIPEG+SKHV  S Y IAGG+AGAASRTATAPLDRLKV
Sbjct  186   ATIENIYHHWERVCLVDIGEQAVIPEGMSKHVKRSNYFIAGGIAGAASRTATAPLDRLKV  245

Query  1447  VLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAK  1268
             +LQ+Q T A I  AVK+IW +GG+ GFFRGNG+N++KVAPESAIKFY YE+ KNAIG   
Sbjct  246   LLQIQKTDAKIRDAVKTIWNQGGVRGFFRGNGLNIVKVAPESAIKFYAYELFKNAIGENM  305

Query  1267  G-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCE-GGKVPHLGRLSKDIWL  1094
             G D+ DIGT+ RL AGG+AGAVAQ +IYP+DLVKTRLQT T + G   P +G L+KDI +
Sbjct  306   GEDKADIGTTARLFAGGMAGAVAQASIYPLDLVKTRLQTCTSQAGAACPRIGTLTKDILV  365

Query  1093  REGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQ-DSEPGPLVQLGSGTISG  917
              EGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ +RTYILQ D+EPGPL+QLG GTISG
Sbjct  366   HEGPRAFYKGLFPSLLGIIPYAGIDLAAYEKLKDLSRTYILQEDAEPGPLIQLGCGTISG  425

Query  916   ALGATCVYPLQVVRT-RMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVV  740
             ALGATCVYPLQVVRT RMQA+ T TS     M  VF +T   EG +  YKGL PNLLKVV
Sbjct  426   ALGATCVYPLQVVRTSRMQAERTRTS-----MSGVFRKTVSEEGYKALYKGLLPNLLKVV  480

Query  739   PAASITYLVYESMKKTLDLD  680
             PAASITY+VYE+MKK+L+LD
Sbjct  481   PAASITYMVYEAMKKSLELD  500



>gb|EAZ37576.1| hypothetical protein OsJ_21908 [Oryza sativa Japonica Group]
Length=469

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/469 (75%), Positives = 413/469 (88%), Gaps = 1/469 (0%)
 Frame = -1

Query  2083  MDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLR  1904
             M+HVL AL ET+ ER+ RIR +F+FFD D  G LDYAQIE GL+A+QI A+ K+A+ELLR
Sbjct  1     MEHVLLALHETEAEREARIREMFAFFDVDGRGQLDYAQIEAGLAALQIPAECKYARELLR  60

Query  1903  VVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDD  1724
               D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELWDALVKAGIEIDD+
Sbjct  61    ACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDALVKAGIEIDDE  120

Query  1723  ELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGI  1544
             ELARFVEHVDKDN+G+ITFEEWRDFLLLYP+E TIENIY + ERVCLVDIGEQAVIPEGI
Sbjct  121   ELARFVEHVDKDNNGIITFEEWRDFLLLYPNEVTIENIYHHWERVCLVDIGEQAVIPEGI  180

Query  1543  SKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFF  1364
             SK V+ASKYLIAGG+AGAASRTATAPLDRLKV++QVQTTR ++M ++K IW +GG+  FF
Sbjct  181   SKSVNASKYLIAGGIAGAASRTATAPLDRLKVIMQVQTTRTTVMHSIKDIWSQGGMLAFF  240

Query  1363  RGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIY  1187
             RGNG+NV+KVAPESAI+FY YEMLK  I  +KG ++ ++G S RL+AGGLAGAVAQTAIY
Sbjct  241   RGNGLNVVKVAPESAIRFYAYEMLKEYIMKSKGENKSEVGPSERLVAGGLAGAVAQTAIY  300

Query  1186  PMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVY  1007
             P+DLVKTRLQTY+C  GKVP LG LS+DI + EGPRAFYRG+VPSLLGI+PYAGIDLAVY
Sbjct  301   PVDLVKTRLQTYSCVDGKVPSLGALSRDILMHEGPRAFYRGLVPSLLGIVPYAGIDLAVY  360

Query  1006  DALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKG  827
             + LK+ ++TYIL+DS+PGPLVQLG GT+SGALGATCVYPLQV+RTR+QAQ  ++ +AY+G
Sbjct  361   ETLKDVSKTYILKDSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQAQRANSESAYRG  420

Query  826   MFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             M DVF RT +HEG+ GFYKG+ PNLLKVVPAASITYLVYE+MKK L LD
Sbjct  421   MSDVFWRTLQHEGVSGFYKGILPNLLKVVPAASITYLVYEAMKKNLSLD  469



>ref|XP_010546110.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X1 [Tarenaya hassleriana]
Length=481

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/485 (74%), Positives = 414/485 (85%), Gaps = 9/485 (2%)
 Frame = -1

Query  2134  KDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGL  1955
             + ++E CNPV KPGPV+M+HVL AL+ETKEER+IRIRSLF FFD  N G+LDY QIE+GL
Sbjct  5     RSKTEGCNPVKKPGPVTMEHVLLALRETKEEREIRIRSLFDFFDGSNLGFLDYTQIEKGL  64

Query  1954  SAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILP  1775
             S++QI  +YK+A +LLRV DAN+DGRVDY EFR+YMD KELELYRIFQAIDVEHSG ILP
Sbjct  65    SSLQIPPEYKYASDLLRVCDANRDGRVDYQEFRRYMDAKELELYRIFQAIDVEHSGCILP  124

Query  1774  EELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLE  1595
             EELWDALVKAGIEIDD+ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + E
Sbjct  125   EELWDALVKAGIEIDDEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWE  184

Query  1594  RVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASI  1415
             R+CL+DIGE AVIP+GISKHV  SK LIAGG+AGA SRTATAPLDRLKVVLQVQ T AS+
Sbjct  185   RLCLIDIGEHAVIPDGISKHVKRSKLLIAGGLAGAISRTATAPLDRLKVVLQVQRTHASV  244

Query  1414  MPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGR  1235
                +  IW+E  + GFFRGNG+NV+KVAPESAIKF  YEMLK  +G   G++GDIG SGR
Sbjct  245   ATVITKIWREDRLLGFFRGNGLNVMKVAPESAIKFCAYEMLKPIVG---GEDGDIGPSGR  301

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTC-EGGKVPHLGRLSKDIWLREGPRAFYRGIV  1058
             L+AGG+AGA+AQTAIYPMDLVKTRLQT    EGGK P LG+L+K+IW+REGPRAFY+G+ 
Sbjct  302   LLAGGMAGALAQTAIYPMDLVKTRLQTCVSEEGGKGPKLGKLTKEIWVREGPRAFYKGLF  361

Query  1057  PSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVV  878
             PSLLGIIPYAGIDLA Y+  K+ +RTYIL+D+EPG LVQL  G +SGALGATCVYPLQVV
Sbjct  362   PSLLGIIPYAGIDLAAYETFKDLSRTYILRDTEPGALVQLSCGMMSGALGATCVYPLQVV  421

Query  877   RTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMK  698
             RTRMQA   +T      M + F++T R EGLRGFY+GL PNLLKVVPAASITY+VYE+MK
Sbjct  422   RTRMQADSANTK-----MREEFMKTLRGEGLRGFYRGLLPNLLKVVPAASITYIVYEAMK  476

Query  697   KTLDL  683
             K +DL
Sbjct  477   KHMDL  481



>ref|XP_006647043.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like 
[Oryza brachyantha]
Length=469

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/469 (74%), Positives = 409/469 (87%), Gaps = 1/469 (0%)
 Frame = -1

Query  2083  MDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLR  1904
             M+HVL AL ET+ ER+ RIR +F+FFD D  G LDYA+IE GL+A+QI A+ K+A+ELLR
Sbjct  1     MEHVLLALHETEAEREARIRDMFAFFDVDGRGQLDYARIEAGLAALQIPAECKYARELLR  60

Query  1903  VVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDD  1724
               D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELW AL+KAGIEIDD+
Sbjct  61    ACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWHALLKAGIEIDDE  120

Query  1723  ELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGI  1544
             ELARFVEHVDKDNDG+ITFEEWRDFLLLYPHEATIENIY++ ERVCLVDIGEQA IPE I
Sbjct  121   ELARFVEHVDKDNDGIITFEEWRDFLLLYPHEATIENIYQHWERVCLVDIGEQAAIPERI  180

Query  1543  SKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFF  1364
             SKH  ASKYLIAGGV+GAASRT TAPLDRLKVV+QVQT R +++ AVK IW+EG + GFF
Sbjct  181   SKHASASKYLIAGGVSGAASRTVTAPLDRLKVVMQVQTNRTTVLQAVKDIWREGSLRGFF  240

Query  1363  RGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIY  1187
             RGNG+NV+KVAPESAI+FY YE LK  I  +KG ++ DIGTSGRL+AGGLAGAVAQTAIY
Sbjct  241   RGNGLNVVKVAPESAIRFYAYETLKEYIMKSKGENKSDIGTSGRLMAGGLAGAVAQTAIY  300

Query  1186  PMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVY  1007
             P+DLVKTRLQT+ C  GK+P LG LS+DIW++EGPRAFYRG+VPSLLG++PYAGIDL VY
Sbjct  301   PIDLVKTRLQTFACGSGKIPSLGALSRDIWMQEGPRAFYRGLVPSLLGMVPYAGIDLTVY  360

Query  1006  DALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKG  827
             + LK  ++TY+L+DS+PGPLVQLG GT+SGALGATCVYPLQV+RTR+QAQ  ++   Y+G
Sbjct  361   ETLKEMSKTYVLKDSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQAQRANSEAPYRG  420

Query  826   MFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             M DVF +T +HEG+ GFYKG+ PNLLKVVPAASITYLVYE+MKK+L LD
Sbjct  421   MSDVFWKTLQHEGISGFYKGIVPNLLKVVPAASITYLVYETMKKSLSLD  469



>gb|KHN31240.1| Calcium-binding mitochondrial carrier protein SCaMC-2-B [Glycine 
soja]
Length=456

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/468 (75%), Positives = 403/468 (86%), Gaps = 12/468 (3%)
 Frame = -1

Query  2083  MDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLR  1904
             MDHVL AL ETKEER++RIRSLF+FFD+ N GYLD            I  +YK+A+EL  
Sbjct  1     MDHVLVALGETKEEREVRIRSLFNFFDAANNGYLD------------IPPEYKYARELCE  48

Query  1903  VVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDD  1724
             V DAN DGRV+Y EFR+YMDDKELELYRIFQAIDVEH G ILPEEL++AL+KAGIE++D+
Sbjct  49    VCDANSDGRVEYHEFRRYMDDKELELYRIFQAIDVEHDGTILPEELYEALLKAGIEMNDE  108

Query  1723  ELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGI  1544
             ELA FVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVIPEGI
Sbjct  109   ELAHFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGI  168

Query  1543  SKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFF  1364
             SKHV+ SKY +AGG+AG  SRTATAPLDRLKVVLQVQ+ RASIMPAV  IWK+ G+ GFF
Sbjct  169   SKHVNRSKYFLAGGIAGGISRTATAPLDRLKVVLQVQSERASIMPAVTRIWKQDGLLGFF  228

Query  1363  RGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYP  1184
             RGNG+NV+KVAPESAIKFY +EMLK  IG A+G++ DIGT+GRL+AGG AGA+AQ AIYP
Sbjct  229   RGNGLNVVKVAPESAIKFYAFEMLKKVIGEAQGNKSDIGTAGRLVAGGTAGAIAQAAIYP  288

Query  1183  MDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYD  1004
             MDL+KTRLQT   EGGKVP LG L+ +IW +EGPRAFYRG+VPSLLG+IPYA IDL  YD
Sbjct  289   MDLIKTRLQTCPYEGGKVPKLGTLTMNIWFQEGPRAFYRGLVPSLLGMIPYAAIDLTAYD  348

Query  1003  ALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGM  824
              LK+ ++ YILQDSEPGPLVQLG GTISGA+GATCVYPLQV+RTR+QAQP++TS AYKGM
Sbjct  349   TLKDMSKRYILQDSEPGPLVQLGCGTISGAVGATCVYPLQVIRTRLQAQPSNTSDAYKGM  408

Query  823   FDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             FD F RTF+ EG  GFYKGLFPNLLKVVPAASITY+VYES+KK LDLD
Sbjct  409   FDAFRRTFQLEGFIGFYKGLFPNLLKVVPAASITYVVYESLKKNLDLD  456



>ref|XP_003519937.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Glycine max]
Length=483

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/475 (75%), Positives = 411/475 (87%), Gaps = 10/475 (2%)
 Frame = -1

Query  2089  VSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYK---FA  1919
              ++DH L A  E+ EER+ RIR+LF+FFD++N G+LD + IE GLSA+++ +D +   +A
Sbjct  14    TTLDHALLASGESAEERETRIRALFAFFDAENCGFLDCSAIESGLSALRMPSDSECCNYA  73

Query  1918  KELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGI  1739
             ++L    DANKDGRVDY EF++YMDDKELELYRIFQAIDVEHSG I PEEL  ALV+AGI
Sbjct  74    QDLFGACDANKDGRVDYEEFKRYMDDKELELYRIFQAIDVEHSGCISPEELSHALVRAGI  133

Query  1738  EIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAV  1559
             +IDD+ELARFVE VDKD++GVITF EWRDFLLLYPHEATIENIY YLERVCL+DIGEQ V
Sbjct  134   QIDDEELARFVERVDKDHNGVITFGEWRDFLLLYPHEATIENIYHYLERVCLIDIGEQTV  193

Query  1558  IPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGG  1379
             IP GISKH+HAS YLIAGGVAGAASRT TAPLDRLKVVLQVQTTRA +MPA+K IWKEGG
Sbjct  194   IPAGISKHIHASSYLIAGGVAGAASRTTTAPLDRLKVVLQVQTTRAHVMPAIKDIWKEGG  253

Query  1378  ISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGD--EGDIGTSGRLIAGGLAGAV  1205
               GFFRGNG+NVLKVAPESAI+FYTYEMLK  IG+AKG+  + D+GT GRL+AGG+AGAV
Sbjct  254   CLGFFRGNGLNVLKVAPESAIRFYTYEMLKAFIGNAKGEGAKADVGTMGRLLAGGMAGAV  313

Query  1204  AQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAG  1025
             AQTAIYP+DLVKTR+QTY CEGG++P LG LSKDIW++EGPRAFY+G++PS+LGI+PYAG
Sbjct  314   AQTAIYPLDLVKTRIQTYACEGGRLPSLGTLSKDIWVKEGPRAFYKGLIPSILGIVPYAG  373

Query  1024  IDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHT  845
             IDLA Y+ LK+ ++ YIL D EPGPLVQLG GT+SGALGATCVYPLQVVRTRMQAQ    
Sbjct  374   IDLAAYETLKDMSKKYILLDEEPGPLVQLGCGTVSGALGATCVYPLQVVRTRMQAQ----  429

Query  844   STAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
               AY GM DVF  TF+HEG RGFYKGLFPNLLKVVP+ASITYLVYE+MKK LDLD
Sbjct  430   -RAYMGMADVFRITFKHEGFRGFYKGLFPNLLKVVPSASITYLVYENMKKGLDLD  483



>ref|NP_001146297.1| hypothetical protein [Zea mays]
 gb|ACL53646.1| unknown [Zea mays]
 gb|AFW87193.1| hypothetical protein ZEAMMB73_723355 [Zea mays]
Length=469

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/469 (74%), Positives = 414/469 (88%), Gaps = 1/469 (0%)
 Frame = -1

Query  2083  MDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLR  1904
             M+HVL AL ET+ ER+ RIR +F+FFD+  +G LDYAQIE GL+A+Q+ A+ K+A+ELLR
Sbjct  1     MEHVLLALHETEAEREARIRDMFAFFDTAGSGQLDYAQIEAGLAALQVPAECKYARELLR  60

Query  1903  VVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDD  1724
               D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELWDAL+KAGIEI+D+
Sbjct  61    ACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDALIKAGIEINDE  120

Query  1723  ELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGI  1544
             ELARFVEHVDKDN+G+ITFEEWRDFLLLYP+EATIENIY + ERVCLVDIGEQA IPEGI
Sbjct  121   ELARFVEHVDKDNNGIITFEEWRDFLLLYPNEATIENIYHHWERVCLVDIGEQAAIPEGI  180

Query  1543  SKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFF  1364
             SKHV+ASKYLIAGG+AGAASRTATAPLDRLKV++QVQTTR S+M A+K IW +GG+ GFF
Sbjct  181   SKHVNASKYLIAGGIAGAASRTATAPLDRLKVIMQVQTTRTSVMHAIKDIWTKGGMLGFF  240

Query  1363  RGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIY  1187
             RGNG+NV+KVAPESAI+FY YEMLK  I   KG ++ ++G S RLIAGGLAGAVAQTAIY
Sbjct  241   RGNGLNVVKVAPESAIRFYAYEMLKEYIMKRKGENKSEVGASERLIAGGLAGAVAQTAIY  300

Query  1186  PMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVY  1007
             P++LVKTRLQTY+ E G VP +G+LS+DI + EGPRAFYRG+VPSLLGI+PYAGIDLAVY
Sbjct  301   PIELVKTRLQTYSGEVGYVPRIGQLSRDILVHEGPRAFYRGLVPSLLGIVPYAGIDLAVY  360

Query  1006  DALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKG  827
             + LK+ ++TYIL+DS+PGPLVQLG GT+SGALGATCVYPLQV+RTR+QAQ  ++ +AY+G
Sbjct  361   ETLKDVSKTYILKDSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQAQQANSESAYRG  420

Query  826   MFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             M DVF RT  HEG+ GFYKG+ PNLLKVVPAASITYLVYE+MKK L LD
Sbjct  421   MSDVFWRTLHHEGVSGFYKGILPNLLKVVPAASITYLVYEAMKKNLSLD  469



>dbj|BAJ86657.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91898.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=513

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/480 (74%), Positives = 417/480 (87%), Gaps = 1/480 (0%)
 Frame = -1

Query  2116  CNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ  1937
             C PV K GPV+M+HVL AL ET+ ER+ RIR +F FFD+   G LDYAQIE GL+A+Q+ 
Sbjct  34    CEPVRKAGPVTMEHVLLALHETEAEREARIRDMFGFFDTSGRGQLDYAQIEAGLAALQVP  93

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
             A+ K+A+ELLR  D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELWDA
Sbjct  94    AECKYARELLRACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDA  153

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             LVKAGIEIDD+ELARFVEHVDKDN+G+ITFEEWRDFL+LYP+EATIENIY + ERVCLVD
Sbjct  154   LVKAGIEIDDEELARFVEHVDKDNNGIITFEEWRDFLMLYPNEATIENIYHHWERVCLVD  213

Query  1576  IGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS  1397
             IGEQA IPEG+SKHV ASKYLIAGG+AGAASRTATAPLDRLKV++QVQTTR ++  AVK 
Sbjct  214   IGEQAAIPEGLSKHVSASKYLIAGGIAGAASRTATAPLDRLKVIMQVQTTRTTVTHAVKD  273

Query  1396  IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGG  1220
             I+  GG+ GFFRGNG+NV+KVAPESAI+FY YE LK  I ++KG ++  +G S RL+AGG
Sbjct  274   IFIRGGLLGFFRGNGLNVVKVAPESAIRFYAYETLKEYIMNSKGENKSAVGASERLVAGG  333

Query  1219  LAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGI  1040
             LAGA+AQTAIYP+DLVKTRLQT++CE GKVP LG LS+DI   EGPRAFYRG+VPSLLGI
Sbjct  334   LAGAIAQTAIYPIDLVKTRLQTFSCESGKVPSLGTLSRDILKHEGPRAFYRGLVPSLLGI  393

Query  1039  IPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQA  860
             +PYAGIDLAVY+ LK+ +RTYI++D+EPGPLVQLG GT+SGALGATCVYPLQV+RTR+QA
Sbjct  394   VPYAGIDLAVYETLKDASRTYIIKDTEPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQA  453

Query  859   QPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             Q  ++  AYKGM DVF RT RHEG+ GFYKG+ PNLLKVVPAASITYLVYE+MKK L LD
Sbjct  454   QQANSEAAYKGMSDVFWRTLRHEGVSGFYKGILPNLLKVVPAASITYLVYEAMKKNLSLD  513



>ref|XP_010546111.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B 
isoform X2 [Tarenaya hassleriana]
Length=479

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/485 (73%), Positives = 412/485 (85%), Gaps = 11/485 (2%)
 Frame = -1

Query  2134  KDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGL  1955
             + ++E CNPV KPGPV+M+HVL AL+ETKEER+IRIRSLF FFD  N G+LDY QIE+GL
Sbjct  5     RSKTEGCNPVKKPGPVTMEHVLLALRETKEEREIRIRSLFDFFDGSNLGFLDYTQIEKGL  64

Query  1954  SAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILP  1775
             S++QI  +YK+A +LLRV DAN+DGRVDY EFR+YMD KELELYRIFQAIDVEHSG ILP
Sbjct  65    SSLQIPPEYKYASDLLRVCDANRDGRVDYQEFRRYMDAKELELYRIFQAIDVEHSGCILP  124

Query  1774  EELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLE  1595
             EELWDALVKAGIEIDD+ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + E
Sbjct  125   EELWDALVKAGIEIDDEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWE  184

Query  1594  RVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASI  1415
             R+CL+DIGE AVIP+GISKHV  SK LIAGG+AGA SRTATAPLDRLKVVLQVQ T AS+
Sbjct  185   RLCLIDIGEHAVIPDGISKHVKRSKLLIAGGLAGAISRTATAPLDRLKVVLQVQRTHASV  244

Query  1414  MPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGR  1235
                +  IW+E  + GFFRGNG+NV+KVAPESAIKF  YEMLK  +G   G++GDIG SGR
Sbjct  245   ATVITKIWREDRLLGFFRGNGLNVMKVAPESAIKFCAYEMLKPIVG---GEDGDIGPSGR  301

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTC-EGGKVPHLGRLSKDIWLREGPRAFYRGIV  1058
             L+AGG+AGA+AQTAIYPMDLVKTRLQT    EGGK P LG+L+K+IW+REGPRAFY+G+ 
Sbjct  302   LLAGGMAGALAQTAIYPMDLVKTRLQTCVSEEGGKGPKLGKLTKEIWVREGPRAFYKGLF  361

Query  1057  PSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVV  878
             PSLLGIIPYAGIDLA Y+  K+ +RTYIL+D+  G LVQL  G +SGALGATCVYPLQVV
Sbjct  362   PSLLGIIPYAGIDLAAYETFKDLSRTYILRDT--GALVQLSCGMMSGALGATCVYPLQVV  419

Query  877   RTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMK  698
             RTRMQA   +T      M + F++T R EGLRGFY+GL PNLLKVVPAASITY+VYE+MK
Sbjct  420   RTRMQADSANTK-----MREEFMKTLRGEGLRGFYRGLLPNLLKVVPAASITYIVYEAMK  474

Query  697   KTLDL  683
             K +DL
Sbjct  475   KHMDL  479



>dbj|BAD15855.1| putative Mcsc-pending-prov protein [Oryza sativa Japonica Group]
Length=476

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/476 (72%), Positives = 407/476 (86%), Gaps = 8/476 (2%)
 Frame = -1

Query  2083  MDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYK-------  1925
             M+HVL AL ET+ ER+ RIR++F FFD+   G+LD+AQIE GL+A+ +            
Sbjct  1     MEHVLLALHETEAEREARIRAMFGFFDAAGRGHLDHAQIEAGLAALHLPPPPPPEEGGGG  60

Query  1924  FAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKA  1745
             +A+ELLR  D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELW ALVKA
Sbjct  61    YARELLRACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWHALVKA  120

Query  1744  GIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQ  1565
             GIEIDD+ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQ
Sbjct  121   GIEIDDEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQ  180

Query  1564  AVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKE  1385
             A IPE ISKH  ASKYLIAGGV+GA SRTATAPLDRLKV++QVQT R +++ AVK IW+E
Sbjct  181   AAIPERISKHASASKYLIAGGVSGATSRTATAPLDRLKVIMQVQTNRITVLQAVKDIWRE  240

Query  1384  GGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGA  1208
             G + GFFRGNG+NV+KVAPESAI+FY YEMLK  I  +KG ++ DIGTSGRL+AGGLAGA
Sbjct  241   GSLRGFFRGNGLNVVKVAPESAIRFYAYEMLKEYIMKSKGENKSDIGTSGRLMAGGLAGA  300

Query  1207  VAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYA  1028
             VAQTAIYP+DLVKTRLQT+ C  GK+P LG LS+DIW++EGPRAFYRG+VPSLLG++PYA
Sbjct  301   VAQTAIYPIDLVKTRLQTFACGSGKIPSLGALSRDIWMQEGPRAFYRGLVPSLLGMVPYA  360

Query  1027  GIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTH  848
             GIDL VY+ LK  ++TY+L+DS+PGPLVQLG GT+SGALGATCVYPLQV+RTR+QAQ  +
Sbjct  361   GIDLTVYETLKEMSKTYVLKDSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQAQRAN  420

Query  847   TSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             +  AY+GM DVF +T +HEG+ GFYKGL PNLLKVVPAASITYLVYE+MKK+L LD
Sbjct  421   SEAAYRGMSDVFWKTLQHEGISGFYKGLVPNLLKVVPAASITYLVYETMKKSLSLD  476



>ref|XP_007151708.1| hypothetical protein PHAVU_004G069200g [Phaseolus vulgaris]
 gb|ESW23702.1| hypothetical protein PHAVU_004G069200g [Phaseolus vulgaris]
Length=479

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/472 (75%), Positives = 407/472 (86%), Gaps = 7/472 (1%)
 Frame = -1

Query  2089  VSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKEL  1910
             V+MDHVL A  E+  +R+ RIR LF FFD    GYLD+A IERGL+A+ + ++  +A++L
Sbjct  13    VTMDHVLLASGESAPQREARIRELFGFFDEQGRGYLDHALIERGLAALGMPSESDYARDL  72

Query  1909  LRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEID  1730
             L   DA+KDGRV+Y EF++YM++KE+ELYRIFQAIDVEHSG I PEELW ALV+AGI+ID
Sbjct  73    LGAWDADKDGRVEYGEFKRYMEEKEVELYRIFQAIDVEHSGCISPEELWHALVRAGIQID  132

Query  1729  DDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPE  1550
             D ELARFVE VDKD++GVITF EWRDFLLLYPHEATIENIY YLERVCLVDIGEQ VIP 
Sbjct  133   DVELARFVERVDKDHNGVITFGEWRDFLLLYPHEATIENIYHYLERVCLVDIGEQTVIPA  192

Query  1549  GISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISG  1370
             GISKH+HAS YLIAGGVAGAASRT TAPLDRLKVVLQVQTTRA IMPAVK IWKEGG  G
Sbjct  193   GISKHIHASSYLIAGGVAGAASRTITAPLDRLKVVLQVQTTRAHIMPAVKDIWKEGGFLG  252

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGD--EGDIGTSGRLIAGGLAGAVAQT  1196
             FFRGNG+NVLKVAPESAI+FYTYEMLK  I +AKG+  + D+GT GRL+AGG AGAVAQT
Sbjct  253   FFRGNGLNVLKVAPESAIRFYTYEMLKTFIVNAKGEGTKADVGTLGRLLAGGTAGAVAQT  312

Query  1195  AIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDL  1016
              IYP+DLVKTR+QT+ CEGGK+P LG LSKDIW++EGPRAFY+G++PS+LGIIPYAGIDL
Sbjct  313   VIYPLDLVKTRIQTHACEGGKLPSLGTLSKDIWVKEGPRAFYKGLIPSILGIIPYAGIDL  372

Query  1015  AVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTA  836
             A Y++LK+ ++ YIL D +PGPL QLG GT+SGALGATCVYPLQVVRTRMQAQ      A
Sbjct  373   AAYESLKDMSKKYILLDEDPGPLTQLGCGTVSGALGATCVYPLQVVRTRMQAQ-----HA  427

Query  835   YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             Y GM DVF RTFR+EGLRGFYKGLFPNLLKVVP+ASITYLVYE+MKK LDL+
Sbjct  428   YMGMSDVFRRTFRYEGLRGFYKGLFPNLLKVVPSASITYLVYENMKKGLDLE  479



>gb|EAZ22133.1| hypothetical protein OsJ_05795 [Oryza sativa Japonica Group]
Length=516

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/482 (72%), Positives = 410/482 (85%), Gaps = 9/482 (2%)
 Frame = -1

Query  2101  KPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYK-  1925
             KP   +M+HVL AL ET+ ER+ RIR++F FFD+   G+LD+AQIE GL+A+ +      
Sbjct  36    KPA-ATMEHVLLALHETEAEREARIRAMFGFFDAAGRGHLDHAQIEAGLAALHLPPPPPP  94

Query  1924  ------FAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELW  1763
                   +A+ELLR  D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELW
Sbjct  95    EEGGGGYARELLRACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELW  154

Query  1762  DALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCL  1583
              ALVKAGIEIDD+ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCL
Sbjct  155   HALVKAGIEIDDEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCL  214

Query  1582  VDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAV  1403
             VDIGEQA IPE ISKH  ASKYLIAGGV+GA SRTATAPLDRLKV++QVQT R +++ AV
Sbjct  215   VDIGEQAAIPERISKHASASKYLIAGGVSGATSRTATAPLDRLKVIMQVQTNRITVLQAV  274

Query  1402  KSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIA  1226
             K IW+EG + GFFRGNG+NV+KVAPESAI+FY YEMLK  I  +KG ++ DIGTSGRL+A
Sbjct  275   KDIWREGSLRGFFRGNGLNVVKVAPESAIRFYAYEMLKEYIMKSKGENKSDIGTSGRLMA  334

Query  1225  GGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLL  1046
             GGLAGAVAQTAIYP+DLVKTRLQT+ C  GK+P LG LS+DIW++EGPRAFYRG+VPSLL
Sbjct  335   GGLAGAVAQTAIYPIDLVKTRLQTFACGSGKIPSLGALSRDIWMQEGPRAFYRGLVPSLL  394

Query  1045  GIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRM  866
             G++PYAGIDL VY+ LK  ++TY+L+DS+PGPLVQLG GT+SGALGATCVYPLQV+RTR+
Sbjct  395   GMVPYAGIDLTVYETLKEMSKTYVLKDSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRL  454

Query  865   QAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLD  686
             QAQ  ++  AY+GM DVF +T +HEG+ GFYKGL PNLLKVVPAASITYLVYE+MKK+L 
Sbjct  455   QAQRANSEAAYRGMSDVFWKTLQHEGISGFYKGLVPNLLKVVPAASITYLVYETMKKSLS  514

Query  685   LD  680
             LD
Sbjct  515   LD  516



>ref|XP_002871265.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47524.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=479

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/478 (73%), Positives = 411/478 (86%), Gaps = 8/478 (2%)
 Frame = -1

Query  2113  NPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQA  1934
             NP+ KP  V+M+HVL AL+ET++ER+IRIRSLF FFD+ N G+LDYAQIE+GL+++QI  
Sbjct  10    NPMKKPVSVTMEHVLLALRETRDEREIRIRSLFDFFDNSNLGFLDYAQIEKGLASLQIPP  69

Query  1933  DYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDAL  1754
             +YK+A++L RV DAN+DGRVDY EFR+Y+D KELELYRIFQAIDVEH+G ILPEELW+AL
Sbjct  70    EYKYARDLFRVCDANRDGRVDYQEFRRYIDAKELELYRIFQAIDVEHNGCILPEELWEAL  129

Query  1753  VKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDI  1574
             VKAGIEIDD+ELARFVEHVDKDN+G ITFEEWRDFLLLYPHEATIENIY + ERVCL+DI
Sbjct  130   VKAGIEIDDEELARFVEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHHWERVCLIDI  189

Query  1573  GEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSI  1394
             GEQAVIP+GISKHV  S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A ++P +K I
Sbjct  190   GEQAVIPDGISKHVKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRAHAGVLPTIKKI  249

Query  1393  WKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLA  1214
             W+E  + GFFRGNG+NV+KVAPESAIKF  YEMLK  IG   G++GDIGTSGRL+AGG+A
Sbjct  250   WREDKLMGFFRGNGLNVMKVAPESAIKFCAYEMLKPMIG---GEDGDIGTSGRLLAGGMA  306

Query  1213  GAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
             GA+AQTAIYPMDLVKTRLQT   EGGK P L +L+KDIW+REGPRAFY+G+ PSLLGIIP
Sbjct  307   GALAQTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGLFPSLLGIIP  366

Query  1033  YAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQP  854
             YAGIDLA Y+ LK+ +RTYILQD+EPGPL+QL  G  SGALGA+CVYPLQVVRTRMQA  
Sbjct  367   YAGIDLAAYETLKDLSRTYILQDTEPGPLIQLSCGMTSGALGASCVYPLQVVRTRMQADS  426

Query  853   THTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             + T+     M   F++T + EGLRGFY+GL PNLLKVVPAASITY+VYE+MKK + LD
Sbjct  427   SDTT-----MKQEFMKTMKGEGLRGFYRGLLPNLLKVVPAASITYIVYEAMKKNMALD  479



>ref|XP_002453502.1| hypothetical protein SORBIDRAFT_04g006930 [Sorghum bicolor]
 gb|EES06478.1| hypothetical protein SORBIDRAFT_04g006930 [Sorghum bicolor]
Length=528

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/477 (73%), Positives = 407/477 (85%), Gaps = 10/477 (2%)
 Frame = -1

Query  2086  SMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQI-------QADY  1928
             +M+HVL AL+ET+ ER+ RIR +F FFD+   G+LD+AQI  GL A+++           
Sbjct  54    TMEHVLLALRETEAEREARIRGVFGFFDAAGRGHLDHAQIVAGLVALRVPEGTAGGAGAE  113

Query  1927  KFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVK  1748
              +A+ LLR  D ++ GRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELW ALVK
Sbjct  114   DYARALLRACDRDRVGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWHALVK  173

Query  1747  AGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGE  1568
             AGIEIDD+ELARFVEHVDKDNDG+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGE
Sbjct  174   AGIEIDDEELARFVEHVDKDNDGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGE  233

Query  1567  QAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWK  1388
             QA IPEGISKHV ASKYLIAGG+AGAASRTATAPLDRLKV +QVQT R +++ AVK IW+
Sbjct  234   QAAIPEGISKHVSASKYLIAGGIAGAASRTATAPLDRLKVNMQVQTNRTTVLDAVKGIWR  293

Query  1387  EGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAG  1211
             EGG+ GFFRGNG+NV+KVAPESAI+FYTYEMLK  I  +KG ++ DIGTSGRL+AGGLAG
Sbjct  294   EGGLLGFFRGNGLNVVKVAPESAIRFYTYEMLKEYIMKSKGENKSDIGTSGRLMAGGLAG  353

Query  1210  AVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPY  1031
             A+AQTAIYP+DLVKTRLQTY  EGGK+P LG LS+DIW+ EGPRAFYRG+VPSLLG++PY
Sbjct  354   AIAQTAIYPIDLVKTRLQTY--EGGKIPSLGALSRDIWIHEGPRAFYRGLVPSLLGMVPY  411

Query  1030  AGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPT  851
             AGIDL VY+ LK  ++TY+L+D++PGPLVQLG GT+SGALGATCVYPLQV+RTRMQAQP 
Sbjct  412   AGIDLTVYETLKEMSKTYVLKDNDPGPLVQLGCGTVSGALGATCVYPLQVIRTRMQAQPA  471

Query  850   HTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             ++   Y+GM D F RT + EG+ GFYKGL PNLLKVVPAASITYLVYE+MKK+L LD
Sbjct  472   NSEDPYRGMTDCFRRTLQREGVSGFYKGLVPNLLKVVPAASITYLVYETMKKSLSLD  528



>ref|XP_004951534.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
isoform X1 [Setaria italica]
 ref|XP_004951535.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
isoform X2 [Setaria italica]
Length=518

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/483 (73%), Positives = 408/483 (84%), Gaps = 18/483 (4%)
 Frame = -1

Query  2086  SMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQA---------  1934
             +M+HV  AL+ET+ ER+ RIR++F+ FD+   G+LD+AQI  GL+A+++ A         
Sbjct  40    TMEHVRLALRETEAEREARIRAVFASFDAAGRGHLDHAQIVAGLAALRVPAVPEGDAGSG  99

Query  1933  ----DYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEEL  1766
                 DY  A+ LLR  D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEEL
Sbjct  100   AGLEDY--ARALLRACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEEL  157

Query  1765  WDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVC  1586
             W ALVKAGIEI D+ELARFVEHVDKDNDG+ITFEEWRDFLLLYPHEATIENIY + ERVC
Sbjct  158   WHALVKAGIEIGDEELARFVEHVDKDNDGIITFEEWRDFLLLYPHEATIENIYHHWERVC  217

Query  1585  LVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPA  1406
             LVDIGEQA IPEGISKHV ASKYL AGG+AGAASRTATAPLDRLKV +QVQT R ++  A
Sbjct  218   LVDIGEQAAIPEGISKHVSASKYLTAGGIAGAASRTATAPLDRLKVNMQVQTNRTTVAHA  277

Query  1405  VKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLI  1229
             VK IW+EGG+ GFFRGNG+NV+KVAPESAI+FYTYEMLK  I  +KG ++ DIGTSGRLI
Sbjct  278   VKGIWREGGLLGFFRGNGLNVVKVAPESAIRFYTYEMLKEYIMKSKGENKSDIGTSGRLI  337

Query  1228  AGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSL  1049
             AGGLAGAVAQTAIYP+DLVKTRLQTY  EGG++P LG LS+DIW+REGPRAFYRG+VPSL
Sbjct  338   AGGLAGAVAQTAIYPIDLVKTRLQTY--EGGRIPSLGALSRDIWIREGPRAFYRGLVPSL  395

Query  1048  LGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTR  869
             LG++PYAGIDL VY+ LK  ++TY+L+DS+PGPLVQLG GT+SGALGATCVYPLQVVRTR
Sbjct  396   LGMVPYAGIDLTVYETLKEMSKTYVLKDSDPGPLVQLGCGTVSGALGATCVYPLQVVRTR  455

Query  868   MQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
             MQAQ  ++   Y+GM D F RT R EG+ GFYKGL PNLLKVVPAASITYLVYE+MKK+L
Sbjct  456   MQAQSANSEDPYRGMTDCFRRTLRREGISGFYKGLVPNLLKVVPAASITYLVYETMKKSL  515

Query  688   DLD  680
              LD
Sbjct  516   SLD  518



>ref|NP_196349.1| mitochondrial ATP-Mg/Pi transporter [Arabidopsis thaliana]
 emb|CAB87921.1| peroxisomal Ca-dependent solute carrier-like protein [Arabidopsis 
thaliana]
 dbj|BAD42991.1| peroxisomal Ca-dependent solute carrier-like protein [Arabidopsis 
thaliana]
 gb|AED91136.1| mitochondrial ATP-Mg/Pi transporter [Arabidopsis thaliana]
Length=479

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/478 (72%), Positives = 409/478 (86%), Gaps = 8/478 (2%)
 Frame = -1

Query  2113  NPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQA  1934
             NP+ KP  ++M+HVL AL+ET +ER+IRIRSLF FFD+ N G+LDYAQIE+GL+++QI  
Sbjct  10    NPMKKPVSITMEHVLLALRETMDEREIRIRSLFDFFDNSNLGFLDYAQIEKGLASLQIPP  69

Query  1933  DYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDAL  1754
             +YK+A++L RV DAN+DGRVDY EFR+Y+D KELELYRIFQAIDVEH+G ILPEELW+AL
Sbjct  70    EYKYARDLFRVCDANRDGRVDYQEFRRYIDAKELELYRIFQAIDVEHNGCILPEELWEAL  129

Query  1753  VKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDI  1574
             VKAGIEIDD+ELARFVEHVDKDN+G ITFEEWRDFLLLYPHEAT+ENIY + ERVCL+DI
Sbjct  130   VKAGIEIDDEELARFVEHVDKDNNGTITFEEWRDFLLLYPHEATLENIYHHWERVCLIDI  189

Query  1573  GEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSI  1394
             GEQAVIP+GISKHV  S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A ++P +K I
Sbjct  190   GEQAVIPDGISKHVKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRAHAGVLPTIKKI  249

Query  1393  WKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLA  1214
             W+E  + GFFRGNG+NV+KVAPESAIKF  YEMLK  IG   G++GDIGTSGRL+AGG+A
Sbjct  250   WREDKLMGFFRGNGLNVMKVAPESAIKFCAYEMLKPMIG---GEDGDIGTSGRLMAGGMA  306

Query  1213  GAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
             GA+AQTAIYPMDLVKTRLQT   EGGK P L +L+KDIW+REGPRAFY+G+ PSLLGI+P
Sbjct  307   GALAQTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGLFPSLLGIVP  366

Query  1033  YAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQP  854
             YAGIDLA Y+ LK+ +RTYILQD+EPGPL+QL  G  SGALGA+CVYPLQVVRTRMQA  
Sbjct  367   YAGIDLAAYETLKDLSRTYILQDTEPGPLIQLSCGMTSGALGASCVYPLQVVRTRMQADS  426

Query  853   THTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             + T+     M   F+ T + EGLRGFY+GL PNLLKVVPAASITY+VYE+MKK + LD
Sbjct  427   SKTT-----MKQEFMNTMKGEGLRGFYRGLLPNLLKVVPAASITYIVYEAMKKNMALD  479



>ref|NP_001151180.1| LOC100284813 [Zea mays]
 gb|ACG41896.1| calcium-binding mitochondrial carrier F55A11.4 [Zea mays]
 gb|ACN34246.1| unknown [Zea mays]
 gb|AFW66148.1| calcium-binding carrier F55A11.4 [Zea mays]
Length=529

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/490 (71%), Positives = 406/490 (83%), Gaps = 12/490 (2%)
 Frame = -1

Query  2119  CCNPVMKPGP-VSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQ  1943
             C  P    GP  +M+HVL AL+ET+ ER+ RIR +F FFD+   G+L++AQI  GL A++
Sbjct  42    CGGPARASGPEATMEHVLLALRETEAEREARIRGVFGFFDAAGQGHLEHAQITAGLIALR  101

Query  1942  IQADYK--------FAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSG  1787
             +  +          +A+ LLR  D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G
Sbjct  102   VPEETSGAGAEAEDYARALLRACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNG  161

Query  1786  GILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIY  1607
              ILPEELW ALVKAGIEIDD+ELARFVEHVDKDNDG+ITFEEWRDFLLLYPHEAT+ENIY
Sbjct  162   CILPEELWHALVKAGIEIDDEELARFVEHVDKDNDGIITFEEWRDFLLLYPHEATMENIY  221

Query  1606  RYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTT  1427
              + ERVCLVDIGEQA IPEGI+KHV ASKYLIAGG+AGAASRTATAPLDRLKV +QVQT 
Sbjct  222   HHWERVCLVDIGEQAAIPEGINKHVSASKYLIAGGIAGAASRTATAPLDRLKVNMQVQTN  281

Query  1426  RASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDI  1250
               +++  VK IW+EGG+ GFFRGNG+NV+KVAPESAI+FYTYEMLK  I  +KG ++GDI
Sbjct  282   CIAVVDVVKGIWREGGLLGFFRGNGLNVVKVAPESAIRFYTYEMLKEYIMKSKGENKGDI  341

Query  1249  GTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFY  1070
             GTSGRL+AGGLAGA+AQT IYPMDLVKTRLQTY  EGG++P LG LS+DIW  EGPRAFY
Sbjct  342   GTSGRLMAGGLAGAIAQTVIYPMDLVKTRLQTY--EGGRIPSLGALSRDIWTHEGPRAFY  399

Query  1069  RGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYP  890
             RG+VPSLLG++PYAGIDL VY+ LK  +RTY L D +PGPLVQLG GT+SGALGATCVYP
Sbjct  400   RGLVPSLLGMVPYAGIDLTVYETLKEMSRTYALVDKDPGPLVQLGCGTVSGALGATCVYP  459

Query  889   LQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVY  710
             LQV+RTRMQAQP ++   Y+GM D F  T R EG+ GFYKGL PNLLKVVPAASITYLVY
Sbjct  460   LQVIRTRMQAQPANSEDPYRGMTDCFRITLRREGVSGFYKGLVPNLLKVVPAASITYLVY  519

Query  709   ESMKKTLDLD  680
             E+MKK+L LD
Sbjct  520   ETMKKSLSLD  529



>ref|XP_010491336.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Camelina sativa]
 ref|XP_010491338.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Camelina sativa]
Length=481

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/487 (71%), Positives = 413/487 (85%), Gaps = 8/487 (2%)
 Frame = -1

Query  2140  TAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIER  1961
             TAK + +  + + KP  V+M+HVL AL+ET +ER+IR+RSLF FFD+ N G+LDYAQIE+
Sbjct  3     TAKSKLKNRSTMKKPVSVTMEHVLLALRETMDEREIRVRSLFDFFDNSNLGFLDYAQIEK  62

Query  1960  GLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGI  1781
             GL+++QI  +YK+A++L RV DAN+DGRVDY EFR+Y+D KELELYRIFQAIDVEH+G I
Sbjct  63    GLASLQIPPEYKYARDLFRVCDANRDGRVDYHEFRRYIDAKELELYRIFQAIDVEHNGCI  122

Query  1780  LPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRY  1601
             LPEELW+ALVKAGIEIDD+ELARFVEHVDKDN+G ITFEEWRDFLLLYPHEATIENIY++
Sbjct  123   LPEELWEALVKAGIEIDDEELARFVEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYQH  182

Query  1600  LERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA  1421
              ERVCL+DIGEQAVIP+GISKHV  S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A
Sbjct  183   WERVCLIDIGEQAVIPDGISKHVKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRAHA  242

Query  1420  SIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTS  1241
              ++P +K IW+E  + GFFRGNG+NV+KVAPESAIKF  YEMLK  IG   G++GDIGTS
Sbjct  243   GVLPTIKKIWREDKLRGFFRGNGLNVMKVAPESAIKFCAYEMLKPMIG---GEDGDIGTS  299

Query  1240  GRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGI  1061
             GRL+AGG+AGA+AQTAIYPMDLVKTRLQT   EGGK P L +L+KDIW REGPRAFY+G+
Sbjct  300   GRLLAGGMAGAIAQTAIYPMDLVKTRLQTCVSEGGKTPKLWKLTKDIWFREGPRAFYKGL  359

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQV  881
              PSLLGIIPYAGIDLA Y+ LK+ +RTYIL D+EPGPL+QL  G  SGALGA+CVYPLQV
Sbjct  360   FPSLLGIIPYAGIDLAAYETLKDLSRTYILHDTEPGPLIQLSCGMTSGALGASCVYPLQV  419

Query  880   VRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESM  701
             VRTRMQA  + T+     M   F++T R EGLRGFY+G+ PNLLKVVPAASITY+VYE+M
Sbjct  420   VRTRMQADSSETT-----MKQEFMKTMRGEGLRGFYRGILPNLLKVVPAASITYIVYEAM  474

Query  700   KKTLDLD  680
             KK + LD
Sbjct  475   KKNMALD  481



>ref|XP_010452689.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X1 [Camelina sativa]
 ref|XP_010452690.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X1 [Camelina sativa]
Length=481

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/487 (71%), Positives = 413/487 (85%), Gaps = 8/487 (2%)
 Frame = -1

Query  2140  TAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIER  1961
             TAK + +  + V KP  V+M+HVL AL+ET +ER+IR+RSLF FFD+ N G+LDYAQIE+
Sbjct  3     TAKSKLKNRSTVKKPVSVTMEHVLLALRETMDEREIRVRSLFDFFDNSNLGFLDYAQIEK  62

Query  1960  GLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGI  1781
             GL+++QI  +YK+A++L RV DAN+DGRVDY EFR+Y+D KELELYRIFQAIDVEH+G I
Sbjct  63    GLASLQIPPEYKYARDLFRVCDANRDGRVDYHEFRRYIDAKELELYRIFQAIDVEHNGCI  122

Query  1780  LPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRY  1601
             LPEELW+ALVKAGIEIDD+ELARF+EHVDKDN+G ITFEEWRDFLLLYPHEATIENIY +
Sbjct  123   LPEELWEALVKAGIEIDDEELARFMEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHH  182

Query  1600  LERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA  1421
              ERVCL+DIGEQAVIP+GISKHV  S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A
Sbjct  183   WERVCLIDIGEQAVIPDGISKHVKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRAHA  242

Query  1420  SIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTS  1241
              ++P +K IW+E  + GFFRGNG+NV+KVAPESAIKF  YEMLK  IG   G++GDIGTS
Sbjct  243   GVLPTIKKIWREDKLRGFFRGNGLNVMKVAPESAIKFCAYEMLKPMIG---GEDGDIGTS  299

Query  1240  GRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGI  1061
             GRL+AGG+AGA+AQTAIYPMDLVKTRLQT   EGGK P L +L+KDIW+REGPRAFY+G+
Sbjct  300   GRLLAGGMAGAIAQTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGL  359

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQV  881
              PSLLGIIPYAGIDLA Y+ LK+ +RTYIL D+EPGPL+QL  G  SGALGA+CVYPLQV
Sbjct  360   FPSLLGIIPYAGIDLAAYETLKDLSRTYILHDTEPGPLIQLSCGMTSGALGASCVYPLQV  419

Query  880   VRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESM  701
             VRTRMQA  + T+     M   F++T R EGLRGFY+G+ PNLLKVVPAASITY+VYE+M
Sbjct  420   VRTRMQADSSETT-----MKQEFMKTMRGEGLRGFYRGILPNLLKVVPAASITYIVYEAM  474

Query  700   KKTLDLD  680
             KK + LD
Sbjct  475   KKNMALD  481



>ref|XP_010423224.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Camelina sativa]
 ref|XP_010423225.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Camelina sativa]
 ref|XP_010423226.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Camelina sativa]
Length=481

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/487 (71%), Positives = 414/487 (85%), Gaps = 8/487 (2%)
 Frame = -1

Query  2140  TAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIER  1961
             TAK + +  + V KP  V+M+HVL AL+ET +ER+IR+RSLF FFD+ N G+LDYAQIE+
Sbjct  3     TAKSKLKNRSTVKKPVSVTMEHVLLALRETMDEREIRVRSLFDFFDNSNLGFLDYAQIEK  62

Query  1960  GLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGI  1781
             GL+++QI  +YK+A++L RV DAN+DGRVDY EFR+Y+D KELELYRIFQAIDVEH+G I
Sbjct  63    GLASLQIPPEYKYARDLFRVCDANRDGRVDYHEFRRYIDAKELELYRIFQAIDVEHNGCI  122

Query  1780  LPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRY  1601
             LPEELW+ALVKAGIEIDD+ELARF+EHVDKDN+G ITFEEWRDFLLLYPHEATIENIY++
Sbjct  123   LPEELWEALVKAGIEIDDEELARFMEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYQH  182

Query  1600  LERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA  1421
              ERVCL+DIGEQAVIP+GISKHV  S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A
Sbjct  183   WERVCLIDIGEQAVIPDGISKHVKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRAHA  242

Query  1420  SIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTS  1241
              ++P +K IW+E  + GFFRGNG+NV+KVAPESAIKF  YEMLK  IG   G++GDIGTS
Sbjct  243   GVLPTIKKIWREDNLRGFFRGNGLNVMKVAPESAIKFCAYEMLKPMIG---GEDGDIGTS  299

Query  1240  GRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGI  1061
             GRL+AGG+AGA+AQTAIYPMDLVKTRLQT   EGGK P L +L++DIW+REGPRAFY+G+
Sbjct  300   GRLLAGGMAGAIAQTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTQDIWVREGPRAFYKGL  359

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQV  881
              PSLLGIIPYAGIDLA Y+ LK+ +RTYIL D+EPGPL+QL  G  SGALGA+CVYPLQV
Sbjct  360   FPSLLGIIPYAGIDLAAYETLKDLSRTYILHDTEPGPLIQLSCGMTSGALGASCVYPLQV  419

Query  880   VRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESM  701
             VRTRMQA  + T+     M   F++T R EGLRGFY+G+ PNLLKVVPAASITY+VYE+M
Sbjct  420   VRTRMQADSSETT-----MKQEFMKTMRGEGLRGFYRGILPNLLKVVPAASITYIVYEAM  474

Query  700   KKTLDLD  680
             KK + LD
Sbjct  475   KKNMALD  481



>ref|XP_006399214.1| hypothetical protein EUTSA_v10013407mg [Eutrema salsugineum]
 gb|ESQ40667.1| hypothetical protein EUTSA_v10013407mg [Eutrema salsugineum]
Length=481

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/487 (71%), Positives = 411/487 (84%), Gaps = 8/487 (2%)
 Frame = -1

Query  2140  TAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIER  1961
             +AK + +  NP+ KP  V+M+HVL AL+ET +ER+IRIRSLF FFD+ N G+LDYAQIE+
Sbjct  3     SAKSKPKYRNPMKKPVSVTMEHVLLALRETNDEREIRIRSLFDFFDNSNLGFLDYAQIEK  62

Query  1960  GLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGI  1781
             GL+++QI  +YK+A++L RV DAN+DGRVDY EFR+Y+D KELELYRIFQAIDV H+G I
Sbjct  63    GLASLQIPPEYKYARDLFRVCDANRDGRVDYHEFRRYIDAKELELYRIFQAIDVAHNGCI  122

Query  1780  LPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRY  1601
             LPEELW+ALV AGIEIDD+ELARFVEHVDKDN+G ITFEEWRDFLLLYPHEATIENIY +
Sbjct  123   LPEELWEALVDAGIEIDDEELARFVEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHH  182

Query  1600  LERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA  1421
              ERVCL+DIGEQAVIP+GISKHV  S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A
Sbjct  183   WERVCLIDIGEQAVIPDGISKHVKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRAHA  242

Query  1420  SIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTS  1241
              ++P +K IW+E  + GFFRGNG+NV+KVAPESAIKF  YEMLK  IG   G+EGDIGTS
Sbjct  243   GVLPTIKKIWREDKVMGFFRGNGLNVMKVAPESAIKFCAYEMLKPIIG---GEEGDIGTS  299

Query  1240  GRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGI  1061
              RL+AGG+AGAVAQTAIYPMDLVKTRLQT   EGGK P L +L+KDIW++EGPRAFY+G+
Sbjct  300   ARLLAGGMAGAVAQTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVQEGPRAFYKGL  359

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQV  881
              PSLLGIIPYAGIDLA Y+ LK+ +RTYIL D+EPGPL+QL  G  SGALGA+CVYPLQV
Sbjct  360   FPSLLGIIPYAGIDLAAYETLKDLSRTYILHDTEPGPLIQLSCGMTSGALGASCVYPLQV  419

Query  880   VRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESM  701
             VRTRMQA  + T+     M   F++T + EGLRGFY+GL PNLLKVVPAASITY+VYE+M
Sbjct  420   VRTRMQADSSETT-----MKQEFMKTMKGEGLRGFYRGLLPNLLKVVPAASITYIVYEAM  474

Query  700   KKTLDLD  680
             KK + LD
Sbjct  475   KKNMALD  481



>emb|CDY14050.1| BnaC02g01670D [Brassica napus]
Length=468

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/474 (73%), Positives = 404/474 (85%), Gaps = 8/474 (2%)
 Frame = -1

Query  2101  KPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKF  1922
             KP  V+MDHVL AL+ET EER++RIRSLF FFD+ + G+LDYAQIE+GL+++QI  +YK+
Sbjct  3     KPASVTMDHVLLALRETSEEREVRIRSLFDFFDNSSLGFLDYAQIEKGLASLQIPPEYKY  62

Query  1921  AKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAG  1742
             A++L RV DAN+DGRVDY EFR+Y+D KELELYRIFQAIDV H+G ILPEELW+ALVKAG
Sbjct  63    ARDLFRVCDANRDGRVDYQEFRRYIDAKELELYRIFQAIDVAHNGCILPEELWEALVKAG  122

Query  1741  IEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQA  1562
             IEIDD+ELARFVEHVDKDN+G ITFEEWRDFLLLYPHEATIENIY + ERVCL+DIGEQA
Sbjct  123   IEIDDEELARFVEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHHWERVCLIDIGEQA  182

Query  1561  VIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEG  1382
             VIP+GISKHV  S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A ++P +K IW+E 
Sbjct  183   VIPDGISKHVKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRAHAGVLPTIKKIWRED  242

Query  1381  GISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVA  1202
              + GFFRGNG+NV+KVAPESAIKF  YEMLK  IG   G+ GDIGTS RL+AGG+AGAVA
Sbjct  243   KLRGFFRGNGLNVMKVAPESAIKFCAYEMLKPMIG---GEGGDIGTSARLLAGGMAGAVA  299

Query  1201  QTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGI  1022
             QTAIYPMDLVKTRLQT   EGGK P L +L+KDIW+REGPRAFY+G+ PSLLGIIPYAGI
Sbjct  300   QTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGLFPSLLGIIPYAGI  359

Query  1021  DLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTS  842
             DLA Y+ LK+ +RTYILQD+EPGPL+QL  G  SGALGA+CVYPLQVVRTRMQA  + T+
Sbjct  360   DLAAYETLKDLSRTYILQDTEPGPLIQLSCGMTSGALGASCVYPLQVVRTRMQADSSETT  419

Query  841   TAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
                  M   F++T R EGLRGFY+GL PNLLKVVPAASITY+VYE+MKK + LD
Sbjct  420   -----MRQEFMKTMRGEGLRGFYRGLLPNLLKVVPAASITYIVYEAMKKNMALD  468



>ref|XP_009125685.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Brassica rapa]
 emb|CDY55175.1| BnaAnng13670D [Brassica napus]
Length=468

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/474 (73%), Positives = 404/474 (85%), Gaps = 8/474 (2%)
 Frame = -1

Query  2101  KPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKF  1922
             KP  +SMDHVL AL+ET EER+IRIRSLF FFD+ + G+LDYAQIE+GL+++QI  +YK+
Sbjct  3     KPASISMDHVLLALRETSEEREIRIRSLFDFFDNSSLGFLDYAQIEKGLASLQIPPEYKY  62

Query  1921  AKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAG  1742
             A++L RV DAN+DGRVDY EFR+Y+D KELELYRIFQAIDV H+G ILPEELW+ALVKAG
Sbjct  63    ARDLFRVCDANRDGRVDYHEFRRYIDAKELELYRIFQAIDVAHNGCILPEELWEALVKAG  122

Query  1741  IEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQA  1562
             IEIDD+ELARFVEHVDKDN+G ITFEEWRDFLLLYPHEATIENIY + ERVCL+DIGEQA
Sbjct  123   IEIDDEELARFVEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHHWERVCLIDIGEQA  182

Query  1561  VIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEG  1382
             VIP+GISKHV  S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A ++P +K IW+E 
Sbjct  183   VIPDGISKHVKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRAHAGVLPTIKKIWRED  242

Query  1381  GISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVA  1202
              + GFFRGNG+NV+KVAPESAIKF  YEMLK  IG   G+ GDIGTS RL+AGG+AGAVA
Sbjct  243   KLRGFFRGNGLNVMKVAPESAIKFCAYEMLKPMIG---GEGGDIGTSARLLAGGMAGAVA  299

Query  1201  QTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGI  1022
             QTAIYPMDLVKTRLQT   EGGK P L +L+KDIW+REGPRAFY+G+ PSL+GIIPYAGI
Sbjct  300   QTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGLFPSLIGIIPYAGI  359

Query  1021  DLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTS  842
             DLA Y+ LK+ +RTYILQD+EPGPL+QL  G  SGALGA+CVYPLQVVRTRMQA  + T+
Sbjct  360   DLAAYETLKDLSRTYILQDTEPGPLIQLSCGMTSGALGASCVYPLQVVRTRMQADSSETT  419

Query  841   TAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
                  M   F++T R EGLRGFY+GL PNLLKVVPAASITY+VYE+MKK + LD
Sbjct  420   -----MRQEFMKTMRGEGLRGFYRGLLPNLLKVVPAASITYIVYEAMKKNMALD  468



>gb|KHG23948.1| Calcium-binding mitochondrial carrier SCaMC-1 [Gossypium arboreum]
Length=468

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/468 (74%), Positives = 404/468 (86%), Gaps = 1/468 (0%)
 Frame = -1

Query  2083  MDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLR  1904
             M+HVL AL ETKEERD+RIRSLFSFFD+ + G+LDY QIE+GLSA+QI A+YK+A +LL+
Sbjct  1     MEHVLLALGETKEERDLRIRSLFSFFDAADVGFLDYTQIEKGLSALQIPAEYKYANDLLK  60

Query  1903  VVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDD  1724
             V DAN+DG VDY EF++YMDDKE+ELYRIFQAIDVEHSG ILPEELWDALVKAGI+I+D+
Sbjct  61    VCDANRDGCVDYYEFKRYMDDKEIELYRIFQAIDVEHSGCILPEELWDALVKAGIQINDE  120

Query  1723  ELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGI  1544
             +LA+FVEHVDKDN+G+ITFEEWRDFLLLYPHEA +ENIY + ERVC VDIGE AVIP+GI
Sbjct  121   KLAQFVEHVDKDNNGIITFEEWRDFLLLYPHEANVENIYHHWERVCHVDIGEHAVIPQGI  180

Query  1543  SKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFF  1364
             +KHV   K LIAGG+AGA SRTATAP DRLKVVLQVQTTR SI+PAV  I KE G+ GFF
Sbjct  181   NKHVPRIKSLIAGGIAGAVSRTATAPFDRLKVVLQVQTTRTSILPAVTKILKEEGLLGFF  240

Query  1363  RGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGD-EGDIGTSGRLIAGGLAGAVAQTAIY  1187
             RGNG+N++KV PESAIKFYT+EMLK+ IG   GD +GDIG  G+L+ GG+AGAVAQ+ IY
Sbjct  241   RGNGLNIVKVTPESAIKFYTFEMLKDVIGEHMGDNKGDIGAGGKLVVGGVAGAVAQSTIY  300

Query  1186  PMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVY  1007
             PMDLVK RLQT   EGGK PHLG+L++DIW++EGPRAFY+G+VPS+ GIIPYA IDL VY
Sbjct  301   PMDLVKIRLQTCASEGGKAPHLGKLTRDIWVQEGPRAFYKGLVPSIFGIIPYASIDLTVY  360

Query  1006  DALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKG  827
             + L++F+RT+ILQDSEPGPLV L  G ISGALGATC+YPLQV+RTRMQAQ T + T Y G
Sbjct  361   ETLRDFSRTHILQDSEPGPLVNLCCGAISGALGATCIYPLQVIRTRMQAQRTTSGTVYNG  420

Query  826   MFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             + +VF RT+R EG RGFYKGL P LLKVVPAASI+YLVYE+MKK L L
Sbjct  421   ISNVFWRTYRKEGYRGFYKGLIPTLLKVVPAASISYLVYEAMKKRLKL  468



>gb|KHN09696.1| Calcium-binding mitochondrial carrier protein SCaMC-2-B [Glycine 
soja]
Length=450

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/472 (72%), Positives = 393/472 (83%), Gaps = 26/472 (6%)
 Frame = -1

Query  2095  GPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAK  1916
             G VSMDHVL AL ETKEER++RIR                          +I  +YK+A+
Sbjct  5     GVVSMDHVLVALGETKEEREVRIR--------------------------RIPPEYKYAR  38

Query  1915  ELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIE  1736
             EL  V DAN DGRV+Y EFR+YMDDKELELYRIFQ+IDVEH G ILPEEL++AL+KAGIE
Sbjct  39    ELCEVCDANSDGRVEYHEFRRYMDDKELELYRIFQSIDVEHDGTILPEELYEALLKAGIE  98

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             ++D+ELA FVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVI
Sbjct  99    MNDEELAHFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVI  158

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             PEGISKH + SKY +AGG+AG  SRTATAPLDRLKVVLQVQ+  ASIMPAV  IWK+ G+
Sbjct  159   PEGISKHANRSKYFLAGGIAGGISRTATAPLDRLKVVLQVQSEPASIMPAVTKIWKQDGL  218

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQT  1196
              GFFRGNG+NV+KV+PESAIKFY +EMLK  IG A G++ DIGT+GRL+AGG AGA+AQ 
Sbjct  219   LGFFRGNGLNVVKVSPESAIKFYAFEMLKKVIGEAHGNKSDIGTAGRLVAGGTAGAIAQA  278

Query  1195  AIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDL  1016
             AIYPMDL+KTRLQT   EGGKVP LG L+ +IW++EGPRAFYRG+VPSLLG+IPYA IDL
Sbjct  279   AIYPMDLIKTRLQTCPSEGGKVPKLGTLTMNIWVQEGPRAFYRGLVPSLLGMIPYAAIDL  338

Query  1015  AVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTA  836
               YD +K+ ++ YILQDSEPGPLVQLG GTISGA+GATCVYPLQV+RTR+QAQP++TS A
Sbjct  339   TAYDTMKDISKRYILQDSEPGPLVQLGCGTISGAVGATCVYPLQVIRTRLQAQPSNTSDA  398

Query  835   YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             YKGMFD F RTF+ EG  GFYKGLFPNLLKVVPAASITY+VYES+KKTLDLD
Sbjct  399   YKGMFDAFRRTFQLEGFIGFYKGLFPNLLKVVPAASITYVVYESLKKTLDLD  450



>ref|XP_006287636.1| hypothetical protein CARUB_v10000847mg [Capsella rubella]
 gb|EOA20534.1| hypothetical protein CARUB_v10000847mg [Capsella rubella]
Length=481

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/487 (71%), Positives = 411/487 (84%), Gaps = 8/487 (2%)
 Frame = -1

Query  2140  TAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIER  1961
             TAK + +  + + K   V+M+HVL AL+ET +ER+IRIRSLF FFD+ N G+LDYAQIE+
Sbjct  3     TAKAKPKNRSSMKKHVSVTMEHVLLALRETMDEREIRIRSLFDFFDNSNLGFLDYAQIEK  62

Query  1960  GLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGI  1781
             GL+++QI  +YK+A++L RV DAN+DGRVDY EFR+Y+D KELELYRIFQAIDVEH+G I
Sbjct  63    GLASLQIPPEYKYARDLFRVCDANRDGRVDYHEFRRYIDAKELELYRIFQAIDVEHNGCI  122

Query  1780  LPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRY  1601
             LPEELW+ALVKAGIEIDD+ELARFVEHVDKDN+G ITFEEWRDFLLLYPHEATIENIY +
Sbjct  123   LPEELWEALVKAGIEIDDEELARFVEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHH  182

Query  1600  LERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA  1421
              ERVCL+DIGEQAVIP+GISKH   S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A
Sbjct  183   WERVCLIDIGEQAVIPDGISKHGKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRVHA  242

Query  1420  SIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTS  1241
              ++P +K IW+E  ++GFFRGNG+NV+KVAPESAIKF  YEMLK  IG   G++GDIGTS
Sbjct  243   GVLPTIKKIWREDKLTGFFRGNGLNVMKVAPESAIKFCAYEMLKPMIG---GEDGDIGTS  299

Query  1240  GRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGI  1061
             GRL+AGG+AGA+AQTAIYPMDLVKTRLQT   EGGK P L +L+KDIW+REGPRAFY+G+
Sbjct  300   GRLLAGGMAGALAQTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGL  359

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQV  881
              PSLLGIIPYAGIDLA Y+  K+ +RTYIL D+EPGPL+QL  G  SGALGA+CVYPLQV
Sbjct  360   FPSLLGIIPYAGIDLAAYETFKDLSRTYILHDTEPGPLIQLSCGMTSGALGASCVYPLQV  419

Query  880   VRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESM  701
             VRTRMQA  + T+     M   F++T R EGLRGFY+GL PNLLKVVPAASITY+VYE+M
Sbjct  420   VRTRMQADSSETT-----MKQEFMKTMRGEGLRGFYRGLLPNLLKVVPAASITYIVYEAM  474

Query  700   KKTLDLD  680
             KK + LD
Sbjct  475   KKNMALD  481



>gb|EEC80932.1| hypothetical protein OsI_23626 [Oryza sativa Indica Group]
Length=485

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/480 (71%), Positives = 398/480 (83%), Gaps = 31/480 (6%)
 Frame = -1

Query  2116  CNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ  1937
             C P  K G V+M+H                              LDYAQIE GL+A+QI 
Sbjct  36    CEPARKAGAVTMEH------------------------------LDYAQIEAGLAALQIP  65

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
             A+ K+A+ELLR  D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELWDA
Sbjct  66    AECKYARELLRACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDA  125

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             LVKAGIEIDD+ELARFVEHVDKDN+G+ITFEEWRDFLLLYP+E TIENIY + ERVCLVD
Sbjct  126   LVKAGIEIDDEELARFVEHVDKDNNGIITFEEWRDFLLLYPNEVTIENIYHHWERVCLVD  185

Query  1576  IGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS  1397
             IGEQAVIPEGISK V+ASKYLIAGG+AGAASRTATAPLDRLKV++QVQTTR ++M ++K 
Sbjct  186   IGEQAVIPEGISKSVNASKYLIAGGIAGAASRTATAPLDRLKVIMQVQTTRTTVMHSIKD  245

Query  1396  IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGG  1220
             IW +GG+  FFRGNG+NV+KVAPESAI+FY YEMLK  I  +KG ++ ++G S RL+AGG
Sbjct  246   IWSQGGMLAFFRGNGLNVVKVAPESAIRFYAYEMLKEYIMKSKGENKSEVGPSERLVAGG  305

Query  1219  LAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGI  1040
             LAGAVAQTAIYP+DLVKTRLQTY+C  GKVP LG LS+DI + EGPRAFYRG+VPSLLGI
Sbjct  306   LAGAVAQTAIYPVDLVKTRLQTYSCVDGKVPSLGALSRDILMHEGPRAFYRGLVPSLLGI  365

Query  1039  IPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQA  860
             +PYAGIDLAVY+ LK+ ++TYIL+DS+PGPLVQLG GT+SGALGATCVYPLQV+RTR+QA
Sbjct  366   VPYAGIDLAVYETLKDVSKTYILKDSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQA  425

Query  859   QPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             Q  ++ +AY+GM DVF RT +HEG+ GFYKG+ PNLLKVVPAASITYLVYE+MKK L LD
Sbjct  426   QRANSESAYRGMSDVFWRTLQHEGVSGFYKGILPNLLKVVPAASITYLVYEAMKKNLSLD  485



>gb|KFK25130.1| hypothetical protein AALP_AA8G069900 [Arabis alpina]
Length=473

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/478 (72%), Positives = 403/478 (84%), Gaps = 8/478 (2%)
 Frame = -1

Query  2113  NPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQA  1934
              P  KP  ++M+HVL AL+ET EER+IRIRSLF FFD+ N G+LDY QIE+GL+++QI  
Sbjct  4     KPRKKPVSITMEHVLLALRETMEEREIRIRSLFDFFDNSNLGFLDYTQIEKGLASLQIPP  63

Query  1933  DYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDAL  1754
             +YK+A++L RV DAN+DG VDY EFR+Y+D KELELY+IFQAIDV H+G ILPEELW+AL
Sbjct  64    EYKYARDLFRVCDANRDGCVDYHEFRRYIDAKELELYKIFQAIDVAHNGCILPEELWEAL  123

Query  1753  VKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDI  1574
             VKAGIEIDD+ELARFVEHVDKDN+G ITFEEWRDFLLLYPHEATIENIY + ERVCL+DI
Sbjct  124   VKAGIEIDDEELARFVEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHHWERVCLIDI  183

Query  1573  GEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSI  1394
             GEQAVIP+GISKHV  S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A ++P +K I
Sbjct  184   GEQAVIPDGISKHVKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRAHAGVLPTIKKI  243

Query  1393  WKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLA  1214
             W+E  + GFFRGNG+NV+KVAPESAIKF  YEMLK  IG   G++GDIGTSGRL+AGG+A
Sbjct  244   WREDKVMGFFRGNGLNVMKVAPESAIKFCAYEMLKPMIG---GEDGDIGTSGRLMAGGMA  300

Query  1213  GAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
             GA+AQTAIYPMDLVKTRLQT   EGGK P L +L+ DIW+REGPRAFY+G+ PSLLGIIP
Sbjct  301   GAIAQTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTTDIWVREGPRAFYKGLFPSLLGIIP  360

Query  1033  YAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQP  854
             YAGIDLA Y+ LK+ +RTYIL D+EPGPL+QL  G  SGALGA+CVYPLQVVRTRMQA  
Sbjct  361   YAGIDLAAYETLKDLSRTYILHDTEPGPLIQLSCGMTSGALGASCVYPLQVVRTRMQADS  420

Query  853   THTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             + T+     M   F++T + EGLRGFY+GL PNLLKVVPAASITY+VYE+MKK + LD
Sbjct  421   SETT-----MKQEFMKTMKGEGLRGFYRGLLPNLLKVVPAASITYIVYEAMKKNMALD  473



>ref|XP_010555591.1| PREDICTED: LOW QUALITY PROTEIN: calcium-binding mitochondrial 
carrier protein SCaMC-1-like [Tarenaya hassleriana]
Length=498

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/509 (69%), Positives = 408/509 (80%), Gaps = 17/509 (3%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPAM--TAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLF  2015
             MSG G  V HV  P+    AK +  C N V K GPVSM+HVL AL+ET+EERD+RIRSLF
Sbjct  1     MSGHG--VEHVGLPSKMEAAKSKHGCSNLVKKSGPVSMEHVLLALRETREERDVRIRSLF  58

Query  2014  SFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKE  1835
             SFFDS+N GYLD AQIE+GLSA+QI + YK+AK+L RV D N+DGRVDY EFR+YMDDKE
Sbjct  59    SFFDSENVGYLDCAQIEKGLSALQIPSGYKYAKDLFRVCDTNRDGRVDYHEFRRYMDDKE  118

Query  1834  LELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWR  1655
             LELYRIFQAIDVEH+G I PE LWDALVKAGIEI+D+ELARFVE V KDN+G+ITFEEWR
Sbjct  119   LELYRIFQAIDVEHNGCISPEGLWDALVKAGIEINDEELARFVEDVSKDNNGIITFEEWR  178

Query  1654  DFLLLYPHEATIENIYRYLE-RVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRT  1478
             DFLLLYPHEATIENIY + E  +   D     V    ++ HV   KY IAGG+AGAASRT
Sbjct  179   DFLLLYPHEATIENIYHHWEISIIFYDF----VYKCELNXHVKRGKYFIAGGIAGAASRT  234

Query  1477  ATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYE  1298
              TAPLDRLKV+LQ+Q T A+I  A++ IWK+ G  GF RGNG+NV+KVAPESAIKFY YE
Sbjct  235   VTAPLDRLKVLLQIQKTDANIREAIRMIWKQDGFLGFLRGNGLNVVKVAPESAIKFYAYE  294

Query  1297  MLKNAIGHAKGD-EGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTC-EGGKVPH  1124
             + KN IG   G+ +GDIGTS RL AGG+AGAVAQ AIYP+DLVKTRLQTYT  +G   P 
Sbjct  295   LFKNVIGDNMGEAKGDIGTSARLFAGGMAGAVAQAAIYPLDLVKTRLQTYTTSQGCAGPR  354

Query  1123  LGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQD-SEPGPL  947
             LG L+++IW+ EGPRAFY+G+ PSLLGIIPYAGIDLAVY+ LK+ ++TYILQD SEPGPL
Sbjct  355   LGTLTREIWVHEGPRAFYKGLFPSLLGIIPYAGIDLAVYETLKDLSKTYILQDSSEPGPL  414

Query  946   VQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKG  767
             +QLG GTISG+LGATCVYPLQVVRTRMQA+   TS     M  VF RT R EG R FY+G
Sbjct  415   IQLGCGTISGSLGATCVYPLQVVRTRMQAERAKTS-----MSGVFRRTLREEGYRAFYRG  469

Query  766   LFPNLLKVVPAASITYLVYESMKKTLDLD  680
             L PNLLKVVPAASITYLVYE+MKK+L+L+
Sbjct  470   LLPNLLKVVPAASITYLVYEAMKKSLELE  498



>ref|XP_002866456.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH42715.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=478

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/479 (69%), Positives = 392/479 (82%), Gaps = 10/479 (2%)
 Frame = -1

Query  2113  NPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQA  1934
             NPV KP   +M+HVL AL+ETKEER+ RIR LF FFD+   G+LD  QIE+GLS++ I  
Sbjct  9     NPVKKPVEATMEHVLVALRETKEERETRIRKLFEFFDNSKLGFLDDTQIEKGLSSLSIPQ  68

Query  1933  DYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDAL  1754
             +Y++A + L+V DAN+DGRVDY EFR+YMD KELELY+IFQAIDVEH+G I PEELW+AL
Sbjct  69    NYRYASDFLKVCDANRDGRVDYQEFRRYMDSKELELYKIFQAIDVEHNGDICPEELWEAL  128

Query  1753  VKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDI  1574
              KAGI+I D+ELA F+EHVDKDN+G+ITFEEWRDFLLL PHEATIENIY + ERVCL+DI
Sbjct  129   DKAGIKIKDEELASFMEHVDKDNNGIITFEEWRDFLLLNPHEATIENIYHHWERVCLIDI  188

Query  1573  GEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSI  1394
             GEQAVIP+GIS H   SK L+AGG+AGA SRTATAPLDRLKV LQVQ T   ++P +K I
Sbjct  189   GEQAVIPDGISTHAQRSKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTNLGVVPTIKKI  248

Query  1393  WKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLA  1214
             W+E  + GFFRGNG+NV KVAPESAIKF  YEMLK+ IG   G +GDIGTSGRL+AGGLA
Sbjct  249   WREDKLLGFFRGNGLNVTKVAPESAIKFAAYEMLKSIIG---GVDGDIGTSGRLLAGGLA  305

Query  1213  GAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
             GAVAQTAIYPMDLVKTRLQT+  E G  P L +L+KDIW++EGPRAFYRG+ PSL+GIIP
Sbjct  306   GAVAQTAIYPMDLVKTRLQTFVSEVG-TPKLWKLTKDIWIQEGPRAFYRGLCPSLIGIIP  364

Query  1033  YAGIDLAVYDALKNFARTYILQDS-EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQ  857
             YAGIDLA Y+ LK+ +R++ L D+ EPGPL+QLG G  SGALGA+CVYPLQV+RTRMQA 
Sbjct  365   YAGIDLAAYETLKDLSRSHFLHDTAEPGPLIQLGCGMTSGALGASCVYPLQVIRTRMQAD  424

Query  856   PTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
              + TS     M   FL+T R EGLRGFY+G+FPN  KV+P+ASI+YLVYE+MKK L LD
Sbjct  425   ISKTS-----MIQEFLKTLRGEGLRGFYRGIFPNFFKVIPSASISYLVYEAMKKNLALD  478



>gb|KFK27926.1| hypothetical protein AALP_AA8G448300 [Arabis alpina]
Length=479

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/481 (69%), Positives = 393/481 (82%), Gaps = 11/481 (2%)
 Frame = -1

Query  2113  NPVMKPGPV-SMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ  1937
             NP  KPG   +M+HVL AL+ETKEER+IRIR+LF FFD  N G+LD  QIE+GLS+++I 
Sbjct  7     NPGKKPGSAATMEHVLVALRETKEEREIRIRNLFKFFDDSNLGFLDDTQIEKGLSSLRIP  66

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
                ++AK+ L+V DAN+DGRVDY EFR+YMD KELELY IFQAIDVEH+G I P ELW+A
Sbjct  67    PKEQYAKDFLKVCDANRDGRVDYEEFRRYMDAKELELYVIFQAIDVEHNGDICPAELWEA  126

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             L KAGIEI D ELA F+EHVDKD +G+ITFEEWRDFLLL+PHEAT+ENIY++ ERVCL+D
Sbjct  127   LNKAGIEIKDKELASFMEHVDKDKNGIITFEEWRDFLLLHPHEATVENIYQHWERVCLID  186

Query  1576  IGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS  1397
             IGEQAVIP+GISKH   SK L+AGG+AGA SRTATAPLDRLKVVLQVQ  +A ++P +K 
Sbjct  187   IGEQAVIPDGISKHAQRSKLLLAGGIAGAVSRTATAPLDRLKVVLQVQRAKAGVVPTIKK  246

Query  1396  IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGL  1217
             IW+E  + GFFRGNG+NV KVAPESAIKF  YEMLK  IG   G +GDIGTSGRL+AGGL
Sbjct  247   IWREDKLLGFFRGNGLNVTKVAPESAIKFAAYEMLKPIIG---GADGDIGTSGRLMAGGL  303

Query  1216  AGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGII  1037
             AGAVAQTAIYPMDLVKTRLQT   E GK P L +L+KDIW++EGPRAFY+G+ PSL+GII
Sbjct  304   AGAVAQTAIYPMDLVKTRLQTCVSELGKTPKLWKLTKDIWIQEGPRAFYKGLCPSLIGII  363

Query  1036  PYAGIDLAVYDALKNFARTYILQDS--EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQ  863
             PYAGIDLA Y+ LK+ +R YIL D   EPGPL+QLG G  SGALGA+CVYPLQV+RTRMQ
Sbjct  364   PYAGIDLAAYETLKDLSRKYILHDKGYEPGPLIQLGCGMTSGALGASCVYPLQVIRTRMQ  423

Query  862   AQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             A   +T      M + FL+T + EGLRGFY+G+ PNL KVVP+ASI+YLVYE+MKK L +
Sbjct  424   ADSANTK-----MSEEFLKTLKGEGLRGFYRGIVPNLFKVVPSASISYLVYEAMKKNLAI  478

Query  682   D  680
             D
Sbjct  479   D  479



>ref|XP_008231227.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Prunus mume]
Length=439

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/430 (75%), Positives = 374/430 (87%), Gaps = 5/430 (1%)
 Frame = -1

Query  2146  AMTAKD---RSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDY  1976
             AM +K+   R   CNPV K GP+SMDHVL AL ETKE+R++RIR+LF+FFD+ N GYLDY
Sbjct  7     AMQSKEKAGRRNGCNPVTKGGPLSMDHVLLALGETKEQRELRIRNLFNFFDTANIGYLDY  66

Query  1975  AQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVE  1796
              QIE  LS +QI ++YK+AK+LL V DAN+DGRVDY EF++YMDDKELELY IFQAIDVE
Sbjct  67    TQIEAALSTLQIPSEYKYAKDLLNVCDANQDGRVDYQEFKRYMDDKELELYCIFQAIDVE  126

Query  1795  HSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIE  1616
             H+G ILPEELWDALV+AGIEIDD+ELARFVE VDKDN+GVITFEEWRDFLLL+PHEATIE
Sbjct  127   HNGCILPEELWDALVRAGIEIDDEELARFVERVDKDNNGVITFEEWRDFLLLFPHEATIE  186

Query  1615  NIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQV  1436
             NIY YLERVCLVDIGEQ VIPE ISKHVHAS+YLIAG VAGA SRTATAPLDRLKVVLQV
Sbjct  187   NIYHYLERVCLVDIGEQTVIPEVISKHVHASRYLIAGAVAGATSRTATAPLDRLKVVLQV  246

Query  1435  QTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--D  1262
             QT +A IMPA++ I++EGG+ GFFRGNG+NVLKVAPESAI+FYTYEMLKN I HA G  D
Sbjct  247   QTKQARIMPAIRDIFREGGLLGFFRGNGLNVLKVAPESAIRFYTYEMLKNFIVHANGEED  306

Query  1261  EGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGP  1082
             + +IGT+ RL++GGLAGAVAQT IYPMDLVKTR+QTY  EGG++P LG LS++IW++EG 
Sbjct  307   QANIGTATRLVSGGLAGAVAQTVIYPMDLVKTRIQTYAGEGGRIPSLGTLSREIWVQEGS  366

Query  1081  RAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGAT  902
             RAFYRG+VPSLLGI+PYAGIDLA Y+ LK+ ++ YIL D EPGPLVQLG GT+SGALGAT
Sbjct  367   RAFYRGLVPSLLGIVPYAGIDLAAYETLKDMSKKYILHDGEPGPLVQLGCGTVSGALGAT  426

Query  901   CVYPLQVVRT  872
             CVYPLQ   T
Sbjct  427   CVYPLQNAST  436


 Score = 93.6 bits (231),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 98/187 (52%), Gaps = 7/187 (4%)
 Frame = -1

Query  1252  IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAF  1073
             +  S  LIAG +AGA ++TA  P+D +K  LQ  T +   +P +    +DI+   G   F
Sbjct  214   VHASRYLIAGAVAGATSRTATAPLDRLKVVLQVQTKQARIMPAI----RDIFREGGLLGF  269

Query  1072  YRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEP--GPLVQLGSGTISGALGATC  899
             +RG   ++L + P + I    Y+ LKNF      ++ +   G   +L SG ++GA+  T 
Sbjct  270   FRGNGLNVLKVAPESAIRFYTYEMLKNFIVHANGEEDQANIGTATRLVSGGLAGAVAQTV  329

Query  898   VYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITY  719
             +YP+ +V+TR+Q            +  +    +  EG R FY+GL P+LL +VP A I  
Sbjct  330   IYPMDLVKTRIQTYAGEGGRI-PSLGTLSREIWVQEGSRAFYRGLVPSLLGIVPYAGIDL  388

Query  718   LVYESMK  698
               YE++K
Sbjct  389   AAYETLK  395



>ref|XP_010444010.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X3 [Camelina sativa]
Length=480

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/481 (68%), Positives = 392/481 (81%), Gaps = 12/481 (2%)
 Frame = -1

Query  2113  NPVMKPGPV--SMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQI  1940
             NP  KP PV  +M+HVL AL+ETK+ER++RIR LF FFD+   G+LD  QIE+G+S++ I
Sbjct  9     NPGKKPRPVEATMEHVLVALRETKDEREMRIRKLFEFFDNSKLGFLDGTQIEKGMSSLSI  68

Query  1939  QADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWD  1760
                Y++A + L+V DAN+DGRVDY EFR+YMD KELELY+IFQAIDVEH+G I PEELW+
Sbjct  69    SPQYRYASDFLKVCDANRDGRVDYQEFRRYMDAKELELYKIFQAIDVEHNGDICPEELWE  128

Query  1759  ALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLV  1580
             AL KAGI+I D+ELA F++HVDKDN+G+ITFEEWRDFLLL PHEATIENIY + ERVCL+
Sbjct  129   ALDKAGIQIKDEELASFMDHVDKDNNGIITFEEWRDFLLLNPHEATIENIYHHWERVCLI  188

Query  1579  DIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVK  1400
             DIGEQAVIP+GIS H   SK L+AGG+AGA SRTATAPLDRLKV LQVQ T   ++P +K
Sbjct  189   DIGEQAVIPDGISTHAQRSKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTNLGVVPTIK  248

Query  1399  SIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGG  1220
              IW+E  + GFFRGNG+NV KVAPESAIKF  YEMLK  IG   G +GDIGTSGRL+AGG
Sbjct  249   KIWREDKLLGFFRGNGLNVTKVAPESAIKFAAYEMLKPIIG---GADGDIGTSGRLLAGG  305

Query  1219  LAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGI  1040
             LAGAVAQTAIYPMDLVKTRLQT+  E G  P L +L+KDIW++EGPRAFY+G+ PSL+GI
Sbjct  306   LAGAVAQTAIYPMDLVKTRLQTFVSEIG-TPKLWKLTKDIWIQEGPRAFYKGLCPSLIGI  364

Query  1039  IPYAGIDLAVYDALKNFARTYILQDS-EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQ  863
             IPYAGIDLA Y+ LK+ +RT+ L D+ EPGPL+QLG G  SGALGA+CVYPLQV+RTRMQ
Sbjct  365   IPYAGIDLAAYETLKDLSRTHFLHDTAEPGPLIQLGCGMTSGALGASCVYPLQVIRTRMQ  424

Query  862   AQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             A  + TS     M   FL+T R EGL+GFY+G+FPN  KV+P+ASI+YLVYE+MKK L L
Sbjct  425   ADSSKTS-----MSQEFLKTLRGEGLKGFYRGIFPNFFKVIPSASISYLVYEAMKKNLAL  479

Query  682   D  680
             D
Sbjct  480   D  480



>gb|KCW64286.1| hypothetical protein EUGRSUZ_G01923 [Eucalyptus grandis]
Length=433

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/422 (76%), Positives = 373/422 (88%), Gaps = 2/422 (0%)
 Frame = -1

Query  2128  RSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSA  1949
             RS+ CNPV KPGPV+MDHVL A  ETKE+R++RIR +F  FD+   GYLDYAQIE GLSA
Sbjct  12    RSDGCNPVRKPGPVTMDHVLLASGETKEKRELRIRGMFDSFDTAKVGYLDYAQIETGLSA  71

Query  1948  MQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEE  1769
             + I  +YK+AK+LL V DANKDGRVDY EF++YMDDKELELYRIFQAIDVEH+G ILPEE
Sbjct  72    LHIPPEYKYAKDLLNVCDANKDGRVDYQEFKRYMDDKELELYRIFQAIDVEHNGCILPEE  131

Query  1768  LWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERV  1589
             L+DAL++AGIEIDD+ELA FVE VDKD++GVITFEEWR+FLLLYPHEAT+ENIYRYLERV
Sbjct  132   LYDALLRAGIEIDDEELAHFVERVDKDSNGVITFEEWREFLLLYPHEATMENIYRYLERV  191

Query  1588  CLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMP  1409
             CLVDIGEQAV+PEGISKHVH S+YLIAG VAGAASRT TAPLDRLKV+LQVQTTRAS+MP
Sbjct  192   CLVDIGEQAVVPEGISKHVHTSRYLIAGAVAGAASRTVTAPLDRLKVILQVQTTRASLMP  251

Query  1408  AVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE--GDIGTSGR  1235
             A+KSIWK+GG+ GFFRGNG+NV+KVAPESA++FYTYEMLK  I  A+G E   +IG  GR
Sbjct  252   AIKSIWKDGGLRGFFRGNGLNVVKVAPESALRFYTYEMLKRVIVTAQGGEEKAEIGPMGR  311

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVP  1055
             L+AGG+AGAVAQT +YPMDLVKTRLQT+  +GGK+P LG++++DIW++EGPRAFYRG+VP
Sbjct  312   LLAGGVAGAVAQTTVYPMDLVKTRLQTHVSDGGKIPSLGQMTRDIWVQEGPRAFYRGVVP  371

Query  1054  SLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVR  875
             SL+GIIPYAGIDLA Y+  K+ ++ YILQD EPGPLVQL  G  SGALGA+CVYPLQVVR
Sbjct  372   SLIGIIPYAGIDLAAYETFKDLSKKYILQDGEPGPLVQLVCGMTSGALGASCVYPLQVVR  431

Query  874   TR  869
             TR
Sbjct  432   TR  433


 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 101/189 (53%), Gaps = 11/189 (6%)
 Frame = -1

Query  1252  IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAF  1073
             + TS  LIAG +AGA ++T   P+D +K  LQ  T     +P +    K IW   G R F
Sbjct  210   VHTSRYLIAGAVAGAASRTVTAPLDRLKVILQVQTTRASLMPAI----KSIWKDGGLRGF  265

Query  1072  YRGIVPSLLGIIPYAGIDLAVYDALKNFARTYI--LQDSEPGPLVQLGSGTISGALGATC  899
             +RG   +++ + P + +    Y+ LK    T     + +E GP+ +L +G ++GA+  T 
Sbjct  266   FRGNGLNVVKVAPESALRFYTYEMLKRVIVTAQGGEEKAEIGPMGRLLAGGVAGAVAQTT  325

Query  898   VYPLQVVRTRMQAQPTHTSTAYK--GMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASI  725
             VYP+ +V+TR+Q   TH S   K   +  +    +  EG R FY+G+ P+L+ ++P A I
Sbjct  326   VYPMDLVKTRLQ---THVSDGGKIPSLGQMTRDIWVQEGPRAFYRGVVPSLIGIIPYAGI  382

Query  724   TYLVYESMK  698
                 YE+ K
Sbjct  383   DLAAYETFK  391



>ref|XP_010444008.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X1 [Camelina sativa]
 ref|XP_010444009.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Camelina sativa]
Length=483

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/484 (68%), Positives = 392/484 (81%), Gaps = 15/484 (3%)
 Frame = -1

Query  2113  NPVMKPGPV--SMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQI  1940
             NP  KP PV  +M+HVL AL+ETK+ER++RIR LF FFD+   G+LD  QIE+G+S++ I
Sbjct  9     NPGKKPRPVEATMEHVLVALRETKDEREMRIRKLFEFFDNSKLGFLDGTQIEKGMSSLSI  68

Query  1939  QADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWD  1760
                Y++A + L+V DAN+DGRVDY EFR+YMD KELELY+IFQAIDVEH+G I PEELW+
Sbjct  69    SPQYRYASDFLKVCDANRDGRVDYQEFRRYMDAKELELYKIFQAIDVEHNGDICPEELWE  128

Query  1759  ALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLV  1580
             AL KAGI+I D+ELA F++HVDKDN+G+ITFEEWRDFLLL PHEATIENIY + ERVCL+
Sbjct  129   ALDKAGIQIKDEELASFMDHVDKDNNGIITFEEWRDFLLLNPHEATIENIYHHWERVCLI  188

Query  1579  DIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVK  1400
             DIGEQAVIP+GIS H   SK L+AGG+AGA SRTATAPLDRLKV LQVQ T   ++P +K
Sbjct  189   DIGEQAVIPDGISTHAQRSKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTNLGVVPTIK  248

Query  1399  SIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGG  1220
              IW+E  + GFFRGNG+NV KVAPESAIKF  YEMLK  IG   G +GDIGTSGRL+AGG
Sbjct  249   KIWREDKLLGFFRGNGLNVTKVAPESAIKFAAYEMLKPIIG---GADGDIGTSGRLLAGG  305

Query  1219  LAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGI  1040
             LAGAVAQTAIYPMDLVKTRLQT+  E G  P L +L+KDIW++EGPRAFY+G+ PSL+GI
Sbjct  306   LAGAVAQTAIYPMDLVKTRLQTFVSEIG-TPKLWKLTKDIWIQEGPRAFYKGLCPSLIGI  364

Query  1039  IPYAGIDLAVYDALKNFARTYILQDS----EPGPLVQLGSGTISGALGATCVYPLQVVRT  872
             IPYAGIDLA Y+ LK+ +RT+ L D+    EPGPL+QLG G  SGALGA+CVYPLQV+RT
Sbjct  365   IPYAGIDLAAYETLKDLSRTHFLHDTAGCAEPGPLIQLGCGMTSGALGASCVYPLQVIRT  424

Query  871   RMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKT  692
             RMQA  + TS     M   FL+T R EGL+GFY+G+FPN  KV+P+ASI+YLVYE+MKK 
Sbjct  425   RMQADSSKTS-----MSQEFLKTLRGEGLKGFYRGIFPNFFKVIPSASISYLVYEAMKKN  479

Query  691   LDLD  680
             L LD
Sbjct  480   LALD  483



>ref|XP_010483867.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X1 [Camelina sativa]
 ref|XP_010483868.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X2 [Camelina sativa]
Length=480

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/481 (68%), Positives = 390/481 (81%), Gaps = 12/481 (2%)
 Frame = -1

Query  2113  NPVMKPGPV--SMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQI  1940
             NP  KP PV  +M+HVL AL+ETK+ER++RIR LF FFD+   G+LD   IE+G+S++ I
Sbjct  9     NPGKKPRPVEATMEHVLVALRETKDEREMRIRKLFEFFDNSKLGFLDGTHIEKGMSSLSI  68

Query  1939  QADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWD  1760
                Y++A + L+V DAN+DGRVDY EFR+YMD KELELY+IFQAID+EH+G I PEELW+
Sbjct  69    SPQYRYASDFLKVCDANRDGRVDYQEFRRYMDAKELELYKIFQAIDIEHNGDICPEELWE  128

Query  1759  ALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLV  1580
             AL KAGI+I D+ELA F++HVDKDN+G+ITFEEWRDFLLL PHEATIENIY + ERVCL+
Sbjct  129   ALDKAGIQIKDEELASFMDHVDKDNNGIITFEEWRDFLLLNPHEATIENIYHHWERVCLI  188

Query  1579  DIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVK  1400
             DIGEQAVIP+GIS H H SK L+AGG+AGA SRTATAPLDRLKV LQVQ T   ++P +K
Sbjct  189   DIGEQAVIPDGISTHAHRSKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTNLGVVPTIK  248

Query  1399  SIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGG  1220
              IW+E  + GFFRGNG+NV KVAPESAIKF  YEMLK  IG   G +GDIGTSGRL+AGG
Sbjct  249   KIWREDKLLGFFRGNGLNVTKVAPESAIKFAAYEMLKPIIG---GADGDIGTSGRLLAGG  305

Query  1219  LAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGI  1040
             LAGAVAQTAIYPMDLVKTRLQT+  E G  P L +L+KDIW++EGPRAFY+G+ PSL+GI
Sbjct  306   LAGAVAQTAIYPMDLVKTRLQTFVSEIG-TPKLWKLTKDIWIQEGPRAFYKGLCPSLIGI  364

Query  1039  IPYAGIDLAVYDALKNFARTYILQDS-EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQ  863
             IPYAGIDLA Y+  K+ +R + L D+ EPGPL+QLG G  SGALGA+CVYPLQV+RTRMQ
Sbjct  365   IPYAGIDLAAYETFKDLSRKHFLHDTAEPGPLIQLGCGMTSGALGASCVYPLQVIRTRMQ  424

Query  862   AQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             A  + TS     M   FL+T R EGLRGFY+G+FPN  KV+P+ASI+YLVYE+MKK L L
Sbjct  425   ADSSKTS-----MSQEFLKTLRGEGLRGFYRGIFPNFFKVIPSASISYLVYEAMKKNLAL  479

Query  682   D  680
             D
Sbjct  480   D  480



>ref|NP_568940.1| ATP-Mg/Pi transporter [Arabidopsis thaliana]
 dbj|BAB10081.1| peroxisomal Ca-dependent solute carrier-like protein [Arabidopsis 
thaliana]
 gb|AAL07068.1| putative peroxisomal Ca-dependent solute carrier protein [Arabidopsis 
thaliana]
 gb|AAM14292.1| putative peroxisomal Ca-dependent solute carrier [Arabidopsis 
thaliana]
 gb|AED97520.1| ATP-Mg/Pi transporter [Arabidopsis thaliana]
Length=478

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/479 (68%), Positives = 388/479 (81%), Gaps = 10/479 (2%)
 Frame = -1

Query  2113  NPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQA  1934
             NP  KP   +M+HVL AL+ETKE+R+IRI+ LF FFD+   G+LD  QIE+GLS++ I  
Sbjct  9     NPGKKPVEATMEHVLVALRETKEKREIRIQKLFEFFDNSKLGFLDDTQIEKGLSSLSIPP  68

Query  1933  DYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDAL  1754
              Y++A + L+V D+N+DGRVDY EFR+YMD KELELY+IFQAID+EH+G I P ELW+AL
Sbjct  69    KYRYASDFLKVCDSNRDGRVDYQEFRRYMDAKELELYKIFQAIDIEHNGDICPAELWEAL  128

Query  1753  VKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDI  1574
              KAGI+I D+ELA F+EHVDKDN+G+ITFEEWRDFLLL PHEATIENIY + ERVCL+DI
Sbjct  129   DKAGIKIKDEELASFMEHVDKDNNGIITFEEWRDFLLLNPHEATIENIYHHWERVCLIDI  188

Query  1573  GEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSI  1394
             GEQAVIP+GIS H   SK L+AGG+AGA SRTATAPLDRLKV LQVQ T   ++P +K I
Sbjct  189   GEQAVIPDGISAHAQRSKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTNLGVVPTIKKI  248

Query  1393  WKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLA  1214
             W+E  + GFFRGNG+NV KVAPESAIKF  YEMLK  IG   G +GDIGTSGRL+AGGLA
Sbjct  249   WREDKLLGFFRGNGLNVAKVAPESAIKFAAYEMLKPIIG---GADGDIGTSGRLLAGGLA  305

Query  1213  GAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
             GAVAQTAIYPMDLVKTRLQT+  E G  P L +L+KDIW++EGPRAFYRG+ PSL+GIIP
Sbjct  306   GAVAQTAIYPMDLVKTRLQTFVSEVG-TPKLWKLTKDIWIQEGPRAFYRGLCPSLIGIIP  364

Query  1033  YAGIDLAVYDALKNFARTYILQDS-EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQ  857
             YAGIDLA Y+ LK+ +R + L D+ EPGPL+QLG G  SGALGA+CVYPLQV+RTRMQA 
Sbjct  365   YAGIDLAAYETLKDLSRAHFLHDTAEPGPLIQLGCGMTSGALGASCVYPLQVIRTRMQAD  424

Query  856   PTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
              + TS     M   FL+T R EGL+GFY+G+FPN  KV+P+ASI+YLVYE+MKK L LD
Sbjct  425   SSKTS-----MGQEFLKTLRGEGLKGFYRGIFPNFFKVIPSASISYLVYEAMKKNLALD  478



>ref|XP_006279765.1| hypothetical protein CARUB_v10027755mg [Capsella rubella]
 gb|EOA12663.1| hypothetical protein CARUB_v10027755mg [Capsella rubella]
Length=477

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/480 (68%), Positives = 391/480 (81%), Gaps = 13/480 (3%)
 Frame = -1

Query  2113  NPVMKPGPV--SMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQI  1940
             NP  KP PV  +M+HVL AL+ETKE+R+IRIR LF FFD+   G+LD  QIE+GLS++ I
Sbjct  9     NPAKKP-PVEPTMEHVLVALRETKEQREIRIRKLFEFFDNSKVGFLDGTQIEKGLSSLSI  67

Query  1939  QADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWD  1760
               +Y++A + L+V DAN+DG VDY EFR+YMD KELELY+IFQAIDVE +G I PEELW+
Sbjct  68    PPNYRYASDFLKVCDANRDGCVDYQEFRRYMDAKELELYKIFQAIDVERNGDICPEELWE  127

Query  1759  ALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLV  1580
             AL KAGI+I D+ELA F++HVDKDN+G+ITFEEWRDFLLL PHEATIENIY + ERVCL+
Sbjct  128   ALDKAGIKIKDEELASFMDHVDKDNNGIITFEEWRDFLLLNPHEATIENIYHHWERVCLI  187

Query  1579  DIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVK  1400
             DIGEQAVIP+G+S H   SK L+AGG+AGA SRTATAPLDRLKV LQVQ T   ++P +K
Sbjct  188   DIGEQAVIPDGVSTHAQRSKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTNLGVVPTIK  247

Query  1399  SIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGG  1220
              IW+E  + GFFRGNG+NV KVAPESAIKF  YEMLK  IG   G +GDIGTSGRL+AGG
Sbjct  248   KIWREDKLLGFFRGNGLNVTKVAPESAIKFAAYEMLKPIIG---GADGDIGTSGRLLAGG  304

Query  1219  LAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGI  1040
             LAGAVAQTAIYPMDLVKTRLQT+  E G  P L +L+KDIW++EGPRAFY+G+ PSL+GI
Sbjct  305   LAGAVAQTAIYPMDLVKTRLQTFVSEVG-TPKLWKLTKDIWIQEGPRAFYKGLCPSLIGI  363

Query  1039  IPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQA  860
             IPYAGIDLA Y+ LK+ +RTYI   +EPGPL+QLG G  SGALGA+CVYPLQV+RTRMQA
Sbjct  364   IPYAGIDLAAYETLKDLSRTYI-DTAEPGPLIQLGCGMTSGALGASCVYPLQVIRTRMQA  422

Query  859   QPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
               + TS     M   FL+T R EGLRGFY+G+FPN  KV+P+ASI+YLVYE+MKK LDL+
Sbjct  423   DSSKTS-----MSQEFLKTLRGEGLRGFYRGIFPNFFKVIPSASISYLVYEAMKKNLDLN  477



>gb|KHN00632.1| Calcium-binding mitochondrial carrier protein SCaMC-2-B [Glycine 
soja]
Length=427

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/424 (77%), Positives = 367/424 (87%), Gaps = 13/424 (3%)
 Frame = -1

Query  1927  KFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVK  1748
              +A++L    DANKDGRVDY EF++YMDDKELELYRIFQAIDVEHSG I PEEL  ALV+
Sbjct  9     NYAQDLFGACDANKDGRVDYEEFKRYMDDKELELYRIFQAIDVEHSGCISPEELSHALVR  68

Query  1747  AGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGE  1568
             AGI+IDD+ELARFVE VDKD++GVITF EWRDFLLLYPHEATIENIY YLERVCL+DIGE
Sbjct  69    AGIQIDDEELARFVERVDKDHNGVITFGEWRDFLLLYPHEATIENIYHYLERVCLIDIGE  128

Query  1567  QAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWK  1388
             Q VIP GISKH+HAS YLIAGGVAGAASRT TAPLDRLKVVLQVQTTRA +MPA+K IWK
Sbjct  129   QTVIPAGISKHIHASSYLIAGGVAGAASRTTTAPLDRLKVVLQVQTTRAHVMPAIKDIWK  188

Query  1387  EGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGD--EGDIGTSGRLIAGGLA  1214
             EGG  GFFRGNG+NVLKVAPESAI+FYTYEMLK  IG+AKG+  + D+GT GRL+AGG+A
Sbjct  189   EGGCLGFFRGNGLNVLKVAPESAIRFYTYEMLKAFIGNAKGEGAKADVGTMGRLLAGGMA  248

Query  1213  GAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
             GAVAQTAIYP+DLVKTR+QTY CEGG++P LG LSKDIW++EGPRAFY+G++PS+LGI+P
Sbjct  249   GAVAQTAIYPLDLVKTRIQTYACEGGRLPSLGTLSKDIWVKEGPRAFYKGLIPSILGIVP  308

Query  1033  YAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQ------VVRT  872
             YAGIDLA Y+ LK+ ++ YIL D EPGPLVQLG GT+SGALGATCVYPLQ      VV  
Sbjct  309   YAGIDLAAYETLKDMSKKYILLDEEPGPLVQLGCGTVSGALGATCVYPLQKLESDMVVDF  368

Query  871   RMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKT  692
             RMQAQ      AY GM DVF  TF+HEG RGFYKGLFPNLLKVVP+ASITYLVYE+MKK 
Sbjct  369   RMQAQ-----RAYMGMADVFRITFKHEGFRGFYKGLFPNLLKVVPSASITYLVYENMKKG  423

Query  691   LDLD  680
             LDLD
Sbjct  424   LDLD  427



>ref|XP_010457733.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Camelina sativa]
Length=481

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/477 (68%), Positives = 387/477 (81%), Gaps = 12/477 (3%)
 Frame = -1

Query  2101  KPGPV--SMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADY  1928
             KP PV  +M+HVL AL+ET EERD+RIR LF FFD+   G+LD  QIE+G+S++ I   Y
Sbjct  14    KPRPVEATMEHVLVALRETNEERDMRIRKLFEFFDNSKVGFLDGTQIEKGMSSLSISPQY  73

Query  1927  KFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVK  1748
             ++A + L+V DAN+DGRVDY EFR+YMD KELELY+IFQAIDVEH+G I PEELW+AL K
Sbjct  74    RYASDFLKVCDANRDGRVDYQEFRRYMDAKELELYKIFQAIDVEHNGDICPEELWEALDK  133

Query  1747  AGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGE  1568
             AGI+I D+ELA F++HVDKDN+G+ITFEEWRDFLLL PHEATIENIY + ERVCL+DIGE
Sbjct  134   AGIKIKDEELASFMDHVDKDNNGIITFEEWRDFLLLNPHEATIENIYHHWERVCLIDIGE  193

Query  1567  QAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWK  1388
             QAVIP+GIS H   SK L+AGG+AGA SRTATAPLDRLKV LQVQ T   ++P +K IW+
Sbjct  194   QAVIPDGISTHAQRSKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTNLGVVPTIKKIWR  253

Query  1387  EGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGA  1208
             E  + GFFRGNG+NV KVAPESAIKF  YEMLK  IG   G +GDIGTSGRL+AGGLAGA
Sbjct  254   EDKLLGFFRGNGLNVTKVAPESAIKFAAYEMLKPIIG---GADGDIGTSGRLLAGGLAGA  310

Query  1207  VAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYA  1028
             VAQTAIYPMDLVKTRLQT+  E G  P L +L+KDIW++EGPRAFY+G+ PSL+GIIPYA
Sbjct  311   VAQTAIYPMDLVKTRLQTFVSEIG-TPKLWKLTKDIWIQEGPRAFYKGLCPSLIGIIPYA  369

Query  1027  GIDLAVYDALKNFARTYILQDS-EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPT  851
             GIDLA Y+  K+ +R + L D+ EPGPL+QLG G  SGALGA+CVYPLQV+RTRMQA  +
Sbjct  370   GIDLAAYETFKDLSRKHFLHDTAEPGPLIQLGCGMTSGALGASCVYPLQVIRTRMQADSS  429

Query  850   HTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
              TS     M   FL+T R EGL+GFY+G+FPN  KV+P+ASI+YLVYE+MKK L LD
Sbjct  430   KTS-----MSQEFLKTLRGEGLKGFYRGIFPNFFKVIPSASISYLVYEAMKKNLALD  481



>ref|XP_006394471.1| hypothetical protein EUTSA_v10004107mg [Eutrema salsugineum]
 gb|ESQ31757.1| hypothetical protein EUTSA_v10004107mg [Eutrema salsugineum]
Length=481

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/481 (69%), Positives = 395/481 (82%), Gaps = 11/481 (2%)
 Frame = -1

Query  2113  NPVMKPG-PVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ  1937
             NP  KPG   +MDHVL AL+ETKEER+ RIR+LF FFD+ N+GYLD  QIE+GLS+++I 
Sbjct  9     NPGKKPGGAATMDHVLLALRETKEERETRIRNLFEFFDNSNSGYLDDTQIEKGLSSLRIP  68

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
               YK+A++L +  D N+DGRVDY EFR+YMD KELELY IFQAIDV H+G I P+ELW+A
Sbjct  69    PKYKYARDLRKACDVNRDGRVDYEEFRRYMDAKELELYIIFQAIDVHHNGDICPDELWEA  128

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             LVKAGIEI D ELA F++HVDKDN+G+ITFEEWRDFLLL+PHEATIENIY + ERVCL+D
Sbjct  129   LVKAGIEISDKELASFMDHVDKDNNGIITFEEWRDFLLLHPHEATIENIYHHWERVCLID  188

Query  1576  IGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS  1397
             IGEQ VIP+GIS H   SK L+AGG+AGA SRTATAPLDRLKVVLQVQ T+A ++P +K 
Sbjct  189   IGEQVVIPDGISTHAQRSKLLLAGGLAGAVSRTATAPLDRLKVVLQVQRTKAGVVPTIKK  248

Query  1396  IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGL  1217
             IW+E  + GFFRGNG+NV KVAPESAIKF  YEMLK  IG   G +GDIGTSGRL++GGL
Sbjct  249   IWREDKLLGFFRGNGLNVTKVAPESAIKFAAYEMLKPIIG---GADGDIGTSGRLLSGGL  305

Query  1216  AGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGII  1037
             AGAVAQTAIYPMDLVKTRLQT   E GK P L +L+K+IW++EGPRAFY+G+ PSLLGI+
Sbjct  306   AGAVAQTAIYPMDLVKTRLQTCVSELGKTPKLWKLTKEIWIQEGPRAFYKGLCPSLLGIV  365

Query  1036  PYAGIDLAVYDALKNFARTYILQDS--EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQ  863
             PYAGIDLA Y+ LK+ +RTYI  D+  EPGPL+QLG G  SGALGA+CVYPLQVVRTRMQ
Sbjct  366   PYAGIDLAAYETLKDLSRTYIHHDTGYEPGPLIQLGCGMTSGALGASCVYPLQVVRTRMQ  425

Query  862   AQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             A  ++ +     M   FL+T + EGLRGFY+G+FPNL KV+P+ASI+YLVYE+MKK L +
Sbjct  426   ADSSNNT-----MRQEFLKTLKGEGLRGFYRGIFPNLFKVIPSASISYLVYEAMKKNLSI  480

Query  682   D  680
             D
Sbjct  481   D  481



>ref|XP_006578741.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like 
isoform X2 [Glycine max]
Length=424

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/408 (77%), Positives = 358/408 (88%), Gaps = 0/408 (0%)
 Frame = -1

Query  2083  MDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLR  1904
             MDHVL AL ETKEER++RIRSLF+FFD+ N GYLDYAQIE GLSA+QI  +YK+A+EL  
Sbjct  1     MDHVLVALGETKEEREVRIRSLFNFFDAANNGYLDYAQIEAGLSALQIPPEYKYARELCE  60

Query  1903  VVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDD  1724
             V DAN DGRV+Y EFR+YMDDKELELYRIFQAIDVEH G ILPEEL++AL+KAGIE++D+
Sbjct  61    VCDANSDGRVEYHEFRRYMDDKELELYRIFQAIDVEHDGTILPEELYEALLKAGIEMNDE  120

Query  1723  ELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGI  1544
             ELA FVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVIPEGI
Sbjct  121   ELAHFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGI  180

Query  1543  SKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFF  1364
             SKH + SKY +AGG+AG  SRTATAPLDRLKVVLQVQ+ RASIMPAV  IWK+ G+ GFF
Sbjct  181   SKHANRSKYFLAGGIAGGISRTATAPLDRLKVVLQVQSERASIMPAVTRIWKQDGLLGFF  240

Query  1363  RGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYP  1184
             RGNG+NV+KVAPESAIKFY +EMLK  IG A+G++ DIGT+GRL+AGG AGA+AQ AIYP
Sbjct  241   RGNGLNVVKVAPESAIKFYAFEMLKKVIGEAQGNKSDIGTAGRLVAGGTAGAIAQAAIYP  300

Query  1183  MDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYD  1004
             MDL+KTRLQT   EGGKVP LG L+ +IW +EGPRAFYRG+VPSLLG+IPYA IDL  YD
Sbjct  301   MDLIKTRLQTCPSEGGKVPKLGTLTMNIWFQEGPRAFYRGLVPSLLGMIPYAAIDLTAYD  360

Query  1003  ALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQA  860
              LK+ ++ YILQDSEPGPLVQLG GTISGA+GATCVYPLQV+RTR  A
Sbjct  361   TLKDMSKRYILQDSEPGPLVQLGCGTISGAVGATCVYPLQVIRTRYNA  408


 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 97/182 (53%), Gaps = 5/182 (3%)
 Frame = -1

Query  1243  SGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRG  1064
             S   +AGG+AG +++TA  P+D +K  LQ  +     +P + R    IW ++G   F+RG
Sbjct  187   SKYFLAGGIAGGISRTATAPLDRLKVVLQVQSERASIMPAVTR----IWKQDGLLGFFRG  242

Query  1063  IVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQ  884
                +++ + P + I    ++ LK          S+ G   +L +G  +GA+    +YP+ 
Sbjct  243   NGLNVVKVAPESAIKFYAFEMLKKVIGEAQGNKSDIGTAGRLVAGGTAGAIAQAAIYPMD  302

Query  883   VVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYES  704
             +++TR+Q  P+      K +  + +  +  EG R FY+GL P+LL ++P A+I    Y++
Sbjct  303   LIKTRLQTCPSEGGKVPK-LGTLTMNIWFQEGPRAFYRGLVPSLLGMIPYAAIDLTAYDT  361

Query  703   MK  698
             +K
Sbjct  362   LK  363


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 71/139 (51%), Gaps = 4/139 (3%)
 Frame = -1

Query  1552  EGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAV----KSIWKE  1385
             +G    +  +  L+AGG AGA ++ A  P+D +K  LQ   +    +P +     +IW +
Sbjct  272   QGNKSDIGTAGRLVAGGTAGAIAQAAIYPMDLIKTRLQTCPSEGGKVPKLGTLTMNIWFQ  331

Query  1384  GGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAV  1205
              G   F+RG   ++L + P +AI    Y+ LK+        + + G   +L  G ++GAV
Sbjct  332   EGPRAFYRGLVPSLLGMIPYAAIDLTAYDTLKDMSKRYILQDSEPGPLVQLGCGTISGAV  391

Query  1204  AQTAIYPMDLVKTRLQTYT  1148
               T +YP+ +++TR   ++
Sbjct  392   GATCVYPLQVIRTRYNAFS  410



>ref|XP_006581822.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like 
isoform X2 [Glycine max]
 ref|XP_006581823.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like 
isoform X3 [Glycine max]
Length=432

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/412 (76%), Positives = 361/412 (88%), Gaps = 0/412 (0%)
 Frame = -1

Query  2095  GPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAK  1916
             G VSMDHVL AL ETKEER++RIRSLF+FFD+ N GYLDYAQIE GLSA+QI  +YK+A+
Sbjct  5     GVVSMDHVLVALGETKEEREVRIRSLFNFFDAANNGYLDYAQIEAGLSALQIPPEYKYAR  64

Query  1915  ELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIE  1736
             EL  V DAN DGRV+Y EFR+YMDDKELELYRIFQ+IDVEH G ILPEEL++AL+KAGIE
Sbjct  65    ELCEVCDANSDGRVEYHEFRRYMDDKELELYRIFQSIDVEHDGTILPEELYEALLKAGIE  124

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             ++D+ELA FVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVI
Sbjct  125   MNDEELAHFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVI  184

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             PEGISKHV+ SKY +AGG+AG  SRTATAPLDRLKVVLQVQ+  ASIMPAV  IWK+ G+
Sbjct  185   PEGISKHVNRSKYFLAGGIAGGISRTATAPLDRLKVVLQVQSEPASIMPAVTKIWKQDGL  244

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQT  1196
              GFFRGNG+NV+KV+PESAIKFY +EMLK  IG A G++ DIGT+GRL+AGG AGA+AQ 
Sbjct  245   LGFFRGNGLNVVKVSPESAIKFYAFEMLKKVIGEAHGNKSDIGTAGRLVAGGTAGAIAQA  304

Query  1195  AIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDL  1016
             AIYPMDL+KTRLQT   EGGKVP LG L+ +IW++EGPRAFYRG+VPSLLG+IPYA IDL
Sbjct  305   AIYPMDLIKTRLQTCPSEGGKVPKLGTLTMNIWVQEGPRAFYRGLVPSLLGMIPYAAIDL  364

Query  1015  AVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQA  860
               YD +K+ ++ YILQDSEPGPLVQLG GTISGA+GATCVYPLQV+RTR  A
Sbjct  365   TAYDTMKDISKRYILQDSEPGPLVQLGCGTISGAVGATCVYPLQVIRTRYNA  416


 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 100/191 (52%), Gaps = 5/191 (3%)
 Frame = -1

Query  1270  KGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLR  1091
             +G    +  S   +AGG+AG +++TA  P+D +K  LQ  +     +P + +    IW +
Sbjct  186   EGISKHVNRSKYFLAGGIAGGISRTATAPLDRLKVVLQVQSEPASIMPAVTK----IWKQ  241

Query  1090  EGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGAL  911
             +G   F+RG   +++ + P + I    ++ LK          S+ G   +L +G  +GA+
Sbjct  242   DGLLGFFRGNGLNVVKVSPESAIKFYAFEMLKKVIGEAHGNKSDIGTAGRLVAGGTAGAI  301

Query  910   GATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAA  731
                 +YP+ +++TR+Q  P+      K +  + +  +  EG R FY+GL P+LL ++P A
Sbjct  302   AQAAIYPMDLIKTRLQTCPSEGGKVPK-LGTLTMNIWVQEGPRAFYRGLVPSLLGMIPYA  360

Query  730   SITYLVYESMK  698
             +I    Y++MK
Sbjct  361   AIDLTAYDTMK  371



>ref|XP_006446894.1| hypothetical protein CICLE_v10015524mg [Citrus clementina]
 gb|ESR60134.1| hypothetical protein CICLE_v10015524mg [Citrus clementina]
Length=393

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/392 (81%), Positives = 351/392 (90%), Gaps = 2/392 (1%)
 Frame = -1

Query  1849  MDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVIT  1670
             MDDKELELYRIFQAIDVEH+GGILPEEL+ ALVKAGIEIDD+ELA FVE VDKDN+GVIT
Sbjct  1     MDDKELELYRIFQAIDVEHNGGILPEELYHALVKAGIEIDDEELATFVERVDKDNNGVIT  60

Query  1669  FEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGA  1490
             FEEW DFLLLYPHEAT+ENIY YLERVCLVDIGEQA IPEGISKHVHA++YLIAGGVAGA
Sbjct  61    FEEWGDFLLLYPHEATMENIYHYLERVCLVDIGEQAAIPEGISKHVHANRYLIAGGVAGA  120

Query  1489  ASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKF  1310
              SRTATAPLDRLKVVLQVQTTRA IMPA++ IW++GGI GFFRGNG+NVLKVAPESAIKF
Sbjct  121   TSRTATAPLDRLKVVLQVQTTRAHIMPAIRDIWRDGGILGFFRGNGLNVLKVAPESAIKF  180

Query  1309  YTYEMLKNAIGHAKGDE--GDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG  1136
             YTYE LK  I   +GDE   +IG SGRL AGGLAGA+AQTAIYPMDLVKTRLQTY CEGG
Sbjct  181   YTYERLKKLIAKVEGDEEKTNIGASGRLFAGGLAGAMAQTAIYPMDLVKTRLQTYVCEGG  240

Query  1135  KVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEP  956
             KVP +G +S+DI ++EGPRAFYRG+VPSLLGIIPYAGIDLA Y++ K  ++ YIL DSEP
Sbjct  241   KVPKIGAMSRDILVQEGPRAFYRGLVPSLLGIIPYAGIDLAAYESFKEMSKKYILHDSEP  300

Query  955   GPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGF  776
             GPLVQLG GT SGALGATCVYPLQVVRTRMQAQ  +T +AY GM DVF RTF+ EGLRGF
Sbjct  301   GPLVQLGCGTFSGALGATCVYPLQVVRTRMQAQCMNTESAYTGMSDVFKRTFKSEGLRGF  360

Query  775   YKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             YKGLF NLLKVVP+ASITY+VYE+MKK+L+L+
Sbjct  361   YKGLFSNLLKVVPSASITYMVYEAMKKSLELE  392



>ref|XP_008341210.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
isoform X2 [Malus domestica]
Length=439

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/413 (75%), Positives = 359/413 (87%), Gaps = 2/413 (0%)
 Frame = -1

Query  2116  CNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ  1937
             CNP+ K GPV+MDHVL AL ETKE+R++RIR+LF+FFD+ N GYLDYA IE GLSA+ I 
Sbjct  22    CNPIKKTGPVTMDHVLLALGETKEQRELRIRTLFNFFDTANVGYLDYAHIEAGLSALDIP  81

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
             + YK+A +LL V DAN+DGRVDY +F++YMDDKELELYRIFQAIDVEH+G ILPEELWDA
Sbjct  82    SQYKYANDLLNVCDANQDGRVDYQDFKRYMDDKELELYRIFQAIDVEHNGCILPEELWDA  141

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             LV+AGIEIDD+ELA FVE VDKDN+GVITFEEWRDFLLLYP EATIENIY YLERVCLVD
Sbjct  142   LVRAGIEIDDEELALFVERVDKDNNGVITFEEWRDFLLLYPQEATIENIYHYLERVCLVD  201

Query  1576  IGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS  1397
             IGEQ ++P   SKHVHAS+YLIAG VAGA SRTATAPLDRLKV+LQVQT RA IMPAVK 
Sbjct  202   IGEQTIVPGVTSKHVHASRYLIAGAVAGATSRTATAPLDRLKVILQVQTKRARIMPAVKD  261

Query  1396  IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEGDIGTSGRLIAG  1223
             IW+EGG+ GFFRGNG+NVLKVAPESAI+FYTYEMLK  I HA G  D+ ++ T+ RL++G
Sbjct  262   IWREGGLLGFFRGNGLNVLKVAPESAIRFYTYEMLKRFIVHANGEEDKANVSTATRLVSG  321

Query  1222  GLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLG  1043
             GLAGAVAQT +YPMDLVKTR+QTYT EG ++P L  LS+DIW++EGPRA Y+G+VPSLLG
Sbjct  322   GLAGAVAQTVVYPMDLVKTRIQTYTGEGRRIPSLXTLSRDIWVQEGPRAXYKGVVPSLLG  381

Query  1042  IIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQ  884
             I+PYAGIDLA Y+ LK+ ++ YI+ D EPG LVQLG GT+SGALGATCVYPLQ
Sbjct  382   IVPYAGIDLAAYETLKDMSKKYIVHDGEPGALVQLGCGTVSGALGATCVYPLQ  434


 Score = 91.7 bits (226),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 98/189 (52%), Gaps = 11/189 (6%)
 Frame = -1

Query  1252  IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAF  1073
             +  S  LIAG +AGA ++TA  P+D +K  LQ  T     +P +    KDIW   G   F
Sbjct  216   VHASRYLIAGAVAGATSRTATAPLDRLKVILQVQTKRARIMPAV----KDIWREGGLLGF  271

Query  1072  YRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPG--PLVQLGSGTISGALGATC  899
             +RG   ++L + P + I    Y+ LK F      ++ +       +L SG ++GA+  T 
Sbjct  272   FRGNGLNVLKVAPESAIRFYTYEMLKRFIVHANGEEDKANVSTATRLVSGGLAGAVAQTV  331

Query  898   VYPLQVVRTRMQAQPTHTSTAYK--GMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASI  725
             VYP+ +V+TR+Q   T+T    +   +  +    +  EG R  YKG+ P+LL +VP A I
Sbjct  332   VYPMDLVKTRIQ---TYTGEGRRIPSLXTLSRDIWVQEGPRAXYKGVVPSLLGIVPYAGI  388

Query  724   TYLVYESMK  698
                 YE++K
Sbjct  389   DLAAYETLK  397



>ref|XP_009378060.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
isoform X2 [Pyrus x bretschneideri]
Length=439

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/413 (75%), Positives = 359/413 (87%), Gaps = 2/413 (0%)
 Frame = -1

Query  2116  CNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ  1937
             CNP+ K GPVSMDHVL AL ETKE+R++RIR+LF+FFD+ N GYLDYA IE GLSA+ I 
Sbjct  22    CNPIKKTGPVSMDHVLLALGETKEQRELRIRTLFNFFDTANVGYLDYAHIEAGLSALDIP  81

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
             + YK+A +LL V DAN+DGRVDY +F++YMDDKELELYRIFQAIDVEH+G ILPEELWDA
Sbjct  82    SQYKYANDLLNVCDANRDGRVDYQDFKRYMDDKELELYRIFQAIDVEHNGCILPEELWDA  141

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             LV+AGIEIDD+ELA FVE VDKDN+GVITFEEWRDFLLLYP EATIENIY YLERVCLVD
Sbjct  142   LVRAGIEIDDEELALFVERVDKDNNGVITFEEWRDFLLLYPQEATIENIYHYLERVCLVD  201

Query  1576  IGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS  1397
             IGEQ ++P    KHVHAS+YLIAG VAGA SRTATAPLDRLKV+LQVQT RA IMPAVK 
Sbjct  202   IGEQTIVPGVTGKHVHASRYLIAGAVAGATSRTATAPLDRLKVILQVQTKRARIMPAVKD  261

Query  1396  IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEGDIGTSGRLIAG  1223
             IW+EGG+ GFFRGNG+NVLKVAPESAI+FYTYEMLK  I HA G  D+ ++ T+ RL++G
Sbjct  262   IWREGGLLGFFRGNGLNVLKVAPESAIRFYTYEMLKRFIVHANGEEDKANVSTATRLVSG  321

Query  1222  GLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLG  1043
             GLAGAVAQT +YPMDLVKTR+QTYT EG ++P L  LS+DIW++EGPRAFY+G+VPSLLG
Sbjct  322   GLAGAVAQTVVYPMDLVKTRIQTYTGEGRRIPSLRTLSRDIWVQEGPRAFYKGVVPSLLG  381

Query  1042  IIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQ  884
             I+PYAGIDLA Y+ +K+ ++ YI+ + EPG LVQLG GT+SGALGATCVYPLQ
Sbjct  382   IVPYAGIDLAAYETMKDMSKKYIVHEGEPGALVQLGCGTVSGALGATCVYPLQ  434


 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 100/192 (52%), Gaps = 17/192 (9%)
 Frame = -1

Query  1252  IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAF  1073
             +  S  LIAG +AGA ++TA  P+D +K  LQ  T     +P +    KDIW   G   F
Sbjct  216   VHASRYLIAGAVAGATSRTATAPLDRLKVILQVQTKRARIMPAV----KDIWREGGLLGF  271

Query  1072  YRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPG--PLVQLGSGTISGALGATC  899
             +RG   ++L + P + I    Y+ LK F      ++ +       +L SG ++GA+  T 
Sbjct  272   FRGNGLNVLKVAPESAIRFYTYEMLKRFIVHANGEEDKANVSTATRLVSGGLAGAVAQTV  331

Query  898   VYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFR-----HEGLRGFYKGLFPNLLKVVPA  734
             VYP+ +V+TR+Q   T+T    +G     LRT        EG R FYKG+ P+LL +VP 
Sbjct  332   VYPMDLVKTRIQ---TYTG---EGRRIPSLRTLSRDIWVQEGPRAFYKGVVPSLLGIVPY  385

Query  733   ASITYLVYESMK  698
             A I    YE+MK
Sbjct  386   AGIDLAAYETMK  397



>ref|XP_007032055.1| Mitochondrial substrate carrier family protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY02981.1| Mitochondrial substrate carrier family protein isoform 2, partial 
[Theobroma cacao]
Length=395

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/391 (81%), Positives = 354/391 (91%), Gaps = 2/391 (1%)
 Frame = -1

Query  2149  PAMTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQ  1970
             P    + R+  CNPV KPGPV+MDHVL AL+ETKEERD RIRSLF+FFDS NAG+LDYAQ
Sbjct  5     PTKAKEQRARGCNPVKKPGPVTMDHVLLALEETKEERDQRIRSLFNFFDSANAGFLDYAQ  64

Query  1969  IERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHS  1790
             IE GLSA+QI ++YK+AK+LL V DAN DGRVDY EFR+YMDDKELELYRIFQAIDVEH+
Sbjct  65    IEAGLSALQIPSEYKYAKDLLDVCDANMDGRVDYQEFRRYMDDKELELYRIFQAIDVEHN  124

Query  1789  GGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENI  1610
             G ILPEEL+DAL++AGIEIDD+ELA FVE VD+DN+GVITF+EWRDFLLLYPHEATIENI
Sbjct  125   GCILPEELYDALLRAGIEIDDEELALFVERVDQDNNGVITFKEWRDFLLLYPHEATIENI  184

Query  1609  YRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQT  1430
             Y YLERVCLVDIGEQAVIPEGISKHVHAS+YLIAGGVAGAASRTATAPLDRLKVVLQVQT
Sbjct  185   YHYLERVCLVDIGEQAVIPEGISKHVHASRYLIAGGVAGAASRTATAPLDRLKVVLQVQT  244

Query  1429  TRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEG  1256
             TRA IMPA++ IW+EGGI GFFRGNG+NVLKVAPESAIKFY YEMLK  I  AKG  D+ 
Sbjct  245   TRAHIMPAIRDIWREGGILGFFRGNGLNVLKVAPESAIKFYMYEMLKEFIIKAKGGKDKA  304

Query  1255  DIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRA  1076
             +IG +GRLIAGGLAGAV+QTAIYPMDLVKTRLQTY+CEGGK+P+LG LSKDIW++EGPRA
Sbjct  305   EIGAAGRLIAGGLAGAVSQTAIYPMDLVKTRLQTYSCEGGKIPNLGALSKDIWIQEGPRA  364

Query  1075  FYRGIVPSLLGIIPYAGIDLAVYDALKNFAR  983
             FYRG+VPSLLGIIPYAGIDLA Y+ LK+ ++
Sbjct  365   FYRGLVPSLLGIIPYAGIDLAAYETLKDMSK  395


 Score = 97.1 bits (240),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 104/193 (54%), Gaps = 19/193 (10%)
 Frame = -1

Query  1252  IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAF  1073
             +  S  LIAGG+AGA ++TA  P+D +K  LQ  T     +P +    +DIW   G   F
Sbjct  210   VHASRYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRAHIMPAI----RDIWREGGILGF  265

Query  1072  YRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQ------DSEPGPLVQLGSGTISGAL  911
             +RG   ++L + P + I   +Y+ LK F    I++       +E G   +L +G ++GA+
Sbjct  266   FRGNGLNVLKVAPESAIKFYMYEMLKEF----IIKAKGGKDKAEIGAAGRLIAGGLAGAV  321

Query  910   GATCVYPLQVVRTRMQAQPTHTSTAYK--GMFDVFLRTFRHEGLRGFYKGLFPNLLKVVP  737
               T +YP+ +V+TR+Q   T++    K   +  +    +  EG R FY+GL P+LL ++P
Sbjct  322   SQTAIYPMDLVKTRLQ---TYSCEGGKIPNLGALSKDIWIQEGPRAFYRGLVPSLLGIIP  378

Query  736   AASITYLVYESMK  698
              A I    YE++K
Sbjct  379   YAGIDLAAYETLK  391



>ref|XP_006574741.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Glycine max]
Length=438

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/414 (74%), Positives = 361/414 (87%), Gaps = 5/414 (1%)
 Frame = -1

Query  2089  VSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYK---FA  1919
              ++DH L A  E+ EER+ RIR+LF+FFD++N G+LD + IE GLSA+++ +D +   +A
Sbjct  14    TTLDHALLASGESAEERETRIRALFAFFDAENCGFLDCSAIESGLSALRMPSDSECCNYA  73

Query  1918  KELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGI  1739
             ++L    DANKDGRVDY EF++YMDDKELELYRIFQAIDVEHSG I PEEL  ALV+AGI
Sbjct  74    QDLFGACDANKDGRVDYEEFKRYMDDKELELYRIFQAIDVEHSGCISPEELSHALVRAGI  133

Query  1738  EIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAV  1559
             +IDD+ELARFVE VDKD++GVITF EWRDFLLLYPHEATIENIY YLERVCL+DIGEQ V
Sbjct  134   QIDDEELARFVERVDKDHNGVITFGEWRDFLLLYPHEATIENIYHYLERVCLIDIGEQTV  193

Query  1558  IPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGG  1379
             IP GISKH+HAS YLIAGGVAGAASRT TAPLDRLKVVLQVQTTRA +MPA+K IWKEGG
Sbjct  194   IPAGISKHIHASSYLIAGGVAGAASRTTTAPLDRLKVVLQVQTTRAHVMPAIKDIWKEGG  253

Query  1378  ISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGD--EGDIGTSGRLIAGGLAGAV  1205
               GFFRGNG+NVLKVAPESAI+FYTYEMLK  IG+AKG+  + D+GT GRL+AGG+AGAV
Sbjct  254   CLGFFRGNGLNVLKVAPESAIRFYTYEMLKAFIGNAKGEGAKADVGTMGRLLAGGMAGAV  313

Query  1204  AQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAG  1025
             AQTAIYP+DLVKTR+QTY CEGG++P LG LSKDIW++EGPRAFY+G++PS+LGI+PYAG
Sbjct  314   AQTAIYPLDLVKTRIQTYACEGGRLPSLGTLSKDIWVKEGPRAFYKGLIPSILGIVPYAG  373

Query  1024  IDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQ  863
             IDLA Y+ LK+ ++ YIL D EPGPLVQLG GT+SGALGATCVYPLQVVRTR+ 
Sbjct  374   IDLAAYETLKDMSKKYILLDEEPGPLVQLGCGTVSGALGATCVYPLQVVRTRLN  427


 Score = 97.8 bits (242),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 101/193 (52%), Gaps = 19/193 (10%)
 Frame = -1

Query  1252  IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAF  1073
             I  S  LIAGG+AGA ++T   P+D +K  LQ  T     +P +    KDIW   G   F
Sbjct  202   IHASSYLIAGGVAGAASRTTTAPLDRLKVVLQVQTTRAHVMPAI----KDIWKEGGCLGF  257

Query  1072  YRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQ--DSEPGPLVQLGSGTISGALGATC  899
             +RG   ++L + P + I    Y+ LK F      +   ++ G + +L +G ++GA+  T 
Sbjct  258   FRGNGLNVLKVAPESAIRFYTYEMLKAFIGNAKGEGAKADVGTMGRLLAGGMAGAVAQTA  317

Query  898   VYPLQVVRTRMQAQPTH------TSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVP  737
             +YPL +V+TR+Q             T  K   D++++    EG R FYKGL P++L +VP
Sbjct  318   IYPLDLVKTRIQTYACEGGRLPSLGTLSK---DIWVK----EGPRAFYKGLIPSILGIVP  370

Query  736   AASITYLVYESMK  698
              A I    YE++K
Sbjct  371   YAGIDLAAYETLK  383



>ref|XP_009122351.1| PREDICTED: LOW QUALITY PROTEIN: calcium-binding mitochondrial 
carrier protein SCaMC-1 [Brassica rapa]
Length=461

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/474 (70%), Positives = 390/474 (82%), Gaps = 15/474 (3%)
 Frame = -1

Query  2101  KPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKF  1922
             KP  V+M+HVL AL+E+ +ER++RIRSLF FFD+   G+LDYAQIE+GL+++QI  +YK+
Sbjct  3     KPASVTMEHVLLALRESNDEREMRIRSLFDFFDNSTLGFLDYAQIEKGLASLQIPPEYKY  62

Query  1921  AKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAG  1742
             A++L RV DAN+DGRVDY EFR+Y+D KELELY IFQAIDV H G I PEELW+ALVKAG
Sbjct  63    ARDLFRVCDANRDGRVDYHEFRRYIDAKELELYIIFQAIDVAHHGCIFPEELWEALVKAG  122

Query  1741  IEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQA  1562
             IEIDD+ELARFVEHVDKDN+G ITFEEWRDFLLLYPHEATIENIY + ERVCL+DIGE A
Sbjct  123   IEIDDEELARFVEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHHWERVCLIDIGEVA  182

Query  1561  VIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEG  1382
             VIP+GIS+HV  S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A ++  V     E 
Sbjct  183   VIPDGISQHVKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQREHAGVLSTV----XED  238

Query  1381  GISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVA  1202
              ++GFFRGNG+NV+KVAPESAIKF  +EMLK  IG      GDIGTSGRL+AGG+AGAVA
Sbjct  239   KLTGFFRGNGLNVMKVAPESAIKFCAFEMLKPLIGGEG--GGDIGTSGRLLAGGMAGAVA  296

Query  1201  QTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGI  1022
             QTAIY MDLVKTRLQ  TC  GK P L +L+KDIW+REGPRAFY+G+ PSLLGI+PYAGI
Sbjct  297   QTAIYLMDLVKTRLQ--TC--GKAPELWKLTKDIWVREGPRAFYKGLFPSLLGIVPYAGI  352

Query  1021  DLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTS  842
             DLA Y+ LK+ +RTYIL D+EPGPL+QL  G  SGALGA+CVYPLQVVRTRMQA  + T+
Sbjct  353   DLAAYETLKDLSRTYILHDTEPGPLIQLSCGMTSGALGASCVYPLQVVRTRMQADSSETT  412

Query  841   TAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
                  M   F+ T R EG+RGFY+GL PNLLKVVPAASITY+VYE+MKK + LD
Sbjct  413   -----MKQEFMNTMRGEGVRGFYRGLLPNLLKVVPAASITYIVYEAMKKNMALD  461



>ref|XP_010452691.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X2 [Camelina sativa]
Length=423

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/424 (73%), Positives = 366/424 (86%), Gaps = 3/424 (1%)
 Frame = -1

Query  2140  TAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIER  1961
             TAK + +  + V KP  V+M+HVL AL+ET +ER+IR+RSLF FFD+ N G+LDYAQIE+
Sbjct  3     TAKSKLKNRSTVKKPVSVTMEHVLLALRETMDEREIRVRSLFDFFDNSNLGFLDYAQIEK  62

Query  1960  GLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGI  1781
             GL+++QI  +YK+A++L RV DAN+DGRVDY EFR+Y+D KELELYRIFQAIDVEH+G I
Sbjct  63    GLASLQIPPEYKYARDLFRVCDANRDGRVDYHEFRRYIDAKELELYRIFQAIDVEHNGCI  122

Query  1780  LPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRY  1601
             LPEELW+ALVKAGIEIDD+ELARF+EHVDKDN+G ITFEEWRDFLLLYPHEATIENIY +
Sbjct  123   LPEELWEALVKAGIEIDDEELARFMEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHH  182

Query  1600  LERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA  1421
              ERVCL+DIGEQAVIP+GISKHV  S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A
Sbjct  183   WERVCLIDIGEQAVIPDGISKHVKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRAHA  242

Query  1420  SIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTS  1241
              ++P +K IW+E  + GFFRGNG+NV+KVAPESAIKF  YEMLK  IG   G++GDIGTS
Sbjct  243   GVLPTIKKIWREDKLRGFFRGNGLNVMKVAPESAIKFCAYEMLKPMIG---GEDGDIGTS  299

Query  1240  GRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGI  1061
             GRL+AGG+AGA+AQTAIYPMDLVKTRLQT   EGGK P L +L+KDIW+REGPRAFY+G+
Sbjct  300   GRLLAGGMAGAIAQTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGL  359

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQV  881
              PSLLGIIPYAGIDLA Y+ LK+ +RTYIL D+EPGPL+QL  G  SGALGA+CVYPLQV
Sbjct  360   FPSLLGIIPYAGIDLAAYETLKDLSRTYILHDTEPGPLIQLSCGMTSGALGASCVYPLQV  419

Query  880   VRTR  869
             VRTR
Sbjct  420   VRTR  423


 Score = 93.6 bits (231),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 93/173 (54%), Gaps = 14/173 (8%)
 Frame = -1

Query  1207  VAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYA  1028
             V++TA  P+D +K  LQ      G +P +    K IW  +  R F+RG   +++ + P +
Sbjct  220   VSRTATAPLDRLKVVLQVQRAHAGVLPTI----KKIWREDKLRGFFRGNGLNVMKVAPES  275

Query  1027  GIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTH  848
              I    Y+ LK        +D + G   +L +G ++GA+  T +YP+ +V+TR+Q   + 
Sbjct  276   AIKFCAYEMLKPMIGG---EDGDIGTSGRLLAGGMAGAIAQTAIYPMDLVKTRLQTCVSE  332

Query  847   TSTA---YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMK  698
                A   +K   D+++R    EG R FYKGLFP+LL ++P A I    YE++K
Sbjct  333   GGKAPKLWKLTKDIWVR----EGPRAFYKGLFPSLLGIIPYAGIDLAAYETLK  381



>emb|CDX86953.1| BnaC03g52230D [Brassica napus]
Length=477

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/478 (68%), Positives = 385/478 (81%), Gaps = 9/478 (2%)
 Frame = -1

Query  2113  NPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQA  1934
              P  KPG  +M+ VL AL ETKEERD+RIR LF FFDS   G+LD   IE+GL++++I  
Sbjct  9     TPSKKPGATTMEDVLVALHETKEERDLRIRRLFEFFDSSKLGFLDDTHIEKGLTSLRIPP  68

Query  1933  DYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDAL  1754
              YK+A++LLRV D+N+DGRVDY EFR+YMD KELELY IF+AIDVE +  I PEEL  AL
Sbjct  69    KYKYARDLLRVCDSNRDGRVDYEEFRRYMDAKELELYIIFKAIDVERNDDICPEELSQAL  128

Query  1753  VKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDI  1574
             VK+GIEI+D ELA F+EHVDKD +G ITF+EWRDFLLL+PHEAT+ENIY + ERVCL+DI
Sbjct  129   VKSGIEIEDKELASFMEHVDKDKNGTITFQEWRDFLLLHPHEATVENIYHHWERVCLIDI  188

Query  1573  GEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSI  1394
             GEQ VIP+GISKH   SK L+AGG+AGA SRTATAPLDRLKVVLQVQ T++ ++P +K I
Sbjct  189   GEQPVIPDGISKHAQRSKLLLAGGLAGAVSRTATAPLDRLKVVLQVQRTKSGVVPTIKKI  248

Query  1393  WKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLA  1214
             W+E  + GFFRGNG+NV KVAPESAIKF  YEMLK  IG   G+    GT GRL+AGGLA
Sbjct  249   WREDKLLGFFRGNGLNVTKVAPESAIKFAAYEMLKPIIGGGDGEI---GTKGRLLAGGLA  305

Query  1213  GAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
             GAVAQTAIYPMDLVKTRLQT   E GK P+L +L+K+IW++EGPRAFY+G+ PSLLGIIP
Sbjct  306   GAVAQTAIYPMDLVKTRLQTCVSELGKTPNLLKLTKEIWMQEGPRAFYKGLYPSLLGIIP  365

Query  1033  YAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQP  854
             YAGIDLA Y+ LK+F+RTYI  D EPGPLVQLG G  SGALGA+CVYPLQVVRTRMQA  
Sbjct  366   YAGIDLAAYETLKDFSRTYIHHD-EPGPLVQLGCGMTSGALGASCVYPLQVVRTRMQADS  424

Query  853   THTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
               TS     M   FL+T + EG+RGFY+G+FPNL KV+P+ASI+YLVYE+MKK L LD
Sbjct  425   AKTS-----MRQEFLKTLKGEGVRGFYRGIFPNLFKVIPSASISYLVYEAMKKNLALD  477



>emb|CDY00231.1| BnaA06g21320D [Brassica napus]
Length=477

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/478 (68%), Positives = 384/478 (80%), Gaps = 9/478 (2%)
 Frame = -1

Query  2113  NPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQA  1934
              P  K G  +M+ VL AL ETKEERD+RIR LF FFDS   G+LD   IE+GL++++I  
Sbjct  9     TPAKKHGATTMEDVLVALHETKEERDLRIRRLFEFFDSSKLGFLDDTHIEKGLTSLRIPP  68

Query  1933  DYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDAL  1754
              YK+A++LLRV D+N+DGRVDY EFR+YMD KELELY IFQAIDVE +  I P+EL  AL
Sbjct  69    KYKYARDLLRVCDSNRDGRVDYEEFRRYMDAKELELYIIFQAIDVERNDDICPDELSQAL  128

Query  1753  VKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDI  1574
             VK+GIEI+D ELA F+EHVDKD +G ITF+EWRDFLLL+PHEAT+ENIY + ERVCL+DI
Sbjct  129   VKSGIEIEDKELASFMEHVDKDKNGTITFQEWRDFLLLHPHEATVENIYHHWERVCLIDI  188

Query  1573  GEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSI  1394
             GEQ VIP+GISKH   SK L+AGG+AGA SRTATAPLDRLKVVLQVQ T++ ++P +K I
Sbjct  189   GEQPVIPDGISKHAQRSKLLLAGGLAGAVSRTATAPLDRLKVVLQVQRTKSGVVPTIKKI  248

Query  1393  WKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLA  1214
             W+E  + GFFRGNG+NV KVAPESAIKF  YEMLK  IG   G+    GT GRL+AGGLA
Sbjct  249   WREDKLLGFFRGNGLNVTKVAPESAIKFAAYEMLKPIIGGGDGEI---GTKGRLLAGGLA  305

Query  1213  GAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
             GAVAQTAIYPMDLVKTRLQT   E GK P+L +L+K+IW++EGPRAFY+G+ PSLLGIIP
Sbjct  306   GAVAQTAIYPMDLVKTRLQTCVSELGKTPNLLKLTKEIWVQEGPRAFYKGLYPSLLGIIP  365

Query  1033  YAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQP  854
             YAGIDLA Y+ LK+F+RTYI  D EPGPLVQLG G  SGALGA+CVYPLQVVRTRMQA  
Sbjct  366   YAGIDLAAYETLKDFSRTYIHHD-EPGPLVQLGCGMTSGALGASCVYPLQVVRTRMQADS  424

Query  853   THTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
               TS     M   FL+T + EG+RGFY+G+FPNL KV+P+ASI+YLVYE+MKK L LD
Sbjct  425   AKTS-----MSQEFLKTLKGEGVRGFYRGIFPNLFKVIPSASISYLVYEAMKKNLALD  477



>ref|XP_009150121.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
[Brassica rapa]
Length=477

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/478 (68%), Positives = 383/478 (80%), Gaps = 9/478 (2%)
 Frame = -1

Query  2113  NPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQA  1934
              P  K G  +M+ VL AL ETKEERD+RIR LF FFDS   G+LD   IE+GL++++I  
Sbjct  9     TPAKKHGATTMEDVLVALHETKEERDLRIRRLFEFFDSSKLGFLDDTHIEKGLTSLRIPP  68

Query  1933  DYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDAL  1754
              YK+A++LLRV D+N+DGRVDY EFR+YMD KELELY IFQAIDVE +  I P+EL  AL
Sbjct  69    KYKYARDLLRVCDSNRDGRVDYEEFRRYMDAKELELYIIFQAIDVERNDDICPDELSQAL  128

Query  1753  VKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDI  1574
              K+GIEI+D ELA F+EHVDKD +G ITF+EWRDFLLL+PHEAT+ENIY + ERVCL+DI
Sbjct  129   AKSGIEIEDKELASFMEHVDKDKNGTITFQEWRDFLLLHPHEATVENIYHHWERVCLIDI  188

Query  1573  GEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSI  1394
             GEQ VIP+GISKH   SK L+AGG+AGA SRTATAPLDRLKVVLQVQ T++ ++P +K I
Sbjct  189   GEQPVIPDGISKHAQRSKLLLAGGLAGAVSRTATAPLDRLKVVLQVQRTKSGVVPTIKKI  248

Query  1393  WKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLA  1214
             W+E  + GFFRGNG+NV KVAPESAIKF  YEMLK  IG   G+    GT GRL+AGGLA
Sbjct  249   WREDKLLGFFRGNGLNVTKVAPESAIKFAAYEMLKPIIGGGDGEI---GTKGRLLAGGLA  305

Query  1213  GAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
             GAVAQTAIYPMDLVKTRLQT   E GK P+L +L+K+IW++EGPRAFY+G+ PSLLGIIP
Sbjct  306   GAVAQTAIYPMDLVKTRLQTCVSELGKTPNLLKLTKEIWVQEGPRAFYKGLYPSLLGIIP  365

Query  1033  YAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQP  854
             YAGIDLA Y+ LK+F+RTYI  D EPGPLVQLG G  SGALGA+CVYPLQVVRTRMQA  
Sbjct  366   YAGIDLAAYETLKDFSRTYIHHD-EPGPLVQLGCGMTSGALGASCVYPLQVVRTRMQADS  424

Query  853   THTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
               TS     M   FL+T + EG+RGFY+G+FPNL KV+P+ASI+YLVYE+MKK L LD
Sbjct  425   AKTS-----MSQEFLKTLKGEGVRGFYRGIFPNLFKVIPSASISYLVYEAMKKNLALD  477



>ref|XP_006287635.1| hypothetical protein CARUB_v10000847mg [Capsella rubella]
 gb|EOA20533.1| hypothetical protein CARUB_v10000847mg [Capsella rubella]
Length=423

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/424 (73%), Positives = 364/424 (86%), Gaps = 3/424 (1%)
 Frame = -1

Query  2140  TAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIER  1961
             TAK + +  + + K   V+M+HVL AL+ET +ER+IRIRSLF FFD+ N G+LDYAQIE+
Sbjct  3     TAKAKPKNRSSMKKHVSVTMEHVLLALRETMDEREIRIRSLFDFFDNSNLGFLDYAQIEK  62

Query  1960  GLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGI  1781
             GL+++QI  +YK+A++L RV DAN+DGRVDY EFR+Y+D KELELYRIFQAIDVEH+G I
Sbjct  63    GLASLQIPPEYKYARDLFRVCDANRDGRVDYHEFRRYIDAKELELYRIFQAIDVEHNGCI  122

Query  1780  LPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRY  1601
             LPEELW+ALVKAGIEIDD+ELARFVEHVDKDN+G ITFEEWRDFLLLYPHEATIENIY +
Sbjct  123   LPEELWEALVKAGIEIDDEELARFVEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHH  182

Query  1600  LERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA  1421
              ERVCL+DIGEQAVIP+GISKH   S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A
Sbjct  183   WERVCLIDIGEQAVIPDGISKHGKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRVHA  242

Query  1420  SIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTS  1241
              ++P +K IW+E  ++GFFRGNG+NV+KVAPESAIKF  YEMLK  IG   G++GDIGTS
Sbjct  243   GVLPTIKKIWREDKLTGFFRGNGLNVMKVAPESAIKFCAYEMLKPMIG---GEDGDIGTS  299

Query  1240  GRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGI  1061
             GRL+AGG+AGA+AQTAIYPMDLVKTRLQT   EGGK P L +L+KDIW+REGPRAFY+G+
Sbjct  300   GRLLAGGMAGALAQTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGL  359

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQV  881
              PSLLGIIPYAGIDLA Y+  K+ +RTYIL D+EPGPL+QL  G  SGALGA+CVYPLQV
Sbjct  360   FPSLLGIIPYAGIDLAAYETFKDLSRTYILHDTEPGPLIQLSCGMTSGALGASCVYPLQV  419

Query  880   VRTR  869
             VRTR
Sbjct  420   VRTR  423


 Score = 90.9 bits (224),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 91/173 (53%), Gaps = 14/173 (8%)
 Frame = -1

Query  1207  VAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYA  1028
             V++TA  P+D +K  LQ      G +P +    K IW  +    F+RG   +++ + P +
Sbjct  220   VSRTATAPLDRLKVVLQVQRVHAGVLPTI----KKIWREDKLTGFFRGNGLNVMKVAPES  275

Query  1027  GIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTH  848
              I    Y+ LK        +D + G   +L +G ++GAL  T +YP+ +V+TR+Q   + 
Sbjct  276   AIKFCAYEMLKPMIGG---EDGDIGTSGRLLAGGMAGALAQTAIYPMDLVKTRLQTCVSE  332

Query  847   TSTA---YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMK  698
                A   +K   D+++R    EG R FYKGLFP+LL ++P A I    YE+ K
Sbjct  333   GGKAPKLWKLTKDIWVR----EGPRAFYKGLFPSLLGIIPYAGIDLAAYETFK  381



>ref|XP_010452692.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X3 [Camelina sativa]
Length=422

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/419 (73%), Positives = 361/419 (86%), Gaps = 3/419 (1%)
 Frame = -1

Query  2140  TAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIER  1961
             TAK + +  + V KP  V+M+HVL AL+ET +ER+IR+RSLF FFD+ N G+LDYAQIE+
Sbjct  3     TAKSKLKNRSTVKKPVSVTMEHVLLALRETMDEREIRVRSLFDFFDNSNLGFLDYAQIEK  62

Query  1960  GLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGI  1781
             GL+++QI  +YK+A++L RV DAN+DGRVDY EFR+Y+D KELELYRIFQAIDVEH+G I
Sbjct  63    GLASLQIPPEYKYARDLFRVCDANRDGRVDYHEFRRYIDAKELELYRIFQAIDVEHNGCI  122

Query  1780  LPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRY  1601
             LPEELW+ALVKAGIEIDD+ELARF+EHVDKDN+G ITFEEWRDFLLLYPHEATIENIY +
Sbjct  123   LPEELWEALVKAGIEIDDEELARFMEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHH  182

Query  1600  LERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA  1421
              ERVCL+DIGEQAVIP+GISKHV  S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A
Sbjct  183   WERVCLIDIGEQAVIPDGISKHVKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRAHA  242

Query  1420  SIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTS  1241
              ++P +K IW+E  + GFFRGNG+NV+KVAPESAIKF  YEMLK  IG   G++GDIGTS
Sbjct  243   GVLPTIKKIWREDKLRGFFRGNGLNVMKVAPESAIKFCAYEMLKPMIG---GEDGDIGTS  299

Query  1240  GRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGI  1061
             GRL+AGG+AGA+AQTAIYPMDLVKTRLQT   EGGK P L +L+KDIW+REGPRAFY+G+
Sbjct  300   GRLLAGGMAGAIAQTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGL  359

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQ  884
              PSLLGIIPYAGIDLA Y+ LK+ +RTYIL D+EPGPL+QL  G  SGALGA+CVYPLQ
Sbjct  360   FPSLLGIIPYAGIDLAAYETLKDLSRTYILHDTEPGPLIQLSCGMTSGALGASCVYPLQ  418


 Score = 93.6 bits (231),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 93/173 (54%), Gaps = 14/173 (8%)
 Frame = -1

Query  1207  VAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYA  1028
             V++TA  P+D +K  LQ      G +P +    K IW  +  R F+RG   +++ + P +
Sbjct  220   VSRTATAPLDRLKVVLQVQRAHAGVLPTI----KKIWREDKLRGFFRGNGLNVMKVAPES  275

Query  1027  GIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTH  848
              I    Y+ LK        +D + G   +L +G ++GA+  T +YP+ +V+TR+Q   + 
Sbjct  276   AIKFCAYEMLKPMIGG---EDGDIGTSGRLLAGGMAGAIAQTAIYPMDLVKTRLQTCVSE  332

Query  847   TSTA---YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMK  698
                A   +K   D+++R    EG R FYKGLFP+LL ++P A I    YE++K
Sbjct  333   GGKAPKLWKLTKDIWVR----EGPRAFYKGLFPSLLGIIPYAGIDLAAYETLK  381



>ref|XP_010423227.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Camelina sativa]
Length=422

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/419 (73%), Positives = 362/419 (86%), Gaps = 3/419 (1%)
 Frame = -1

Query  2140  TAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIER  1961
             TAK + +  + V KP  V+M+HVL AL+ET +ER+IR+RSLF FFD+ N G+LDYAQIE+
Sbjct  3     TAKSKLKNRSTVKKPVSVTMEHVLLALRETMDEREIRVRSLFDFFDNSNLGFLDYAQIEK  62

Query  1960  GLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGI  1781
             GL+++QI  +YK+A++L RV DAN+DGRVDY EFR+Y+D KELELYRIFQAIDVEH+G I
Sbjct  63    GLASLQIPPEYKYARDLFRVCDANRDGRVDYHEFRRYIDAKELELYRIFQAIDVEHNGCI  122

Query  1780  LPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRY  1601
             LPEELW+ALVKAGIEIDD+ELARF+EHVDKDN+G ITFEEWRDFLLLYPHEATIENIY++
Sbjct  123   LPEELWEALVKAGIEIDDEELARFMEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYQH  182

Query  1600  LERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA  1421
              ERVCL+DIGEQAVIP+GISKHV  S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A
Sbjct  183   WERVCLIDIGEQAVIPDGISKHVKRSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRAHA  242

Query  1420  SIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTS  1241
              ++P +K IW+E  + GFFRGNG+NV+KVAPESAIKF  YEMLK  IG   G++GDIGTS
Sbjct  243   GVLPTIKKIWREDNLRGFFRGNGLNVMKVAPESAIKFCAYEMLKPMIG---GEDGDIGTS  299

Query  1240  GRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGI  1061
             GRL+AGG+AGA+AQTAIYPMDLVKTRLQT   EGGK P L +L++DIW+REGPRAFY+G+
Sbjct  300   GRLLAGGMAGAIAQTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTQDIWVREGPRAFYKGL  359

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQ  884
              PSLLGIIPYAGIDLA Y+ LK+ +RTYIL D+EPGPL+QL  G  SGALGA+CVYPLQ
Sbjct  360   FPSLLGIIPYAGIDLAAYETLKDLSRTYILHDTEPGPLIQLSCGMTSGALGASCVYPLQ  418


 Score = 94.4 bits (233),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 93/173 (54%), Gaps = 14/173 (8%)
 Frame = -1

Query  1207  VAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYA  1028
             V++TA  P+D +K  LQ      G +P +    K IW  +  R F+RG   +++ + P +
Sbjct  220   VSRTATAPLDRLKVVLQVQRAHAGVLPTI----KKIWREDNLRGFFRGNGLNVMKVAPES  275

Query  1027  GIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTH  848
              I    Y+ LK        +D + G   +L +G ++GA+  T +YP+ +V+TR+Q   + 
Sbjct  276   AIKFCAYEMLKPMIGG---EDGDIGTSGRLLAGGMAGAIAQTAIYPMDLVKTRLQTCVSE  332

Query  847   TSTA---YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMK  698
                A   +K   D+++R    EG R FYKGLFP+LL ++P A I    YE++K
Sbjct  333   GGKAPKLWKLTQDIWVR----EGPRAFYKGLFPSLLGIIPYAGIDLAAYETLK  381



>ref|XP_008677345.1| PREDICTED: LOC100284813 isoform X1 [Zea mays]
Length=472

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/430 (71%), Positives = 359/430 (83%), Gaps = 12/430 (3%)
 Frame = -1

Query  2119  CCNPVMKPGP-VSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQ  1943
             C  P    GP  +M+HVL AL+ET+ ER+ RIR +F FFD+   G+L++AQI  GL A++
Sbjct  42    CGGPARASGPEATMEHVLLALRETEAEREARIRGVFGFFDAAGQGHLEHAQITAGLIALR  101

Query  1942  IQADYK--------FAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSG  1787
             +  +          +A+ LLR  D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G
Sbjct  102   VPEETSGAGAEAEDYARALLRACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNG  161

Query  1786  GILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIY  1607
              ILPEELW ALVKAGIEIDD+ELARFVEHVDKDNDG+ITFEEWRDFLLLYPHEAT+ENIY
Sbjct  162   CILPEELWHALVKAGIEIDDEELARFVEHVDKDNDGIITFEEWRDFLLLYPHEATMENIY  221

Query  1606  RYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTT  1427
              + ERVCLVDIGEQA IPEGI+KHV ASKYLIAGG+AGAASRTATAPLDRLKV +QVQT 
Sbjct  222   HHWERVCLVDIGEQAAIPEGINKHVSASKYLIAGGIAGAASRTATAPLDRLKVNMQVQTN  281

Query  1426  RASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDI  1250
               +++  VK IW+EGG+ GFFRGNG+NV+KVAPESAI+FYTYEMLK  I  +KG ++GDI
Sbjct  282   CIAVVDVVKGIWREGGLLGFFRGNGLNVVKVAPESAIRFYTYEMLKEYIMKSKGENKGDI  341

Query  1249  GTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFY  1070
             GTSGRL+AGGLAGA+AQT IYPMDLVKTRLQTY  EGG++P LG LS+DIW  EGPRAFY
Sbjct  342   GTSGRLMAGGLAGAIAQTVIYPMDLVKTRLQTY--EGGRIPSLGALSRDIWTHEGPRAFY  399

Query  1069  RGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYP  890
             RG+VPSLLG++PYAGIDL VY+ LK  +RTY L D +PGPLVQLG GT+SGALGATCVYP
Sbjct  400   RGLVPSLLGMVPYAGIDLTVYETLKEMSRTYALVDKDPGPLVQLGCGTVSGALGATCVYP  459

Query  889   LQVVRTRMQA  860
             LQV+RTRMQA
Sbjct  460   LQVIRTRMQA  469


 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 102/193 (53%), Gaps = 8/193 (4%)
 Frame = -1

Query  1270  KGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLR  1091
             +G    +  S  LIAGG+AGA ++TA  P+D +K  +Q  T        +  + K IW  
Sbjct  240   EGINKHVSASKYLIAGGIAGAASRTATAPLDRLKVNMQVQT----NCIAVVDVVKGIWRE  295

Query  1090  EGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNF-ARTYILQDSEPGPLVQLGSGTISGA  914
              G   F+RG   +++ + P + I    Y+ LK +  ++      + G   +L +G ++GA
Sbjct  296   GGLLGFFRGNGLNVVKVAPESAIRFYTYEMLKEYIMKSKGENKGDIGTSGRLMAGGLAGA  355

Query  913   LGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPA  734
             +  T +YP+ +V+TR+Q   T+       +  +    + HEG R FY+GL P+LL +VP 
Sbjct  356   IAQTVIYPMDLVKTRLQ---TYEGGRIPSLGALSRDIWTHEGPRAFYRGLVPSLLGMVPY  412

Query  733   ASITYLVYESMKK  695
             A I   VYE++K+
Sbjct  413   AGIDLTVYETLKE  425



>gb|AFW66147.1| hypothetical protein ZEAMMB73_421477 [Zea mays]
Length=466

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/427 (71%), Positives = 356/427 (83%), Gaps = 12/427 (3%)
 Frame = -1

Query  2119  CCNPVMKPGP-VSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQ  1943
             C  P    GP  +M+HVL AL+ET+ ER+ RIR +F FFD+   G+L++AQI  GL A++
Sbjct  42    CGGPARASGPEATMEHVLLALRETEAEREARIRGVFGFFDAAGQGHLEHAQITAGLIALR  101

Query  1942  IQADYK--------FAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSG  1787
             +  +          +A+ LLR  D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G
Sbjct  102   VPEETSGAGAEAEDYARALLRACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNG  161

Query  1786  GILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIY  1607
              ILPEELW ALVKAGIEIDD+ELARFVEHVDKDNDG+ITFEEWRDFLLLYPHEAT+ENIY
Sbjct  162   CILPEELWHALVKAGIEIDDEELARFVEHVDKDNDGIITFEEWRDFLLLYPHEATMENIY  221

Query  1606  RYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTT  1427
              + ERVCLVDIGEQA IPEGI+KHV ASKYLIAGG+AGAASRTATAPLDRLKV +QVQT 
Sbjct  222   HHWERVCLVDIGEQAAIPEGINKHVSASKYLIAGGIAGAASRTATAPLDRLKVNMQVQTN  281

Query  1426  RASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDI  1250
               +++  VK IW+EGG+ GFFRGNG+NV+KVAPESAI+FYTYEMLK  I  +KG ++GDI
Sbjct  282   CIAVVDVVKGIWREGGLLGFFRGNGLNVVKVAPESAIRFYTYEMLKEYIMKSKGENKGDI  341

Query  1249  GTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFY  1070
             GTSGRL+AGGLAGA+AQT IYPMDLVKTRLQTY  EGG++P LG LS+DIW  EGPRAFY
Sbjct  342   GTSGRLMAGGLAGAIAQTVIYPMDLVKTRLQTY--EGGRIPSLGALSRDIWTHEGPRAFY  399

Query  1069  RGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYP  890
             RG+VPSLLG++PYAGIDL VY+ LK  +RTY L D +PGPLVQLG GT+SGALGATCVYP
Sbjct  400   RGLVPSLLGMVPYAGIDLTVYETLKEMSRTYALVDKDPGPLVQLGCGTVSGALGATCVYP  459

Query  889   LQVVRTR  869
             LQV+RTR
Sbjct  460   LQVIRTR  466


 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 102/193 (53%), Gaps = 8/193 (4%)
 Frame = -1

Query  1270  KGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLR  1091
             +G    +  S  LIAGG+AGA ++TA  P+D +K  +Q  T        +  + K IW  
Sbjct  240   EGINKHVSASKYLIAGGIAGAASRTATAPLDRLKVNMQVQT----NCIAVVDVVKGIWRE  295

Query  1090  EGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNF-ARTYILQDSEPGPLVQLGSGTISGA  914
              G   F+RG   +++ + P + I    Y+ LK +  ++      + G   +L +G ++GA
Sbjct  296   GGLLGFFRGNGLNVVKVAPESAIRFYTYEMLKEYIMKSKGENKGDIGTSGRLMAGGLAGA  355

Query  913   LGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPA  734
             +  T +YP+ +V+TR+Q   T+       +  +    + HEG R FY+GL P+LL +VP 
Sbjct  356   IAQTVIYPMDLVKTRLQ---TYEGGRIPSLGALSRDIWTHEGPRAFYRGLVPSLLGMVPY  412

Query  733   ASITYLVYESMKK  695
             A I   VYE++K+
Sbjct  413   AGIDLTVYETLKE  425



>gb|KEH23501.1| substrate carrier family protein [Medicago truncatula]
Length=421

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/415 (72%), Positives = 352/415 (85%), Gaps = 5/415 (1%)
 Frame = -1

Query  2128  RSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSA  1949
             + E  NPV KPGPV+MDHVL A QETKEERD RIRS+F+FFD +N GYL+++ IE G  A
Sbjct  3     KEERTNPVKKPGPVTMDHVLLASQETKEERDERIRSIFAFFDKENRGYLEFSHIEAGYLA  62

Query  1948  MQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEE  1769
             ++I ++YK+A +LL   D NKDGRVD+ EF+KYMDDKELELYRIFQAIDVEH+GGILPEE
Sbjct  63    LEIPSEYKYATDLLNACDVNKDGRVDFVEFKKYMDDKELELYRIFQAIDVEHNGGILPEE  122

Query  1768  LWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERV  1589
             LW+ALV+AGI+IDD+ELA FVE VDKD++GVITFEEWRDFLLLYPHEATIENIY YLER+
Sbjct  123   LWEALVRAGIKIDDEELAHFVERVDKDHNGVITFEEWRDFLLLYPHEATIENIYHYLERI  182

Query  1588  CLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMP  1409
             C+VDIGE  VIP G+ KHVHA +YLIAGGVAGAASRTATAPLDRLKVVLQVQTT A IMP
Sbjct  183   CMVDIGEHTVIPAGVGKHVHAYRYLIAGGVAGAASRTATAPLDRLKVVLQVQTTSARIMP  242

Query  1408  AVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE--GDIGTSGR  1235
             AVK++WKEGG+ GFFRGNG+NVLKVAPESAI+FYTYEM+K  I  AKG E   DIG  GR
Sbjct  243   AVKTLWKEGGLVGFFRGNGLNVLKVAPESAIRFYTYEMMKTFIVDAKGGEEKADIGGMGR  302

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVP  1055
             L+AGG+AGAVAQT IYPMDLVKTRLQTYT   GK+P LG LSKDIW++EGPRAFYRG++P
Sbjct  303   LLAGGIAGAVAQTLIYPMDLVKTRLQTYTHASGKIPSLGTLSKDIWVQEGPRAFYRGLIP  362

Query  1054  SLLGIIPYAGIDLAVYDALKNFARTYILQD-SEPGPLVQLGSGTISGALGATCVY  893
             S++GIIPYAGIDLA Y+ LK  ++ YI+Q+  +   L+ L S ++SG +  +CV+
Sbjct  363   SIVGIIPYAGIDLAAYETLKEMSKKYIIQEGGKNNKLICLLS-SVSG-IAFSCVF  415


 Score = 96.7 bits (239),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 102/186 (55%), Gaps = 15/186 (8%)
 Frame = -1

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVP  1055
             LIAGG+AGA ++TA  P+D +K  LQ  T     +P +    K +W   G   F+RG   
Sbjct  207   LIAGGVAGAASRTATAPLDRLKVVLQVQTTSARIMPAV----KTLWKEGGLVGFFRGNGL  262

Query  1054  SLLGIIPYAGIDLAVYDALKNFARTYIL------QDSEPGPLVQLGSGTISGALGATCVY  893
             ++L + P + I    Y+ +K    T+I+      + ++ G + +L +G I+GA+  T +Y
Sbjct  263   NVLKVAPESAIRFYTYEMMK----TFIVDAKGGEEKADIGGMGRLLAGGIAGAVAQTLIY  318

Query  892   PLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLV  713
             P+ +V+TR+Q   TH S     +  +    +  EG R FY+GL P+++ ++P A I    
Sbjct  319   PMDLVKTRLQTY-THASGKIPSLGTLSKDIWVQEGPRAFYRGLIPSIVGIIPYAGIDLAA  377

Query  712   YESMKK  695
             YE++K+
Sbjct  378   YETLKE  383



>ref|XP_006366294.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
[Solanum tuberosum]
Length=375

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/358 (83%), Positives = 326/358 (91%), Gaps = 7/358 (2%)
 Frame = -1

Query  1747  AGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGE  1568
             AGIE+DDDELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY+YLERVCLVDIGE
Sbjct  23    AGIELDDDELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYQYLERVCLVDIGE  82

Query  1567  QAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWK  1388
             Q VIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKV+LQVQTT ASI PAVKSIWK
Sbjct  83    QTVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVILQVQTTHASIGPAVKSIWK  142

Query  1387  EGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEGDIGTSGRLIAGGLA  1214
             EGG+ GFFRGNG+NVLKVAPESAIKFY YE LKNAIG A+G  D+ DIGTSGRL+AGG+A
Sbjct  143   EGGLLGFFRGNGLNVLKVAPESAIKFYAYETLKNAIGRARGVEDQRDIGTSGRLMAGGMA  202

Query  1213  GAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
             GA+AQTAIYPMDLVKTRLQT++CE G VP L +LSKDI+++EGPRAFYRG+VPSLLGIIP
Sbjct  203   GAIAQTAIYPMDLVKTRLQTHSCESGSVPSLRKLSKDIFIQEGPRAFYRGLVPSLLGIIP  262

Query  1033  YAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQP  854
             YAGIDLA Y+ LK+ ++ YIL DSE GPLVQLG GTISGALGATCVYPLQV+RTRMQA  
Sbjct  263   YAGIDLAAYETLKDLSKVYILHDSEAGPLVQLGCGTISGALGATCVYPLQVIRTRMQAD-  321

Query  853   THTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
                 +AYKGM DVF +T + EG RGFYKGLFPNLLKVVPAASITYLVYESMKK+LDLD
Sbjct  322   ----SAYKGMADVFRKTVQREGFRGFYKGLFPNLLKVVPAASITYLVYESMKKSLDLD  375



>ref|XP_010663818.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X3 [Vitis vinifera]
Length=357

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/356 (81%), Positives = 327/356 (92%), Gaps = 1/356 (0%)
 Frame = -1

Query  1744  GIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQ  1565
             GIEIDD+ELARFVE+VDKDN+G+ITFEEWRDFLLLYPHEATIENIY+Y  RVCLVDIGEQ
Sbjct  2     GIEIDDEELARFVENVDKDNNGIITFEEWRDFLLLYPHEATIENIYQYWGRVCLVDIGEQ  61

Query  1564  AVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKE  1385
             AVIPEGISKHVHASKYL+AGGVAGAASRTATAPLDRLKVVLQVQTT A I+PA+K+IWKE
Sbjct  62    AVIPEGISKHVHASKYLLAGGVAGAASRTATAPLDRLKVVLQVQTTHARIVPAIKNIWKE  121

Query  1384  GGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGD-EGDIGTSGRLIAGGLAGA  1208
             GG+ GFFRGNG+NV+KVAPESAIKFYTYEM KN +  AKG+ + DIG +GRL AGG+AGA
Sbjct  122   GGLLGFFRGNGLNVVKVAPESAIKFYTYEMFKNVVRDAKGEAKDDIGAAGRLFAGGMAGA  181

Query  1207  VAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYA  1028
             VAQTAIYP+DLVKTRLQTYTCEGGKVP+L  L+++IW +EGP+ FYRG+VPS+LGIIPYA
Sbjct  182   VAQTAIYPLDLVKTRLQTYTCEGGKVPYLKTLARNIWFQEGPQGFYRGLVPSVLGIIPYA  241

Query  1027  GIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTH  848
             GIDLA Y+ LK+ ++TY+L DSEPGPLVQLGSGTISGALGATCVYPLQV+RTRMQAQ T+
Sbjct  242   GIDLAAYETLKDMSKTYLLHDSEPGPLVQLGSGTISGALGATCVYPLQVIRTRMQAQRTN  301

Query  847   TSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             T  +Y GM DVF RT +HEG RGFYKGLFPNLLKVVP+ASITYLVYE+MKK+LDLD
Sbjct  302   TDASYNGMSDVFRRTLQHEGFRGFYKGLFPNLLKVVPSASITYLVYETMKKSLDLD  357



>ref|XP_010322634.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
isoform X2 [Solanum lycopersicum]
Length=371

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/358 (83%), Positives = 326/358 (91%), Gaps = 7/358 (2%)
 Frame = -1

Query  1747  AGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGE  1568
             AGIE+DDDELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY+YLERVCLVDIGE
Sbjct  19    AGIELDDDELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYQYLERVCLVDIGE  78

Query  1567  QAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWK  1388
             Q VIPEGISKHVHASKYLIAGGVAGAASRTATAPLDR+KV+LQVQTT ASI PAVKSIWK
Sbjct  79    QTVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRVKVILQVQTTHASIGPAVKSIWK  138

Query  1387  EGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEGDIGTSGRLIAGGLA  1214
             EGG+ GFFRGNG+NVLKVAPESAIKFY YE LKNAIG A+G  D+ DIGTSGRL+AGG+A
Sbjct  139   EGGLLGFFRGNGLNVLKVAPESAIKFYAYETLKNAIGRARGVEDQRDIGTSGRLVAGGMA  198

Query  1213  GAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
             GA+AQTAIYPMDLVKTRLQT++CE G VP L +LSKDI+++EGPRAFYRG+VPSLLGIIP
Sbjct  199   GAIAQTAIYPMDLVKTRLQTHSCESGSVPSLRKLSKDIFIQEGPRAFYRGLVPSLLGIIP  258

Query  1033  YAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQP  854
             YAGIDLA Y+ LK+ ++ YIL DSE GPLVQLG GTISGALGATCVYPLQV+RTRMQA  
Sbjct  259   YAGIDLAAYETLKDLSKVYILHDSEAGPLVQLGCGTISGALGATCVYPLQVIRTRMQA--  316

Query  853   THTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
                 +AY+GM DVF +T + EG RGFYKGLFPNLLKVVPAASITYLVYESMKK+LDLD
Sbjct  317   ---DSAYQGMADVFRKTVQREGFRGFYKGLFPNLLKVVPAASITYLVYESMKKSLDLD  371



>ref|XP_006446899.1| hypothetical protein CICLE_v10015032mg [Citrus clementina]
 gb|ESR60139.1| hypothetical protein CICLE_v10015032mg [Citrus clementina]
Length=358

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/357 (80%), Positives = 320/357 (90%), Gaps = 2/357 (1%)
 Frame = -1

Query  1744  GIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQ  1565
             GIEIDD+ELA FVE VDKDN+GVITFEEWRDFLLLYPHEAT+ENIY YLERVCLVDIGEQ
Sbjct  2     GIEIDDEELATFVERVDKDNNGVITFEEWRDFLLLYPHEATMENIYHYLERVCLVDIGEQ  61

Query  1564  AVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKE  1385
             A IPEGISKHVHA++YLI+GGVAGA SRTATAPLDRLKVVLQVQTTRA IMPA++ IW++
Sbjct  62    AAIPEGISKHVHANRYLISGGVAGATSRTATAPLDRLKVVLQVQTTRAHIMPAIRDIWRD  121

Query  1384  GGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE--GDIGTSGRLIAGGLAG  1211
             GGISGFFRGNG+NV+KVAPESAIKFYTYE LK  I   +GDE   +IG SGRL AGGLAG
Sbjct  122   GGISGFFRGNGLNVIKVAPESAIKFYTYERLKKLIAKVEGDEEKTNIGASGRLFAGGLAG  181

Query  1210  AVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPY  1031
             AVAQTAIYPMDLVKTRLQTY CEGGKVP +G +S+DI ++EGPRAFYRG+VPSLLGIIPY
Sbjct  182   AVAQTAIYPMDLVKTRLQTYVCEGGKVPKIGAMSRDILVQEGPRAFYRGLVPSLLGIIPY  241

Query  1030  AGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPT  851
             AGIDLA Y++ K  ++ YIL DSEPGPLVQLG GT SGALGATCVYPLQVVRTRMQAQ  
Sbjct  242   AGIDLAAYESFKEMSKKYILHDSEPGPLVQLGCGTFSGALGATCVYPLQVVRTRMQAQRM  301

Query  850   HTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             +T +AY GM DVF RTF+ EGLRGFYKGLFPNLLKVVP+ASITY+VYE+MKK+L+L+
Sbjct  302   NTESAYTGMSDVFKRTFKSEGLRGFYKGLFPNLLKVVPSASITYMVYEAMKKSLELE  358



>ref|XP_006581824.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like 
isoform X4 [Glycine max]
Length=383

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/379 (75%), Positives = 331/379 (87%), Gaps = 0/379 (0%)
 Frame = -1

Query  2095  GPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAK  1916
             G VSMDHVL AL ETKEER++RIRSLF+FFD+ N GYLDYAQIE GLSA+QI  +YK+A+
Sbjct  5     GVVSMDHVLVALGETKEEREVRIRSLFNFFDAANNGYLDYAQIEAGLSALQIPPEYKYAR  64

Query  1915  ELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIE  1736
             EL  V DAN DGRV+Y EFR+YMDDKELELYRIFQ+IDVEH G ILPEEL++AL+KAGIE
Sbjct  65    ELCEVCDANSDGRVEYHEFRRYMDDKELELYRIFQSIDVEHDGTILPEELYEALLKAGIE  124

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             ++D+ELA FVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVI
Sbjct  125   MNDEELAHFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVI  184

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             PEGISKHV+ SKY +AGG+AG  SRTATAPLDRLKVVLQVQ+  ASIMPAV  IWK+ G+
Sbjct  185   PEGISKHVNRSKYFLAGGIAGGISRTATAPLDRLKVVLQVQSEPASIMPAVTKIWKQDGL  244

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQT  1196
              GFFRGNG+NV+KV+PESAIKFY +EMLK  IG A G++ DIGT+GRL+AGG AGA+AQ 
Sbjct  245   LGFFRGNGLNVVKVSPESAIKFYAFEMLKKVIGEAHGNKSDIGTAGRLVAGGTAGAIAQA  304

Query  1195  AIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDL  1016
             AIYPMDL+KTRLQT   EGGKVP LG L+ +IW++EGPRAFYRG+VPSLLG+IPYA IDL
Sbjct  305   AIYPMDLIKTRLQTCPSEGGKVPKLGTLTMNIWVQEGPRAFYRGLVPSLLGMIPYAAIDL  364

Query  1015  AVYDALKNFARTYILQDSE  959
               YD +K+ ++ YILQDS+
Sbjct  365   TAYDTMKDISKRYILQDSD  383


 Score = 94.0 bits (232),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 100/191 (52%), Gaps = 5/191 (3%)
 Frame = -1

Query  1270  KGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLR  1091
             +G    +  S   +AGG+AG +++TA  P+D +K  LQ  +     +P + +    IW +
Sbjct  186   EGISKHVNRSKYFLAGGIAGGISRTATAPLDRLKVVLQVQSEPASIMPAVTK----IWKQ  241

Query  1090  EGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGAL  911
             +G   F+RG   +++ + P + I    ++ LK          S+ G   +L +G  +GA+
Sbjct  242   DGLLGFFRGNGLNVVKVSPESAIKFYAFEMLKKVIGEAHGNKSDIGTAGRLVAGGTAGAI  301

Query  910   GATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAA  731
                 +YP+ +++TR+Q  P+      K +  + +  +  EG R FY+GL P+LL ++P A
Sbjct  302   AQAAIYPMDLIKTRLQTCPSEGGKVPK-LGTLTMNIWVQEGPRAFYRGLVPSLLGMIPYA  360

Query  730   SITYLVYESMK  698
             +I    Y++MK
Sbjct  361   AIDLTAYDTMK  371



>ref|XP_006578742.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like 
isoform X3 [Glycine max]
Length=375

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/375 (76%), Positives = 328/375 (87%), Gaps = 0/375 (0%)
 Frame = -1

Query  2083  MDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLR  1904
             MDHVL AL ETKEER++RIRSLF+FFD+ N GYLDYAQIE GLSA+QI  +YK+A+EL  
Sbjct  1     MDHVLVALGETKEEREVRIRSLFNFFDAANNGYLDYAQIEAGLSALQIPPEYKYARELCE  60

Query  1903  VVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDD  1724
             V DAN DGRV+Y EFR+YMDDKELELYRIFQAIDVEH G ILPEEL++AL+KAGIE++D+
Sbjct  61    VCDANSDGRVEYHEFRRYMDDKELELYRIFQAIDVEHDGTILPEELYEALLKAGIEMNDE  120

Query  1723  ELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGI  1544
             ELA FVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVIPEGI
Sbjct  121   ELAHFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGI  180

Query  1543  SKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFF  1364
             SKH + SKY +AGG+AG  SRTATAPLDRLKVVLQVQ+ RASIMPAV  IWK+ G+ GFF
Sbjct  181   SKHANRSKYFLAGGIAGGISRTATAPLDRLKVVLQVQSERASIMPAVTRIWKQDGLLGFF  240

Query  1363  RGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYP  1184
             RGNG+NV+KVAPESAIKFY +EMLK  IG A+G++ DIGT+GRL+AGG AGA+AQ AIYP
Sbjct  241   RGNGLNVVKVAPESAIKFYAFEMLKKVIGEAQGNKSDIGTAGRLVAGGTAGAIAQAAIYP  300

Query  1183  MDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYD  1004
             MDL+KTRLQT   EGGKVP LG L+ +IW +EGPRAFYRG+VPSLLG+IPYA IDL  YD
Sbjct  301   MDLIKTRLQTCPSEGGKVPKLGTLTMNIWFQEGPRAFYRGLVPSLLGMIPYAAIDLTAYD  360

Query  1003  ALKNFARTYILQDSE  959
              LK+ ++ YILQDS+
Sbjct  361   TLKDMSKRYILQDSD  375


 Score = 94.0 bits (232),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 97/182 (53%), Gaps = 5/182 (3%)
 Frame = -1

Query  1243  SGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRG  1064
             S   +AGG+AG +++TA  P+D +K  LQ  +     +P + R    IW ++G   F+RG
Sbjct  187   SKYFLAGGIAGGISRTATAPLDRLKVVLQVQSERASIMPAVTR----IWKQDGLLGFFRG  242

Query  1063  IVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQ  884
                +++ + P + I    ++ LK          S+ G   +L +G  +GA+    +YP+ 
Sbjct  243   NGLNVVKVAPESAIKFYAFEMLKKVIGEAQGNKSDIGTAGRLVAGGTAGAIAQAAIYPMD  302

Query  883   VVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYES  704
             +++TR+Q  P+      K +  + +  +  EG R FY+GL P+LL ++P A+I    Y++
Sbjct  303   LIKTRLQTCPSEGGKVPK-LGTLTMNIWFQEGPRAFYRGLVPSLLGMIPYAAIDLTAYDT  361

Query  703   MK  698
             +K
Sbjct  362   LK  363



>ref|XP_011073596.1| PREDICTED: solute carrier family 25 member 41 [Sesamum indicum]
Length=422

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/480 (66%), Positives = 352/480 (73%), Gaps = 71/480 (15%)
 Frame = -1

Query  2119  CCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQI  1940
             CCNPV KPG  S+DHVL+AL ETKEER+ RIRSLFSFFDS+N GYLD + IE+GL AMQI
Sbjct  14    CCNPVKKPGHASLDHVLSALGETKEERESRIRSLFSFFDSNNVGYLDSSVIEKGLWAMQI  73

Query  1939  QADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWD  1760
              A YKFAKELL V DAN+DGRVDY EFRKYMDDKELELY                     
Sbjct  74    PAGYKFAKELLEVCDANQDGRVDYQEFRKYMDDKELELY---------------------  112

Query  1759  ALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLV  1580
                            R  + +D +++G I  EE  D L+                     
Sbjct  113   ---------------RIFQAIDVEHNGCILPEELWDALVK-------------------A  138

Query  1579  DIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVK  1400
             DIGE AVIPEGISKHV+A+KYLIAGGVAGAASRT TAPLDRLKV+LQVQTT ASI  AV+
Sbjct  139   DIGEHAVIPEGISKHVNATKYLIAGGVAGAASRTVTAPLDRLKVILQVQTTHASIGSAVQ  198

Query  1399  SIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGG  1220
             +IWKEGG+ GFFRGNGINVLKVAPESAIKFYTYEMLK AIG A GD   +G  GRL AG 
Sbjct  199   NIWKEGGLLGFFRGNGINVLKVAPESAIKFYTYEMLKGAIGDANGD---VGMVGRLAAG-  254

Query  1219  LAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGI  1040
                     +IYPMDLVKTRLQT+ CE G VP+LG+LSKDIW+REGPRA YRG++PSLLGI
Sbjct  255   -------ASIYPMDLVKTRLQTHVCERGNVPNLGKLSKDIWVREGPRALYRGLMPSLLGI  307

Query  1039  IPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQA  860
             IPYAGIDLA Y+ LK+ +R YIL D EPGPLVQL  GTISG+LGATCVYPLQVVRTRMQA
Sbjct  308   IPYAGIDLAAYETLKDMSRKYILHDGEPGPLVQLSCGTISGSLGATCVYPLQVVRTRMQA  367

Query  859   QPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             Q      AY  M DVF RT++HEG RGFYKGLFPNLLKVVPAASITYLVYE+MKK+L+LD
Sbjct  368   Q-----RAYCSMSDVFWRTYQHEGFRGFYKGLFPNLLKVVPAASITYLVYEAMKKSLNLD  422



>ref|XP_007137826.1| hypothetical protein PHAVU_009G158900g [Phaseolus vulgaris]
 gb|ESW09820.1| hypothetical protein PHAVU_009G158900g [Phaseolus vulgaris]
Length=398

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/377 (75%), Positives = 328/377 (87%), Gaps = 0/377 (0%)
 Frame = -1

Query  2095  GPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAK  1916
             G VSMDH+LAAL ETKEER++RIRSLF+FFD+ N GYLD AQIE GLSA+QI  +YK+A+
Sbjct  5     GVVSMDHLLAALGETKEEREVRIRSLFNFFDAANNGYLDVAQIEVGLSALQIPPEYKYAR  64

Query  1915  ELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIE  1736
             EL  V DAN DGRV+Y EFR+YMDDKELELYRIFQAIDVEH G I+PEEL++AL+KAGIE
Sbjct  65    ELCEVCDANSDGRVEYHEFRRYMDDKELELYRIFQAIDVEHDGNIIPEELYEALLKAGIE  124

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             +DD+ELARFV+HVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVI
Sbjct  125   MDDEELARFVDHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVI  184

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             PEGISKH + +KY +AGGVAG+ SRT TAPLDRLKVVLQVQT  ASIMPAV  I K+ G+
Sbjct  185   PEGISKHANRTKYFLAGGVAGSISRTVTAPLDRLKVVLQVQTAHASIMPAVTKILKQDGL  244

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQT  1196
             SGFFRGNG+NV+KV PESAIKFY +EMLK  +G A+G + DIGT+GRL AGG+AGAVAQ 
Sbjct  245   SGFFRGNGLNVVKVTPESAIKFYAFEMLKKVVGEAQGSKSDIGTAGRLFAGGMAGAVAQA  304

Query  1195  AIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDL  1016
             AIYPMDL+KTRLQT   EGGKVP LG L+ +IW++EGPRAFYRG+VPSLLG+IPYA IDL
Sbjct  305   AIYPMDLIKTRLQTCPSEGGKVPKLGTLTMNIWVQEGPRAFYRGLVPSLLGMIPYAAIDL  364

Query  1015  AVYDALKNFARTYILQD  965
               YD LK+ ++ +ILQD
Sbjct  365   TAYDTLKDMSKRHILQD  381


 Score = 91.3 bits (225),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/179 (28%), Positives = 97/179 (54%), Gaps = 5/179 (3%)
 Frame = -1

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVP  1055
              +AGG+AG++++T   P+D +K  LQ  T     +P + ++ K    ++G   F+RG   
Sbjct  198   FLAGGVAGSISRTVTAPLDRLKVVLQVQTAHASIMPAVTKILK----QDGLSGFFRGNGL  253

Query  1054  SLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVR  875
             +++ + P + I    ++ LK          S+ G   +L +G ++GA+    +YP+ +++
Sbjct  254   NVVKVTPESAIKFYAFEMLKKVVGEAQGSKSDIGTAGRLFAGGMAGAVAQAAIYPMDLIK  313

Query  874   TRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMK  698
             TR+Q  P+      K +  + +  +  EG R FY+GL P+LL ++P A+I    Y+++K
Sbjct  314   TRLQTCPSEGGKVPK-LGTLTMNIWVQEGPRAFYRGLVPSLLGMIPYAAIDLTAYDTLK  371



>ref|XP_002512812.1| ADP,ATP carrier protein, putative [Ricinus communis]
 gb|EEF49315.1| ADP,ATP carrier protein, putative [Ricinus communis]
Length=469

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/493 (60%), Positives = 368/493 (75%), Gaps = 42/493 (9%)
 Frame = -1

Query  2134  KDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGL  1955
             + R  CCNPV + GPV+MDHVL AL ETKEER++RIRSLF+FFD  N+G++DY QIE+GL
Sbjct  11    EQRPNCCNPVKQAGPVTMDHVLLALGETKEERELRIRSLFNFFDGANSGFIDYTQIEKGL  70

Query  1954  SAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILP  1775
             S++ I ADYK+AK+LL V DAN+DGRVDY EF+++MDDKELELY IFQAIDVEH+G ILP
Sbjct  71    SSLLIPADYKYAKDLLNVCDANQDGRVDYQEFKRHMDDKELELYLIFQAIDVEHNGCILP  130

Query  1774  EELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFE------EWRDFLLLYPHEATIEN  1613
             EEL+DAL++A + I    L +F+      +  ++ F+      E + ++  +    ++ N
Sbjct  131   EELYDALIRAELTIAIQSL-KFIIFTPPSHSRILHFQYSCLSLELQTWIFFFCFLFSVVN  189

Query  1612  IYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQ  1433
                                    S HV          V  +  +     +     +LQVQ
Sbjct  190   -----------------------SLHV----------VLHSPLKNNVKRIYGKTFILQVQ  216

Query  1432  TTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DE  1259
             T RA ++PA+K+IWKEGG+  FFRGN +NVLKVAPESA++FYTYEMLK  I  AKG  ++
Sbjct  217   TARARMIPAIKNIWKEGGVLAFFRGNALNVLKVAPESALRFYTYEMLKEVIVKAKGEGNK  276

Query  1258  GDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPR  1079
              D+GT+GRL AGG AGAVAQTAIYPMDLVKTRLQTYTC+ GKVP+LG +S+DIW++EGPR
Sbjct  277   ADVGTTGRLFAGGFAGAVAQTAIYPMDLVKTRLQTYTCKNGKVPNLGAMSRDIWVQEGPR  336

Query  1078  AFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATC  899
             AFYRG+VPSLLGIIPYAGIDLA Y+  K+ ++ YIL+DSEPGPLVQLG GT+SGALGATC
Sbjct  337   AFYRGLVPSLLGIIPYAGIDLAAYETFKDMSKKYILRDSEPGPLVQLGCGTLSGALGATC  396

Query  898   VYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITY  719
             VYPLQVVRTRMQA  T+T TAY+GM DVF RTF+HEG+RG YKG+FPN+LKVVP+ASITY
Sbjct  397   VYPLQVVRTRMQAHRTNTGTAYEGMSDVFRRTFQHEGIRGLYKGIFPNMLKVVPSASITY  456

Query  718   LVYESMKKTLDLD  680
             +VYE+MKK LDL+
Sbjct  457   MVYEAMKKRLDLE  469



>ref|XP_006578743.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like 
isoform X4 [Glycine max]
Length=362

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/356 (78%), Positives = 315/356 (88%), Gaps = 0/356 (0%)
 Frame = -1

Query  1747  AGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGE  1568
             AGIE++D+ELA FVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGE
Sbjct  7     AGIEMNDEELAHFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGE  66

Query  1567  QAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWK  1388
             QAVIPEGISKH + SKY +AGG+AG  SRTATAPLDRLKVVLQVQ+ RASIMPAV  IWK
Sbjct  67    QAVIPEGISKHANRSKYFLAGGIAGGISRTATAPLDRLKVVLQVQSERASIMPAVTRIWK  126

Query  1387  EGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGA  1208
             + G+ GFFRGNG+NV+KVAPESAIKFY +EMLK  IG A+G++ DIGT+GRL+AGG AGA
Sbjct  127   QDGLLGFFRGNGLNVVKVAPESAIKFYAFEMLKKVIGEAQGNKSDIGTAGRLVAGGTAGA  186

Query  1207  VAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYA  1028
             +AQ AIYPMDL+KTRLQT   EGGKVP LG L+ +IW +EGPRAFYRG+VPSLLG+IPYA
Sbjct  187   IAQAAIYPMDLIKTRLQTCPSEGGKVPKLGTLTMNIWFQEGPRAFYRGLVPSLLGMIPYA  246

Query  1027  GIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTH  848
              IDL  YD LK+ ++ YILQDSEPGPLVQLG GTISGA+GATCVYPLQV+RTR+QAQP++
Sbjct  247   AIDLTAYDTLKDMSKRYILQDSEPGPLVQLGCGTISGAVGATCVYPLQVIRTRLQAQPSN  306

Query  847   TSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             TS AYKGMFD F RTF+ EG  GFYKGLFPNLLKVVPAASITY+VYES+KK LDLD
Sbjct  307   TSDAYKGMFDAFRRTFQLEGFIGFYKGLFPNLLKVVPAASITYVVYESLKKNLDLD  362



>gb|EMT02893.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Aegilops 
tauschii]
Length=437

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/421 (71%), Positives = 344/421 (82%), Gaps = 32/421 (8%)
 Frame = -1

Query  1846  DDKELELYRIFQAIDVEHSGGILPEELWDALVKA--------------------------  1745
             D+K  + YRIFQAIDVEH+G ILPEELWDALVKA                          
Sbjct  17    DNKRRDPYRIFQAIDVEHNGCILPEELWDALVKAEWIPRFVKLQQNWPEPKMPSWDIGSV  76

Query  1744  -----GIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLV  1580
                   IEIDD+ELARFVEHVDKDN+G+ITFEEWRDFL+LYP+EATIENIY + ERVCLV
Sbjct  77    NHLRCSIEIDDEELARFVEHVDKDNNGIITFEEWRDFLMLYPNEATIENIYHHWERVCLV  136

Query  1579  DIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVK  1400
             DIGEQA IPEG+SKHV ASKYLIAGG+AGAASRTATAPLDRLKV++QVQTTR ++  AVK
Sbjct  137   DIGEQAAIPEGLSKHVSASKYLIAGGIAGAASRTATAPLDRLKVIMQVQTTRTTVTHAVK  196

Query  1399  SIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAG  1223
              I+  GG+ GFFRGNG+NV+KVAPESAI+FY YE LK  I ++KG ++  +G S RL+AG
Sbjct  197   DIFIRGGLLGFFRGNGLNVVKVAPESAIRFYAYETLKEYIMNSKGENKSAVGASERLVAG  256

Query  1222  GLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLG  1043
             GLAGA+AQTAIYP+DLVKTRLQT++CE GKVP LG LS+DI   EGPRAFYRG+VPSLLG
Sbjct  257   GLAGAIAQTAIYPIDLVKTRLQTFSCESGKVPSLGTLSRDILKHEGPRAFYRGLVPSLLG  316

Query  1042  IIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQ  863
             I+PYAGIDLAVY+ LK+ +RTYI++D+EPGPLVQLG GT+SGALGATCVYPLQV+RTR+Q
Sbjct  317   IVPYAGIDLAVYETLKDASRTYIIKDTEPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQ  376

Query  862   AQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             AQ  ++  AYKGM DVF RT RHEG+ GFYKG+ PNLLKVVPAASITYLVYE+MKK L L
Sbjct  377   AQQANSEAAYKGMSDVFWRTLRHEGVSGFYKGILPNLLKVVPAASITYLVYEAMKKNLSL  436

Query  682   D  680
             D
Sbjct  437   D  437



>ref|XP_006578744.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like 
isoform X5 [Glycine max]
Length=352

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/352 (78%), Positives = 311/352 (88%), Gaps = 0/352 (0%)
 Frame = -1

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             ++D+ELA FVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVI
Sbjct  1     MNDEELAHFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVI  60

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             PEGISKH + SKY +AGG+AG  SRTATAPLDRLKVVLQVQ+ RASIMPAV  IWK+ G+
Sbjct  61    PEGISKHANRSKYFLAGGIAGGISRTATAPLDRLKVVLQVQSERASIMPAVTRIWKQDGL  120

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQT  1196
              GFFRGNG+NV+KVAPESAIKFY +EMLK  IG A+G++ DIGT+GRL+AGG AGA+AQ 
Sbjct  121   LGFFRGNGLNVVKVAPESAIKFYAFEMLKKVIGEAQGNKSDIGTAGRLVAGGTAGAIAQA  180

Query  1195  AIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDL  1016
             AIYPMDL+KTRLQT   EGGKVP LG L+ +IW +EGPRAFYRG+VPSLLG+IPYA IDL
Sbjct  181   AIYPMDLIKTRLQTCPSEGGKVPKLGTLTMNIWFQEGPRAFYRGLVPSLLGMIPYAAIDL  240

Query  1015  AVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTA  836
               YD LK+ ++ YILQDSEPGPLVQLG GTISGA+GATCVYPLQV+RTR+QAQP++TS A
Sbjct  241   TAYDTLKDMSKRYILQDSEPGPLVQLGCGTISGAVGATCVYPLQVIRTRLQAQPSNTSDA  300

Query  835   YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             YKGMFD F RTF+ EG  GFYKGLFPNLLKVVPAASITY+VYES+KK LDLD
Sbjct  301   YKGMFDAFRRTFQLEGFIGFYKGLFPNLLKVVPAASITYVVYESLKKNLDLD  352



>ref|XP_006581825.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like 
isoform X5 [Glycine max]
 ref|XP_006581826.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like 
isoform X6 [Glycine max]
Length=352

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/352 (77%), Positives = 312/352 (89%), Gaps = 0/352 (0%)
 Frame = -1

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             ++D+ELA FVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVI
Sbjct  1     MNDEELAHFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVI  60

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             PEGISKHV+ SKY +AGG+AG  SRTATAPLDRLKVVLQVQ+  ASIMPAV  IWK+ G+
Sbjct  61    PEGISKHVNRSKYFLAGGIAGGISRTATAPLDRLKVVLQVQSEPASIMPAVTKIWKQDGL  120

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQT  1196
              GFFRGNG+NV+KV+PESAIKFY +EMLK  IG A G++ DIGT+GRL+AGG AGA+AQ 
Sbjct  121   LGFFRGNGLNVVKVSPESAIKFYAFEMLKKVIGEAHGNKSDIGTAGRLVAGGTAGAIAQA  180

Query  1195  AIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDL  1016
             AIYPMDL+KTRLQT   EGGKVP LG L+ +IW++EGPRAFYRG+VPSLLG+IPYA IDL
Sbjct  181   AIYPMDLIKTRLQTCPSEGGKVPKLGTLTMNIWVQEGPRAFYRGLVPSLLGMIPYAAIDL  240

Query  1015  AVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTA  836
               YD +K+ ++ YILQDSEPGPLVQLG GTISGA+GATCVYPLQV+RTR+QAQP++TS A
Sbjct  241   TAYDTMKDISKRYILQDSEPGPLVQLGCGTISGAVGATCVYPLQVIRTRLQAQPSNTSDA  300

Query  835   YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             YKGMFD F RTF+ EG  GFYKGLFPNLLKVVPAASITY+VYES+KKTLDLD
Sbjct  301   YKGMFDAFRRTFQLEGFIGFYKGLFPNLLKVVPAASITYVVYESLKKTLDLD  352



>ref|XP_011040299.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
isoform X2 [Populus euphratica]
Length=368

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/356 (79%), Positives = 311/356 (87%), Gaps = 1/356 (0%)
 Frame = -1

Query  1744  GIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQ  1565
             GIEIDD+ELA FVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVC VDIGEQ
Sbjct  13    GIEIDDEELAHFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCHVDIGEQ  72

Query  1564  AVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKE  1385
             AVIPEGISK VH SKY IAGG+AGAASRTATAPLDRLKV LQ+QT+ A + P +  IWKE
Sbjct  73    AVIPEGISKQVHRSKYFIAGGIAGAASRTATAPLDRLKVFLQIQTSCARLAPIINKIWKE  132

Query  1384  GGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGA  1208
              G  GFFRGNG+NV+KVAPESAIKFY YEMLK+ IG  KG D+ DIG  GRL+AGG+AGA
Sbjct  133   EGFLGFFRGNGLNVVKVAPESAIKFYAYEMLKDVIGDVKGGDKVDIGPGGRLLAGGMAGA  192

Query  1207  VAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYA  1028
             VAQTAIYPMDLVKTRLQT  CEGGK P LG L KDIW+ EGPRAFYRG+VPSLLGIIPYA
Sbjct  193   VAQTAIYPMDLVKTRLQTGVCEGGKAPKLGVLMKDIWVLEGPRAFYRGLVPSLLGIIPYA  252

Query  1027  GIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTH  848
             GIDLA Y+ LK+ ++TYILQDS PGPLVQL  GTISGALGATCVYPLQV+RTRMQAQP +
Sbjct  253   GIDLAAYETLKDMSKTYILQDSAPGPLVQLCCGTISGALGATCVYPLQVIRTRMQAQPPN  312

Query  847   TSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
              +  YKGM DVF RTF++EG RGFYKG+FPNLLKVVPAASITY+VYE+MKK+L+LD
Sbjct  313   DARPYKGMSDVFWRTFQNEGCRGFYKGIFPNLLKVVPAASITYMVYEAMKKSLELD  368



>gb|ACN33669.1| unknown [Zea mays]
 gb|AFW87194.1| hypothetical protein ZEAMMB73_723355 [Zea mays]
Length=375

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/361 (76%), Positives = 321/361 (89%), Gaps = 1/361 (0%)
 Frame = -1

Query  1759  ALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLV  1580
              L+ AGIEI+D+ELARFVEHVDKDN+G+ITFEEWRDFLLLYP+EATIENIY + ERVCLV
Sbjct  15    CLLSAGIEINDEELARFVEHVDKDNNGIITFEEWRDFLLLYPNEATIENIYHHWERVCLV  74

Query  1579  DIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVK  1400
             DIGEQA IPEGISKHV+ASKYLIAGG+AGAASRTATAPLDRLKV++QVQTTR S+M A+K
Sbjct  75    DIGEQAAIPEGISKHVNASKYLIAGGIAGAASRTATAPLDRLKVIMQVQTTRTSVMHAIK  134

Query  1399  SIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAG  1223
              IW +GG+ GFFRGNG+NV+KVAPESAI+FY YEMLK  I   KG ++ ++G S RLIAG
Sbjct  135   DIWTKGGMLGFFRGNGLNVVKVAPESAIRFYAYEMLKEYIMKRKGENKSEVGASERLIAG  194

Query  1222  GLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLG  1043
             GLAGAVAQTAIYP++LVKTRLQTY+ E G VP +G+LS+DI + EGPRAFYRG+VPSLLG
Sbjct  195   GLAGAVAQTAIYPIELVKTRLQTYSGEVGYVPRIGQLSRDILVHEGPRAFYRGLVPSLLG  254

Query  1042  IIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQ  863
             I+PYAGIDLAVY+ LK+ ++TYIL+DS+PGPLVQLG GT+SGALGATCVYPLQV+RTR+Q
Sbjct  255   IVPYAGIDLAVYETLKDVSKTYILKDSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQ  314

Query  862   AQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             AQ  ++ +AY+GM DVF RT  HEG+ GFYKG+ PNLLKVVPAASITYLVYE+MKK L L
Sbjct  315   AQQANSESAYRGMSDVFWRTLHHEGVSGFYKGILPNLLKVVPAASITYLVYEAMKKNLSL  374

Query  682   D  680
             D
Sbjct  375   D  375



>ref|XP_002866455.1| hypothetical protein ARALYDRAFT_496347 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42714.1| hypothetical protein ARALYDRAFT_496347 [Arabidopsis lyrata subsp. 
lyrata]
Length=1401

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/415 (70%), Positives = 345/415 (83%), Gaps = 5/415 (1%)
 Frame = -1

Query  2113  NPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQA  1934
             NPV KP   +M+HVL AL+ETKEER+ RIR LF FFD+   G+LD  QIE+GLS++ I  
Sbjct  9     NPVKKPVEATMEHVLVALRETKEERETRIRKLFEFFDNSKLGFLDDTQIEKGLSSLSIPQ  68

Query  1933  DYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDAL  1754
             +Y++A + L+V DAN+DGRVDY EFR+YMD KELELY+IFQAIDVEH+G I PEELW+AL
Sbjct  69    NYRYASDFLKVCDANRDGRVDYQEFRRYMDSKELELYKIFQAIDVEHNGDICPEELWEAL  128

Query  1753  VKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDI  1574
              KAGI+I D+ELA F+EHVDKDN+G+ITFEEWRDFLLL PHEATIENIY + ERVCL+DI
Sbjct  129   DKAGIKIKDEELASFMEHVDKDNNGIITFEEWRDFLLLNPHEATIENIYHHWERVCLIDI  188

Query  1573  GEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSI  1394
             GEQAVIP+GIS H   SK L+AGG+AGA SRTATAPLDRLKV LQVQ T   ++P +K I
Sbjct  189   GEQAVIPDGISTHAQRSKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTNLGVVPTIKKI  248

Query  1393  WKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLA  1214
             W+E  + GFFRGNG+NV KVAPESAIKF  YEMLK+ IG   G +GDIGTSGRL+AGGLA
Sbjct  249   WREDKLLGFFRGNGLNVTKVAPESAIKFAAYEMLKSIIG---GVDGDIGTSGRLLAGGLA  305

Query  1213  GAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
             GAVAQTAIYPMDLVKTRLQT+  E G  P L +L+KDIW++EGPRAFYRG+ PSL+GIIP
Sbjct  306   GAVAQTAIYPMDLVKTRLQTFVSEVG-TPKLWKLTKDIWIQEGPRAFYRGLCPSLIGIIP  364

Query  1033  YAGIDLAVYDALKNFARTYILQDS-EPGPLVQLGSGTISGALGATCVYPLQVVRT  872
             YAGIDLA Y+ LK+ +R++ L D+ EPGPL+QLG G  SGALGA+CVYPLQV+RT
Sbjct  365   YAGIDLAAYETLKDLSRSHFLHDTAEPGPLIQLGCGMTSGALGASCVYPLQVIRT  419


 Score = 99.8 bits (247),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 101/184 (55%), Gaps = 13/184 (7%)
 Frame = -1

Query  1243  SGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRG  1064
             S  L+AGG+AGAV++TA  P+D +K  LQ      G VP +    K IW  +    F+RG
Sbjct  205   SKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTNLGVVPTI----KKIWREDKLLGFFRG  260

Query  1063  IVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQ  884
                ++  + P + I  A Y+ LK+        D + G   +L +G ++GA+  T +YP+ 
Sbjct  261   NGLNVTKVAPESAIKFAAYEMLKSIIGGV---DGDIGTSGRLLAGGLAGAVAQTAIYPMD  317

Query  883   VVRTRMQAQPTHTSTA--YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVY  710
             +V+TR+Q   +   T   +K   D++++    EG R FY+GL P+L+ ++P A I    Y
Sbjct  318   LVKTRLQTFVSEVGTPKLWKLTKDIWIQ----EGPRAFYRGLCPSLIGIIPYAGIDLAAY  373

Query  709   ESMK  698
             E++K
Sbjct  374   ETLK  377



>ref|XP_009360282.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009360285.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Pyrus x bretschneideri]
Length=353

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/353 (78%), Positives = 314/353 (89%), Gaps = 2/353 (1%)
 Frame = -1

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             +DD+ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERV LVDIGEQAVI
Sbjct  1     MDDEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVFLVDIGEQAVI  60

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             PEGI +HVH S+Y IAG VAGAASRTATAPLDRLKVVLQVQT+RAS++PA+K I K+ GI
Sbjct  61    PEGIGRHVHRSRYFIAGAVAGAASRTATAPLDRLKVVLQVQTSRASVVPAIKKILKDDGI  120

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQ  1199
              GFFRGNGINV+KVAPESAIKFYTYEMLK  IG   G DEGDIGT+GRL+AGG+AGAVAQ
Sbjct  121   LGFFRGNGINVVKVAPESAIKFYTYEMLKKVIGDNMGADEGDIGTAGRLLAGGMAGAVAQ  180

Query  1198  TAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGID  1019
             T+IYP+DLVKTRLQT T E GK P L  L+K+IW+ EGPRAFY+G+ PSLLGI+PYAGID
Sbjct  181   TSIYPLDLVKTRLQTCTSEAGKSPRLRTLTKEIWIHEGPRAFYKGLCPSLLGIVPYAGID  240

Query  1018  LAVYDALKNFARTYILQD-SEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTS  842
             LA Y+ LK+ ++TY L D SEPGPL+QLG GT+SGALGATCVYPLQV+RTR+QAQ ++T+
Sbjct  241   LATYETLKDMSKTYFLHDNSEPGPLIQLGCGTVSGALGATCVYPLQVIRTRLQAQRSNTA  300

Query  841   TAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             TAYKGM DVF RT +HEG RGFYKGLFPNLLKVVPAASITY+VYE+MKK LDL
Sbjct  301   TAYKGMSDVFWRTLQHEGYRGFYKGLFPNLLKVVPAASITYMVYEAMKKKLDL  353



>ref|XP_008375425.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X2 [Malus domestica]
Length=353

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/353 (78%), Positives = 313/353 (89%), Gaps = 2/353 (1%)
 Frame = -1

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             +DD+ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERV LVDIGEQAVI
Sbjct  1     MDDEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVFLVDIGEQAVI  60

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             PEGI +HVH S+Y IAG VAGAASRTATAPLDRLKVVLQVQT+RAS++PA+K I K+ GI
Sbjct  61    PEGIGRHVHRSRYFIAGAVAGAASRTATAPLDRLKVVLQVQTSRASVVPAIKKILKDDGI  120

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQ  1199
              GFFRGNGINV+KVAPESAIKFYTYEMLK  IG   G DE DIGT+GRL+AGG+AGAVAQ
Sbjct  121   LGFFRGNGINVVKVAPESAIKFYTYEMLKKVIGDNMGADESDIGTAGRLLAGGMAGAVAQ  180

Query  1198  TAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGID  1019
             T+IYP+DLVKTRLQT T E GK P L  L+K+IW+ EGPRAFY+G+ PSLLGI+PYAGID
Sbjct  181   TSIYPLDLVKTRLQTCTSEAGKSPQLRTLTKEIWIHEGPRAFYKGLFPSLLGIVPYAGID  240

Query  1018  LAVYDALKNFARTYILQD-SEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTS  842
             LA Y+ LK+ ++TY L D SEPGPL+QLG GTISGALGATCVYPLQV+RTR+QAQ ++T+
Sbjct  241   LAAYETLKDMSKTYFLHDNSEPGPLIQLGCGTISGALGATCVYPLQVIRTRLQAQRSNTA  300

Query  841   TAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             TAYKGM DVF RT +HEG RGFYKGLFPNLLKVVPAASITY+VYE+MKK LDL
Sbjct  301   TAYKGMSDVFWRTIQHEGYRGFYKGLFPNLLKVVPAASITYMVYEAMKKKLDL  353



>gb|EEC72696.1| hypothetical protein OsI_06277 [Oryza sativa Indica Group]
Length=584

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/355 (76%), Positives = 315/355 (89%), Gaps = 1/355 (0%)
 Frame = -1

Query  1741  IEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQA  1562
             IEIDD+ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQA
Sbjct  230   IEIDDEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQA  289

Query  1561  VIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEG  1382
              IPE ISKH  ASKYLIAGGV+GA SRTATAPLDRLKV++QVQT R +++ AVK IW+EG
Sbjct  290   AIPERISKHASASKYLIAGGVSGATSRTATAPLDRLKVIMQVQTNRTTVLQAVKDIWREG  349

Query  1381  GISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAV  1205
              + GFFRGNG+NV+KVAPESAI+FY YEMLK  I  +KG ++ DIGTSGRL+AGGLAGAV
Sbjct  350   SLRGFFRGNGLNVVKVAPESAIRFYAYEMLKEYIMKSKGENKSDIGTSGRLMAGGLAGAV  409

Query  1204  AQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAG  1025
             AQTAIYP+DLVKTRLQT+ C  GK+P LG LS+DIW++EGPRAFYRG+VPSLLG++PYAG
Sbjct  410   AQTAIYPIDLVKTRLQTFACGSGKIPSLGALSRDIWMQEGPRAFYRGLVPSLLGMVPYAG  469

Query  1024  IDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHT  845
             IDL VY+ LK  ++TY+L+DS+PGPLVQLG GT+SGALGATCVYPLQV+RTR+QAQ  ++
Sbjct  470   IDLTVYETLKEMSKTYVLKDSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQAQRANS  529

Query  844   STAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
               AY+GM DVF +T +HEG+ GFYKGL PNLLKVVPAASITYLVYE+MKK+L LD
Sbjct  530   EAAYRGMSDVFWKTLQHEGISGFYKGLVPNLLKVVPAASITYLVYETMKKSLSLD  584


 Score =   150 bits (379),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 92/125 (74%), Gaps = 11/125 (9%)
 Frame = -1

Query  2086  SMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYK------  1925
             +M+HVL AL ET+ ER+ RIR++F FFD+   G+LD+AQIE GL+A+ +           
Sbjct  40    TMEHVLLALHETEAEREARIRAMFGFFDAAGRGHLDHAQIEAGLAALHLPPPPPPEEGAG  99

Query  1924  -----FAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWD  1760
                  +A+ELLR  D ++DGRV Y +FR+YMDDKELELYRIFQAIDVEH+G ILPEELW 
Sbjct  100   GGGGGYARELLRACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWH  159

Query  1759  ALVKA  1745
             ALVKA
Sbjct  160   ALVKA  164



>ref|XP_002989097.1| hypothetical protein SELMODRAFT_269471 [Selaginella moellendorffii]
 gb|EFJ09891.1| hypothetical protein SELMODRAFT_269471 [Selaginella moellendorffii]
Length=517

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/475 (60%), Positives = 366/475 (77%), Gaps = 9/475 (2%)
 Frame = -1

Query  2098  PGP-VSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKF  1922
             P P V++  V  AL ET E+R+ RIR+LF+ FDS  +G+LD+ QIE+ L  M I + YKF
Sbjct  43    PAPAVTLREVELALDETGEQREGRIRNLFALFDSSESGFLDHGQIEQRLKTMSIPSHYKF  102

Query  1921  AKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAG  1742
             A++LL+V DAN DGRVD+ EFR+Y+D+KELELY +FQ IDV + G I PEEL DAL  AG
Sbjct  103   AQDLLQVCDANHDGRVDFLEFRRYIDEKELELYHMFQQIDVTNDGYIHPEELRDALKNAG  162

Query  1741  IEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQA  1562
             I + D  L++F++HVD+DN+G+ITFEEWRDFLLL PH  TI  +Y+Y E+VC +DIGEQA
Sbjct  163   IHLSDRNLSKFMDHVDRDNNGIITFEEWRDFLLLSPHAGTITEVYQYWEKVCQIDIGEQA  222

Query  1561  VIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQT---TRASIMPAVKSIW  1391
             +IPEGIS+H++AS+Y IAGGVAGA SRTATAPLDRLKV+LQVQT    R ++   +K I+
Sbjct  223   IIPEGISRHLYASRYFIAGGVAGAVSRTATAPLDRLKVILQVQTERRARPNLFQGLKQIY  282

Query  1390  KEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE-GDIGTSGRLIAGGLA  1214
              EGG++GF+ GNGINVLKVAPESA+KFY +EMLK      +G++  +IG  GRL AGG A
Sbjct  283   TEGGMAGFYVGNGINVLKVAPESAVKFYAFEMLKEVAAKIQGEQKSEIGPLGRLFAGGAA  342

Query  1213  GAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
             GA+AQT +YP+D+VKTRLQ  +    +   +  L +D++  EG  +FYRG+VPSL+GIIP
Sbjct  343   GAIAQTVVYPLDVVKTRLQVLS----RKSQMSSLVRDMYAHEGFLSFYRGLVPSLVGIIP  398

Query  1033  YAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQP  854
             YAGIDLA+Y+ LK+ +R+ + + +EPGPL QL  GTISGA+GAT VYPLQ++RTR+QAQP
Sbjct  399   YAGIDLAMYETLKDLSRSILPEGTEPGPLTQLACGTISGAIGATSVYPLQLIRTRLQAQP  458

Query  853   THTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
              ++   YKGM DVF RT  HEG+  FYKGL PNL KV PAASITY+VYE MKK L
Sbjct  459   LNSPMRYKGMKDVFKRTLEHEGVTAFYKGLVPNLCKVAPAASITYVVYEKMKKLL  513



>ref|XP_008245875.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X2 [Prunus mume]
Length=352

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/352 (80%), Positives = 314/352 (89%), Gaps = 1/352 (0%)
 Frame = -1

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             +DD+ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVI
Sbjct  1     MDDEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVI  60

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             PEGIS+HVH S+Y IAG +AGAASRTATAPLDRLKVVLQVQT RAS++PA+K I KE GI
Sbjct  61    PEGISRHVHRSRYFIAGAIAGAASRTATAPLDRLKVVLQVQTARASVVPAIKKILKEDGI  120

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQ  1199
              GFFRGNGINV+KVAPESAIKFYTYEMLK  IG   G D GDIGTSGRL+AGG+AGAVAQ
Sbjct  121   LGFFRGNGINVVKVAPESAIKFYTYEMLKKVIGDGMGEDSGDIGTSGRLLAGGIAGAVAQ  180

Query  1198  TAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGID  1019
             T+IYP+DLVKTRLQT T E GK P L  L+K+IW+ EGPRAFY+G+ PSLLGIIPYAGID
Sbjct  181   TSIYPLDLVKTRLQTCTSEAGKSPQLRTLTKEIWIHEGPRAFYKGLFPSLLGIIPYAGID  240

Query  1018  LAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTST  839
             LA Y+ LK+ +RTYILQDSEPGPL+QLG GTISGALGATCVYPLQV+RTR+QAQ ++T+ 
Sbjct  241   LAAYETLKDMSRTYILQDSEPGPLIQLGCGTISGALGATCVYPLQVIRTRLQAQRSNTAA  300

Query  838   AYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             AYKGM DVF RT ++EG  GFYKGLFPNLLKVVPAASITY+VYE+MKK LDL
Sbjct  301   AYKGMSDVFWRTLQNEGYTGFYKGLFPNLLKVVPAASITYMVYEAMKKKLDL  352



>ref|XP_009373668.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X2 [Pyrus x bretschneideri]
Length=353

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/353 (79%), Positives = 317/353 (90%), Gaps = 2/353 (1%)
 Frame = -1

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             +DD ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVI
Sbjct  1     MDDKELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVI  60

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             PEGI KHVH S+Y IAG +AGAASRTATAPLDRLKVVLQVQT+RAS++PA+K I KE GI
Sbjct  61    PEGIGKHVHRSRYFIAGAIAGAASRTATAPLDRLKVVLQVQTSRASVVPAIKKILKEDGI  120

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQ  1199
              GFFRGNGINV+KVAPESAIKFYTYEMLK  IG   G DEGDIGT+GRL+AGG+AGAVAQ
Sbjct  121   LGFFRGNGINVVKVAPESAIKFYTYEMLKKVIGDNMGADEGDIGTAGRLLAGGMAGAVAQ  180

Query  1198  TAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGID  1019
             T+IYP+DLVKTRLQT T E GK P LG L+++IW+ EGPRAFYRG++PS+LGI+PY GID
Sbjct  181   TSIYPLDLVKTRLQTCTSEAGKSPQLGTLTREIWIHEGPRAFYRGLLPSVLGIVPYTGID  240

Query  1018  LAVYDALKNFARTYILQD-SEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTS  842
             LA Y+ALK+ ++TY L D SEPGPL+QLG GTISGALGATCVYPLQV+RTR+QAQ ++T+
Sbjct  241   LAAYEALKDMSKTYFLHDNSEPGPLIQLGCGTISGALGATCVYPLQVIRTRLQAQRSNTA  300

Query  841   TAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             TAYKGM DVF RT +HEG+RGFYKGLFPNLLKVVPAASITY+VYE+MKK LDL
Sbjct  301   TAYKGMSDVFWRTLQHEGVRGFYKGLFPNLLKVVPAASITYMVYEAMKKKLDL  353



>ref|XP_008389299.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Malus domestica]
Length=353

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/353 (78%), Positives = 315/353 (89%), Gaps = 2/353 (1%)
 Frame = -1

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             +DD+ELARFVEHVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVI
Sbjct  1     MDDEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVI  60

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             PEGI KHVH S+Y IAG +AGAASRTATAPLDRLKVVLQVQT+RAS++PA+K I KE GI
Sbjct  61    PEGIGKHVHRSRYFIAGAIAGAASRTATAPLDRLKVVLQVQTSRASVVPAIKKILKEDGI  120

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQ  1199
              GFFRGNG NV+KVAPESAIKFYTYEMLK  IG   G +EGDIGT+GRL+AGG+AGAVAQ
Sbjct  121   LGFFRGNGXNVVKVAPESAIKFYTYEMLKKVIGDNMGABEGDIGTAGRLLAGGMAGAVAQ  180

Query  1198  TAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGID  1019
             T+IYP+DLVKTRLQT T E GK P LG L+++IW+ EGPRAFY+G++PSLLGI+PYAGID
Sbjct  181   TSIYPLDLVKTRLQTCTSEAGKSPRLGTLTREIWIHEGPRAFYKGLLPSLLGIVPYAGID  240

Query  1018  LAVYDALKNFARTYILQD-SEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTS  842
             L  Y+ LK+ ++TY L D SEPGPL+QLG GTISGALGATCVYPLQV+RTR+QAQ ++T+
Sbjct  241   LTAYETLKDMSKTYFLHDNSEPGPLIQLGCGTISGALGATCVYPLQVIRTRLQAQRSNTA  300

Query  841   TAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             TAYKGM DVF RT +HEG RGFYKGLFPNLLKVVPAASITY+VYE+MKK LDL
Sbjct  301   TAYKGMSDVFWRTLQHEGYRGFYKGLFPNLLKVVPAASITYMVYEAMKKKLDL  353



>gb|AFJ66222.1| hypothetical protein 34G24.27 [Capsella rubella]
Length=422

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/487 (61%), Positives = 344/487 (71%), Gaps = 71/487 (15%)
 Frame = -1

Query  2134  KDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGL  1955
             K +  CCNPV KPGPVSMDHVL AL+ET+EERD+RIRSLF+FFDS+N GYLD AQIE+GL
Sbjct  5     KSKQGCCNPVKKPGPVSMDHVLLALRETREERDLRIRSLFNFFDSENVGYLDCAQIEKGL  64

Query  1954  SAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILP  1775
              A+QI                           R  ++D+EL   R  + +D ++ G IL 
Sbjct  65    CALQIP--------------------------RIEINDEELA--RFVEHVDKDNDGIILF  96

Query  1774  EELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLE  1595
             EE  D L+                                    LYPHEATIENIY + E
Sbjct  97    EEWRDFLL------------------------------------LYPHEATIENIYHHWE  120

Query  1594  RVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASI  1415
             RVCLVDIGEQAVIPEGISKHV  S Y IAGG+AGAASRTATAPLDRLKV+LQ+Q T A I
Sbjct  121   RVCLVDIGEQAVIPEGISKHVKRSNYFIAGGIAGAASRTATAPLDRLKVLLQIQKTDAKI  180

Query  1414  MPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSG  1238
               A+K IWK+ G+ GFFRGNG+N++KVAPESAIKFY YE+ KNAIG   G D+ DIGT+ 
Sbjct  181   REAIKMIWKQDGVRGFFRGNGLNIVKVAPESAIKFYAYELFKNAIGENMGEDKADIGTTA  240

Query  1237  RLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG-KVPHLGRLSKDIWLREGPRAFYRGI  1061
             RL AGG+AGAVAQ +IYP+DLVKTRLQT T + G  VP LG L+KDI + EGPRAFY+G+
Sbjct  241   RLFAGGMAGAVAQASIYPLDLVKTRLQTCTSQAGVAVPKLGTLTKDILVHEGPRAFYKGL  300

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQV  881
              PSLLGIIPYAGIDLA Y+ LK+ +R YILQD+EPGPLVQLG GTISGALGATCVYPLQV
Sbjct  301   FPSLLGIIPYAGIDLAAYEKLKDLSRIYILQDAEPGPLVQLGCGTISGALGATCVYPLQV  360

Query  880   VRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESM  701
             VRTRMQA+   TS     M  VF RT   EG +  YKGL PNLLKVVPAASITY+VYE+M
Sbjct  361   VRTRMQAERERTS-----MSGVFRRTISEEGYKALYKGLLPNLLKVVPAASITYMVYEAM  415

Query  700   KKTLDLD  680
             KK+L+LD
Sbjct  416   KKSLELD  422



>ref|XP_002983817.1| hypothetical protein SELMODRAFT_118883 [Selaginella moellendorffii]
 gb|EFJ15313.1| hypothetical protein SELMODRAFT_118883 [Selaginella moellendorffii]
Length=517

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/475 (59%), Positives = 358/475 (75%), Gaps = 9/475 (2%)
 Frame = -1

Query  2098  PGP-VSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKF  1922
             P P V++  V  AL ET E+R+ RIR+LF+ FDS  +G+LD+ QIE+ L  M I + YKF
Sbjct  43    PAPAVTLREVELALDETGEQREGRIRNLFALFDSSKSGFLDHGQIEQRLKTMSIPSHYKF  102

Query  1921  AKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAG  1742
             A++LL+V DAN DGRVD+ EFR+Y+D+KELELY +FQ IDV + G I PEEL DAL  AG
Sbjct  103   AQDLLQVCDANHDGRVDFLEFRRYIDEKELELYHMFQQIDVTNDGYIHPEELRDALKNAG  162

Query  1741  IEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQA  1562
             I + D  L++F++HVD+DN+G+ITFEEWRDFLLL PH  TI  +Y+Y E+VC +DIGEQA
Sbjct  163   IHLSDRNLSKFMDHVDRDNNGIITFEEWRDFLLLSPHAGTITEVYQYWEKVCQIDIGEQA  222

Query  1561  VIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQT---TRASIMPAVKSIW  1391
             +IPEGIS+H++AS+Y IAGGVAGA SRTATAPLDRLKV+LQVQT    R ++   +K I+
Sbjct  223   IIPEGISRHLYASRYFIAGGVAGAVSRTATAPLDRLKVILQVQTERRARPNLFQGLKQIY  282

Query  1390  KEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDE-GDIGTSGRLIAGGLA  1214
              EGG++GF+ GNGINVLKVAPESA+KFY +EMLK      +G++  +IG  GRL AGG A
Sbjct  283   TEGGMAGFYVGNGINVLKVAPESAVKFYAFEMLKEVAAKIQGEQKSEIGPLGRLFAGGAA  342

Query  1213  GAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIP  1034
             GA+AQT +YP+D+VKTRLQ  +    +   +  L +D++  EG  +FYRG+VPSL+GIIP
Sbjct  343   GAIAQTVVYPLDVVKTRLQVLS----RKSQMSSLVRDMYAHEGFLSFYRGLVPSLVGIIP  398

Query  1033  YAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQP  854
             YAGIDLA+Y+ LK+ +R+ + + +EPGPL QL  GTISGA+GAT VYPLQ++RTR     
Sbjct  399   YAGIDLAMYETLKDLSRSILPEGTEPGPLTQLACGTISGAIGATSVYPLQLIRTRQAITT  458

Query  853   THTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
                   +  +FDVF RT  HEG+  FYKGL PNL KV PAASITY+VYE MKK L
Sbjct  459   LSLLRNFLPLFDVFKRTLEHEGVTAFYKGLVPNLCKVAPAASITYVVYEKMKKLL  513



>ref|XP_001769325.1| predicted protein [Physcomitrella patens]
 gb|EDQ65879.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/455 (60%), Positives = 342/455 (75%), Gaps = 9/455 (2%)
 Frame = -1

Query  2035  IRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFR  1856
             +RIR LF  FDS   GYL+  QIE GL ++      K+  ELL   DAN+DGR+D+ EFR
Sbjct  1     MRIRKLFEAFDSGKCGYLESTQIESGLQSLSFPFQRKYVLELLEACDANRDGRIDFAEFR  60

Query  1855  KYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGV  1676
             +Y++DKE+EL+ +F+AIDV   G +  EEL  AL  AG+++ D EL  F++H+D+D +G 
Sbjct  61    RYVNDKEIELFNLFEAIDVSRDGVLQREELLFALRNAGVQLGDQELDAFLQHIDQDKNGH  120

Query  1675  ITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVA  1496
             ITF EWRDFLL+YPHEAT+ NIY+Y E++ LVDIGEQAVIPEGI +H +  ++L+AG VA
Sbjct  121   ITFGEWRDFLLMYPHEATLSNIYQYWEKISLVDIGEQAVIPEGIDEH-NRMRFLLAGAVA  179

Query  1495  GAASRTATAPLDRLKVVLQVQT--TRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPES  1322
             GA SRTATAPLDRLKV+L VQT  T +SIM  +  I+++ G+ GFFRGNG+NVLKVAPES
Sbjct  180   GAMSRTATAPLDRLKVMLAVQTHSTTSSIMHGLTHIYQKNGVIGFFRGNGLNVLKVAPES  239

Query  1321  AIKFYTYEMLKNAIGHAKGDE--GDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYT  1148
             AIKFY YE++K+A+    GDE  G+IGT GRL+AGG AGA+AQT IYP+DL+KTRLQ + 
Sbjct  240   AIKFYAYEIMKSAL---VGDEKHGEIGTLGRLVAGGSAGAIAQTIIYPLDLLKTRLQCHN  296

Query  1147  CEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQ  968
              E G+ P L + + DI + EGPRA YRG++PSLLGIIPYAGIDL  Y+ LK  AR  +  
Sbjct  297   -EPGRAPRLAKFTYDILIHEGPRALYRGLLPSLLGIIPYAGIDLTTYETLKIKARLLLPP  355

Query  967   DSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEG  788
              +EPGP V L  GT SGA GATCVYPLQ++RTR+QAQ + ++  Y GM D F  T+R EG
Sbjct  356   GTEPGPFVHLCCGTFSGAFGATCVYPLQLIRTRLQAQSSKSNERYTGMVDAFRHTYRKEG  415

Query  787   LRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             LRGFYKG  PN+LKVVP+ASITYLVYE MK  L +
Sbjct  416   LRGFYKGWLPNMLKVVPSASITYLVYEDMKTRLSI  450



>ref|XP_006394470.1| hypothetical protein EUTSA_v10004107mg [Eutrema salsugineum]
 gb|ESQ31756.1| hypothetical protein EUTSA_v10004107mg [Eutrema salsugineum]
Length=393

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/385 (70%), Positives = 320/385 (83%), Gaps = 4/385 (1%)
 Frame = -1

Query  2113  NPVMKPG-PVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ  1937
             NP  KPG   +MDHVL AL+ETKEER+ RIR+LF FFD+ N+GYLD  QIE+GLS+++I 
Sbjct  9     NPGKKPGGAATMDHVLLALRETKEERETRIRNLFEFFDNSNSGYLDDTQIEKGLSSLRIP  68

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
               YK+A++L +  D N+DGRVDY EFR+YMD KELELY IFQAIDV H+G I P+ELW+A
Sbjct  69    PKYKYARDLRKACDVNRDGRVDYEEFRRYMDAKELELYIIFQAIDVHHNGDICPDELWEA  128

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             LVKAGIEI D ELA F++HVDKDN+G+ITFEEWRDFLLL+PHEATIENIY + ERVCL+D
Sbjct  129   LVKAGIEISDKELASFMDHVDKDNNGIITFEEWRDFLLLHPHEATIENIYHHWERVCLID  188

Query  1576  IGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS  1397
             IGEQ VIP+GIS H   SK L+AGG+AGA SRTATAPLDRLKVVLQVQ T+A ++P +K 
Sbjct  189   IGEQVVIPDGISTHAQRSKLLLAGGLAGAVSRTATAPLDRLKVVLQVQRTKAGVVPTIKK  248

Query  1396  IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGL  1217
             IW+E  + GFFRGNG+NV KVAPESAIKF  YEMLK  IG   G +GDIGTSGRL++GGL
Sbjct  249   IWREDKLLGFFRGNGLNVTKVAPESAIKFAAYEMLKPIIG---GADGDIGTSGRLLSGGL  305

Query  1216  AGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGII  1037
             AGAVAQTAIYPMDLVKTRLQT   E GK P L +L+K+IW++EGPRAFY+G+ PSLLGI+
Sbjct  306   AGAVAQTAIYPMDLVKTRLQTCVSELGKTPKLWKLTKEIWIQEGPRAFYKGLCPSLLGIV  365

Query  1036  PYAGIDLAVYDALKNFARTYILQDS  962
             PYAGIDLA Y+ LK+ +RTYI  D+
Sbjct  366   PYAGIDLAAYETLKDLSRTYIHHDT  390


 Score = 88.2 bits (217),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 88/170 (52%), Gaps = 8/170 (5%)
 Frame = -1

Query  1207  VAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYA  1028
             V++TA  P+D +K  LQ    + G VP +    K IW  +    F+RG   ++  + P +
Sbjct  218   VSRTATAPLDRLKVVLQVQRTKAGVVPTI----KKIWREDKLLGFFRGNGLNVTKVAPES  273

Query  1027  GIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTH  848
              I  A Y+ LK         D + G   +L SG ++GA+  T +YP+ +V+TR+Q   + 
Sbjct  274   AIKFAAYEMLKPIIGG---ADGDIGTSGRLLSGGLAGAVAQTAIYPMDLVKTRLQTCVSE  330

Query  847   TSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMK  698
                  K ++ +    +  EG R FYKGL P+LL +VP A I    YE++K
Sbjct  331   LGKTPK-LWKLTKEIWIQEGPRAFYKGLCPSLLGIVPYAGIDLAAYETLK  379



>ref|XP_001777279.1| predicted protein [Physcomitrella patens]
 gb|EDQ57934.1| predicted protein [Physcomitrella patens]
Length=470

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/451 (58%), Positives = 340/451 (75%), Gaps = 5/451 (1%)
 Frame = -1

Query  2029  IRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKY  1850
             +R LF+  DS   GYL+  QIE GL ++      K+A ELL   D+N DG +D+ EF++Y
Sbjct  22    VRKLFNSLDSRKCGYLESKQIESGLQSLSFPFQRKYALELLEACDSNHDGHIDFAEFQRY  81

Query  1849  MDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVIT  1670
             M+DKE+EL+++FQAIDV H G + PEEL  AL  +G++++D EL  FV+++D+D +G IT
Sbjct  82    MNDKEVELFKLFQAIDVSHDGALQPEELQLALRNSGVQLEDHELDAFVQYIDRDKNGKIT  141

Query  1669  FEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGA  1490
             F EWRDFLLLYP E T+ NIY+Y E++CLVDIGEQAVIPEGI +H H  +YL AG +AGA
Sbjct  142   FNEWRDFLLLYPRETTLPNIYQYWEKICLVDIGEQAVIPEGIGEH-HRLRYLAAGAMAGA  200

Query  1489  ASRTATAPLDRLKVVLQVQT--TRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAI  1316
              SRTATAPLDRLKV+L +QT  + +SIM  +  I K  G  GFFRGN +NV KVAPESAI
Sbjct  201   VSRTATAPLDRLKVLLAIQTHSSTSSIMNGLVQIHKHNGAIGFFRGNALNVFKVAPESAI  260

Query  1315  KFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG  1136
             KFY YE++K  +    G +G+IGT GRL++GG AGA+AQT IYP+DL+KTRLQ +  E G
Sbjct  261   KFYAYEIMKRVVV-GDGKDGEIGTLGRLVSGGTAGAIAQTIIYPVDLLKTRLQCHN-EPG  318

Query  1135  KVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEP  956
             + P L + ++DI ++EGPRAFYRG++PSLLGIIPYAGIDLA Y+ LK  +R  +  ++EP
Sbjct  319   RAPQLVKFTRDILVQEGPRAFYRGLLPSLLGIIPYAGIDLATYETLKLKSRHLLPPETEP  378

Query  955   GPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGF  776
             GP++ L  GT SGALGATCVYPLQ++RTR+QAQ   ++  Y GM D F RT+R+EG+RGF
Sbjct  379   GPILHLCCGTFSGALGATCVYPLQLIRTRLQAQTLKSAVRYTGMADAFRRTYRNEGIRGF  438

Query  775   YKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             YKG  PN+LK VP+ASITYLVYE MK  L +
Sbjct  439   YKGWLPNMLKAVPSASITYLVYEDMKIRLSI  469



>gb|EMS49732.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Triticum 
urartu]
Length=354

 Score =   535 bits (1378),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 265/356 (74%), Positives = 309/356 (87%), Gaps = 6/356 (2%)
 Frame = -1

Query  1744  GIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQ  1565
             GIEIDD+ELARFVEHVDKDN+G+ITFEEWRDFL+LYP+EATIENIY + E      IGEQ
Sbjct  4     GIEIDDEELARFVEHVDKDNNGIITFEEWRDFLMLYPNEATIENIYHHWE-----SIGEQ  58

Query  1564  AVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKE  1385
             A IPEG+SKHV ASKYLIAGG+AGAASRTATAPLDRLKV++QVQTTR ++  AVK I+  
Sbjct  59    AAIPEGLSKHVSASKYLIAGGIAGAASRTATAPLDRLKVIMQVQTTRTTVTHAVKDIFIR  118

Query  1384  GGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGA  1208
             GG+ GFFRGNG+NV+KVAPESAI+FY YE LK  I ++KG ++  +G S RL+AGGLAGA
Sbjct  119   GGLLGFFRGNGLNVVKVAPESAIRFYAYETLKEYIMNSKGENKSAVGASERLVAGGLAGA  178

Query  1207  VAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYA  1028
             +AQTAIYP+DLVKTRLQT++CE GKVP LG LS+DI   EGPRAFYRG+VPSLLGI+PYA
Sbjct  179   IAQTAIYPIDLVKTRLQTFSCESGKVPSLGTLSRDILKHEGPRAFYRGLVPSLLGIVPYA  238

Query  1027  GIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTH  848
             GIDLAVY+ LK+ +RTYI++D+EPGPLVQLG GT+SGALGATCVYPLQV+RTR+QAQ  +
Sbjct  239   GIDLAVYETLKDASRTYIIKDTEPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQAQQAN  298

Query  847   TSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             +  AYKGM DVF RT RHEG+ GFYKG+ PNLLKVVPAASITYLVYE+MKK L LD
Sbjct  299   SEAAYKGMSDVFWRTLRHEGVSGFYKGILPNLLKVVPAASITYLVYEAMKKNLSLD  354



>ref|XP_006446898.1| hypothetical protein CICLE_v10015032mg [Citrus clementina]
 gb|ESR60138.1| hypothetical protein CICLE_v10015032mg [Citrus clementina]
Length=316

 Score =   521 bits (1342),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 250/316 (79%), Positives = 281/316 (89%), Gaps = 2/316 (1%)
 Frame = -1

Query  1621  IENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVL  1442
             +ENIY YLERVCLVDIGEQA IPEGISKHVHA++YLI+GGVAGA SRTATAPLDRLKVVL
Sbjct  1     MENIYHYLERVCLVDIGEQAAIPEGISKHVHANRYLISGGVAGATSRTATAPLDRLKVVL  60

Query  1441  QVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGD  1262
             QVQTTRA IMPA++ IW++GGISGFFRGNG+NV+KVAPESAIKFYTYE LK  I   +GD
Sbjct  61    QVQTTRAHIMPAIRDIWRDGGISGFFRGNGLNVIKVAPESAIKFYTYERLKKLIAKVEGD  120

Query  1261  E--GDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLRE  1088
             E   +IG SGRL AGGLAGAVAQTAIYPMDLVKTRLQTY CEGGKVP +G +S+DI ++E
Sbjct  121   EEKTNIGASGRLFAGGLAGAVAQTAIYPMDLVKTRLQTYVCEGGKVPKIGAMSRDILVQE  180

Query  1087  GPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALG  908
             GPRAFYRG+VPSLLGIIPYAGIDLA Y++ K  ++ YIL DSEPGPLVQLG GT SGALG
Sbjct  181   GPRAFYRGLVPSLLGIIPYAGIDLAAYESFKEMSKKYILHDSEPGPLVQLGCGTFSGALG  240

Query  907   ATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAAS  728
             ATCVYPLQVVRTRMQAQ  +T +AY GM DVF RTF+ EGLRGFYKGLFPNLLKVVP+AS
Sbjct  241   ATCVYPLQVVRTRMQAQRMNTESAYTGMSDVFKRTFKSEGLRGFYKGLFPNLLKVVPSAS  300

Query  727   ITYLVYESMKKTLDLD  680
             ITY+VYE+MKK+L+L+
Sbjct  301   ITYMVYEAMKKSLELE  316



>ref|XP_006446893.1| hypothetical protein CICLE_v10015524mg [Citrus clementina]
 gb|ESR60133.1| hypothetical protein CICLE_v10015524mg [Citrus clementina]
Length=317

 Score =   517 bits (1331),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 249/316 (79%), Positives = 279/316 (88%), Gaps = 2/316 (1%)
 Frame = -1

Query  1621  IENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVL  1442
             +ENIY YLERVCLVDIGEQA IPEGISKHVHA++YLIAGGVAGA SRTATAPLDRLKVVL
Sbjct  1     MENIYHYLERVCLVDIGEQAAIPEGISKHVHANRYLIAGGVAGATSRTATAPLDRLKVVL  60

Query  1441  QVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGD  1262
             QVQTTRA IMPA++ IW++GGI GFFRGNG+NVLKVAPESAIKFYTYE LK  I   +GD
Sbjct  61    QVQTTRAHIMPAIRDIWRDGGILGFFRGNGLNVLKVAPESAIKFYTYERLKKLIAKVEGD  120

Query  1261  E--GDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLRE  1088
             E   +IG SGRL AGGLAGA+AQTAIYPMDLVKTRLQTY CEGGKVP +G +S+DI ++E
Sbjct  121   EEKTNIGASGRLFAGGLAGAMAQTAIYPMDLVKTRLQTYVCEGGKVPKIGAMSRDILVQE  180

Query  1087  GPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALG  908
             GPRAFYRG+VPSLLGIIPYAGIDLA Y++ K  ++ YIL DSEPGPLVQLG GT SGALG
Sbjct  181   GPRAFYRGLVPSLLGIIPYAGIDLAAYESFKEMSKKYILHDSEPGPLVQLGCGTFSGALG  240

Query  907   ATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAAS  728
             ATCVYPLQVVRTRMQAQ  +T +AY GM DVF RTF+ EGLRGFYKGLF NLLKVVP+AS
Sbjct  241   ATCVYPLQVVRTRMQAQCMNTESAYTGMSDVFKRTFKSEGLRGFYKGLFSNLLKVVPSAS  300

Query  727   ITYLVYESMKKTLDLD  680
             ITY+VYE+MKK+L+L+
Sbjct  301   ITYMVYEAMKKSLELE  316



>ref|XP_010452693.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X4 [Camelina sativa]
Length=335

 Score =   503 bits (1296),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 249/343 (73%), Positives = 289/343 (84%), Gaps = 8/343 (2%)
 Frame = -1

Query  1708  VEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVH  1529
             +EHVDKDN+G ITFEEWRDFLLLYPHEATIENIY + ERVCL+DIGEQAVIP+GISKHV 
Sbjct  1     MEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHHWERVCLIDIGEQAVIPDGISKHVK  60

Query  1528  ASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGI  1349
              S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A ++P +K IW+E  + GFFRGNG+
Sbjct  61    RSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRAHAGVLPTIKKIWREDKLRGFFRGNGL  120

Query  1348  NVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVK  1169
             NV+KVAPESAIKF  YEMLK  IG   G++GDIGTSGRL+AGG+AGA+AQTAIYPMDLVK
Sbjct  121   NVMKVAPESAIKFCAYEMLKPMIG---GEDGDIGTSGRLLAGGMAGAIAQTAIYPMDLVK  177

Query  1168  TRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNF  989
             TRLQT   EGGK P L +L+KDIW+REGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ 
Sbjct  178   TRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGLFPSLLGIIPYAGIDLAAYETLKDL  237

Query  988   ARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFL  809
             +RTYIL D+EPGPL+QL  G  SGALGA+CVYPLQVVRTRMQA  + T+     M   F+
Sbjct  238   SRTYILHDTEPGPLIQLSCGMTSGALGASCVYPLQVVRTRMQADSSETT-----MKQEFM  292

Query  808   RTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             +T R EGLRGFY+G+ PNLLKVVPAASITY+VYE+MKK + LD
Sbjct  293   KTMRGEGLRGFYRGILPNLLKVVPAASITYIVYEAMKKNMALD  335



>ref|XP_010423228.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X3 [Camelina sativa]
Length=335

 Score =   503 bits (1296),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 248/343 (72%), Positives = 290/343 (85%), Gaps = 8/343 (2%)
 Frame = -1

Query  1708  VEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVH  1529
             +EHVDKDN+G ITFEEWRDFLLLYPHEATIENIY++ ERVCL+DIGEQAVIP+GISKHV 
Sbjct  1     MEHVDKDNNGTITFEEWRDFLLLYPHEATIENIYQHWERVCLIDIGEQAVIPDGISKHVK  60

Query  1528  ASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGI  1349
              S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A ++P +K IW+E  + GFFRGNG+
Sbjct  61    RSRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRAHAGVLPTIKKIWREDNLRGFFRGNGL  120

Query  1348  NVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVK  1169
             NV+KVAPESAIKF  YEMLK  IG   G++GDIGTSGRL+AGG+AGA+AQTAIYPMDLVK
Sbjct  121   NVMKVAPESAIKFCAYEMLKPMIG---GEDGDIGTSGRLLAGGMAGAIAQTAIYPMDLVK  177

Query  1168  TRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNF  989
             TRLQT   EGGK P L +L++DIW+REGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ 
Sbjct  178   TRLQTCVSEGGKAPKLWKLTQDIWVREGPRAFYKGLFPSLLGIIPYAGIDLAAYETLKDL  237

Query  988   ARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFL  809
             +RTYIL D+EPGPL+QL  G  SGALGA+CVYPLQVVRTRMQA  + T+     M   F+
Sbjct  238   SRTYILHDTEPGPLIQLSCGMTSGALGASCVYPLQVVRTRMQADSSETT-----MKQEFM  292

Query  808   RTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             +T R EGLRGFY+G+ PNLLKVVPAASITY+VYE+MKK + LD
Sbjct  293   KTMRGEGLRGFYRGILPNLLKVVPAASITYIVYEAMKKNMALD  335



>ref|XP_010442585.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Camelina sativa]
 ref|XP_010482433.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Camelina sativa]
Length=328

 Score =   495 bits (1275),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 244/332 (73%), Positives = 276/332 (83%), Gaps = 7/332 (2%)
 Frame = -1

Query  1669  FEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGA  1490
             FEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVIP+GISKHV  S Y IAGG+AGA
Sbjct  2     FEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPQGISKHVKRSNYFIAGGIAGA  61

Query  1489  ASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKF  1310
             ASRTATAPLDRLKV+LQ+Q T A I  A+K IWK+ G+ GFFRGNG+N++KVAPESAIKF
Sbjct  62    ASRTATAPLDRLKVLLQIQKTDAKIREAIKMIWKQDGVRGFFRGNGLNIVKVAPESAIKF  121

Query  1309  YTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG-  1136
             Y YE+ KNAIG   G D+ DIGT+ RL AGG+AGAVAQ +IYP+DLVKTRLQT T + G 
Sbjct  122   YAYELFKNAIGENMGEDKADIGTTARLFAGGMAGAVAQASIYPLDLVKTRLQTCTSQAGV  181

Query  1135  KVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEP  956
              VP LG L+KDI + EGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ +RTYILQD+EP
Sbjct  182   VVPKLGTLTKDILVHEGPRAFYKGLFPSLLGIIPYAGIDLAAYEKLKDLSRTYILQDAEP  241

Query  955   GPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGF  776
             GPLVQLG GTISGALGATCVYPLQVVRTRMQA+   TS     M  VF RT   EG +  
Sbjct  242   GPLVQLGCGTISGALGATCVYPLQVVRTRMQAERERTS-----MSGVFRRTISEEGYKAL  296

Query  775   YKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             YKGL PNLLKVVPAASITY+VYE+MKK+L+LD
Sbjct  297   YKGLLPNLLKVVPAASITYMVYEAMKKSLELD  328



>ref|XP_010442866.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Camelina sativa]
Length=328

 Score =   494 bits (1271),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 244/332 (73%), Positives = 276/332 (83%), Gaps = 7/332 (2%)
 Frame = -1

Query  1669  FEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGA  1490
             FEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVIP+GISKHV  S Y IAGG+AGA
Sbjct  2     FEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPQGISKHVKRSNYFIAGGIAGA  61

Query  1489  ASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKF  1310
             ASRTATAPLDRLKV+LQ+Q T A I  A+K IWK+ G+ GFFRGNG+ ++KVAPESAIKF
Sbjct  62    ASRTATAPLDRLKVLLQIQKTDAKIREAIKMIWKQDGVRGFFRGNGLIIVKVAPESAIKF  121

Query  1309  YTYEMLKNAIGHAKG-DEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG-  1136
             Y YE+ KNAIG   G D+ DIGT+GRL AGG+AGAVAQ +IYP+DLVKTRLQT T + G 
Sbjct  122   YAYELFKNAIGENMGEDKADIGTTGRLFAGGMAGAVAQASIYPLDLVKTRLQTCTSQAGV  181

Query  1135  KVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEP  956
              VP LG L+KDI + EGPRAFY+G+ PSLLGIIPYAGIDLA Y+ LK+ +RTYILQD+EP
Sbjct  182   VVPKLGSLTKDILVHEGPRAFYKGLFPSLLGIIPYAGIDLAAYEKLKDLSRTYILQDAEP  241

Query  955   GPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGF  776
             GPLVQLG GTISGALGATCVYPLQVVRTRMQA+   TS     M  VF RT   EG +  
Sbjct  242   GPLVQLGCGTISGALGATCVYPLQVVRTRMQAERERTS-----MSGVFRRTISEEGYKAL  296

Query  775   YKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             YKGL PNLLKVVPAASITY+VYE+MKK+L+LD
Sbjct  297   YKGLLPNLLKVVPAASITYMVYEAMKKSLELD  328



>ref|NP_001032121.1| ATP-Mg/Pi transporter [Arabidopsis thaliana]
 gb|AED97521.1| ATP-Mg/Pi transporter [Arabidopsis thaliana]
Length=335

 Score =   494 bits (1271),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 241/344 (70%), Positives = 281/344 (82%), Gaps = 10/344 (3%)
 Frame = -1

Query  1708  VEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVH  1529
             +EHVDKDN+G+ITFEEWRDFLLL PHEATIENIY + ERVCL+DIGEQAVIP+GIS H  
Sbjct  1     MEHVDKDNNGIITFEEWRDFLLLNPHEATIENIYHHWERVCLIDIGEQAVIPDGISAHAQ  60

Query  1528  ASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGI  1349
              SK L+AGG+AGA SRTATAPLDRLKV LQVQ T   ++P +K IW+E  + GFFRGNG+
Sbjct  61    RSKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTNLGVVPTIKKIWREDKLLGFFRGNGL  120

Query  1348  NVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVK  1169
             NV KVAPESAIKF  YEMLK  IG   G +GDIGTSGRL+AGGLAGAVAQTAIYPMDLVK
Sbjct  121   NVAKVAPESAIKFAAYEMLKPIIG---GADGDIGTSGRLLAGGLAGAVAQTAIYPMDLVK  177

Query  1168  TRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNF  989
             TRLQT+  E G  P L +L+KDIW++EGPRAFYRG+ PSL+GIIPYAGIDLA Y+ LK+ 
Sbjct  178   TRLQTFVSEVG-TPKLWKLTKDIWIQEGPRAFYRGLCPSLIGIIPYAGIDLAAYETLKDL  236

Query  988   ARTYILQDS-EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVF  812
             +R + L D+ EPGPL+QLG G  SGALGA+CVYPLQV+RTRMQA  + TS     M   F
Sbjct  237   SRAHFLHDTAEPGPLIQLGCGMTSGALGASCVYPLQVIRTRMQADSSKTS-----MGQEF  291

Query  811   LRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDLD  680
             L+T R EGL+GFY+G+FPN  KV+P+ASI+YLVYE+MKK L LD
Sbjct  292   LKTLRGEGLKGFYRGIFPNFFKVIPSASISYLVYEAMKKNLALD  335



>gb|KDO45960.1| hypothetical protein CISIN_1g039485mg, partial [Citrus sinensis]
Length=367

 Score =   466 bits (1198),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 224/284 (79%), Positives = 256/284 (90%), Gaps = 1/284 (0%)
 Frame = -1

Query  2113  NPVMKPG-PVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ  1937
             NPV K G  V+M+HVL AL E+KEER+ RIR+LF+FFD +N+GYLDYA+IE GLS++ I 
Sbjct  52    NPVKKAGTSVTMEHVLLALGESKEEREQRIRALFNFFDVNNSGYLDYAKIEAGLSSLNIP  111

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
             ++YK+A++LL V D+N+DGRV+Y EFR+YMDDKELELYRIFQAIDVEH+GGILPEEL+ A
Sbjct  112   SEYKYARDLLNVCDSNQDGRVEYQEFRRYMDDKELELYRIFQAIDVEHNGGILPEELYHA  171

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             LVKAGIEIDD+ELA FVE VDKDN+GVITFEEWRDFLLLYPHEAT+ENIY YLERVCLVD
Sbjct  172   LVKAGIEIDDEELATFVERVDKDNNGVITFEEWRDFLLLYPHEATMENIYHYLERVCLVD  231

Query  1576  IGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS  1397
             IGEQA IPEGISKHVHA++YLIAGGVAGA SRTATAPLDRLKVVLQVQTTRA IMPA++ 
Sbjct  232   IGEQAAIPEGISKHVHANRYLIAGGVAGATSRTATAPLDRLKVVLQVQTTRAHIMPAIRD  291

Query  1396  IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG  1265
             IW++GGISGFFRGNG+NVLKVAPESAIKFYTYE LK  I   KG
Sbjct  292   IWRDGGISGFFRGNGLNVLKVAPESAIKFYTYERLKKLIAKVKG  335


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 4/82 (5%)
 Frame = -1

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVP  1055
             LIAGG+AGA ++TA  P+D +K  LQ  T     +P +    +DIW   G   F+RG   
Sbjct  252   LIAGGVAGATSRTATAPLDRLKVVLQVQTTRAHIMPAI----RDIWRDGGISGFFRGNGL  307

Query  1054  SLLGIIPYAGIDLAVYDALKNF  989
             ++L + P + I    Y+ LK  
Sbjct  308   NVLKVAPESAIKFYTYERLKKL  329



>ref|XP_007137827.1| hypothetical protein PHAVU_009G158900g [Phaseolus vulgaris]
 gb|ESW09821.1| hypothetical protein PHAVU_009G158900g [Phaseolus vulgaris]
Length=343

 Score =   429 bits (1102),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 219/369 (59%), Positives = 266/369 (72%), Gaps = 38/369 (10%)
 Frame = -1

Query  2095  GPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAK  1916
             G VSMDH+LAAL ETKEER++RIRSLF+FFD+ N GYLD AQIE GLSA+QI  +YK+A+
Sbjct  5     GVVSMDHLLAALGETKEEREVRIRSLFNFFDAANNGYLDVAQIEVGLSALQIPPEYKYAR  64

Query  1915  ELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIE  1736
             EL  V DAN DGRV+Y EFR+YMDDKELELYRIFQAIDVEH G I+PEEL++AL+KAGIE
Sbjct  65    ELCEVCDANSDGRVEYHEFRRYMDDKELELYRIFQAIDVEHDGNIIPEELYEALLKAGIE  124

Query  1735  IDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVI  1556
             +DD+ELARFV+HVDKDN+G+ITFEEWRDFLLLYPHEATIENIY + ERVCLVDIGEQAVI
Sbjct  125   MDDEELARFVDHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVI  184

Query  1555  PEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGI  1376
             PEGISKH + +KY +AGGVAG+ SRT TAPLDRLKVVLQVQT  ASIMPAV  I K+ G+
Sbjct  185   PEGISKHANRTKYFLAGGVAGSISRTVTAPLDRLKVVLQVQTAHASIMPAVTKILKQDGL  244

Query  1375  SGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQT  1196
             SGFFR  G  V                                   +L  G ++GAV  T
Sbjct  245   SGFFREPGPLV-----------------------------------QLGCGTISGAVGAT  269

Query  1195  AIYPMDLVKTRLQTYTCEGGKVPHLGRLS--KDIWLREGPRAFYRGIVPSLLGIIPYAGI  1022
              +YP+ +++TRLQ  +       + G     +  +  EG   FY+G+ P+LL ++P A I
Sbjct  270   CVYPLQVIRTRLQAQSSNASDA-YKGMFDAFRRTFQLEGFIGFYKGLFPNLLKVVPAASI  328

Query  1021  DLAVYDALK  995
                VY+++K
Sbjct  329   TYVVYESMK  337


 Score =   177 bits (450),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 116/185 (63%), Gaps = 39/185 (21%)
 Frame = -1

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVP  1055
              +AGG+AG++++T   P+D +K  LQ  T     +P + ++ K    ++G   F+R    
Sbjct  198   FLAGGVAGSISRTVTAPLDRLKVVLQVQTAHASIMPAVTKILK----QDGLSGFFR----  249

Query  1054  SLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVR  875
                                            EPGPLVQLG GTISGA+GATCVYPLQV+R
Sbjct  250   -------------------------------EPGPLVQLGCGTISGAVGATCVYPLQVIR  278

Query  874   TRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKK  695
             TR+QAQ ++ S AYKGMFD F RTF+ EG  GFYKGLFPNLLKVVPAASITY+VYESMKK
Sbjct  279   TRLQAQSSNASDAYKGMFDAFRRTFQLEGFIGFYKGLFPNLLKVVPAASITYVVYESMKK  338

Query  694   TLDLD  680
              LDLD
Sbjct  339   NLDLD  343



>ref|XP_010444015.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like, 
partial [Camelina sativa]
Length=320

 Score =   415 bits (1067),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 199/293 (68%), Positives = 238/293 (81%), Gaps = 5/293 (2%)
 Frame = -1

Query  2113  NPVMKPGPV--SMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQI  1940
             NP  KP PV  +M+HVL AL+ETK+ER++RIR LF FFD+   G+LD  QIE+G+S++ I
Sbjct  9     NPGRKPRPVEATMEHVLVALRETKDEREMRIRKLFEFFDNSKLGFLDGTQIEKGMSSLSI  68

Query  1939  QADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWD  1760
                Y++A + L+V DAN+DGRVDY EFR+YMD KELELY+IFQAIDVEH+G I PEELW+
Sbjct  69    SPQYRYASDFLKVCDANRDGRVDYQEFRRYMDAKELELYKIFQAIDVEHNGDICPEELWE  128

Query  1759  ALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLV  1580
             AL KAGI+I D+ELA F++HVDKDN+G+ITFEEWRDFLLL PHEATIENIY + ERVCL+
Sbjct  129   ALDKAGIQIKDEELASFMDHVDKDNNGIITFEEWRDFLLLNPHEATIENIYHHWERVCLI  188

Query  1579  DIGEQAVIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVK  1400
             DIGEQAVIP+GIS H   SK L+AGG+AGA SRTATAPLDRLKV LQVQ T   ++P +K
Sbjct  189   DIGEQAVIPDGISTHAQRSKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTNLGVVPTIK  248

Query  1399  SIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTS  1241
              IW+E  + GFFRGNG+NV KVAPESAIKF  YEMLK  IG   G +GDIGTS
Sbjct  249   KIWREDKLLGFFRGNGLNVTKVAPESAIKFAAYEMLKPIIG---GADGDIGTS  298


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 4/83 (5%)
 Frame = -1

Query  1243  SGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRG  1064
             S  L+AGG+AGAV++TA  P+D +K  LQ      G VP +    K IW  +    F+RG
Sbjct  207   SKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTNLGVVPTI----KKIWREDKLLGFFRG  262

Query  1063  IVPSLLGIIPYAGIDLAVYDALK  995
                ++  + P + I  A Y+ LK
Sbjct  263   NGLNVTKVAPESAIKFAAYEMLK  285



>emb|CDX98981.1| BnaC09g48540D [Brassica napus]
Length=426

 Score =   410 bits (1055),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 211/379 (56%), Positives = 272/379 (72%), Gaps = 25/379 (7%)
 Frame = -1

Query  2065  ALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANK  1886
             AL+E+ +ER++RIRSLF FFD+   G+LDYAQIE+GL+++QI  +YK+A++L RV DAN+
Sbjct  47    ALRESNDEREVRIRSLFDFFDNSTLGFLDYAQIEKGLASLQIPPEYKYARDLFRVCDANR  106

Query  1885  DGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFV  1706
             DGRVDY EFR+Y+D KELELYRIFQAIDV H G ILPEELW+ALVKAGIE+DD+ELARFV
Sbjct  107   DGRVDYHEFRRYIDAKELELYRIFQAIDVAHHGCILPEELWEALVKAGIEMDDEELARFV  166

Query  1705  EHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHA  1526
             EHVDKDN+G ITFEEWRDFLLLYPHEATIENIY + ERVCL+DIGE AVIP+GIS+HV  
Sbjct  167   EHVDKDNNGTITFEEWRDFLLLYPHEATIENIYHHWERVCLIDIGEVAVIPDGISQHVKG  226

Query  1525  SKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKSIWKEGGISGFFRGNGIN  1346
             S+ L+AGG+AGA SRTATAPLDRLKVVLQVQ   A ++P V+ IW+E  ++GFFRGNG+N
Sbjct  227   SRLLLAGGLAGAVSRTATAPLDRLKVVLQVQRGHAGVLPTVRKIWREDKLTGFFRGNGLN  286

Query  1345  VLK---------------------VAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLI  1229
             V+K                     + P + I    YE LK+        + + G   +L 
Sbjct  287   VMKDIWVREGPRAFYKGLFPSLLGIVPYAGIDLAAYETLKDLSRTYILHDTEPGPLIQLS  346

Query  1228  AGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSL  1049
              G  +GA+  + +YP+ +V+TR+Q  + E        +  +     EG R FYRG++P+L
Sbjct  347   CGMTSGALGASCVYPLQVVRTRMQADSSETTMKQEFIKTMRG----EGVRGFYRGLLPNL  402

Query  1048  LGIIPYAGIDLAVYDALKN  992
             L ++P A I   VY+A+K 
Sbjct  403   LKVVPVASITYIVYEAMKK  421


 Score =   216 bits (549),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 135/193 (70%), Gaps = 22/193 (11%)
 Frame = -1

Query  1207  VAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRL-----------------SKDIWLREGPR  1079
             V++TA  P+D +K  LQ      G +P + ++                  KDIW+REGPR
Sbjct  239   VSRTATAPLDRLKVVLQVQRGHAGVLPTVRKIWREDKLTGFFRGNGLNVMKDIWVREGPR  298

Query  1078  AFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATC  899
             AFY+G+ PSLLGI+PYAGIDLA Y+ LK+ +RTYIL D+EPGPL+QL  G  SGALGA+C
Sbjct  299   AFYKGLFPSLLGIVPYAGIDLAAYETLKDLSRTYILHDTEPGPLIQLSCGMTSGALGASC  358

Query  898   VYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITY  719
             VYPLQVVRTRMQA  + T+     M   F++T R EG+RGFY+GL PNLLKVVP ASITY
Sbjct  359   VYPLQVVRTRMQADSSETT-----MKQEFIKTMRGEGVRGFYRGLLPNLLKVVPVASITY  413

Query  718   LVYESMKKTLDLD  680
             +VYE+MKK + LD
Sbjct  414   IVYEAMKKNMALD  426



>gb|KHN17449.1| Calcium-binding mitochondrial carrier protein SCaMC-2-A [Glycine 
soja]
Length=245

 Score =   393 bits (1009),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 184/245 (75%), Positives = 213/245 (87%), Gaps = 0/245 (0%)
 Frame = -1

Query  1414  MPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGR  1235
             MPAV  IWK+ G+ GFFRGNG+NV+KVAPESAIKFY YEMLKN IG A+  + DIGT+GR
Sbjct  1     MPAVMKIWKQDGLLGFFRGNGLNVVKVAPESAIKFYAYEMLKNVIGDAQDGKSDIGTAGR  60

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVP  1055
             L AGG+AGAVAQ AIYPMDLVKTRLQT   +GG+VP LG L+KDIW+ EGPRAFYRG+VP
Sbjct  61    LFAGGMAGAVAQMAIYPMDLVKTRLQTCASDGGRVPKLGTLTKDIWVHEGPRAFYRGLVP  120

Query  1054  SLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVR  875
             SLLG+IPYAGIDL  YD LK+ ++ YIL DS+PGPLVQLG GT+SGALGATCVYPLQV+R
Sbjct  121   SLLGMIPYAGIDLTAYDTLKDLSKRYILYDSDPGPLVQLGCGTVSGALGATCVYPLQVIR  180

Query  874   TRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKK  695
             TR+QAQP ++++AYKGM DVF +T + EG RGFYKGL PNLLKVVPAASITY+VYESMKK
Sbjct  181   TRLQAQPANSTSAYKGMSDVFWKTLKDEGFRGFYKGLIPNLLKVVPAASITYMVYESMKK  240

Query  694   TLDLD  680
             +LDLD
Sbjct  241   SLDLD  245


 Score = 89.0 bits (219),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 92/182 (51%), Gaps = 9/182 (5%)
 Frame = -1

Query  1516  LIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAV----KSIWKEGGISGFFRGNGI  1349
             L AGG+AGA ++ A  P+D +K  LQ   +    +P +    K IW   G   F+RG   
Sbjct  61    LFAGGMAGAVAQMAIYPMDLVKTRLQTCASDGGRVPKLGTLTKDIWVHEGPRAFYRGLVP  120

Query  1348  NVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVK  1169
             ++L + P + I    Y+ LK+        + D G   +L  G ++GA+  T +YP+ +++
Sbjct  121   SLLGMIPYAGIDLTAYDTLKDLSKRYILYDSDPGPLVQLGCGTVSGALGATCVYPLQVIR  180

Query  1168  TRLQTYTCEGGKVPHLGRLSKDIWLR---EGPRAFYRGIVPSLLGIIPYAGIDLAVYDAL  998
             TRLQ              +S   W     EG R FY+G++P+LL ++P A I   VY+++
Sbjct  181   TRLQAQPAN--STSAYKGMSDVFWKTLKDEGFRGFYKGLIPNLLKVVPAASITYMVYESM  238

Query  997   KN  992
             K 
Sbjct  239   KK  240



>gb|KHN46834.1| Calcium-binding mitochondrial carrier protein SCaMC-3 [Glycine 
soja]
Length=243

 Score =   389 bits (1000),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 185/248 (75%), Positives = 215/248 (87%), Gaps = 8/248 (3%)
 Frame = -1

Query  1414  MPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEG---DIGT  1244
             MPA+K IWK+GG+ GFFRGNG+NVLKVAPESAI+FY+YEMLK+ I  AKGDE    +IG 
Sbjct  1     MPAIKDIWKKGGLLGFFRGNGLNVLKVAPESAIRFYSYEMLKSFITRAKGDEAKAANIGA  60

Query  1243  SGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRG  1064
              GRL+AGG+AGAVAQTAIYPMDLVKTRLQT+ C+ G++P LG LSKDIW++EGPRAFYRG
Sbjct  61    MGRLLAGGIAGAVAQTAIYPMDLVKTRLQTHACKSGRIPSLGTLSKDIWVQEGPRAFYRG  120

Query  1063  IVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQ  884
             ++PSLLGIIPYAGIDLA Y+ LK+ ++ YIL D EPGPLVQLG GT+SG LGATCVYPLQ
Sbjct  121   LIPSLLGIIPYAGIDLAAYETLKDMSKQYILHDGEPGPLVQLGCGTVSGTLGATCVYPLQ  180

Query  883   VVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYES  704
             VVRTRMQAQ      +YKGM DVF +T  HEGLRGFYKG+FPNLLKVVP+ASITY+VYES
Sbjct  181   VVRTRMQAQ-----RSYKGMADVFRKTLEHEGLRGFYKGIFPNLLKVVPSASITYMVYES  235

Query  703   MKKTLDLD  680
             MKK+LDL+
Sbjct  236   MKKSLDLE  243


 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 102/191 (53%), Gaps = 8/191 (4%)
 Frame = -1

Query  1552  EGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAV----KSIWKE  1385
             E  + ++ A   L+AGG+AGA ++TA  P+D +K  LQ    ++  +P++    K IW +
Sbjct  52    EAKAANIGAMGRLLAGGIAGAVAQTAIYPMDLVKTRLQTHACKSGRIPSLGTLSKDIWVQ  111

Query  1384  GGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAV  1205
              G   F+RG   ++L + P + I    YE LK+        +G+ G   +L  G ++G +
Sbjct  112   EGPRAFYRGLIPSLLGIIPYAGIDLAAYETLKDMSKQYILHDGEPGPLVQLGCGTVSGTL  171

Query  1204  AQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAG  1025
               T +YP+ +V+TR+Q      G    +  + +     EG R FY+GI P+LL ++P A 
Sbjct  172   GATCVYPLQVVRTRMQAQRSYKG----MADVFRKTLEHEGLRGFYKGIFPNLLKVVPSAS  227

Query  1024  IDLAVYDALKN  992
             I   VY+++K 
Sbjct  228   ITYMVYESMKK  238



>gb|ESA19406.1| hypothetical protein GLOINDRAFT_135767 [Rhizophagus irregularis 
DAOM 181602]
Length=520

 Score =   398 bits (1022),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 221/501 (44%), Positives = 305/501 (61%), Gaps = 53/501 (11%)
 Frame = -1

Query  2056  ETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQ-ADYKFAKELLRVVDANKDG  1880
             E++ ER  RIR LF   D D  G L+   I +GL+ ++   +  K+A ELL+  D + DG
Sbjct  29    ESEIERISRIRKLFEELDYDKTGVLERKNILKGLNRLKNHPSKKKYASELLQRCDVSSDG  88

Query  1879  RVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEH  1700
              VD+ EF+ ++++KE EL+++F  ID  +   + PEEL  AL K+GI     EL RF+  
Sbjct  89    VVDFNEFKAFVEEKEKELFKLFLEIDKSNDMKLQPEELEIALRKSGINCTQAELKRFINT  148

Query  1699  VDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASK  1520
             +DKD +GVI F EWRDFLLL P E T+  I+ Y + +  V +  + +IP          K
Sbjct  149   MDKDQNGVIDFSEWRDFLLLLPRETTMSEIFEYYKVIAQVSMDGEVIIPP------TDPK  202

Query  1519  YLIAGGVAGAASRTATAPLDRLKVVLQVQT------------------TRA---------  1421
             YL+AG +AGA SRTATAP DRLKV LQ+QT                  T+A         
Sbjct  203   YLLAGAIAGAVSRTATAPFDRLKVYLQIQTISPQLLTNTVKNMIVQSETQASKRLVSPAS  262

Query  1420  -SIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEGDI  1250
              SI  A+KSI+  GG+  FFRGNG+NV K+APESAIKF+ YE  K A+ +  G  D   I
Sbjct  263   NSITNAIKSIYLSGGLVNFFRGNGLNVAKIAPESAIKFFAYEQSKVAVANLMGAKDTDSI  322

Query  1249  GTSGRLIAGGLAGAVAQTAIYPMDLVKTR------LQTYTCEGGKVPHLGRLSKDIWLRE  1088
             G SGR ++GGL G ++Q  IYP++ +KTR      L   T  GG V    + + ++W  +
Sbjct  323   GMSGRFLSGGLGGVISQFVIYPLETMKTRIMSSSGLSLNTSPGGSV--FLKTASEMWKTQ  380

Query  1087  GPRAFYRGIVPSLLGIIPYAGIDLAVYDALK----NFARTYILQDSEPGPLVQLGSGTIS  920
             G R+FY+G++P+L+G+ PYA +D++VY+ LK    N  +T +  +      V LG G IS
Sbjct  381   GLRSFYKGLLPALIGVFPYAAVDMSVYEGLKLAYINHEKT-LHNEKASSVFVSLGCGMIS  439

Query  919   GALGATCVYPLQVVRTRMQAQ--PTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLK  746
             G++GA+ VYPL +VRTR+QAQ  P H  T Y G FDV  +T+ +E LRGFYKGL P L+K
Sbjct  440   GSIGASIVYPLALVRTRLQAQGTPGHPQT-YTGAFDVIKKTYSNERLRGFYKGLVPALVK  498

Query  745   VVPAASITYLVYESMKKTLDL  683
             VVPAA+ITY+VY+  K  L+L
Sbjct  499   VVPAAAITYMVYDKTKSKLEL  519



>ref|XP_004512666.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
isoform X2 [Cicer arietinum]
Length=242

 Score =   359 bits (922),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 179/245 (73%), Positives = 206/245 (84%), Gaps = 11/245 (4%)
 Frame = -1

Query  2188  MSGAGEAVGHVNFPA---MTAKDRSECCNPVMKPGPVSMDHVLAALQETKEERDIRIRSL  2018
             MS AG+A+  ++F       A D     NP        MDHVL AL+ETKEER++RIRSL
Sbjct  1     MSEAGQAMD-MSFSKPKPSPAADHGRGTNP-------PMDHVLLALRETKEERELRIRSL  52

Query  2017  FSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDK  1838
             F+FFD+ N GYLDYA IE GLSA+QI  +YK+AKEL +V DA++DGR+DY +FR+YMDDK
Sbjct  53    FNFFDAANNGYLDYAHIEAGLSALQIPPEYKYAKELFKVCDADRDGRIDYHDFRRYMDDK  112

Query  1837  ELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEW  1658
             ELELYRIFQAIDVEH+G ILPEELWDALVKAGIEID+ ELARFVEHVDKDN+G+ITFEEW
Sbjct  113   ELELYRIFQAIDVEHNGCILPEELWDALVKAGIEIDEAELARFVEHVDKDNNGIITFEEW  172

Query  1657  RDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHASKYLIAGGVAGAASRT  1478
             RDFLLLYPHEAT+ENIY++ ERVCLVDIGEQAVIPEGISKHVH S+Y IAGG+AGAASRT
Sbjct  173   RDFLLLYPHEATMENIYQHWERVCLVDIGEQAVIPEGISKHVHRSRYFIAGGIAGAASRT  232

Query  1477  ATAPL  1463
             ATAPL
Sbjct  233   ATAPL  237



>ref|XP_005520980.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Pseudopodoces humilis]
Length=476

 Score =   364 bits (934),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 192/470 (41%), Positives = 287/470 (61%), Gaps = 14/470 (3%)
 Frame = -1

Query  2068  AALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDAN  1889
             AA  E   + D R  +LF   D +  G +D A+++ GL AM I    +  +++ +  D N
Sbjct  12    AAACEGNRDSDSRYANLFRKLDLNEDGRVDIAELQTGLRAMGIPLGKEAEEKIFKAGDTN  71

Query  1888  KDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARF  1709
             +DG++D+ EF +Y+ + E ++   F+++D  + G I   E+  +L   GI I + +  + 
Sbjct  72    QDGQLDFEEFMQYLKEHEKKMKLAFKSLDKNNDGKIEASEVVQSLKILGINISEKQAEKI  131

Query  1708  VEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVH  1529
             ++ +D D    + + EWRD  +  P  A IE I RY +   ++DIG+   +P+  ++   
Sbjct  132   LQSIDADGTMTVDWNEWRDHFMFNPA-ADIEEIIRYWKHSTVLDIGDSLTVPDEFTEEEK  190

Query  1528  AS----KYLIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISG  1370
              +    K L+AGGVAGA SRT TAPLDRLKV++QV   ++ + +I    K + KEGG+  
Sbjct  191   KTGQWWKQLLAGGVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNIASGFKQMLKEGGVRS  250

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAI  1190
              +RGNG+NV+K+APE+AIKF+ YE  K  +     D+G +GT  R ++G LAGA AQT+I
Sbjct  251   LWRGNGVNVVKIAPETAIKFWAYEQYKKILTR---DDGKLGTVERFVSGSLAGATAQTSI  307

Query  1189  YPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAV  1010
             YPM+++KTRL     + G+   +   +K I  REGP+AFY+G +P++LGIIPYAGIDLAV
Sbjct  308   YPMEVLKTRLAV--GKTGQYSGMFDCAKKILKREGPKAFYKGYIPNILGIIPYAGIDLAV  365

Query  1009  YDALKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAY  833
             Y+ LK+ +   Y    + PG  V LG GT+S   G    YPL ++RTRMQAQ +      
Sbjct  366   YELLKSTWLEHYASSSANPGVFVLLGCGTVSSTCGQLASYPLALIRTRMQAQASVEGAPQ  425

Query  832   KGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
               M D+F R    EGLRG Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  426   LNMVDLFQRIVATEGLRGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  475



>ref|XP_006676546.1| hypothetical protein BATDEDRAFT_9761, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF82382.1| hypothetical protein BATDEDRAFT_9761, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=453

 Score =   363 bits (932),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 198/457 (43%), Positives = 281/457 (61%), Gaps = 48/457 (11%)
 Frame = -1

Query  1936  ADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDA  1757
             + + +A+EL+R  D   DGR+ +PEF  ++ +KE EL ++FQ ID  +   I   EL  +
Sbjct  5     STFMYARELVRACDKTADGRITFPEFEAFVKEKEKELLQLFQEIDSGNDNVIHLTELLSS  64

Query  1756  LVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVD  1577
             +  AGI++ + EL +F+EHVDK NDGVI F EWRD+LLL P + T+ N++++   +  VD
Sbjct  65    VRAAGIDVSEQELQQFIEHVDKGNDGVIDFFEWRDYLLLLPQKTTLTNVFKFFNTLPNVD  124

Query  1576  IGEQAV-IPEGISKHVHAS--KYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRAS----  1418
             +   AV IP+ IS    ++  KY +AGG+AGA SRTATAPLDRLKV+LQ QT R      
Sbjct  125   LNADAVPIPDHISVPGFSARLKYFLAGGIAGAVSRTATAPLDRLKVLLQTQTFRPRTSYL  184

Query  1417  --IMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAI---GHAKGDEGD  1253
               ++ +V+ I+++GGI  F+RGNG+N++K+ PESA+KF+ +E +K+ I     +   +  
Sbjct  185   ELLLSSVRKIYQDGGILSFYRGNGLNIVKIIPESALKFFIFEYVKDIIRSRSDSPTSDNA  244

Query  1252  IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEG-----GKVPHLGRLSKD-----  1103
             +G  GR I+GG+AG V+Q AIYP++  KTR+      G      ++  +G+L KD     
Sbjct  245   LGVGGRFISGGIAGLVSQFAIYPIETTKTRMMAQITNGAPHKLARLESIGQLHKDSTIYD  304

Query  1102  ----IWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDSEPGPL----  947
                 +W   G RAFYRG +P+L+GI+PYAGIDLAV++ LK   ++YI       P     
Sbjct  305   TVRHMWTEGGIRAFYRGCIPALVGIVPYAGIDLAVFETLK---QSYISWSRSRDPANFPF  361

Query  946   ---------VQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRH  794
                      V L  G ISG  GA  VYPL +VRTR      +  T Y+  FDV  +TF  
Sbjct  362   GSTPHLSTPVILMFGMISGTCGAVLVYPLSLVRTR------YHPTFYRNSFDVVKKTFVK  415

Query  793   EGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             EG+ GFYKGL P L KV+PA SI+Y VYE  K+ L+L
Sbjct  416   EGMLGFYKGLIPTLFKVLPAVSISYWVYEKSKRALNL  452



>ref|XP_010224133.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Tinamus guttatus]
Length=497

 Score =   363 bits (931),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 196/471 (42%), Positives = 286/471 (61%), Gaps = 14/471 (3%)
 Frame = -1

Query  2071  LAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDA  1892
             +AA  E   + D R  +LF   D +  G +D A+++ GL AM I    +  +++ +  D 
Sbjct  32    MAAACEGGRDADSRYANLFRKLDLNEDGRVDIAELQTGLRAMGIPLGKEAEEKIFKAGDT  91

Query  1891  NKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELAR  1712
             N+DG++D+ EF +Y+ D E ++   F+++D  + G I   E+  +L   GI I + +  +
Sbjct  92    NQDGQLDFEEFMQYLKDHEKKMKLAFKSLDKNNDGKIEASEVVQSLKILGINISEKQAEK  151

Query  1711  FVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHV  1532
              ++ +D D    + + EWRD  +  P  A IE I RY +   ++DIG+   IP+  ++  
Sbjct  152   ILQSIDADGTMTVDWNEWRDHFMFNPA-ADIEEIIRYWKHSTVLDIGDSLTIPDEFTEEE  210

Query  1531  HAS----KYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRAS---IMPAVKSIWKEGGIS  1373
               +    K L+AGGVAGA SRT TAPLDRLKV++QV  +++S   I    K + KEGGI 
Sbjct  211   KKTGQWWKQLLAGGVAGAVSRTGTAPLDRLKVMMQVHGSKSSKMNIASGFKQMVKEGGIR  270

Query  1372  GFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTA  1193
               +RGNG+NV+K+APE+AIKF+ YE  K  +     D+G +GT  R ++G LAGA AQT+
Sbjct  271   SLWRGNGVNVVKIAPETAIKFWAYEQYKKILSK---DDGKLGTIERFVSGSLAGATAQTS  327

Query  1192  IYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLA  1013
             IYPM+++KTRL     + G+   +   +K I  REG +AFY+G +P++LGIIPYAGIDLA
Sbjct  328   IYPMEVLKTRLAV--GKTGQYSGMFDCAKKILKREGVKAFYKGYIPNILGIIPYAGIDLA  385

Query  1012  VYDALKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTA  836
             VY+ LK  +   Y    + PG LV LG GTIS   G    YPL +VRTRMQAQ +     
Sbjct  386   VYELLKTTWLEHYASSSANPGVLVLLGCGTISSTCGQLASYPLALVRTRMQAQASVEGAP  445

Query  835   YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
                M  +F R    EG+RG Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  446   QLNMVGLFQRIIATEGVRGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  496



>gb|KGL84922.1| Calcium-binding mitochondrial carrier protein SCaMC-1, partial 
[Tinamus guttatus]
Length=465

 Score =   361 bits (927),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 196/470 (42%), Positives = 285/470 (61%), Gaps = 14/470 (3%)
 Frame = -1

Query  2068  AALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDAN  1889
             AA  E   + D R  +LF   D +  G +D A+++ GL AM I    +  +++ +  D N
Sbjct  1     AAACEGGRDADSRYANLFRKLDLNEDGRVDIAELQTGLRAMGIPLGKEAEEKIFKAGDTN  60

Query  1888  KDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARF  1709
             +DG++D+ EF +Y+ D E ++   F+++D  + G I   E+  +L   GI I + +  + 
Sbjct  61    QDGQLDFEEFMQYLKDHEKKMKLAFKSLDKNNDGKIEASEVVQSLKILGINISEKQAEKI  120

Query  1708  VEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVH  1529
             ++ +D D    + + EWRD  +  P  A IE I RY +   ++DIG+   IP+  ++   
Sbjct  121   LQSIDADGTMTVDWNEWRDHFMFNPA-ADIEEIIRYWKHSTVLDIGDSLTIPDEFTEEEK  179

Query  1528  AS----KYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRAS---IMPAVKSIWKEGGISG  1370
              +    K L+AGGVAGA SRT TAPLDRLKV++QV  +++S   I    K + KEGGI  
Sbjct  180   KTGQWWKQLLAGGVAGAVSRTGTAPLDRLKVMMQVHGSKSSKMNIASGFKQMVKEGGIRS  239

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAI  1190
              +RGNG+NV+K+APE+AIKF+ YE  K  +     D+G +GT  R ++G LAGA AQT+I
Sbjct  240   LWRGNGVNVVKIAPETAIKFWAYEQYKKILSK---DDGKLGTIERFVSGSLAGATAQTSI  296

Query  1189  YPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAV  1010
             YPM+++KTRL     + G+   +   +K I  REG +AFY+G +P++LGIIPYAGIDLAV
Sbjct  297   YPMEVLKTRLAV--GKTGQYSGMFDCAKKILKREGVKAFYKGYIPNILGIIPYAGIDLAV  354

Query  1009  YDALKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAY  833
             Y+ LK  +   Y    + PG LV LG GTIS   G    YPL +VRTRMQAQ +      
Sbjct  355   YELLKTTWLEHYASSSANPGVLVLLGCGTISSTCGQLASYPLALVRTRMQAQASVEGAPQ  414

Query  832   KGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
               M  +F R    EG+RG Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  415   LNMVGLFQRIIATEGVRGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  464



>ref|XP_005050523.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X2 [Ficedula albicollis]
Length=476

 Score =   358 bits (919),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 190/470 (40%), Positives = 285/470 (61%), Gaps = 14/470 (3%)
 Frame = -1

Query  2068  AALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDAN  1889
             AA  +   + D R  +LF   D +  G +D A+++ GL AM I    +  +++ +  D N
Sbjct  12    AAACDGNRDGDSRYANLFRKLDLNEDGRVDIAELQTGLRAMGIPLGKEAEEKIFKAGDTN  71

Query  1888  KDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARF  1709
             +DG++D+ EF +Y+ + E ++   F+++D  + G I   E+  +L   GI I + +  + 
Sbjct  72    QDGQLDFEEFMQYLKEHEKKMKLAFKSLDKNNDGKIEASEVVQSLKILGINISEKQAEKI  131

Query  1708  VEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVH  1529
             ++ +D D    + + EWRD  +  P    IE I RY +   ++DIG+   +P+  ++   
Sbjct  132   LQSIDADGTMTVDWNEWRDHFMFNPA-TDIEEIIRYWKHSTVLDIGDSLTVPDEFTEEEK  190

Query  1528  AS----KYLIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISG  1370
              +    K L+AGGVAGA SRT TAPLDRLKV++QV   ++ + +I    K + KEGG+  
Sbjct  191   KTGQWWKQLLAGGVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNIASGFKQMLKEGGVRS  250

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAI  1190
              +RGNG+NV+K+APE+AIKF+ YE  K  +     D+G +GT  R ++G LAGA AQT+I
Sbjct  251   LWRGNGVNVVKIAPETAIKFWAYEQYKKILTR---DDGKLGTVERFVSGSLAGATAQTSI  307

Query  1189  YPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAV  1010
             YPM+++KTRL     + G+   +   +K I  REGP+AFY+G +P++LGIIPYAGIDLAV
Sbjct  308   YPMEVLKTRLAV--GKTGQYSGMFDCAKKILKREGPKAFYKGYIPNILGIIPYAGIDLAV  365

Query  1009  YDALKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAY  833
             Y+ LK+ +   Y    + PG  V LG GTIS   G    YPL ++RTRMQAQ +      
Sbjct  366   YELLKSTWLEHYASSSANPGVFVLLGCGTISSTCGQLASYPLALIRTRMQAQASVEGAPQ  425

Query  832   KGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
               M  +F R    EGLRG Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  426   LNMVGLFQRIVATEGLRGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  475



>emb|CDH53071.1| mitochondrial substrate carrier family protein [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=487

 Score =   357 bits (917),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 207/489 (42%), Positives = 289/489 (59%), Gaps = 23/489 (5%)
 Frame = -1

Query  2098  PGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAM-QIQADYKF  1922
             P PVS +  L+   ET  ERD RIR LF   D + +G+LD   I +G + M  + A  K+
Sbjct  4     PMPVSTEFYLS---ETPTERDRRIRDLFDTLDRNKSGHLDAEAIRKGFTQMTHLPARNKY  60

Query  1921  AKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAG  1742
               ELL   D   DG VD+ EF+ Y+ DKE EL+++FQ ID    G + P +L  AL   G
Sbjct  61    VNELLDRCDTKHDGYVDFHEFKAYVCDKERELWQLFQTIDRSGDGRLRPSDLETALRIKG  120

Query  1741  IEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQA  1562
             IE+  +E   F++ +D D +GVI F E+++FLLL P +A +  +YRY +    +    + 
Sbjct  121   IEVSREEFMDFMQLMDLDGNGVIDFHEFKNFLLLLP-QANMSEVYRYYQASTRLSPDAEV  179

Query  1561  VIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQV-QTTRASIMPAVKSIWKE  1385
              IP       HA  YL+AGG AGA SRT TAP DRLKV L   Q +  S+  A+  I+++
Sbjct  180   TIPPTDETSSHALGYLLAGGFAGACSRTCTAPFDRLKVYLITNQNSSVSLRQAITRIYQQ  239

Query  1384  GGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEGDIGTSGRLIAGGLAG  1211
             GG  GFF GNG+NV+K+ PESAIKFY+YE  K  +    G  D+  I T+ R +AGG AG
Sbjct  240   GGWRGFFVGNGLNVMKIIPESAIKFYSYETCKRLVATTFGYDDKDSIPTTARFMAGGTAG  299

Query  1210  AVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLS------KDIWLREGPRAFYRGIVPSL  1049
               AQ +IYP++ +KTR+ +   E GKV +  + S      K ++ + G RAF+ G+   L
Sbjct  300   MCAQFSIYPVETLKTRVMSLQRE-GKVTNSRQHSIILDTIKSMYTKGGIRAFWPGLTLGL  358

Query  1048  LGIIPYAGIDLAVYDALKNFARTYILQ-----DSEPGPLVQLGSGTISGALGATCVYPLQ  884
             +G+ PY  +DL +Y+ LK    TY+ +     + +P  LV    G ISG++GAT VYPL 
Sbjct  359   IGVFPYQALDLGIYETLKLTYLTYMEEKTGGTNRQPSVLVLWACGMISGSIGATSVYPLN  418

Query  883   VVRTRMQAQ--PTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVY  710
             V+RTR+QAQ  P H    Y   +     T++  G+R FY+GL P LLKVVPA SI+Y+ Y
Sbjct  419   VIRTRLQAQGTPAH-PVYYNSPWHAVQMTYKVGGIREFYRGLGPTLLKVVPAISISYVTY  477

Query  709   ESMKKTLDL  683
             E  K+ LD+
Sbjct  478   EWSKRQLDI  486



>ref|XP_006270480.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Alligator mississippiensis]
Length=478

 Score =   357 bits (915),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 194/471 (41%), Positives = 286/471 (61%), Gaps = 15/471 (3%)
 Frame = -1

Query  2068  AALQETKEER-DIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDA  1892
             AA QE      + R   LF   D++  G +D A+++ GLSAM I       +++ +  D 
Sbjct  13    AACQEGGGGGGESRYEKLFKKLDANADGRVDIAELQTGLSAMGIPLGKAAEEKIFQAGDT  72

Query  1891  NKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELAR  1712
             N+DG++D+ EF +Y+ D E ++   F+++D  + G I   E+  AL   GI I + +  +
Sbjct  73    NQDGQLDFEEFMQYLKDHEKKMKLAFKSLDKNNDGKIEASEVVQALKILGINISERQAEK  132

Query  1711  FVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHV  1532
              ++ +D D    + + EWRD  +  P    IE+I RY +   ++DIG+   IP+  ++  
Sbjct  133   ILQSIDADGTMTVDWNEWRDHFMFNPA-TDIEDIIRYWKHSTVLDIGDSLTIPDEFTEEE  191

Query  1531  HAS----KYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAV---KSIWKEGGIS  1373
               S    K L++GGVAGA SRT TAPLDRLKV++QV +++++ M  V   K + KEGGI 
Sbjct  192   KKSGQWWKQLLSGGVAGAVSRTGTAPLDRLKVMMQVHSSKSNKMNIVDGFKQMLKEGGIR  251

Query  1372  GFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTA  1193
               +RGNG+NV+K+APE+AIKF+ YE  K    +    +G IG   R I+G LAGA AQT+
Sbjct  252   SLWRGNGVNVVKIAPETAIKFWAYEQYKKLFAN---KDGKIGMIERFISGSLAGATAQTS  308

Query  1192  IYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLA  1013
             IYPM+++KTRL     + G+   +   +K I  REG +AFY+G +P++LGIIPYAGIDLA
Sbjct  309   IYPMEVLKTRLAV--GKTGQYSGMFDCAKKILKREGVKAFYKGYIPNILGIIPYAGIDLA  366

Query  1012  VYDALKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTA  836
             VY+ALKN +   Y    + PG LV LG GT S   G    YPL ++RTRMQAQ +     
Sbjct  367   VYEALKNTWLEHYASDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRMQAQASVEGAP  426

Query  835   YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
                M  +F +    EG++G Y+G+ PN +KV+PA SI+Y+VYE MK+ + +
Sbjct  427   QLNMVALFRKIISAEGVQGLYRGITPNFMKVLPAVSISYVVYEKMKQNVGI  477



>ref|XP_005487153.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Zonotrichia albicollis]
Length=476

 Score =   357 bits (915),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 187/458 (41%), Positives = 280/458 (61%), Gaps = 14/458 (3%)
 Frame = -1

Query  2032  RIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRK  1853
             R  +LF   D +  G +D A+++ GL AM I    +  +++ +  D N+DG++D+ EF +
Sbjct  24    RYANLFRKLDLNEDGRVDIAELQTGLRAMGIPLGKEAEEKIFKAGDTNQDGQLDFEEFMQ  83

Query  1852  YMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVI  1673
             Y+ + E ++   F+++D  + G I   E+  +L   GI I + +  + ++ +D D    +
Sbjct  84    YLKEHEKKMKLAFKSLDKNNDGKIEASEVVQSLKILGINISEKQAEKILQSIDADGTMTV  143

Query  1672  TFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLIAG  1505
              + EWRD  +  P    IE I RY +   ++DIG+   +P+  ++    S    K L+AG
Sbjct  144   DWNEWRDHFMFNPA-TDIEEIIRYWKHSTVLDIGDSLTVPDEFTEEEKKSGQWWKQLLAG  202

Query  1504  GVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISGFFRGNGINVLKV  1334
             GVAGA SRT TAPLDRLKV++QV   ++ + +I    K + KEGG+   +RGNG+NV+K+
Sbjct  203   GVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNIASGFKQMLKEGGVRSLWRGNGVNVVKI  262

Query  1333  APESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQT  1154
             APE+AIKF+ YE  K  +     D+G +GT  R ++G LAGA AQT+IYPM+++KTRL  
Sbjct  263   APETAIKFWAYEQYKKILTR---DDGKLGTVERFVSGSLAGATAQTSIYPMEVLKTRLAV  319

Query  1153  YTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-FARTY  977
                + G+   +   +K I  REGP+AFY+G +P++LGIIPYAGIDLAVY+ LK+ +   Y
Sbjct  320   --GKTGQYSGMFDCAKKILKREGPKAFYKGYIPNILGIIPYAGIDLAVYELLKSTWLEHY  377

Query  976   ILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFR  797
                 + PG  V LG GT+S   G    YPL ++RTRMQAQ +        M  +F R   
Sbjct  378   ASSSANPGVFVLLGCGTVSSTCGQLASYPLALIRTRMQAQASVEGAPQLSMVGLFQRIVA  437

Query  796   HEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
              EGLRG Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  438   TEGLRGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  475



>ref|XP_002841552.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ85743.1| unnamed protein product [Tuber melanosporum]
Length=498

 Score =   357 bits (915),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 200/505 (40%), Positives = 296/505 (59%), Gaps = 57/505 (11%)
 Frame = -1

Query  2059  QETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQ--IQADYKFAKELLRVVDANK  1886
             +E+++ RD R+  LF   D+ + G+LD   + RGL  +   ++       ++L  VD +K
Sbjct  4     RESQKARDERLLKLFKSLDTRSEGHLDLEGLRRGLKRINHPLKDAEHLLHDILEAVDTSK  63

Query  1885  DGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFV  1706
             DG + Y EF+ + +  + EL+ IF ++D++ +G I   EL  AL +AG+ +D   L  F 
Sbjct  64    DGLIQYSEFKHFFESADRELWHIFTSVDLDRNGNIDKAELRIALSRAGLVVDTKRLQEFF  123

Query  1705  EHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEG---ISKH  1535
             + +D++NDGVI +EEWRDFL+  PHEA+++ IY Y      V+       PEG   +S  
Sbjct  124   DSMDRNNDGVICYEEWRDFLMFMPHEASLKTIYSYYLSTVNVN-------PEGDVSLSDE  176

Query  1534  VH--ASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRAS-------------------  1418
             ++     Y +AGG+AGA SRTATAP DR+KV L  QT  ++                   
Sbjct  177   INHLGLGYFLAGGIAGAISRTATAPFDRIKVYLIAQTGNSTAKKAIEAVTQGEAVQAAKK  236

Query  1417  ----IMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEG  1256
                 I  +++++W+ GG+  FF GNG+NV+K+ PESAIKF ++E  K A+   +G  D  
Sbjct  237   AAGPIKDSIRALWRAGGVRSFFAGNGLNVVKILPESAIKFGSFEAAKRALSRLEGTNDAS  296

Query  1255  DIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLS--KDIWLREGP  1082
             +I    R +AGG+ G V+Q +IYP+D +K R+Q    E G   +   L   +  W   GP
Sbjct  297   NISPISRFLAGGIGGVVSQFSIYPIDTLKFRMQCELVENGSTGNKLILETFRKTWSNGGP  356

Query  1081  RAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYIL----------QDSEPGPLVQLGS  932
             +AFY+G+  +L+GI PY+ IDL  ++ +K   R+Y            +D E    V LG 
Sbjct  357   QAFYKGLPLALIGIFPYSAIDLGTFEYMK---RSYTARKAKKLKCDEKDVEVPNWVVLGI  413

Query  931   GTISGALGATCVYPLQVVRTRMQAQPT--HTSTAYKGMFDVFLRTFRHEGLRGFYKGLFP  758
             G  SG++GAT VYP+ V+RTR+QAQ T  H  T Y GM+DV ++T+  EG RG ++GL P
Sbjct  414   GATSGSVGATMVYPINVLRTRLQAQGTAQHPQT-YTGMWDVAVKTYSAEGFRGMFRGLTP  472

Query  757   NLLKVVPAASITYLVYESMKKTLDL  683
             NLLKVVPA SI+YLVYE+ KKT+ L
Sbjct  473   NLLKVVPAVSISYLVYENSKKTMGL  497



>ref|XP_002195432.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Taeniopygia guttata]
Length=476

 Score =   356 bits (913),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 189/470 (40%), Positives = 285/470 (61%), Gaps = 14/470 (3%)
 Frame = -1

Query  2068  AALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDAN  1889
             AA  +   + + R  +LF   D +  G +D A+++ GL AM I    +  +++ +  D N
Sbjct  12    AAACDGNRDGESRYANLFRKLDLNEDGRVDIAELQTGLRAMGIPLGKEAEEKIFKAGDTN  71

Query  1888  KDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARF  1709
             +DG++D+ EF +Y+ + E ++   F+++D  + G I   E+  +L   GI I + +  + 
Sbjct  72    QDGQLDFEEFMQYLKEHEKKMKLAFKSLDKNNDGKIEASEVVQSLKILGINISEKQAEKI  131

Query  1708  VEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVH  1529
             ++ +D D    + + EWRD  +  P    IE I RY +   ++DIG+   +P+  ++   
Sbjct  132   LQSIDADGTMTVDWNEWRDHFMFNPA-TDIEEIIRYWKHSTVLDIGDSLTVPDEFTEEEK  190

Query  1528  AS----KYLIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISG  1370
              +    K L+AGGVAGA SRT TAPLDRLKV++QV   ++ + +I    K + KEGG+  
Sbjct  191   KTGQWWKQLLAGGVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNIASGFKQMLKEGGVRS  250

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAI  1190
              +RGNG+NV+K+APE+AIKF+ YE  K  +     D+G +GT  R ++G LAGA AQT+I
Sbjct  251   LWRGNGVNVVKIAPETAIKFWAYEQYKKILTR---DDGKLGTVERFVSGSLAGATAQTSI  307

Query  1189  YPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAV  1010
             YPM+++KTRL     + G+   +   +K I  REGP+AFY+G +P++LGIIPYAGIDLAV
Sbjct  308   YPMEVLKTRLAV--GKTGQYSGMFDCAKKILKREGPKAFYKGYIPNILGIIPYAGIDLAV  365

Query  1009  YDALKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAY  833
             Y+ LK+ +   Y    + PG  V LG GTIS   G    YPL ++RTRMQAQ +      
Sbjct  366   YELLKSTWLEHYASSSANPGVFVLLGCGTISSTCGQLASYPLALIRTRMQAQASVEGAPQ  425

Query  832   KGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
               M  +F R    EGLRG Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  426   LSMVGLFQRIVATEGLRGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  475



>ref|XP_009086732.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Serinus canaria]
Length=476

 Score =   355 bits (912),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/470 (40%), Positives = 285/470 (61%), Gaps = 14/470 (3%)
 Frame = -1

Query  2068  AALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDAN  1889
             AA  +   + + R  +LF   D +  G +D A+++ GL AM I    +  +++ +  D N
Sbjct  12    AAACDGNRDGESRYANLFRKLDLNEDGRVDIAELQTGLRAMGIPLGKEAEEKIFKAGDTN  71

Query  1888  KDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARF  1709
             +DG++D+ EF +Y+ + E ++   F+++D  + G I   E+  +L   GI I + +  + 
Sbjct  72    QDGQLDFEEFMQYLKEHEKKMKLAFKSLDKNNDGKIEASEVVQSLKILGINISEKQAEKI  131

Query  1708  VEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVH  1529
             ++ +D D    + + EWRD  +  P    IE I RY +   ++DIG+   +P+  ++   
Sbjct  132   LQSIDADGTMTVDWNEWRDHFMFNPA-TDIEEIIRYWKHSTVLDIGDSLTVPDEFTEEEK  190

Query  1528  AS----KYLIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISG  1370
              +    K L+AGGVAGA SRT TAPLDRLKV++QV   ++ + +I    K + KEGG+  
Sbjct  191   KTGQWWKQLLAGGVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNIASGFKQMLKEGGVRS  250

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAI  1190
              +RGNG+NV+K+APE+AIKF+ YE  K  +     D+G +GT  R ++G LAGA AQT+I
Sbjct  251   LWRGNGVNVVKIAPETAIKFWAYEQYKKILTR---DDGKLGTVERFVSGSLAGATAQTSI  307

Query  1189  YPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAV  1010
             YPM+++KTRL     + G+   +   +K I  REGP+AFY+G +P++LGIIPYAGIDLAV
Sbjct  308   YPMEVLKTRLAV--GKTGQYSGMFDCAKKILKREGPKAFYKGYIPNILGIIPYAGIDLAV  365

Query  1009  YDALKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAY  833
             Y+ LK+ +   Y    + PG  V LG GT+S   G    YPL ++RTRMQAQ +      
Sbjct  366   YELLKSTWLEHYASSSANPGVFVLLGCGTVSSTCGQLASYPLALIRTRMQAQASVEGAPQ  425

Query  832   KGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
               M  +F R    EGLRG Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  426   LSMVGLFQRIVATEGLRGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  475



>emb|CDS14214.1| hypothetical protein LRAMOSA06384 [Absidia idahoensis var. thermophila]
Length=487

 Score =   355 bits (912),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 206/489 (42%), Positives = 288/489 (59%), Gaps = 23/489 (5%)
 Frame = -1

Query  2098  PGPVSMDHVLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAM-QIQADYKF  1922
             P PVS +  L+   ET  ERD RIR LF   D + +G LD   I +G + M  + A  K+
Sbjct  4     PMPVSTEFYLS---ETPTERDRRIRDLFDTLDRNKSGLLDAEAIRKGFTQMTHLPARNKY  60

Query  1921  AKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAG  1742
               ELL   D   DG VD+ EF+ Y+ DKE EL+++FQ ID    G + P +L  AL   G
Sbjct  61    VNELLDRCDTKHDGYVDFYEFKAYVCDKERELWQLFQTIDRSGDGRLRPSDLETALRIKG  120

Query  1741  IEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQA  1562
             IE+  +E   F++ +D D +GVI F E+++FLLL P +A +  +YRY +    +    + 
Sbjct  121   IEVSREEFMDFMQLMDLDGNGVIDFHEFKNFLLLLP-QANMSEVYRYYQSSTRLSPDAEV  179

Query  1561  VIPEGISKHVHASKYLIAGGVAGAASRTATAPLDRLKVVLQV-QTTRASIMPAVKSIWKE  1385
              IP       HA  YL+AGG AGA SRT TAP DRLKV L   Q++  S+  A+  I+++
Sbjct  180   TIPPTDETSSHALGYLLAGGFAGACSRTCTAPFDRLKVYLITNQSSSVSLRQAISHIYQQ  239

Query  1384  GGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEGDIGTSGRLIAGGLAG  1211
             GG  GFF GNG+NV+K+ PESAIKFY+YE  K  I    G  D+  I T+ R +AGG AG
Sbjct  240   GGWRGFFVGNGLNVMKIVPESAIKFYSYETCKRLIATTFGYDDKDSIPTTARFMAGGTAG  299

Query  1210  AVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLS------KDIWLREGPRAFYRGIVPSL  1049
               AQ +IYP++ +KTR+ +   E G+V    + S      K ++ + G RAF+ G+   L
Sbjct  300   MCAQFSIYPVETLKTRVMSLQRE-GRVTSSRQHSIILDTIKSMYTKGGIRAFWPGLTLGL  358

Query  1048  LGIIPYAGIDLAVYDALKNFARTYILQ-----DSEPGPLVQLGSGTISGALGATCVYPLQ  884
             +G+ PY  +DL +Y+ LK    TY+ +     + +P  LV    G +SG++GAT VYPL 
Sbjct  359   IGVFPYQALDLGIYETLKLTYLTYMEEKTGGTNRQPSVLVLWACGMVSGSIGATSVYPLN  418

Query  883   VVRTRMQAQ--PTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVY  710
             V+RTR+QAQ  P H    Y   +     T++  G+R FY+GL P LLKVVPA SI+Y+ Y
Sbjct  419   VIRTRLQAQGTPAH-PVYYNSPWHAVQMTYKVGGIREFYRGLGPTLLKVVPAISISYVTY  477

Query  709   ESMKKTLDL  683
             E  K+ LD+
Sbjct  478   EWSKRQLDI  486



>ref|XP_009899206.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1, 
partial [Picoides pubescens]
 gb|KFV67677.1| Calcium-binding mitochondrial carrier protein SCaMC-1, partial 
[Picoides pubescens]
Length=466

 Score =   355 bits (910),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 187/463 (40%), Positives = 282/463 (61%), Gaps = 14/463 (3%)
 Frame = -1

Query  2047  EERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDY  1868
             ++ D R  +LF   D +  G +D A+++ GL AM I    +  +++ +  D N+DG++D+
Sbjct  9     KDNDSRYANLFRKLDLNEDGRVDIAELQTGLRAMGIPLGKEAEEKIFKAGDTNQDGQLDF  68

Query  1867  PEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKD  1688
              EF +Y+ D E ++   F+++D  + G I   E+  +L   GI I + +  + ++ +D D
Sbjct  69    EEFMRYLKDHEKKMKLAFKSLDKNNDGKIEASEVVQSLKILGISISEKQAEKILQSIDAD  128

Query  1687  NDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----K  1520
                 + + EWRD  +  P  A IE I RY +   ++DIG+   +P+  ++    +    K
Sbjct  129   GTMTVDWNEWRDHFMFNPA-ADIEEIIRYWKHSTVLDIGDSLTVPDEFTEEEKKTGQWWK  187

Query  1519  YLIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISGFFRGNGI  1349
              L+AGGVAGA SRT TAPLDRLKV++QV   ++ + +I    K + KEGG+   +RGNG+
Sbjct  188   QLLAGGVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNIASGFKQMLKEGGVRSLWRGNGV  247

Query  1348  NVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVK  1169
             NV+K+APE+AIKF+ YE  K  +     D+G +GT  R ++G LAGA AQT+IYPM+++K
Sbjct  248   NVVKIAPETAIKFWAYEQYKKILTK---DDGKLGTVERFVSGSLAGATAQTSIYPMEVLK  304

Query  1168  TRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-  992
             TRL     + G+   +   +K I  REG +AFY+G +P++LGIIPYAGIDLAVY+ LK+ 
Sbjct  305   TRLAV--GKTGQYSGMFDCAKKILKREGVKAFYKGYIPNILGIIPYAGIDLAVYELLKST  362

Query  991   FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVF  812
             +   Y    + PG  V LG GT S   G    YPL ++RTRMQAQ +        M  +F
Sbjct  363   WLEHYASSSANPGVFVLLGCGTASSTCGQLASYPLALIRTRMQAQASIEGAPQLNMVGLF  422

Query  811   LRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
              R    EG+RG Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  423   RRIIATEGIRGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  465



>ref|XP_005148139.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Melopsittacus undulatus]
Length=476

 Score =   355 bits (911),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 188/470 (40%), Positives = 284/470 (60%), Gaps = 14/470 (3%)
 Frame = -1

Query  2068  AALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDAN  1889
             AA  +   + D R  +LF   D +  G +D A+++ GL AM I    +  +++ +  D N
Sbjct  12    AAACDGNRDGDSRYANLFRKLDLNEDGRVDIAELQTGLRAMGIPLGKEAEEKIFKAGDTN  71

Query  1888  KDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARF  1709
             +DG++D+ EF +Y+ D E ++   F+++D  + G I   E+  +L   GI I + +  + 
Sbjct  72    QDGQLDFEEFMQYLKDHEKKMKLAFKSLDKNNDGKIEASEVVQSLKILGINISEKQAEKI  131

Query  1708  VEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVH  1529
             ++ +D D    + + EWRD  +  P    IE I RY +   ++DIG+   +P+  ++   
Sbjct  132   LQSIDADGTMTVDWNEWRDHFMFNP-ATDIEEIIRYWKHSTVLDIGDSLTVPDEFTEEEK  190

Query  1528  AS----KYLIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISG  1370
              +    K L+AGGVAGA SRT TAPLDRLKV++QV   ++ + +I    K + KEGG+  
Sbjct  191   KTGQWWKQLLAGGVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNIASGFKQMLKEGGVRS  250

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAI  1190
              +RGNG+NV+K+APE+AIKF+ YE  K  +     D+G +GT  R ++G LAGA AQT+I
Sbjct  251   LWRGNGVNVVKIAPETAIKFWAYEQYKRILTK---DDGKLGTVERFVSGSLAGATAQTSI  307

Query  1189  YPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAV  1010
             YPM+++KTRL     + G+   +   +K I  REG +AFY+G +P++LGIIPYAGIDLAV
Sbjct  308   YPMEVLKTRLAV--GKTGQYSGMFDCAKKILKREGVKAFYKGYIPNILGIIPYAGIDLAV  365

Query  1009  YDALKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAY  833
             Y+ LK+ +   Y    + PG  V LG GT+S   G    YPL ++RTRMQAQ +      
Sbjct  366   YELLKSTWLEHYASSSANPGVFVLLGCGTVSSTCGQLASYPLALIRTRMQAQASVEGAPQ  425

Query  832   KGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
               M  +F R    EG+RG Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  426   LNMVSLFQRIVATEGIRGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  475



>ref|XP_001519699.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X1 [Ornithorhynchus anatinus]
Length=472

 Score =   354 bits (909),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 193/460 (42%), Positives = 276/460 (60%), Gaps = 14/460 (3%)
 Frame = -1

Query  2044  ERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYP  1865
             ER+ R   LF   DS+  G +D  ++  GL+ +   A     +E+L+  D ++DG +D  
Sbjct  14    EREQRWGRLFEELDSNKDGRVDIHELREGLARLGTGARSNAEQEILQEGDTDRDGELDLE  73

Query  1864  EFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDN  1685
             EF  Y+ ++E  L  +F ++D  + G I   E+  +    GI I   +  + +  +D+D 
Sbjct  74    EFTHYLQERERRLLLMFHSLDRNNDGHIDVSEIQQSFQALGISISLQQAEKILHSMDRDG  133

Query  1684  DGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KY  1517
                I ++EWRD  LL P E  +E +  + +   ++DIGE   +P+  S+    S    K 
Sbjct  134   TMTIDWQEWRDHFLLNPLE-NMEEVMHFWKHSTVLDIGECLTVPDEFSEQEKRSGMWWKQ  192

Query  1516  LIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISGFFRGNGIN  1346
             L+AG VAGA SRT TAPLDRLKV +QV   +T + +++  ++S+ +EGGI   +RGNGIN
Sbjct  193   LVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNQLNVLGGLRSMIREGGIRSLWRGNGIN  252

Query  1345  VLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKT  1166
             VLK+APESAIKF  YE +K AI   +G +  +    R +AG LAGA AQT IYPM+++KT
Sbjct  253   VLKIAPESAIKFMAYEQIKRAI---RGQQETLRVQERFVAGSLAGATAQTIIYPMEVLKT  309

Query  1165  RLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-F  989
             RL       G+   LG  ++ I  REGP+AFY+G +P++LGIIPYAGIDLAVY+ LKN +
Sbjct  310   RLTLRRT--GQYKGLGDCARQILQREGPQAFYKGYLPNVLGIIPYAGIDLAVYETLKNRW  367

Query  988   ARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFL  809
              + Y    ++PG LV L  GTIS   G    YPL +VRTRMQAQ +        M  +F 
Sbjct  368   LQQYSQNSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQASIEGAPQLTMLGLFR  427

Query  808   RTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
                  EG+ G Y+G+ PN +KV+PA SI+Y+VYE+MK  L
Sbjct  428   HILSREGIWGLYRGIAPNFMKVIPAVSISYVVYENMKMAL  467



>ref|XP_010561738.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Haliaeetus leucocephalus]
Length=476

 Score =   354 bits (908),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 188/470 (40%), Positives = 284/470 (60%), Gaps = 14/470 (3%)
 Frame = -1

Query  2068  AALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDAN  1889
             AA  +   + D R  +LF   D +  G +D A+++ GL AM I    +  +++ +  D N
Sbjct  12    AAACDGSRDGDSRYANLFRKLDLNEDGRVDIAELQTGLRAMGIPLGKEAEEKIFKAGDTN  71

Query  1888  KDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARF  1709
             +DG++D+ EF +Y+ D E ++   F+++D  + G I   E+  +L   GI I + +  + 
Sbjct  72    QDGQLDFEEFMQYLKDHEKKMKLAFKSLDKNNDGKIEASEVVQSLKILGISISEKQAEKI  131

Query  1708  VEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVH  1529
             ++ +D D    + + EWRD  +  P    IE I RY +   ++DIG+   +P+  ++   
Sbjct  132   LQSIDADGTMTVDWNEWRDHFMFNPA-TDIEEIIRYWKHSTVLDIGDSLTVPDEFTEEEK  190

Query  1528  AS----KYLIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISG  1370
              +    K L+AGGVAGA SRT TAPLDRLKV++QV   ++ + +I    K + KEGG+  
Sbjct  191   KTGQWWKQLLAGGVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNIASGFKQMLKEGGVRS  250

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAI  1190
              +RGNG+NV+K+APE+AIKF+ YE  K  +     D+G +GT  R ++G LAGA AQT+I
Sbjct  251   LWRGNGVNVVKIAPETAIKFWAYEQYKKILTK---DDGKLGTVERFVSGSLAGATAQTSI  307

Query  1189  YPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAV  1010
             YPM+++KTRL     + G+   +   +K I  REG +AFY+G +P++LGIIPYAGIDLAV
Sbjct  308   YPMEVLKTRLAV--GKTGQYSGMFDCAKKILKREGVKAFYKGYIPNILGIIPYAGIDLAV  365

Query  1009  YDALKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAY  833
             Y+ LK+ +   Y    + PG  V LG GT+S   G    YPL ++RTRMQAQ +      
Sbjct  366   YELLKSTWLEHYASSSANPGVFVLLGCGTVSSTCGQLASYPLALIRTRMQAQASVEGAPQ  425

Query  832   KGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
               M  +F R    EG+RG Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  426   LNMVGLFQRIVATEGIRGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  475



>gb|KFO72410.1| Calcium-binding mitochondrial carrier protein SCaMC-1, partial 
[Cuculus canorus]
Length=463

 Score =   353 bits (907),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 188/460 (41%), Positives = 278/460 (60%), Gaps = 14/460 (3%)
 Frame = -1

Query  2038  DIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEF  1859
             D R  SLF   D +  G +D A+++ GL AM I    +  +++ +  D N+DG++D+ EF
Sbjct  9     DSRYASLFRKLDLNEDGRVDIAELQTGLRAMGIPLGKEAEEKIFKAGDINQDGQLDFEEF  68

Query  1858  RKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDG  1679
              +Y+ D E ++   F+++D  + G I   E+  +L   GI I + +  + ++ +D D   
Sbjct  69    MQYLKDHEKKMKLAFKSLDKNNDGKIEASEVVQSLKILGINISEKQAEKILQSIDADGTM  128

Query  1678  VITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLI  1511
              + + EWRD  +  P    IE I RY +   ++DIG+   +P+  ++    +    K L+
Sbjct  129   TVDWNEWRDHFMFNPA-TDIEEIIRYWKHSTVLDIGDSLTVPDEFTEEEKKTGQWWKQLL  187

Query  1510  AGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISGFFRGNGINVL  1340
             AGGVAGA SRT TAPLDRLKV++QV   ++ + +I    K + KEGG    +RGNG+NV+
Sbjct  188   AGGVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNIASGFKQMLKEGGARSLWRGNGVNVV  247

Query  1339  KVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRL  1160
             K+APE+AIKF+ YE  K  +     ++G +GT  R ++G LAGA AQT+IYPM+++KTRL
Sbjct  248   KIAPETAIKFWAYEQYKKILAK---EDGKLGTVERFVSGSLAGATAQTSIYPMEVLKTRL  304

Query  1159  QTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-FAR  983
                  + G+   +   +K I  REG +AFY+G +P++LGIIPYAGIDLAVY+ LK  +  
Sbjct  305   AV--GKTGQYSGMFDCAKKILKREGVKAFYKGYIPNILGIIPYAGIDLAVYELLKTTWLE  362

Query  982   TYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRT  803
              Y    + PG  V LG GTIS   G    YPL ++RTRMQAQ +        M  +F R 
Sbjct  363   HYASSSANPGVFVLLGCGTISSTCGQLASYPLALIRTRMQAQASVEGAPQLNMVGLFQRI  422

Query  802   FRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
                EGLRG Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  423   IATEGLRGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  462



>ref|XP_009468952.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Nipponia nippon]
 gb|KFR03318.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Nipponia 
nippon]
Length=476

 Score =   354 bits (908),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 188/470 (40%), Positives = 284/470 (60%), Gaps = 14/470 (3%)
 Frame = -1

Query  2068  AALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDAN  1889
             AA  +   + D R  +LF   D +  G +D A+++ GL AM I    +  +++ +  D N
Sbjct  12    AAACDGSRDGDSRYANLFRKLDLNEDGKVDIAELQTGLRAMGIPLGREAEEKIFKAGDTN  71

Query  1888  KDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARF  1709
             +DG++D+ EF +Y+ D E ++   F+++D  + G I   E+  +L   GI I + +  + 
Sbjct  72    QDGQLDFEEFMQYLKDHEKKMKLAFKSLDKNNDGKIEASEVVQSLKILGISISEKQAEKI  131

Query  1708  VEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVH  1529
             ++ +D D    + + EWRD  +  P    IE I RY +   ++DIG+   +P+  ++   
Sbjct  132   LQSIDADGTMTVDWNEWRDHFMFNP-ATDIEEIIRYWKHSTVLDIGDSLTVPDEFTEEEK  190

Query  1528  AS----KYLIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISG  1370
              +    K L+AGGVAGA SRT TAPLDRLKV++QV   ++ + +I    K + KEGG+  
Sbjct  191   KTGQWWKQLLAGGVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNIASGFKQMLKEGGVRS  250

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAI  1190
              +RGNG+NV+K+APE+AIKF+ YE  K  +     D+G +GT  R ++G LAGA AQT+I
Sbjct  251   LWRGNGVNVVKIAPETAIKFWAYEQYKKILTK---DDGKLGTVERFVSGSLAGATAQTSI  307

Query  1189  YPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAV  1010
             YPM+++KTRL     + G+   +   +K I  REG +AFY+G +P++LGIIPYAGIDLAV
Sbjct  308   YPMEVLKTRLAV--GKTGQYSGMFDCAKKILKREGVKAFYKGYIPNILGIIPYAGIDLAV  365

Query  1009  YDALKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAY  833
             Y+ LK+ +   Y    + PG  V LG GT+S   G    YPL ++RTRMQAQ +      
Sbjct  366   YEVLKSTWLEHYASSSANPGVFVLLGCGTVSSTCGQLASYPLALIRTRMQAQASVEGAPQ  425

Query  832   KGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
               M  +F R    EG+RG Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  426   LNMVGLFQRIIAVEGVRGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  475



>ref|XP_009554122.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Cuculus canorus]
Length=470

 Score =   353 bits (907),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 188/460 (41%), Positives = 278/460 (60%), Gaps = 14/460 (3%)
 Frame = -1

Query  2038  DIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEF  1859
             D R  SLF   D +  G +D A+++ GL AM I    +  +++ +  D N+DG++D+ EF
Sbjct  16    DSRYASLFRKLDLNEDGRVDIAELQTGLRAMGIPLGKEAEEKIFKAGDINQDGQLDFEEF  75

Query  1858  RKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDG  1679
              +Y+ D E ++   F+++D  + G I   E+  +L   GI I + +  + ++ +D D   
Sbjct  76    MQYLKDHEKKMKLAFKSLDKNNDGKIEASEVVQSLKILGINISEKQAEKILQSIDADGTM  135

Query  1678  VITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLI  1511
              + + EWRD  +  P    IE I RY +   ++DIG+   +P+  ++    +    K L+
Sbjct  136   TVDWNEWRDHFMFNPA-TDIEEIIRYWKHSTVLDIGDSLTVPDEFTEEEKKTGQWWKQLL  194

Query  1510  AGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISGFFRGNGINVL  1340
             AGGVAGA SRT TAPLDRLKV++QV   ++ + +I    K + KEGG    +RGNG+NV+
Sbjct  195   AGGVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNIASGFKQMLKEGGARSLWRGNGVNVV  254

Query  1339  KVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRL  1160
             K+APE+AIKF+ YE  K  +     ++G +GT  R ++G LAGA AQT+IYPM+++KTRL
Sbjct  255   KIAPETAIKFWAYEQYKKILAK---EDGKLGTVERFVSGSLAGATAQTSIYPMEVLKTRL  311

Query  1159  QTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-FAR  983
                  + G+   +   +K I  REG +AFY+G +P++LGIIPYAGIDLAVY+ LK  +  
Sbjct  312   AV--GKTGQYSGMFDCAKKILKREGVKAFYKGYIPNILGIIPYAGIDLAVYELLKTTWLE  369

Query  982   TYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRT  803
              Y    + PG  V LG GTIS   G    YPL ++RTRMQAQ +        M  +F R 
Sbjct  370   HYASSSANPGVFVLLGCGTISSTCGQLASYPLALIRTRMQAQASVEGAPQLNMVGLFQRI  429

Query  802   FRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
                EGLRG Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  430   IATEGLRGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  469



>gb|EPB87242.1| hypothetical protein HMPREF1544_05964 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=515

 Score =   353 bits (907),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 200/480 (42%), Positives = 290/480 (60%), Gaps = 22/480 (5%)
 Frame = -1

Query  2062  LQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAM-QIQADYKFAKELLRVVDANK  1886
             L ET  ER+ RIR LF+  D +N G LD   I+RG +AM  + A  K+A ELL   D + 
Sbjct  37    LSETPSERNDRIRELFNTLDRENRGLLDSKAIQRGFTAMTHLPARTKYANELLSRCDTSH  96

Query  1885  DGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFV  1706
             DG VD+ EF+ Y++DKE EL+++F+ +D    G + P +L  AL +AG+EI ++++  F+
Sbjct  97    DGLVDFEEFKTYVNDKENELWQLFKKLDRSGEGQLDPTDLQIALQRAGMEICEEDVVEFM  156

Query  1705  EHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHA  1526
             + +D D +G+I F E+++FLLL P +  +  +YRY E    +    + VIP       +A
Sbjct  157   QLMDADGNGLIDFNEFKNFLLLLP-QTNMSEMYRYYESSTQLTQDGEVVIPTTDETARNA  215

Query  1525  SKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRA----SIMPAVKSIWKEGGISGFFRG  1358
               YL+AGG+AGA SRT TAP DRLKV L   ++      ++  AV+SI+  GG   FF G
Sbjct  216   LGYLLAGGIAGAVSRTCTAPFDRLKVYLITHSSTPQNPLTLASAVRSIYSHGGWKSFFVG  275

Query  1357  NGINVLKVAPESAIKFYTYEMLKNAIG---HAKGDEGDIGTSGRLIAGGLAGAVAQTAIY  1187
             NG+NV+K+ PESAIKFY+YE  K  I    H + D+  I TS R  AGG+AG  AQ +IY
Sbjct  276   NGLNVMKIIPESAIKFYSYESCKQLIANILHCE-DKDSIPTSARFAAGGMAGICAQFSIY  334

Query  1186  PMDLVKTRLQTY-TCE---GGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGID  1019
             P++ +KTR+ T+ +C      K   +   +K ++ + G +AF+ G+   L+G+ PY  +D
Sbjct  335   PVETLKTRIMTHQSCNRYATAKSSIITETAKSMYAKGGIKAFWPGLTLGLIGVFPYQAMD  394

Query  1018  LAVYDALK----NFARTYILQD---SEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQA  860
             L +Y+ LK     +++    +D    +P   V    G ISG +GAT VYPL V+RTR+QA
Sbjct  395   LGIYETLKLSYLQYSQGEYNEDGSQKQPNVFVLWACGMISGTIGATSVYPLNVIRTRLQA  454

Query  859   QPTHTS-TAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             Q T      YK  ++    TF   G++GFYKGL P LLKVVPA S++Y+ YE  K+ L L
Sbjct  455   QGTKGHPRLYKSPWEAVQVTFLEGGVKGFYKGLGPTLLKVVPAVSLSYVTYEWSKRELGL  514



>ref|XP_005285526.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Chrysemys picta bellii]
Length=475

 Score =   351 bits (901),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 187/458 (41%), Positives = 278/458 (61%), Gaps = 14/458 (3%)
 Frame = -1

Query  2032  RIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRK  1853
             R  +LF   D +  G +D A++  GL A+ I       +++ +  D+NKDG++D+ EF +
Sbjct  23    RYENLFKKLDLNEDGRVDIAELHEGLKALGIPLGKDAEEKIFKTGDSNKDGQLDFKEFMQ  82

Query  1852  YMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVI  1673
             Y+ D E ++   F+++D  + G I   E+  +L   GI I + +  + ++ +D D    +
Sbjct  83    YLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLKILGINISEQQAEKILKSIDADGTMSV  142

Query  1672  TFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLIAG  1505
              + EWRD  L  P    IE I RY +   ++DIG+   IP+  ++    S    + L++G
Sbjct  143   DWNEWRDHFLFNPA-TDIEEIIRYWKHSTVLDIGDSLTIPDEFTEEEKKSGQWWRQLLSG  201

Query  1504  GVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISGFFRGNGINVLKV  1334
             GVAGA SRT TAPLDRLKV++QV   ++ + +I   +K + KEGGI   +RGNG+NV+K+
Sbjct  202   GVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNISSGLKQMVKEGGIRSLWRGNGVNVIKI  261

Query  1333  APESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQT  1154
             APE+AIKF+ YE  K    +   ++G IGT  R ++G LAGA AQT+IYPM+++KTRL  
Sbjct  262   APETAIKFWAYEQYKKIFAN---EDGKIGTVERFVSGSLAGATAQTSIYPMEVLKTRLAV  318

Query  1153  YTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-FARTY  977
                + G+   +   +K I  REG +AFY+G VP++LGIIPYAGIDLA+Y+ALK  +   Y
Sbjct  319   --GKTGQYSGMFDCAKKILKREGLKAFYKGYVPNILGIIPYAGIDLAIYEALKTAWLDGY  376

Query  976   ILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFR  797
                 + PG  V LG GT+S   G    YPL ++RTRMQAQ          M  +F R   
Sbjct  377   ASDSANPGVFVLLGCGTVSSTCGQLASYPLALIRTRMQAQALLEGAPQLNMVGLFQRIVA  436

Query  796   HEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             +EG+ G Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  437   NEGILGLYRGIGPNFMKVLPAVSISYVVYEKMKQNLGI  474



>ref|XP_007662321.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X2 [Ornithorhynchus anatinus]
Length=471

 Score =   351 bits (900),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 193/460 (42%), Positives = 277/460 (60%), Gaps = 15/460 (3%)
 Frame = -1

Query  2044  ERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYP  1865
             ER+ R   LF   DS+  G +D  ++  GL+ +   A    A+++L+  D ++DG +D  
Sbjct  14    EREQRWGRLFEELDSNKDGRVDIHELREGLARLGTGARSN-AEQILQEGDTDRDGELDLE  72

Query  1864  EFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDN  1685
             EF  Y+ ++E  L  +F ++D  + G I   E+  +    GI I   +  + +  +D+D 
Sbjct  73    EFTHYLQERERRLLLMFHSLDRNNDGHIDVSEIQQSFQALGISISLQQAEKILHSMDRDG  132

Query  1684  DGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KY  1517
                I ++EWRD  LL P E  +E +  + +   ++DIGE   +P+  S+    S    K 
Sbjct  133   TMTIDWQEWRDHFLLNPLE-NMEEVMHFWKHSTVLDIGECLTVPDEFSEQEKRSGMWWKQ  191

Query  1516  LIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISGFFRGNGIN  1346
             L+AG VAGA SRT TAPLDRLKV +QV   +T + +++  ++S+ +EGGI   +RGNGIN
Sbjct  192   LVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNQLNVLGGLRSMIREGGIRSLWRGNGIN  251

Query  1345  VLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKT  1166
             VLK+APESAIKF  YE +K AI   +G +  +    R +AG LAGA AQT IYPM+++KT
Sbjct  252   VLKIAPESAIKFMAYEQIKRAI---RGQQETLRVQERFVAGSLAGATAQTIIYPMEVLKT  308

Query  1165  RLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-F  989
             RL       G+   LG  ++ I  REGP+AFY+G +P++LGIIPYAGIDLAVY+ LKN +
Sbjct  309   RLTLRRT--GQYKGLGDCARQILQREGPQAFYKGYLPNVLGIIPYAGIDLAVYETLKNRW  366

Query  988   ARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFL  809
              + Y    ++PG LV L  GTIS   G    YPL +VRTRMQAQ +        M  +F 
Sbjct  367   LQQYSQNSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQASIEGAPQLTMLGLFR  426

Query  808   RTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
                  EG+ G Y+G+ PN +KV+PA SI+Y+VYE+MK  L
Sbjct  427   HILSREGIWGLYRGIAPNFMKVIPAVSISYVVYENMKMAL  466



>ref|XP_006119851.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Pelodiscus sinensis]
Length=475

 Score =   351 bits (901),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 188/458 (41%), Positives = 279/458 (61%), Gaps = 14/458 (3%)
 Frame = -1

Query  2032  RIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRK  1853
             R  +LF   D +  G +D A+++ GL A+ I       +++ +  DANKDG++D  EF +
Sbjct  23    RYENLFKKLDLNEDGRVDIAELQAGLKALGIPLGRDAEEKIFKAGDANKDGQLDIEEFMQ  82

Query  1852  YMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVI  1673
             Y+ D E ++   F+++D  + G I   E+  +L   GI I + +  + ++ +D D    +
Sbjct  83    YLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLRILGIVISEQQAEKILQSIDADGTMSV  142

Query  1672  TFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLIAG  1505
              + EWRD  L  P    IE I RY +   ++DIG+   IP+  ++    S    + L++G
Sbjct  143   DWNEWRDHFLFNPA-TDIEEIVRYWKHSTVLDIGDSLTIPDEFTEEEKKSGQWWRQLLSG  201

Query  1504  GVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISGFFRGNGINVLKV  1334
             GVAGA SRT TAPLDRLKV++QV   ++ + +I   +K + KEGG+   +RGNG+NV+K+
Sbjct  202   GVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNISSGLKQMVKEGGVRSLWRGNGVNVIKI  261

Query  1333  APESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQT  1154
             APE+AIKF+ YE  K    +   ++G +GT  R ++G LAGA AQT+IYPM+++KTRL  
Sbjct  262   APETAIKFWAYEQYKKIFAN---EDGKVGTIERFVSGSLAGATAQTSIYPMEVLKTRLAV  318

Query  1153  YTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-FARTY  977
                + G+   +   +K I+ REG +AFY+G VP++LGIIPYAGIDLAVY+ALK  +   Y
Sbjct  319   --GKTGQYSGMFDCAKKIFKREGVKAFYKGYVPNILGIIPYAGIDLAVYEALKTAWLDRY  376

Query  976   ILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFR  797
                 + PG  V LG GTIS   G    YPL ++RTRMQAQ          M  +F R   
Sbjct  377   ASDSANPGVFVLLGCGTISSTCGQLASYPLALIRTRMQAQALLEEAPQLNMVGLFQRIIA  436

Query  796   HEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             +EG+ G Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  437   NEGIIGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  474



>ref|XP_007055270.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Chelonia mydas]
 gb|EMP40098.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Chelonia 
mydas]
Length=476

 Score =   351 bits (900),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 190/470 (40%), Positives = 283/470 (60%), Gaps = 15/470 (3%)
 Frame = -1

Query  2068  AALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDAN  1889
             AA QE       R  +LF   D +  G +D A++  GL A+ I       +++ +  D+N
Sbjct  13    AACQEANNNSS-RYENLFKKLDLNEDGRVDIAELHVGLKALGIPLGRDAEEKIFKTGDSN  71

Query  1888  KDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARF  1709
             KDG++D+ EF +Y+ D E ++   F+++D  + G I   E+ ++L   GI I + +  + 
Sbjct  72    KDGQLDFEEFMQYLKDHEKKMKLAFKSLDKNNDGKIEASEIVESLKLLGINITEQQAEKI  131

Query  1708  VEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVH  1529
             ++ +D D    + + EWRD  L  P    IE I RY +   ++DIG+   IP+  ++   
Sbjct  132   LQSIDADGTMSVDWNEWRDHFLFNP-ATDIEEIIRYWKHSTVLDIGDSLTIPDEFTEEEK  190

Query  1528  AS----KYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIM---PAVKSIWKEGGISG  1370
              S    + L++GGVAGA SRT TAPLDRLKV++QV +++++ M     +K + KEGG+  
Sbjct  191   KSGQWWRQLLSGGVAGAVSRTGTAPLDRLKVMMQVHSSKSNKMNISSGLKQMVKEGGVRS  250

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAI  1190
              +RGNG+NV+K+APE+A+KF+ YE  K    +   ++G IGT  R ++G LAGA AQT+I
Sbjct  251   LWRGNGVNVIKIAPETAVKFWAYEQYKKLFAN---EDGKIGTVERFVSGSLAGATAQTSI  307

Query  1189  YPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAV  1010
             YPM+++KTRL     + G+   +   ++ I  REG  AFY+G VP++LGIIPYAGIDLAV
Sbjct  308   YPMEVLKTRLAV--GKTGQYSGMFDCARKILKREGLTAFYKGYVPNILGIIPYAGIDLAV  365

Query  1009  YDALKNFARTYILQDS-EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAY  833
             Y+ALK     +   DS  PG  V LG GT+S   G    YPL ++RTRMQAQ        
Sbjct  366   YEALKTAWLDHYASDSANPGVFVLLGCGTVSSTCGQLASYPLALIRTRMQAQALLEGAPQ  425

Query  832   KGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
               M  +F R   +EG+ G Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  426   LNMVGLFQRIIANEGILGLYRGIGPNFMKVLPAVSISYVVYEKMKQNLGI  475



>ref|XP_008501525.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Calypte anna]
 gb|KFP08145.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Calypte 
anna]
Length=476

 Score =   349 bits (896),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 187/470 (40%), Positives = 282/470 (60%), Gaps = 14/470 (3%)
 Frame = -1

Query  2068  AALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDAN  1889
             AA  +   + D R  +LF   D +  G +D A+++ GL AM I    +  +++ +  D N
Sbjct  12    AAACDGNRDGDSRYANLFRKLDLNEDGKVDIAELQTGLRAMGIPLGKEAEEKIFKAGDTN  71

Query  1888  KDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARF  1709
             +DG++D+ EF +Y+ D E ++   F+++D  + G I   E+  +L   GI I   +  + 
Sbjct  72    QDGQLDFEEFMRYLKDHEKKMKLAFKSLDKNNDGKIEASEVVQSLKILGISISKKQAEKI  131

Query  1708  VEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVH  1529
             ++ +D D    + + EWRD  +  P    IE I RY +   ++DIG+   +P+  ++   
Sbjct  132   LQSIDADGTMTVDWNEWRDHFMFNP-ATDIEEIIRYWKHSTVLDIGDSLTVPDEFTEEEK  190

Query  1528  AS----KYLIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISG  1370
              +    + L+AGGVAGA SRT TAPLDRLKV++QV   ++ + +I    K + KEGG+  
Sbjct  191   KTGQWWRQLLAGGVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNIASGFKQMLKEGGVLS  250

Query  1369  FFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAI  1190
              +RGNG+NV+K+APE+AIKF+ YE  K  +     D+G +GT  R ++G LAGA AQT+I
Sbjct  251   LWRGNGVNVVKIAPETAIKFWAYEKYKKLLTK---DDGKLGTIERFVSGSLAGATAQTSI  307

Query  1189  YPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAV  1010
             YPM+++KTRL     + G+   +   +K I  REG +AFY+G +P++LGIIPYAGIDLAV
Sbjct  308   YPMEVLKTRLAV--GKTGQYSGMFDCAKKILKREGVKAFYKGYIPNILGIIPYAGIDLAV  365

Query  1009  YDALKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAY  833
             Y+ LK+ +   Y    + PG  V LG GT S   G    YPL ++RTRMQAQ +      
Sbjct  366   YELLKSTWLEHYASSSANPGVFVLLGCGTASSTCGQLASYPLALIRTRMQAQASVEGAPQ  425

Query  832   KGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
               M  +F R    EG+RG Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  426   LNMVALFQRIIATEGVRGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGI  475



>ref|NP_001038417.1| solute carrier family 25, member 23 [Danio rerio]
Length=481

 Score =   349 bits (896),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 194/458 (42%), Positives = 273/458 (60%), Gaps = 12/458 (3%)
 Frame = -1

Query  2044  ERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYP  1865
             ER+ R   LF   D +  G +D  ++  GL+A  I        E++RV D N DG++D+ 
Sbjct  26    EREKRWAELFDQLDLNKDGRIDLNELRTGLTAWGIVRGE--VDEIVRVSDTNHDGQLDFK  83

Query  1864  EFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDN  1685
             EF +Y+   E EL  +F ++D  + G I   E+  +L   G+ +  ++ +R ++ +D+D 
Sbjct  84    EFTQYLRTHEKELRLMFSSLDHNNDGHIDVPEIQLSLRSLGVNVSTEQASRILQSIDRDG  143

Query  1684  DGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KY  1517
                I + EWRD  L  P    +E+I  Y +   ++DIGEQ  +P+  S+    S    + 
Sbjct  144   TMTIDWNEWRDHFLFNPLH-NMEDIAHYWKHSLMLDIGEQLTVPDEFSEKERRSGVVWRQ  202

Query  1516  LIAGGVAGAASRTATAPLDRLKVVLQVQ-TTRASIMPAVKSIWKEGGISGFFRGNGINVL  1340
             L+AG +AGA SRT TAPLDRLKV LQV  T+  ++   ++ + +EGG+   +RGNGINVL
Sbjct  203   LVAGAMAGAVSRTGTAPLDRLKVFLQVHGTSGVTLFSGLQGMVREGGLRSLWRGNGINVL  262

Query  1339  KVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRL  1160
             K+APESAIKF  YE +K  I   + + G +    R IAG LAGA AQT IYPM+++KTRL
Sbjct  263   KIAPESAIKFMAYEQIKWLI-RGRREGGTLRVQERFIAGSLAGATAQTIIYPMEVLKTRL  321

Query  1159  QTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-FAR  983
                    G+   +   +K I  +EG RAFY+G VP+ LGIIPYAGIDLAVY+ LKN + +
Sbjct  322   TLRKT--GQYSGMADCAKQILRKEGVRAFYKGYVPNTLGIIPYAGIDLAVYETLKNAWLQ  379

Query  982   TYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRT  803
              Y +  ++PG LV L  GT+S   G    YPL ++RTRMQAQ +        M   F   
Sbjct  380   RYCMGSADPGVLVLLACGTVSSTCGQLASYPLALIRTRMQAQASAEGAPQLSMVGQFKHI  439

Query  802   FRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
               HEG+ G Y+G+ PN LKV+PA SI+Y+VYE MKK L
Sbjct  440   VSHEGVPGLYRGIAPNFLKVIPAVSISYVVYEHMKKAL  477



>gb|KFP84445.1| Calcium-binding mitochondrial carrier protein SCaMC-1, partial 
[Acanthisitta chloris]
Length=435

 Score =   347 bits (891),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 182/439 (41%), Positives = 271/439 (62%), Gaps = 14/439 (3%)
 Frame = -1

Query  1975  AQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVE  1796
             A+++ GL AM I    +  +++ +  D N+DG++D+ EF +Y+ + E ++   F+++D  
Sbjct  2     AELQTGLRAMGIPLGKEAEEKIFKAGDINQDGQLDFEEFMQYLKEHEKKMKLAFKSLDKN  61

Query  1795  HSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIE  1616
             + G I   E+  +L   GI I + +  + ++ +D D    + + EWRD  +  P    IE
Sbjct  62    NDGKIEASEVVQSLKILGINISEKQAQKILQSIDADGTMTVDWNEWRDHFMFNP-ATDIE  120

Query  1615  NIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLIAGGVAGAASRTATAPLDRLKV  1448
              I RY +   ++DIG+   +P+  ++    +    K L+AGGVAGA SRT TAPLDRLKV
Sbjct  121   EIIRYWKHSTVLDIGDSLTVPDEFTEEEKKTGQWWKQLLAGGVAGAVSRTGTAPLDRLKV  180

Query  1447  VLQV---QTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIG  1277
             ++QV   ++ + +I    K + KEGG+   +RGNG+NV+K+APE+AIKF+ YE  K  + 
Sbjct  181   MMQVHGSKSNKMNIASGFKQMLKEGGVRSLWRGNGVNVVKIAPETAIKFWAYEQYKKILT  240

Query  1276  HAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIW  1097
                 D+G +GT  R ++G LAGA AQT+IYPM+++KTRL     + G+   +   +K I 
Sbjct  241   K---DDGKLGTVERFVSGSLAGATAQTSIYPMEVLKTRLAV--GKTGQYSGMFDCAKKIL  295

Query  1096  LREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-FARTYILQDSEPGPLVQLGSGTIS  920
              REGP+AFY+G VP++LGIIPYAGIDLAVY+ LK+ +   Y    + PG  V LG GT+S
Sbjct  296   KREGPKAFYKGYVPNILGIIPYAGIDLAVYELLKSTWLEHYASSSANPGVFVLLGCGTVS  355

Query  919   GALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVV  740
                G    YPL ++RTRMQAQ          M  +F RT   EGLRG Y+G+ PN +KV+
Sbjct  356   STCGQLASYPLALIRTRMQAQALVEGAPQLNMVGLFKRTVATEGLRGLYRGIAPNFMKVL  415

Query  739   PAASITYLVYESMKKTLDL  683
             PA SI+Y+VYE MK+ L +
Sbjct  416   PAVSISYVVYEKMKQNLGI  434



>ref|XP_009077057.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1, 
partial [Acanthisitta chloris]
Length=434

 Score =   347 bits (890),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 182/439 (41%), Positives = 271/439 (62%), Gaps = 14/439 (3%)
 Frame = -1

Query  1975  AQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDDKELELYRIFQAIDVE  1796
             A+++ GL AM I    +  +++ +  D N+DG++D+ EF +Y+ + E ++   F+++D  
Sbjct  1     AELQTGLRAMGIPLGKEAEEKIFKAGDINQDGQLDFEEFMQYLKEHEKKMKLAFKSLDKN  60

Query  1795  HSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIE  1616
             + G I   E+  +L   GI I + +  + ++ +D D    + + EWRD  +  P    IE
Sbjct  61    NDGKIEASEVVQSLKILGINISEKQAQKILQSIDADGTMTVDWNEWRDHFMFNP-ATDIE  119

Query  1615  NIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLIAGGVAGAASRTATAPLDRLKV  1448
              I RY +   ++DIG+   +P+  ++    +    K L+AGGVAGA SRT TAPLDRLKV
Sbjct  120   EIIRYWKHSTVLDIGDSLTVPDEFTEEEKKTGQWWKQLLAGGVAGAVSRTGTAPLDRLKV  179

Query  1447  VLQV---QTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIG  1277
             ++QV   ++ + +I    K + KEGG+   +RGNG+NV+K+APE+AIKF+ YE  K  + 
Sbjct  180   MMQVHGSKSNKMNIASGFKQMLKEGGVRSLWRGNGVNVVKIAPETAIKFWAYEQYKKILT  239

Query  1276  HAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIW  1097
                 D+G +GT  R ++G LAGA AQT+IYPM+++KTRL     + G+   +   +K I 
Sbjct  240   K---DDGKLGTVERFVSGSLAGATAQTSIYPMEVLKTRLAV--GKTGQYSGMFDCAKKIL  294

Query  1096  LREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-FARTYILQDSEPGPLVQLGSGTIS  920
              REGP+AFY+G VP++LGIIPYAGIDLAVY+ LK+ +   Y    + PG  V LG GT+S
Sbjct  295   KREGPKAFYKGYVPNILGIIPYAGIDLAVYELLKSTWLEHYASSSANPGVFVLLGCGTVS  354

Query  919   GALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVV  740
                G    YPL ++RTRMQAQ          M  +F RT   EGLRG Y+G+ PN +KV+
Sbjct  355   STCGQLASYPLALIRTRMQAQALVEGAPQLNMVGLFKRTVATEGLRGLYRGIAPNFMKVL  414

Query  739   PAASITYLVYESMKKTLDL  683
             PA SI+Y+VYE MK+ L +
Sbjct  415   PAVSISYVVYEKMKQNLGI  433



>ref|NP_001121016.1| calcium-binding mitochondrial carrier protein SCaMC-1 [Rattus 
norvegicus]
 gb|EDL81976.1| rCG29001 [Rattus norvegicus]
 gb|AAI62022.1| Slc25a24 protein [Rattus norvegicus]
Length=475

 Score =   347 bits (891),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 189/455 (42%), Positives = 277/455 (61%), Gaps = 14/455 (3%)
 Frame = -1

Query  2032  RIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRK  1853
             R  +LF   D +  G +D  ++++GL ++ I       +++    D NKDG++D+ EF K
Sbjct  23    RYETLFRALDRNGDGVVDIGELQQGLQSLGIPLGQAAEEKIFTTGDVNKDGKLDFEEFMK  82

Query  1852  YMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVI  1673
             Y+ D E ++   F+++D  + G I P E+  +L   G+ I + +    ++ +D D    +
Sbjct  83    YLKDHEKKMKLAFKSLDKNNDGKIEPFEIVQSLQMLGLNISEKQAELILQSIDSDGTMTV  142

Query  1672  TFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLIAG  1505
              + EWRD+ L  P    IE I R+ +    +DIG+   IP+  ++    S    + L+AG
Sbjct  143   DWNEWRDYFLFNPV-TDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAG  201

Query  1504  GVAGAASRTATAPLDRLKVVLQVQTTRA-SIMPAVKSIWKEGGISGFFRGNGINVLKVAP  1328
             GVAGA SRT+TAPLDRLKV++QV  +++ +I    + + KEGGI   +RGNGINV+K+AP
Sbjct  202   GVAGAVSRTSTAPLDRLKVMMQVHGSKSMNIFGGFRQMVKEGGIRSLWRGNGINVIKIAP  261

Query  1327  ESAIKFYTYEMLKNAIGHAKGDEGD-IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTY  1151
             E+A+KF+ YE  K  +     +EG  +GTS R I+G +AGA AQT IYPM+++KTRL   
Sbjct  262   ETAVKFWAYEQYKKLLT----EEGQKLGTSERFISGSMAGATAQTFIYPMEVLKTRLAV-  316

Query  1150  TCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYIL  971
               + G+   +   +K I   EG RAFY+G VP+LLGIIPYAGIDLAVY+ LK++      
Sbjct  317   -AKTGQYSGIYGCAKKILKHEGFRAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWLDNFA  375

Query  970   QDS-EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRH  794
             +DS  PG +V LG G +S   G    YPL +VRTRMQAQ T        M  +F R    
Sbjct  376   KDSVNPGVVVLLGCGALSSTCGQLASYPLALVRTRMQAQATTEGAPQLSMVGLFQRIVSK  435

Query  793   EGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
             EG+ G Y+G+ PN +KV+PA  I+Y+VYE+MK+TL
Sbjct  436   EGVSGLYRGITPNFMKVLPAVGISYVVYENMKQTL  470



>ref|XP_006170310.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X4 [Tupaia chinensis]
 gb|ELV10002.1| Calcium-binding mitochondrial carrier protein SCaMC-3 [Tupaia 
chinensis]
Length=468

 Score =   346 bits (888),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 194/461 (42%), Positives = 276/461 (60%), Gaps = 15/461 (3%)
 Frame = -1

Query  2044  ERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRV-VDANKDGRVDY  1868
             ER  R   LF   DS+  G +D  ++ +GL+ +      + A++      DA+ DG +D 
Sbjct  9     ERRQRWSRLFEELDSNKDGRVDVHELRQGLARLGGGDPERGAQQGGSPGTDADPDGGLDL  68

Query  1867  PEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKD  1688
              EF +Y+ ++E  L  +F ++D    G I   E+  +    GI I  ++  + +  +D+D
Sbjct  69    EEFTRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISITLEQAEKILHSMDRD  128

Query  1687  NDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----K  1520
             N   I ++EWRD  LL+P E  +E++  + +   ++DIGE   +P+  SK    +    K
Sbjct  129   NTMTIDWQEWRDHFLLHPLE-NVEDVLYFWKHSTVLDIGEHLTVPDEFSKQEKLTGTWWK  187

Query  1519  YLIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISGFFRGNGI  1349
              L+AG VAGA SRT TAPLDRLKV +QV   +T R +I+  ++S+  EGG+   +RGNGI
Sbjct  188   QLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVGEGGLRSLWRGNGI  247

Query  1348  NVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVK  1169
             NVLK+APESAIKF  YE +K  I   +G +  +    R +AG LAGA AQT IYPM+++K
Sbjct  248   NVLKIAPESAIKFMAYEQIKRGI---RGQQETLHVQERFVAGSLAGATAQTVIYPMEVLK  304

Query  1168  TRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-  992
             TRL       G+   L   ++ I  REGPRAFYRG +P++LGIIPYAGIDLAVY+ LKN 
Sbjct  305   TRLTLRRT--GQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNR  362

Query  991   FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVF  812
             + + Y    ++PG LV L  GTIS   G    YPL +VRTRMQAQ +        M  + 
Sbjct  363   WLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQASVEGGPQLSMLGLL  422

Query  811   LRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
                   EG+RG Y+G+ PN +KV+PA SI+Y+VYE+MK+ L
Sbjct  423   RHILSQEGIRGLYRGIAPNFMKVIPAVSISYVVYENMKQAL  463



>ref|XP_007237962.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
[Astyanax mexicanus]
Length=478

 Score =   347 bits (889),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 197/469 (42%), Positives = 278/469 (59%), Gaps = 14/469 (3%)
 Frame = -1

Query  2074  VLAALQETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQI-QADYKFAKELLRVV  1898
             + A  +E+  ERD R   LF   D +  G +D  ++  GL+A  + + D     E++RV 
Sbjct  13    IRARCEESGAERDKRWAELFQQLDLNKDGRIDVHELRSGLAAWGVARTD---VDEIVRVS  69

Query  1897  DANKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDEL  1718
             D N DG++D+ EF +Y+   E EL  +F+++D  + G I   E+  +L   G+E+  ++ 
Sbjct  70    DTNHDGQLDFQEFTQYLRTHEKELKLMFRSLDRNNDGQIDVGEIQQSLHSLGVEVSTEQA  129

Query  1717  ARFVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISK  1538
              R +  +D+D    I + EWRD  L  P    +E+I  Y +   ++DIGE   +P+  S+
Sbjct  130   YRILRSMDRDGTMTIDWNEWRDHFLFNPFR-NMEDIAHYWKHSLMLDIGEHLTVPDEFSE  188

Query  1537  HVHAS----KYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS-IWKEGGIS  1373
                 +    + L+AG +AGA SRT TAPLDRLKV LQV  +    + +    + +EGG+ 
Sbjct  189   RERRAGLVWRQLVAGAMAGAVSRTGTAPLDRLKVFLQVHGSGGGGLWSGLRGMVQEGGLR  248

Query  1372  GFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTA  1193
               +RGNGINVLK+APESAIKF  YE +K  I   K D G +    R +AG LAGA AQT 
Sbjct  249   SLWRGNGINVLKIAPESAIKFMAYEQIKWLIRGCK-DGGSLRVQERFVAGSLAGATAQTI  307

Query  1192  IYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLA  1013
             IYPM+++KTRL     + G+   +   ++ I  +EG RAFYRG VP+ LGIIPYAGIDLA
Sbjct  308   IYPMEVLKTRLTLR--KTGQYSGMMDCAQQILRKEGIRAFYRGYVPNTLGIIPYAGIDLA  365

Query  1012  VYDALKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTA  836
             VY+ LKN + + Y +  ++PG LV LG GT+S   G    YPL ++RTRMQAQ +     
Sbjct  366   VYETLKNAWLQRYCVGSADPGVLVLLGCGTVSSTCGQLASYPLALIRTRMQAQASTEGAP  425

Query  835   YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
                M   F     HEG+ G Y+G+ PN LKV+PA SI+Y+VYE MKK L
Sbjct  426   KLTMVGQFKHIVSHEGVPGLYRGIAPNFLKVIPAVSISYVVYEHMKKAL  474



>ref|XP_007431604.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Python bivittatus]
Length=474

 Score =   346 bits (888),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 186/457 (41%), Positives = 278/457 (61%), Gaps = 13/457 (3%)
 Frame = -1

Query  2032  RIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRK  1853
             R  +LF   D +  G +D A+++ GL  + I       K++ R  D N+DGR+D+ EF +
Sbjct  23    RYENLFKKLDRNEDGRVDIAELQSGLKELGIPLGDDAEKKIFRAGDTNQDGRLDFEEFTR  82

Query  1852  YMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVI  1673
             Y+ D E ++   F+++D  + G I   E+  +L   GI+I + +  + ++ +D D    +
Sbjct  83    YLKDHEKKMKLAFKSLDKNNDGVIEASEIVQSLKILGIDISEKQAEKILQSIDADGTMSV  142

Query  1672  TFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLIAG  1505
              + EWRD  L  P    I+ I RY +   ++DIG+   IP+  ++    +    K L++G
Sbjct  143   DWNEWRDHFLFNPA-TDIQGIVRYWKHSTVLDIGDSLTIPDEFTEEEKKTGQWWKQLLSG  201

Query  1504  GVAGAASRTATAPLDRLKVVLQVQTTRA--SIMPAVKSIWKEGGISGFFRGNGINVLKVA  1331
             GVAGA SRT TAPLDRLKV++QV  ++   +I+  ++ + KEGG+   +RGNG+NV+K+A
Sbjct  202   GVAGAVSRTGTAPLDRLKVMMQVHGSKGKMNIVGGLQQMVKEGGVRSLWRGNGVNVVKIA  261

Query  1330  PESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTY  1151
             PE+AIKF+ YE  K    +   +EG IGT  R I+G LAGA AQT+IYPM+++KTRL   
Sbjct  262   PETAIKFWAYERYKKMFVN---EEGKIGTIERFISGSLAGATAQTSIYPMEVLKTRLAV-  317

Query  1150  TCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-FARTYI  974
               + G+   +   +K I   EG +AFY+G +P++LGIIPYAGIDLA+Y+ALK  +   Y 
Sbjct  318   -GKTGQYFGMFDCAKKILKMEGVKAFYKGYIPNILGIIPYAGIDLAIYEALKKMWLEKYA  376

Query  973   LQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRH  794
                + PG LV LG GT+S   G    YPL ++RTRMQAQ    S     M  +F +    
Sbjct  377   TDSANPGILVLLGCGTLSSTCGQLASYPLALIRTRMQAQAMVESGPQLNMVGLFRKIVAK  436

Query  793   EGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             EG+ G Y+G+ PN +KV+PA SI+Y+VYE MK+ L +
Sbjct  437   EGILGLYRGIAPNFMKVLPAVSISYVVYEKMKENLGI  473



>ref|XP_008404488.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
[Poecilia reticulata]
Length=475

 Score =   346 bits (888),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 183/452 (40%), Positives = 277/452 (61%), Gaps = 14/452 (3%)
 Frame = -1

Query  2020  LFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDD  1841
             LF+  D++  G +D ++++ GL+AM IQ      ++++   D NKD  +D+ EF KY+ +
Sbjct  26    LFAKLDTNKDGKVDVSELKAGLAAMGIQTGKGAVQKIISSADKNKDDALDFNEFAKYLKE  85

Query  1840  KELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEE  1661
              E +L   F+++D    G +   E+  +    G+EI  ++  + ++ +D D    + + E
Sbjct  86    HEKKLRLTFKSLDKNKDGQVDYMEIQQSFADLGLEITKEDAKKILQSIDSDGTMSLDWNE  145

Query  1660  WRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLIAGGVAG  1493
             WR+  LL P   +++ I RY +   ++DIG+   IP+  ++    +    K LI+G VAG
Sbjct  146   WREHFLLNP-ATSLQEIIRYWKHSTVLDIGDSLTIPDEFTEEEKTTGLWWKQLISGAVAG  204

Query  1492  AASRTATAPLDRLKVVLQVQTTRA---SIMPAVKSIWKEGGISGFFRGNGINVLKVAPES  1322
             A SRT TAPLDR+KV +QV  +++   S+    K + KEGG++  +RGNGINVLK+APE+
Sbjct  205   AVSRTGTAPLDRMKVFMQVHASKSNKISLAGGFKQMLKEGGVTSLWRGNGINVLKIAPET  264

Query  1321  AIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCE  1142
             AIKF  YE  K  +     ++G I T  R +AG LAGA AQTAIYPM+++KTRL      
Sbjct  265   AIKFMAYEQYKKLLAS---EQGKIQTHERFMAGSLAGATAQTAIYPMEVMKTRLTLRKT-  320

Query  1141  GGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDS  962
              G+   +   +K I  +EG +AFY+G VP++LGIIPYAGIDLAVY++LKNF  +   +D+
Sbjct  321   -GQYSGMFDCAKKILQKEGVKAFYKGYVPNILGIIPYAGIDLAVYESLKNFWLSKYAKDT  379

Query  961   -EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGL  785
               PG LV LG GTIS   G    YPL ++RTRMQAQ +   +    M  +  +    +G 
Sbjct  380   ANPGVLVLLGCGTISSTCGQLASYPLALIRTRMQAQASLEGSEQLPMGRMVQKILEKDGF  439

Query  784   RGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
              G Y+G+ PN +KV+PA SI+Y+VYE+M+ +L
Sbjct  440   FGLYRGILPNFMKVIPAVSISYVVYENMRSSL  471



>ref|XP_004079367.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Oryzias latipes]
Length=475

 Score =   346 bits (887),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 194/455 (43%), Positives = 278/455 (61%), Gaps = 17/455 (4%)
 Frame = -1

Query  2026  RSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYM  1847
             ++LF   D++  G +D A++  GL AM I   +  A+E++   D NKDG +D+ EF KY+
Sbjct  25    QTLFDRLDTNKDGKVDVAELREGLKAMGI-FRHGAAQEIVSSGDQNKDGCLDFNEFTKYL  83

Query  1846  DDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITF  1667
              + E++L+  F+++D  + G I   E+  +L + GI +  ++  + +  +D D   +I +
Sbjct  84    KEHEMKLWLTFKSLDRNNDGRIDASEIQQSLAELGINLSKEDARKILHSMDIDGTMMIDW  143

Query  1666  EEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLIAGGV  1499
              EWR+  LL P    +E I+RY +   ++DIG+   IP+  ++   +S    K L+AG  
Sbjct  144   NEWREHFLLCPAH-NLEEIFRYWKHSSVLDIGDSLAIPDEFTEEEKSSDVWWKQLVAGAS  202

Query  1498  AGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISGFFRGNGINVLKVAP  1328
             AGA SRT TAPLDRLKV +QV   +T R  +   ++ +  EGG++  +RGNGINVLK+AP
Sbjct  203   AGAVSRTGTAPLDRLKVFMQVHSSKTNRIGLTGGLRQMIAEGGLTSLWRGNGINVLKIAP  262

Query  1327  ESAIKFYTYEMLKNAIGHAKGDEGD-IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTY  1151
             E+AIKF  YE  K  +      EG  I T  R +AG +AGA AQTAIYPM+++KTRL   
Sbjct  263   ETAIKFMAYEQYKKLLS----SEGKKIETHKRFMAGSMAGATAQTAIYPMEVLKTRLTLR  318

Query  1150  TCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYIL  971
               + G+   +   +K I  +EG  AFY+G +P+LLGIIPYAGIDLAVY+ LKN   +Y  
Sbjct  319   --KTGQYAGMFDCAKKILKKEGVIAFYKGYIPNLLGIIPYAGIDLAVYETLKNAWLSYYA  376

Query  970   QDS-EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRH  794
             +DS  PG LV LG GTIS   G    YPL +VRTRMQAQ +  S+    M  +       
Sbjct  377   KDSANPGVLVLLGCGTISSTCGQLSSYPLALVRTRMQAQASLGSSEQVSMTGLLKTIVAK  436

Query  793   EGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
             +GL G Y+G+ PN +KV+PA SI+Y+VYE MK  L
Sbjct  437   DGLFGLYRGILPNFMKVIPAVSISYVVYEYMKTGL  471



>ref|NP_001135638.1| solute carrier family 25 (mitochondrial carrier; phosphate carrier), 
member 23 [Xenopus (Silurana) tropicalis]
 gb|AAI68491.1| Unknown (protein for MGC:173005) [Xenopus (Silurana) tropicalis]
Length=467

 Score =   345 bits (886),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 189/459 (41%), Positives = 277/459 (60%), Gaps = 13/459 (3%)
 Frame = -1

Query  2044  ERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYP  1865
             +R+ R   LFS  DS+  G +D  ++  GL A+ +   +   +E+LR  D ++DG++D+ 
Sbjct  10    DREKRYALLFSQLDSNRDGRVDINELREGLQALGMTPCHNAEQEILRAGDTDQDGQLDFE  69

Query  1864  EFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDN  1685
             EF  Y++++E  L  +F ++D  + G I   E+ +     GI I   +  + ++ +D+D 
Sbjct  70    EFTHYLEERERRLLIMFNSLDRNNDGQIDISEIQECFHGLGIHITLAQAKKVLQSMDRDG  129

Query  1684  DGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KY  1517
                I + EWRD  LL P    +E++  Y +   ++DIGE   +P+  SK    S    K 
Sbjct  130   TLTIDWLEWRDHFLLNPLH-NMEDVITYWKHSSMLDIGESLAVPDEFSKKEIRSGMWWKQ  188

Query  1516  LIAGGVAGAASRTATAPLDRLKVVLQVQTTRA-SIMPAVKSIWKEGGISGFFRGNGINVL  1340
             L+AGGVAGA SRT TAPLDRLKV++QV  ++  SI+  ++ + +EGG+   +RGNGINV+
Sbjct  189   LLAGGVAGAVSRTGTAPLDRLKVLMQVHGSQGLSILRGLRVMIEEGGVRSLWRGNGINVI  248

Query  1339  KVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRL  1160
             K+APESAIKF  YE +K  I   +G    +    R IAG LAGA+AQTAIYPM+++KTR+
Sbjct  249   KIAPESAIKFMAYEQIKKLI---RGQHETLRVRERFIAGSLAGAIAQTAIYPMEVLKTRM  305

Query  1159  QTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN--FA  986
                    G+   +   ++ I   EG RAF++G +P+LLGI+PYAGIDLAVY+ LKN    
Sbjct  306   ALRRT--GQYSGMSDCARQILRNEGVRAFFKGYIPNLLGIVPYAGIDLAVYETLKNTWLQ  363

Query  985   RTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLR  806
             R      ++PG LV L  GT+S   G    YPL +VRTRMQAQ +   +    M  +F  
Sbjct  364   RYRSSTSADPGVLVLLACGTVSSTCGQIASYPLALVRTRMQAQASVQGSPQLSMVALFRH  423

Query  805   TFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
                 EG  G Y+G+ PN +KV+PA SI+Y+VYE+MK+ L
Sbjct  424   IVAREGFLGLYRGIAPNFMKVIPAVSISYVVYENMKRLL  462



>ref|XP_004689356.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
[Condylura cristata]
Length=468

 Score =   345 bits (886),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 193/461 (42%), Positives = 278/461 (60%), Gaps = 15/461 (3%)
 Frame = -1

Query  2044  ERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVV-DANKDGRVDY  1868
             ER  R   LF   DS+  G +D  ++ +GL+ +      + A++ + +  DA+ DG +D 
Sbjct  9     ERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGAGDPDRGAQQGISLEGDADPDGGLDL  68

Query  1867  PEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKD  1688
              EF +Y+ ++E  L  +F ++D    G I   E+  +    GI I  ++  + +  +D+D
Sbjct  69    EEFIRYLQEREQRLLLLFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRD  128

Query  1687  NDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----K  1520
                 I ++EWRD  LL+  E  +E++  + +   ++DIGE   +P+  S+    +    K
Sbjct  129   GTMTIDWQEWRDHFLLHSLE-NVEDVLYFWKHSTVLDIGECLTVPDEFSEQEKLTGMWWK  187

Query  1519  YLIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGISGFFRGNGI  1349
              L+AG VAGA SRT TAPLDRLKV +QV   +T R +I+  ++S+ +EGG+   +RGNGI
Sbjct  188   QLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLQSMIREGGVRSLWRGNGI  247

Query  1348  NVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVK  1169
             NVLK+APESAIKF  YE +K AI   +G +  +    R +AG LAGA AQT IYPM+++K
Sbjct  248   NVLKIAPESAIKFMAYEQIKRAI---RGQQETLHVQERFVAGSLAGATAQTIIYPMEVLK  304

Query  1168  TRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-  992
             TRL       G+   L   ++ I  REGPRAFYRG +P++LGIIPYAGIDLAVY+ LKN 
Sbjct  305   TRLTLRRT--GQYKGLLDCARCILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNQ  362

Query  991   FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVF  812
             + + Y    + PG LV L  GTIS   G    YPL +VRTRMQAQ +   T    M  + 
Sbjct  363   WLQQYSRDSANPGILVLLACGTISSTCGQIASYPLALVRTRMQAQASFEGTPQSSMLGLL  422

Query  811   LRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
                   EG+RG Y+G+ PN +KV+PA SI+Y+VYE+MK+ L
Sbjct  423   RHILAQEGVRGLYRGIAPNFMKVIPAVSISYVVYENMKQAL  463



>ref|XP_005805271.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Xiphophorus maculatus]
Length=475

 Score =   345 bits (885),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 183/454 (40%), Positives = 277/454 (61%), Gaps = 14/454 (3%)
 Frame = -1

Query  2020  LFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDD  1841
             LF+  D++  G +D ++++ GL+AM IQ      ++++   D NKD  +D+ EF KY+ +
Sbjct  26    LFAKLDTNKDGKVDVSELKAGLAAMGIQNGKGAVQKIISSADKNKDDELDFNEFAKYLKE  85

Query  1840  KELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEE  1661
              E +L   F+++D    G +   E+  +    G+EI  ++  + ++ +D D    + + E
Sbjct  86    HEKKLRLTFKSLDKNRDGQVDYMEIQQSFADLGLEITKEDAKKILQSIDSDGTMSLDWNE  145

Query  1660  WRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLIAGGVAG  1493
             WR+  LL P   +++ I RY +   ++DIG+   IP+  ++    +    K L++G VAG
Sbjct  146   WREHFLLNP-ATSLQEIIRYWKHSTVLDIGDSLTIPDEFTEEEKTTGLWWKQLMSGAVAG  204

Query  1492  AASRTATAPLDRLKVVLQVQTTRA---SIMPAVKSIWKEGGISGFFRGNGINVLKVAPES  1322
             A SRT TAPLDR+KV +QV  +++   S++   K + KEGG++  +RGNGINVLK+APE+
Sbjct  205   AVSRTGTAPLDRMKVFMQVHASKSNKISLVGGFKQMLKEGGVTSLWRGNGINVLKIAPET  264

Query  1321  AIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCE  1142
             AIKF  YE  K  +     + G + T  R +AG LAGA AQTAIYPM+++KTRL      
Sbjct  265   AIKFMAYEQYKKLLAS---EPGKVQTHERFMAGSLAGATAQTAIYPMEVMKTRLTLRKT-  320

Query  1141  GGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDS  962
              G+   +   +K I  REG +AFY+G VP++LGIIPYAGIDLAVY++LKNF  +   +D+
Sbjct  321   -GQYSGMFDCAKKILQREGVKAFYKGYVPNILGIIPYAGIDLAVYESLKNFWLSKYAKDT  379

Query  961   -EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGL  785
               PG LV LG GTIS   G    YPL ++RTRMQAQ +   +    M  +  +    EG 
Sbjct  380   ANPGVLVLLGCGTISSTCGQLASYPLALIRTRMQAQASLEGSEQLPMGRMVQKILEKEGF  439

Query  784   RGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
              G Y+G+ PN +KV+PA SI+Y+VYE+M+  L +
Sbjct  440   FGLYRGILPNFMKVIPAVSISYVVYENMRSGLGI  473



>ref|XP_007058269.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
[Chelonia mydas]
 gb|EMP37261.1| Calcium-binding mitochondrial carrier protein SCaMC-3 [Chelonia 
mydas]
Length=481

 Score =   345 bits (885),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 188/469 (40%), Positives = 279/469 (59%), Gaps = 15/469 (3%)
 Frame = -1

Query  2068  AALQETKE-ERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDA  1892
             A  Q++++ ER      LF   D++  G +D  ++  GL+ M + A  +  +E+LR  D 
Sbjct  14    ALCQDSRDPERQKHWAELFDQLDTNKDGRVDINELREGLARMGMNASSQAEQEILREGDT  73

Query  1891  NKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELAR  1712
             ++DG +D+ EF  Y+ ++E +L  +F ++D  + G I   E+       G+ I   +  +
Sbjct  74    DQDGELDFEEFVCYLQERERKLRLMFHSLDRNNDGHIDVSEIQQTFHSLGVYISLQQAEK  133

Query  1711  FVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHV  1532
              ++ +DKD    I + EWRD  +L P E  +E +  Y +   ++DIGE   +P+  S+  
Sbjct  134   ILQSMDKDGTMTIDWHEWRDHFILNPLE-NMEEVVHYWKHSMVLDIGECLTVPDEFSEKE  192

Query  1531  HAS----KYLIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGIS  1373
               +    K L+AG +AGA SRT TAPLDRLKV +QV   +T   ++   +K + +EGG+ 
Sbjct  193   KKTGMWWKQLLAGAMAGAVSRTGTAPLDRLKVFMQVHASKTNNMNVFGGLKGMIQEGGVC  252

Query  1372  GFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTA  1193
               +RGNGINVLK+APESAIKF  YE +K AI   +G +  +    R +AG LAGA AQT 
Sbjct  253   SLWRGNGINVLKIAPESAIKFMAYEQIKRAI---RGQQETLRVQERFVAGSLAGATAQTI  309

Query  1192  IYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLA  1013
             IYPM+++KTRL       G+   +   +K I  +EG RAFY+G +P++LGIIPYAGIDLA
Sbjct  310   IYPMEVLKTRLTLRKT--GQYSGMADCAKKILQKEGIRAFYKGYLPNVLGIIPYAGIDLA  367

Query  1012  VYDALKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTA  836
             +Y+ LKN + + Y    ++PG LV L  GT+S   G    YPL +VRTRMQAQ +     
Sbjct  368   IYETLKNMWLQKYSKNTADPGILVLLACGTMSSTCGQIASYPLALVRTRMQAQASIEGAP  427

Query  835   YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
                M  +F      EG+ G Y+G+ PN +KV+PA SI+Y+VYE+MK+ L
Sbjct  428   QPTMLGLFKHILSREGVLGLYRGIAPNFMKVIPAVSISYVVYENMKQVL  476



>ref|XP_004068093.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like 
[Oryzias latipes]
Length=475

 Score =   345 bits (885),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 182/452 (40%), Positives = 276/452 (61%), Gaps = 14/452 (3%)
 Frame = -1

Query  2020  LFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDD  1841
             LF+  D++N G +D A+++ GL+AM I+ + + A++++   D NKD  +D+ EF +Y+ D
Sbjct  26    LFARLDTNNDGKVDVAELKAGLAAMGIKTENQAAQKIISAGDKNKDDFLDFSEFSRYLKD  85

Query  1840  KELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEE  1661
              E ++  +F+++D    G I   E+  +L   G+ I  +E    ++ +D D    + + E
Sbjct  86    HEKKIKLVFKSLDKNKDGEINLAEIKQSLADLGLNISTEEAKTILQSIDADGTMSVDWNE  145

Query  1660  WRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLIAGGVAG  1493
             WRD  L  P    ++ I RY +   ++DIG+   IP+  ++    +    K L+AG  AG
Sbjct  146   WRDHFLFNPVN-NLQEIIRYWKHSTVLDIGDSLSIPDEFTEEEKITGMWWKQLMAGAAAG  204

Query  1492  AASRTATAPLDRLKVVLQVQTTRA---SIMPAVKSIWKEGGISGFFRGNGINVLKVAPES  1322
             A SRT TAPLDR+KV +QV  +++   S++   K + KEGG++  +RGNG+NVLK+APE+
Sbjct  205   AVSRTGTAPLDRMKVFMQVHASKSNKISMVNGFKQMLKEGGVTSLWRGNGVNVLKIAPET  264

Query  1321  AIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTCE  1142
             AIKF  YE  K  +     + G + T  R IAG LAGA AQTAIYPM+++KTRL     +
Sbjct  265   AIKFMAYEQYKKLLS---SNSGKVQTHERFIAGSLAGATAQTAIYPMEVMKTRLTLR--K  319

Query  1141  GGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNFARTYILQDS  962
              G+   +   +K I  +EG +AFY+G +P++LGIIPYAGIDLAVY++LKNF  +   +D+
Sbjct  320   TGQYSGMFDCAKKILKKEGVKAFYKGYIPNILGIIPYAGIDLAVYESLKNFWLSKHAKDT  379

Query  961   -EPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRHEGL  785
               PG LV LG GTIS   G    YPL ++RTRMQA  +   +    M  +  +    +G 
Sbjct  380   ANPGVLVLLGCGTISSTCGQLASYPLALIRTRMQAAASLEGSEQLSMGSMVKQILAKDGF  439

Query  784   RGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
              G Y+G+ PN +KV+PA SI+Y+VYE M+  L
Sbjct  440   FGLYRGILPNFMKVIPAVSISYVVYEYMRSGL  471



>ref|NP_001011047.1| calcium-binding mitochondrial carrier protein SCaMC-1 [Xenopus 
(Silurana) tropicalis]
 sp|Q5XHA0.1|SCMC1_XENTR RecName: Full=Calcium-binding mitochondrial carrier protein SCaMC-1; 
AltName: Full=Small calcium-binding mitochondrial carrier 
protein 1; AltName: Full=Solute carrier family 25 member 
24 [Xenopus (Silurana) tropicalis]
 gb|AAH84172.1| solute carrier family 25 (mitochondrial carrier; phosphate carrier), 
member 24 [Xenopus (Silurana) tropicalis]
Length=473

 Score =   344 bits (883),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 186/457 (41%), Positives = 273/457 (60%), Gaps = 13/457 (3%)
 Frame = -1

Query  2032  RIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRK  1853
             R   LF   D +  G +D  +++ GL AM +       ++++   D NKDG +D+ EF +
Sbjct  23    RYAELFHKLDVNKDGKVDIVELQEGLKAMGMAVGKGAEEKIVAAGDTNKDGHLDFGEFIR  82

Query  1852  YMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVI  1673
             Y+++ E ++   F ++D    G I   E+ ++L   GI I  +   + ++ +D D    +
Sbjct  83    YLEEHEKKMKIAFTSLDKNKDGKIESAEIMNSLKTLGINISLEHAEKILKSMDADGTLTV  142

Query  1672  TFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLIAG  1505
              + EWRD  L  P +  I+ I RY +   ++DIG+   IP+  ++    +    K L+AG
Sbjct  143   DWNEWRDHFLFNPAD-NIQQIIRYWKHSTVLDIGDSLTIPDEFTEEEKKTGQWWKQLLAG  201

Query  1504  GVAGAASRTATAPLDRLKVVLQVQTTR--ASIMPAVKSIWKEGGISGFFRGNGINVLKVA  1331
             G+AGA SRT TAPLDRLKV++QV  ++  A+I+  +K + KEGGI   +RGNG+NV+K+A
Sbjct  202   GMAGAVSRTGTAPLDRLKVMMQVHGSKGNANIITGLKQMVKEGGIRSLWRGNGVNVIKIA  261

Query  1330  PESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTY  1151
             PE+A+KF+ YE  K        + G +GT+ R IAG LAGA AQT+IYPM+++KTRL   
Sbjct  262   PETAMKFWAYEQYKKLF---TSESGKLGTAERFIAGSLAGATAQTSIYPMEVLKTRLAV-  317

Query  1150  TCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKNF-ARTYI  974
               + G+   +   +K I  REG RAFY+G +P++LGIIPYAGIDLA+Y+ LK F  + Y 
Sbjct  318   -GKTGQYSGMFDCAKKIMQREGVRAFYKGYIPNILGIIPYAGIDLAIYETLKTFWLQNYA  376

Query  973   LQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTFRH  794
                + PG LV LG GT S   G    YPL ++RTRMQAQ +        M  +F +    
Sbjct  377   TDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRMQAQASIEGAPQLNMGGLFRKIVAK  436

Query  793   EGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTLDL  683
             EG  G Y+G+ PN LKV+PA SI+Y+VYE MK  L +
Sbjct  437   EGFFGLYRGIAPNFLKVLPAVSISYVVYEKMKIKLGI  473



>ref|XP_005310209.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
[Chrysemys picta bellii]
Length=481

 Score =   344 bits (883),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 188/469 (40%), Positives = 279/469 (59%), Gaps = 15/469 (3%)
 Frame = -1

Query  2068  AALQETKE-ERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDA  1892
             A  Q++++ ER      LF   D++  G +D  ++  GL+ M + A  +  +E+LR  D 
Sbjct  14    ALCQDSRDPERQKHWAELFDQLDTNKDGRVDINELREGLARMGMNASSQAEQEILREGDT  73

Query  1891  NKDGRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELAR  1712
             ++DG +D+ EF  Y+ ++E +L  +F ++D  + G I   E+       G+ I   +  +
Sbjct  74    DRDGELDFEEFVSYLQERERKLRLMFHSLDRNNDGQIDVSEIQQTFHGLGVYISLQQAEK  133

Query  1711  FVEHVDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHV  1532
              ++ +DKD    I + EWRD  +L P E  +E +  Y +   ++DIGE   +P+  S+  
Sbjct  134   ILQSMDKDGTMTIDWHEWRDHFILNPLE-NMEEVVHYWKHSTVLDIGECLTVPDEFSEKE  192

Query  1531  HAS----KYLIAGGVAGAASRTATAPLDRLKVVLQV---QTTRASIMPAVKSIWKEGGIS  1373
               +    K L+AG +AGA SRT TAPLDRLKV +QV   +T   ++   +K + +EGG+ 
Sbjct  193   KRTGMWWKQLLAGAMAGAVSRTGTAPLDRLKVFMQVHASKTNNMNVFGGLKGMIQEGGVR  252

Query  1372  GFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTA  1193
               +RGNGINVLK+APESAIKF  YE +K AI   +G +  +    R +AG LAGA AQT 
Sbjct  253   SLWRGNGINVLKIAPESAIKFMAYEQIKRAI---RGQQETLRVQERFVAGSLAGATAQTI  309

Query  1192  IYPMDLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLA  1013
             IYPM+++KTRL       G+   +   +K I  +EG RAFY+G +P++LGIIPYAGIDLA
Sbjct  310   IYPMEVLKTRLTLRKT--GQYSGVADCAKKILQKEGIRAFYKGYLPNVLGIIPYAGIDLA  367

Query  1012  VYDALKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTA  836
             +Y+ LKN + + Y    ++PG LV L  GT+S   G    YPL +VRTRMQAQ +     
Sbjct  368   IYETLKNMWLQKYSRNTADPGILVLLACGTMSSTCGQIASYPLALVRTRMQAQASIEGAP  427

Query  835   YKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
                M  +F      EG+ G Y+G+ PN +KV+PA SI+Y+VYE+MK+ L
Sbjct  428   QPTMLGLFKHILSREGVLGLYRGIAPNFMKVIPAVSISYVVYENMKQVL  476



>ref|XP_007948134.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X2 [Orycteropus afer afer]
Length=458

 Score =   343 bits (881),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 188/457 (41%), Positives = 273/457 (60%), Gaps = 24/457 (5%)
 Frame = -1

Query  2020  LFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDD  1841
             L+ + D DN G LD  +++ GL  +      +  K++    D NKDG++D+ EF KY+ D
Sbjct  8     LYWYLDLDNNGTLDIHELQEGLRDLGFSVTQEKGKKIFTTGDVNKDGQLDFEEFMKYLKD  67

Query  1840  KELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEE  1661
              E ++   F+++D  + G I   E+  AL   G+ I + +    ++ +D D    + + E
Sbjct  68    HEKKMKLAFKSLDKNNDGKIEASEIVQALQTLGLNISEKQAESILQSIDADGTMTVDWNE  127

Query  1660  WRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLIAGGVAG  1493
             WRD+ L  P  + IE I R+ +    +DIG+   IP+  ++    S    + L+AGG+AG
Sbjct  128   WRDYFLFNP-ASDIEEIIRFWKHTTGIDIGDSLTIPDEFTEDEKVSGQWWRQLLAGGIAG  186

Query  1492  AASRTATAPLDRLKVVLQVQTTRASIMPAV---KSIWKEGGISGFFRGNGINVLKVAPES  1322
             A SRT+TAPLDRLKV++QV  +++  M  V   + + KEGGI   +RGNG NV+K+APE+
Sbjct  187   AVSRTSTAPLDRLKVMMQVHGSKSDKMNLVGGFRQMVKEGGIRSLWRGNGTNVIKIAPET  246

Query  1321  AIKFYTYEMLKNAIGHAKGDEGD-IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTC  1145
             A+KF+ YE  K  +     +EG  +GT  R I+G +AGA AQT IYPM+++KTRL     
Sbjct  247   AVKFWAYEQYKKLLT----EEGQKVGTFERFISGSMAGATAQTFIYPMEVIKTRLAV--G  300

Query  1144  EGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALK-----NFART  980
             + G+   +   +K I   EG  AFY+G +P+LLGIIPYAGIDLAVY+ LK     NFA+ 
Sbjct  301   KTGQYSGIFDCAKKILKHEGLGAFYKGYIPNLLGIIPYAGIDLAVYELLKSHWLDNFAKD  360

Query  979   YILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTF  800
              +     PG +V LG G +S   G    YPL +VRTRMQAQ     T    M  +F R  
Sbjct  361   TV----NPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGTPQLNMVGLFRRII  416

Query  799   RHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
               EG+RG Y+G+ PN +KV+PA  I+Y+VYE+MK+TL
Sbjct  417   SKEGVRGLYRGITPNFMKVLPAVGISYVVYENMKQTL  453



>ref|XP_007423951.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
[Python bivittatus]
Length=482

 Score =   344 bits (883),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 188/460 (41%), Positives = 274/460 (60%), Gaps = 14/460 (3%)
 Frame = -1

Query  2044  ERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYP  1865
             ER  R  SLF   D++  G +D  ++  GL+ M ++A  +  +++LR  D + DG +++ 
Sbjct  24    ERHQRWASLFEQLDTNKDGRVDINELREGLARMGMEAGSQAEQDILREGDTDHDGELNFE  83

Query  1864  EFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDN  1685
             EF +Y+ ++E +L  +F ++D  + G I   E+       G+ I   +  + +  +DKD 
Sbjct  84    EFAQYLQERERKLLLMFHSLDRNNDGEIDVSEIQQTFHSLGVYISLQQAEKILHSIDKDG  143

Query  1684  DGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KY  1517
                I + EWRD  +L P E  +E I  Y +   ++DIGE   +P+  S+    +    K 
Sbjct  144   TMTIDWHEWRDHFILNPLE-NMEEIVHYWKHSMVLDIGECLTVPDEFSEKEKKTGMWWKQ  202

Query  1516  LIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMP---AVKSIWKEGGISGFFRGNGIN  1346
             LIAG +AGA SRT TAPLDRLKV +QV  ++ + M     ++ +  EGG+   +RGNG+N
Sbjct  203   LIAGAMAGAVSRTGTAPLDRLKVFMQVHASKNNNMNVFGGLQGMIHEGGVRSLWRGNGVN  262

Query  1345  VLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPMDLVKT  1166
             VLK+APESAIKF  YE +K AI   +G +  +    R IAG LAGA AQT IYPM+++KT
Sbjct  263   VLKIAPESAIKFMAYEQIKRAI---RGQQETLRVQERFIAGSLAGATAQTIIYPMEVLKT  319

Query  1165  RLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALKN-F  989
             RL       G+   +   ++ I  +EG  AFY+G +P++LGIIPYAGIDLAVY+ LKN +
Sbjct  320   RLALRKT--GQYSGVADCARQILQKEGIPAFYKGYLPNMLGIIPYAGIDLAVYETLKNTW  377

Query  988   ARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFL  809
              + Y    ++PG LV LG GTIS   G    YPL +VRTRMQAQ +        M  +F 
Sbjct  378   LQKYSKNTADPGVLVLLGCGTISSTCGQIASYPLALVRTRMQAQASIEGAPQLTMLGLFR  437

Query  808   RTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
                  EG+ G Y+G+ PN +KV+PA SI+Y+VYE+MK+ L
Sbjct  438   HILSREGVLGLYRGIAPNFMKVIPAVSISYVVYENMKQAL  477



>ref|XP_010872642.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
isoform X3 [Esox lucius]
Length=487

 Score =   344 bits (882),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 197/465 (42%), Positives = 271/465 (58%), Gaps = 16/465 (3%)
 Frame = -1

Query  2056  ETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQI-QADYKFAKELLRVVDANKDG  1880
             E + E   R   LF   D +  G +D  ++  GL+   + ++D   A+E++R  D N DG
Sbjct  26    EGEPENRKRWAELFEQLDLNKDGKVDINELRIGLANRGLLRSD---AEEIVRESDTNHDG  82

Query  1879  RVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEH  1700
              +D  EF +Y+ D E EL  IF  +D  H G I   E+  +L   G+E+  +   + ++ 
Sbjct  83    LLDLEEFSQYLWDHEQELRVIFHTLDHNHDGHIDVGEIQQSLHNLGLEVSTEHAVKILQS  142

Query  1699  VDKDNDGVITFEEWRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS-  1523
             +D+D    I + EWRD  L  P    +E+I  Y +   + DIGEQ  +P   S+    S 
Sbjct  143   MDRDGTMTINWNEWRDHFLFNPLH-NMESIAHYWKHSLMFDIGEQLTVPPEFSQQERRSG  201

Query  1522  ---KYLIAGGVAGAASRTATAPLDRLKVVLQVQ---TTRASIMPAVKSIWKEGGISGFFR  1361
                + L+AG +AGA SRT TAPLDRLKV LQV    + R ++   +K + +EGGI   +R
Sbjct  202   VVWRQLVAGAMAGAVSRTGTAPLDRLKVFLQVHGSSSNRINLWTGLKGMVQEGGIRALWR  261

Query  1360  GNGINVLKVAPESAIKFYTYEMLKNAIGHAKGDEGDIGTSGRLIAGGLAGAVAQTAIYPM  1181
             GNGINVLK+APESAIKF  YE +K  I   + + G +    R IAG LAGA AQT IYPM
Sbjct  262   GNGINVLKIAPESAIKFMAYEQIKWLI-RGRKEGGTLRVQERFIAGSLAGATAQTIIYPM  320

Query  1180  DLVKTRLQTYTCEGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDA  1001
             +++KTRL       G+   +   ++ I  +EG RAFYRG +P+ LGIIPYAGIDLAVY+ 
Sbjct  321   EVLKTRLTLRKT--GQYSGIADCARQILRKEGVRAFYRGYMPNTLGIIPYAGIDLAVYET  378

Query  1000  LKN-FARTYILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGM  824
             LKN + + Y    ++PG LV LG GT+S   G    YPL ++RTRMQAQ +        M
Sbjct  379   LKNAWLQRYCKGSADPGVLVLLGCGTVSSTCGQLASYPLALIRTRMQAQASTEGGPKLSM  438

Query  823   FDVFLRTFRHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
                F     H+G+ G Y+G+ PN LKV+PA SI+Y+VYE MKK L
Sbjct  439   VGHFKHIISHDGVPGLYRGIAPNFLKVIPAVSISYVVYEHMKKAL  483



>gb|KEQ89390.1| mitochondrial carrier [Aureobasidium pullulans EXF-150]
Length=494

 Score =   344 bits (883),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 198/495 (40%), Positives = 278/495 (56%), Gaps = 42/495 (8%)
 Frame = -1

Query  2056  ETKEERDIRIRSLFSFFDSDNAGYLDYAQIERGLSAMQ--IQADYKFAKELLRVVDANKD  1883
             E+  ER+ R RSL+   D+ N G+LD+    +GL  +   ++      +++L  VD N  
Sbjct  4     ESSAERETRARSLWKKLDTQNEGFLDFKAFRKGLKKLDHPLKNADGLIEDVLEAVDINNS  63

Query  1882  GRVDYPEFRKYMDDKELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVE  1703
             GR++Y EFRK++D  E EL+++FQ+ID  H G +   EL  A V+AG+ + +  L  F +
Sbjct  64    GRIEYDEFRKFVDQTERELWQLFQSIDRNHDGNLDKNELRAAFVRAGLAVPNSRLDSFFD  123

Query  1702  HVDKDNDGVITFEEWRDFLLLYPHEA-TIENIYRYLERVCLVDI-GEQAVIPEGISKHVH  1529
              VD DNDGVI F EWRDFLL  P  +  ++ +  Y +    V   G+ +V  + I     
Sbjct  124   DVDTDNDGVINFGEWRDFLLFMPMSSPGLKAVMSYYQSAMKVTAEGDVSVSDDAI----Q  179

Query  1528  ASKYLIAGGVAGAASRTATAPLDRLKVVLQVQTTRASIMPAVKS----------------  1397
                Y +AGG++G ASRT TAPLDRLKV L  QT     + AVK+                
Sbjct  180   GLGYFLAGGISGVASRTTTAPLDRLKVYLIAQTGATETVQAVKNGAPAAAAKSSANTLVR  239

Query  1396  ----IWKEGGISGFFRGNGINVLKVAPESAIKFYTYEMLKNAIGHAKG--DEGDIGTSGR  1235
                 +W  GGI   F GNG+NV+KV PESA+KF +YE  K  +   +G  +   I    +
Sbjct  240   ACKELWAAGGIRSLFAGNGLNVVKVMPESAVKFGSYEAAKKMVARFEGHTNTRKISPVSQ  299

Query  1234  LIAGGLAGAVAQTAIYPMDLVKTRLQTYTCEGG--KVPHLGRLSKDIWLREGPRAFYRGI  1061
              IAGG+AG V+Q  +YP+D +K R+Q  T  GG      +   +  +W + G  +FYRG+
Sbjct  300   FIAGGVAGMVSQAVVYPLDTLKFRMQCETVPGGLRGTRLIAATAVKMWGKNGIVSFYRGL  359

Query  1060  VPSLLGIIPYAGIDLAVYDALKNFARTYILQ-------DSEPGPLVQLGSGTISGALGAT  902
                L+G+ PYA IDL  ++ LK     Y ++       D+ P        G  SGA GA+
Sbjct  360   PMGLVGMFPYAAIDLGTFEYLKRTITAYNVKKYGGHEADAAPSSFATALIGGFSGAFGAS  419

Query  901   CVYPLQVVRTRMQAQPT--HTSTAYKGMFDVFLRTFRHEGLRGFYKGLFPNLLKVVPAAS  728
              VYPL ++RTR+Q+Q T  H  T Y G+ DV  +T   EG+RG +KGL PNLLKVVPA S
Sbjct  420   AVYPLNLLRTRLQSQGTASHPRT-YTGIMDVTRQTLAGEGVRGLFKGLTPNLLKVVPAVS  478

Query  727   ITYLVYESMKKTLDL  683
             ITY+VYE+ KK L+L
Sbjct  479   ITYVVYENTKKALNL  493



>ref|XP_006882527.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X2 [Elephantulus edwardii]
Length=457

 Score =   343 bits (879),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 189/457 (41%), Positives = 276/457 (60%), Gaps = 24/457 (5%)
 Frame = -1

Query  2020  LFSFFDSDNAGYLDYAQIERGLSAMQIQADYKFAKELLRVVDANKDGRVDYPEFRKYMDD  1841
             L+++ DSD+ G ++  + + GL  + +    +  K++    D NKDG +D+ EF KY+ D
Sbjct  7     LYNYLDSDSDGTVNIKEFQEGLEDLGVTQSMERGKKIFNTGDTNKDGMLDFEEFMKYLKD  66

Query  1840  KELELYRIFQAIDVEHSGGILPEELWDALVKAGIEIDDDELARFVEHVDKDNDGVITFEE  1661
              E ++   F+++D  + G I   E+ DAL   GI+I +++    ++ +D D    + ++E
Sbjct  67    HEKKMKLAFKSLDKNNDGKIEALEIVDALKTLGIDISENQAQLILQSIDVDGTMTVDWDE  126

Query  1660  WRDFLLLYPHEATIENIYRYLERVCLVDIGEQAVIPEGISKHVHAS----KYLIAGGVAG  1493
             WR+  L  P  A IE I R+ +    +DIG+   IP+  +K    S    + L+AGGVAG
Sbjct  127   WRNHFLFNP-AADIEEIIRFWKHSTGIDIGDSLTIPDEFTKEEKLSGQWWRQLLAGGVAG  185

Query  1492  AASRTATAPLDRLKVVLQVQTTRASIMP---AVKSIWKEGGISGFFRGNGINVLKVAPES  1322
             A SRT+TAPLDRLKV++QV  ++++ M      + + KEGGI   +RGNG NV+K+APE+
Sbjct  186   AVSRTSTAPLDRLKVMMQVHGSKSNKMNLAGGFQQMVKEGGIRSLWRGNGTNVIKIAPET  245

Query  1321  AIKFYTYEMLKNAIGHAKGDEGD-IGTSGRLIAGGLAGAVAQTAIYPMDLVKTRLQTYTC  1145
             A+KF+ YE  K  +     +EG  +GT  R I+G +AGA AQT IYPM+++KTRL     
Sbjct  246   AVKFWAYEQYKKLLT----EEGQQVGTVERFISGSMAGATAQTFIYPMEVIKTRLAV--S  299

Query  1144  EGGKVPHLGRLSKDIWLREGPRAFYRGIVPSLLGIIPYAGIDLAVYDALK-----NFART  980
             + G+   +   +K I   E   AFY+G VP+LLGIIPYAGIDLAVY+ LK     NFA+ 
Sbjct  300   KTGQYSGIFDCAKKILKHESLGAFYKGYVPNLLGIIPYAGIDLAVYELLKKHWLDNFAKD  359

Query  979   YILQDSEPGPLVQLGSGTISGALGATCVYPLQVVRTRMQAQPTHTSTAYKGMFDVFLRTF  800
              +     PG +V LG G +S   G    YPL +VRTRMQAQ     T    M  +F R  
Sbjct  360   TV----NPGVVVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGTPQLNMVGLFRRIL  415

Query  799   RHEGLRGFYKGLFPNLLKVVPAASITYLVYESMKKTL  689
               EG+RG Y+G+ PN +KV+PA  I+Y+VYE+MK+TL
Sbjct  416   AKEGVRGLYRGITPNFMKVLPAVGISYVVYENMKQTL  452



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7736894236528