BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25363_g1_i1 len=1367 path=[6141:0-828 6970:829-855 12090:856-1366]

Length=1367
                                                                      Score     E

ref|XP_004249868.1|  PREDICTED: trihelix transcription factor GT-...    345   8e-110   
ref|XP_009626647.1|  PREDICTED: trihelix transcription factor GT-...    343   6e-109   
ref|XP_006351020.1|  PREDICTED: trihelix transcription factor GT-...    343   7e-109   
ref|XP_009766495.1|  PREDICTED: trihelix transcription factor GT-...    341   3e-108   
ref|XP_011099803.1|  PREDICTED: trihelix transcription factor GT-...    327   2e-102   
ref|XP_002276933.1|  PREDICTED: trihelix transcription factor GT-2      315   5e-98    Vitis vinifera
gb|KDP35327.1|  hypothetical protein JCGZ_09486                         311   1e-96    
ref|XP_011045710.1|  PREDICTED: trihelix transcription factor GT-...    310   3e-96    
ref|XP_007048236.1|  Duplicated homeodomain-like superfamily prot...    309   5e-96    
ref|XP_002298711.2|  hypothetical protein POPTR_0001s31660g             308   2e-95    Populus trichocarpa [western balsam poplar]
ref|XP_006427884.1|  hypothetical protein CICLE_v10025533mg             303   6e-94    
gb|KDO53356.1|  hypothetical protein CISIN_1g012030mg                   303   7e-94    
ref|XP_010098893.1|  Trihelix transcription factor GT-2                 303   2e-93    
emb|CDP12790.1|  unnamed protein product                                300   2e-92    
ref|XP_006371015.1|  hypothetical protein POPTR_0019s02650g             298   3e-91    
ref|XP_011046370.1|  PREDICTED: trihelix transcription factor GT-...    292   2e-89    
ref|XP_011046366.1|  PREDICTED: trihelix transcription factor GT-...    292   3e-89    
ref|XP_004169667.1|  PREDICTED: trihelix transcription factor GT-...    291   8e-89    
ref|XP_008460913.1|  PREDICTED: trihelix transcription factor GT-...    290   3e-88    
gb|EYU43477.1|  hypothetical protein MIMGU_mgv1a004878mg                285   1e-86    
emb|CBI37606.3|  unnamed protein product                                283   2e-85    
ref|XP_010680281.1|  PREDICTED: trihelix transcription factor GT-...    278   6e-84    
ref|XP_004147355.1|  PREDICTED: LOW QUALITY PROTEIN: trihelix tra...    276   6e-84    
gb|KHG24952.1|  Trihelix transcription factor GT-2 -like protein        275   7e-83    
ref|XP_003533931.1|  PREDICTED: trihelix transcription factor GT-...    275   1e-82    
gb|EPS67979.1|  hypothetical protein M569_06795                         270   7e-82    
gb|KHN15835.1|  Trihelix transcription factor GT-2                      273   8e-82    
ref|XP_010241710.1|  PREDICTED: trihelix transcription factor GT-...    270   3e-80    
emb|CDY65284.1|  BnaCnng46430D                                          268   2e-79    
ref|XP_006302034.1|  hypothetical protein CARUB_v10020016mg             267   1e-78    
emb|CDY45955.1|  BnaA02g17810D                                          263   1e-78    
ref|XP_007137690.1|  hypothetical protein PHAVU_009G147500g             265   2e-78    
gb|EPS64836.1|  hypothetical protein M569_09942                         264   2e-78    
ref|NP_001236630.1|  trihelix transcription factor                      262   8e-78    
emb|CDY48545.1|  BnaC06g18750D                                          264   9e-78    
emb|CDY13568.1|  BnaC02g23790D                                          262   1e-77    
ref|XP_010537279.1|  PREDICTED: trihelix transcription factor GT-...    261   4e-77    
ref|XP_007213893.1|  hypothetical protein PRUPE_ppa003808mg             261   5e-77    
ref|XP_009128203.1|  PREDICTED: trihelix transcription factor GT-...    260   2e-76    
emb|CDY45957.1|  BnaA02g17830D                                          256   9e-76    
ref|XP_008232997.1|  PREDICTED: trihelix transcription factor GTL...    257   2e-75    
ref|XP_003526850.1|  PREDICTED: trihelix transcription factor GT-...    252   5e-74    
ref|XP_004306599.1|  PREDICTED: trihelix transcription factor GT-...    250   2e-72    
emb|CDX68080.1|  BnaA07g21200D                                          249   3e-72    
emb|CBI34644.3|  unnamed protein product                                246   1e-71    
ref|XP_009106347.1|  PREDICTED: trihelix transcription factor GT-...    246   3e-71    
ref|XP_001755752.1|  predicted protein                                  244   3e-71    
dbj|BAK06689.1|  predicted protein                                      246   2e-70    
dbj|BAK07324.1|  predicted protein                                      246   2e-70    
gb|KHN09580.1|  Trihelix transcription factor GT-2                      238   5e-69    
ref|XP_010539733.1|  PREDICTED: trihelix transcription factor GT-2      238   9e-68    
ref|XP_001766573.1|  predicted protein                                  236   2e-67    
ref|XP_010474373.1|  PREDICTED: trihelix transcription factor GTL1      233   3e-66    
ref|NP_001146214.1|  uncharacterized protein LOC100279784               232   6e-65    Zea mays [maize]
ref|XP_008810373.1|  PREDICTED: trihelix transcription factor GTL...    230   2e-64    
ref|XP_008810371.1|  PREDICTED: trihelix transcription factor GTL...    230   2e-64    
emb|CDX93785.1|  BnaA09g23850D                                          229   2e-64    
emb|CDY71745.1|  BnaAnng38690D                                          226   1e-63    
ref|XP_010252772.1|  PREDICTED: trihelix transcription factor GTL...    206   1e-55    
ref|XP_002277307.2|  PREDICTED: trihelix transcription factor PTL       204   3e-55    Vitis vinifera
emb|CDY62151.1|  BnaCnng39380D                                          203   4e-55    
emb|CAN71904.1|  hypothetical protein VITISV_035582                     203   1e-54    Vitis vinifera
ref|XP_010243939.1|  PREDICTED: trihelix transcription factor GTL1      200   3e-54    
ref|XP_010236837.1|  PREDICTED: LOW QUALITY PROTEIN: trihelix tra...    200   5e-54    
ref|XP_006838982.1|  hypothetical protein AMTR_s00002p00271480          200   2e-53    
ref|XP_009389116.1|  PREDICTED: trihelix transcription factor GTL...    200   2e-53    
ref|XP_009389115.1|  PREDICTED: trihelix transcription factor GTL...    200   3e-53    
dbj|BAK03748.1|  predicted protein                                      191   4e-51    
ref|XP_011101506.1|  PREDICTED: LOW QUALITY PROTEIN: trihelix tra...    188   6e-50    
ref|XP_003574172.1|  PREDICTED: trihelix transcription factor GTL...    190   1e-49    
emb|CBI40214.3|  unnamed protein product                                186   5e-49    
ref|XP_002267674.3|  PREDICTED: trihelix transcription factor PTL...    186   5e-49    Vitis vinifera
gb|KHN18737.1|  Trihelix transcription factor GT-2                      181   5e-47    
gb|KFK24832.1|  hypothetical protein AALP_AA8G030800                    180   1e-46    
ref|XP_003521447.2|  PREDICTED: trihelix transcription factor PTL...    180   2e-46    
gb|KFK24833.1|  hypothetical protein AALP_AA8G030800                    177   8e-46    
ref|XP_004246556.1|  PREDICTED: trihelix transcription factor PTL       177   1e-45    
ref|XP_007162858.1|  hypothetical protein PHAVU_001G187000g             177   2e-45    
ref|XP_003553586.1|  PREDICTED: trihelix transcription factor PTL...    176   6e-45    
ref|XP_006341153.1|  PREDICTED: trihelix transcription factor PTL...    175   6e-45    
ref|XP_010558209.1|  PREDICTED: trihelix transcription factor PTL...    175   1e-44    
ref|XP_009394024.1|  PREDICTED: trihelix transcription factor PTL       174   1e-44    
ref|XP_010490858.1|  PREDICTED: trihelix transcription factor PTL...    175   1e-44    
ref|XP_007145244.1|  hypothetical protein PHAVU_007G222800g             175   1e-44    
ref|XP_010452262.1|  PREDICTED: trihelix transcription factor PTL...    174   1e-44    
ref|XP_010423677.1|  PREDICTED: trihelix transcription factor PTL...    174   1e-44    
ref|XP_006287334.1|  hypothetical protein CARUB_v10000532mg             174   2e-44    
ref|XP_010423678.1|  PREDICTED: trihelix transcription factor PTL...    174   2e-44    
ref|NP_195988.1|  trihelix transcription factor PTL                     173   3e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002530882.1|  transcription factor, putative                     173   4e-44    Ricinus communis
ref|XP_002871053.1|  hypothetical protein ARALYDRAFT_487148             173   6e-44    
ref|XP_010089408.1|  Trihelix transcription factor GT-2                 172   8e-44    
emb|CDX87564.1|  BnaA07g33090D                                          170   8e-44    
emb|CDX85981.1|  BnaC06g21530D                                          168   1e-43    
ref|XP_006588827.1|  PREDICTED: trihelix transcription factor PTL...    172   1e-43    
gb|AAS64746.1|  trihelix transcription factor                           172   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|KHN45678.1|  Trihelix transcription factor GT-2                      172   1e-43    
ref|XP_008813676.1|  PREDICTED: trihelix transcription factor PTL...    170   2e-43    
ref|XP_006398825.1|  hypothetical protein EUTSA_v10013048mg             171   2e-43    
gb|KHG27281.1|  Trihelix transcription factor GT-2 -like protein        169   6e-43    
ref|XP_009125516.1|  PREDICTED: trihelix transcription factor PTL...    168   3e-42    
ref|XP_008231992.1|  PREDICTED: trihelix transcription factor PTL...    166   3e-42    
ref|XP_009125515.1|  PREDICTED: trihelix transcription factor PTL...    167   3e-42    
ref|XP_009130776.1|  PREDICTED: trihelix transcription factor PTL...    167   4e-42    
emb|CBI18200.3|  unnamed protein product                                166   8e-42    
emb|CDP11393.1|  unnamed protein product                                165   1e-41    
ref|XP_002528594.1|  transcription factor, putative                     165   2e-41    Ricinus communis
gb|KDP45019.1|  hypothetical protein JCGZ_01519                         164   3e-41    
gb|KHN48185.1|  Trihelix transcription factor GT-2                      165   3e-41    
ref|XP_010909888.1|  PREDICTED: trihelix transcription factor PTL       164   4e-41    
ref|XP_010683862.1|  PREDICTED: trihelix transcription factor PTL       162   8e-41    
emb|CDY44379.1|  BnaC02g02980D                                          162   2e-40    
ref|XP_002522201.1|  hypothetical protein RCOM_1731940                  159   3e-40    Ricinus communis
ref|XP_011044212.1|  PREDICTED: trihelix transcription factor GT-...    161   5e-40    
ref|XP_007220052.1|  hypothetical protein PRUPE_ppa026265mg             160   7e-40    
ref|XP_010521043.1|  PREDICTED: trihelix transcription factor GT-...    156   8e-40    
ref|XP_001755749.1|  predicted protein                                  161   8e-40    
ref|XP_002300920.2|  hypothetical protein POPTR_0002s06900g             159   3e-39    Populus trichocarpa [western balsam poplar]
ref|XP_002306695.2|  trihelix DNA-binding family protein                158   5e-39    Populus trichocarpa [western balsam poplar]
gb|AEV53413.1|  SANT DNA-binding domain-containing protein              157   1e-38    
ref|XP_002266195.1|  PREDICTED: trihelix transcription factor GT-...    157   1e-38    Vitis vinifera
ref|XP_007201190.1|  hypothetical protein PRUPE_ppa002848mg             155   8e-38    
gb|AAL65124.1|  GT-2 factor                                             151   1e-37    Glycine max [soybeans]
ref|XP_004290520.1|  PREDICTED: trihelix transcription factor GT-...    154   1e-37    
ref|XP_008237582.1|  PREDICTED: trihelix transcription factor GT-...    154   2e-37    
ref|XP_010471850.1|  PREDICTED: trihelix transcription factor GT-2      154   2e-37    
ref|XP_010428752.1|  PREDICTED: trihelix transcription factor GT-...    154   2e-37    
ref|XP_006300884.1|  hypothetical protein CARUB_v10019974mg             154   2e-37    
gb|KHG04250.1|  Trihelix transcription factor GT-2 -like protein        154   2e-37    
ref|XP_009368512.1|  PREDICTED: trihelix transcription factor GT-...    154   3e-37    
ref|XP_009343632.1|  PREDICTED: trihelix transcription factor GT-...    153   4e-37    
emb|CAA05997.1|  GT2                                                    152   4e-37    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010260937.1|  PREDICTED: trihelix transcription factor GT-...    152   4e-37    
ref|XP_004290519.1|  PREDICTED: trihelix transcription factor GT-...    152   4e-37    
ref|XP_007200087.1|  hypothetical protein PRUPE_ppa021097mg             152   4e-37    
ref|XP_010428754.1|  PREDICTED: trihelix transcription factor GT-...    152   5e-37    
ref|XP_008358288.1|  PREDICTED: trihelix transcription factor GT-...    152   6e-37    
ref|XP_008339105.1|  PREDICTED: trihelix transcription factor GT-2      152   7e-37    
ref|XP_003518601.1|  PREDICTED: trihelix transcription factor GT-2      152   8e-37    
ref|XP_008237583.1|  PREDICTED: trihelix transcription factor GT-...    152   9e-37    
ref|XP_004496473.1|  PREDICTED: trihelix transcription factor GT-...    152   1e-36    
gb|KHN46419.1|  Trihelix transcription factor GT-2                      151   1e-36    
ref|XP_002307497.1|  hypothetical protein POPTR_0005s21420g             151   1e-36    Populus trichocarpa [western balsam poplar]
ref|XP_011044213.1|  PREDICTED: trihelix transcription factor GT-...    151   1e-36    
ref|XP_009621830.1|  PREDICTED: trihelix transcription factor PTL...    149   2e-36    
ref|XP_001766547.1|  predicted protein                                  151   2e-36    
ref|XP_010416613.1|  PREDICTED: trihelix transcription factor GT-2      151   2e-36    
gb|AAL65125.1|  GT-2 factor                                             145   2e-36    Glycine max [soybeans]
ref|XP_010660505.1|  PREDICTED: trihelix transcription factor GTL...    152   2e-36    
ref|XP_010660510.1|  PREDICTED: trihelix transcription factor GTL...    152   2e-36    
ref|XP_004237789.1|  PREDICTED: trihelix transcription factor GT-...    151   2e-36    
gb|KFK42102.1|  hypothetical protein AALP_AA2G210900                    151   2e-36    
ref|NP_177815.1|  trihelix transcription factor GT-2                    150   2e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009594163.1|  PREDICTED: trihelix transcription factor GTL...    151   2e-36    
gb|AAM64675.1|  trihelix DNA-binding protein (GT2)                      150   2e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002532429.1|  conserved hypothetical protein                     151   2e-36    Ricinus communis
ref|XP_006359818.1|  PREDICTED: trihelix transcription factor GT-...    150   3e-36    
ref|XP_010416611.1|  PREDICTED: trihelix transcription factor GT-...    150   3e-36    
ref|XP_002889107.1|  hypothetical protein ARALYDRAFT_895570             150   3e-36    
ref|XP_009128204.1|  PREDICTED: trihelix transcription factor GT-...    150   3e-36    
ref|XP_010660501.1|  PREDICTED: trihelix transcription factor GTL...    152   3e-36    
ref|XP_011042851.1|  PREDICTED: trihelix transcription factor GT-...    150   4e-36    
ref|XP_003536427.1|  PREDICTED: trihelix transcription factor GT-...    150   4e-36    
gb|KCW71141.1|  hypothetical protein EUGRSUZ_F04239                     150   4e-36    
ref|XP_006390147.1|  hypothetical protein EUTSA_v10018336mg             149   5e-36    
ref|XP_007143536.1|  hypothetical protein PHAVU_007G079700g             150   6e-36    
ref|XP_009382324.1|  PREDICTED: trihelix transcription factor GTL...    149   6e-36    
ref|XP_010063871.1|  PREDICTED: trihelix transcription factor GT-...    149   6e-36    
ref|XP_011042850.1|  PREDICTED: trihelix transcription factor GT-...    149   6e-36    
gb|KFK42101.1|  hypothetical protein AALP_AA2G210800                    149   6e-36    
ref|XP_002302180.1|  trihelix DNA-binding family protein                149   8e-36    Populus trichocarpa [western balsam poplar]
ref|XP_004516630.1|  PREDICTED: trihelix transcription factor GT-...    149   8e-36    
ref|XP_009106348.1|  PREDICTED: trihelix transcription factor GT-...    149   9e-36    
ref|XP_010062115.1|  PREDICTED: trihelix transcription factor GT-...    148   9e-36    
gb|EYU35138.1|  hypothetical protein MIMGU_mgv1a024778mg                148   1e-35    
gb|KCW69185.1|  hypothetical protein EUGRSUZ_F02707                     148   1e-35    
ref|XP_003556152.2|  PREDICTED: trihelix transcription factor GT-...    150   1e-35    
ref|XP_010531649.1|  PREDICTED: trihelix transcription factor GT-...    148   1e-35    
ref|XP_006390148.1|  hypothetical protein EUTSA_v10018297mg             148   1e-35    
ref|XP_007143535.1|  hypothetical protein PHAVU_007G079700g             149   1e-35    
ref|XP_009382323.1|  PREDICTED: trihelix transcription factor GTL...    149   1e-35    
ref|XP_010062114.1|  PREDICTED: trihelix transcription factor GT-...    148   1e-35    
ref|XP_008381818.1|  PREDICTED: trihelix transcription factor GT-...    148   1e-35    
gb|KDP42684.1|  hypothetical protein JCGZ_23624                         148   2e-35    
ref|XP_010680658.1|  PREDICTED: trihelix transcription factor GT-...    149   2e-35    
ref|XP_002887660.1|  hypothetical protein ARALYDRAFT_895569             147   2e-35    
ref|XP_011101538.1|  PREDICTED: trihelix transcription factor GT-...    148   2e-35    
ref|XP_004173228.1|  PREDICTED: trihelix transcription factor GT-...    140   2e-35    
ref|XP_011074760.1|  PREDICTED: trihelix transcription factor GT-...    147   2e-35    
gb|AFK41859.1|  unknown                                                 142   3e-35    
gb|KDP42994.1|  hypothetical protein JCGZ_25180                         147   3e-35    
gb|KDP42995.1|  hypothetical protein JCGZ_25181                         148   3e-35    
ref|XP_009368514.1|  PREDICTED: trihelix transcription factor GT-...    147   3e-35    
ref|XP_010108641.1|  Trihelix transcription factor GT-2                 147   4e-35    
ref|XP_007019487.1|  Duplicated homeodomain-like superfamily prot...    147   4e-35    
ref|NP_177814.1|  Duplicated homeodomain-like superfamily protein       147   4e-35    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002300534.2|  hypothetical protein POPTR_0001s45870g             148   4e-35    Populus trichocarpa [western balsam poplar]
ref|XP_009787560.1|  PREDICTED: trihelix transcription factor GTL...    147   4e-35    
ref|XP_002532428.1|  hypothetical protein RCOM_0453340                  147   4e-35    Ricinus communis
gb|KEH42088.1|  trihelix transcription factor                           146   4e-35    
ref|XP_010108642.1|  Trihelix transcription factor GT-2                 147   5e-35    
ref|XP_006364133.1|  PREDICTED: trihelix transcription factor GTL...    147   5e-35    
ref|XP_010250890.1|  PREDICTED: trihelix transcription factor GTL...    147   6e-35    
ref|XP_009411483.1|  PREDICTED: trihelix transcription factor GTL...    147   6e-35    
ref|XP_004309494.1|  PREDICTED: uncharacterized protein LOC101290918    148   6e-35    
ref|XP_003548114.1|  PREDICTED: trihelix transcription factor GT-...    147   7e-35    
ref|XP_010314480.1|  PREDICTED: trihelix transcription factor GTL...    147   7e-35    
ref|XP_006434456.1|  hypothetical protein CICLE_v10000627mg             146   7e-35    
ref|XP_003592114.1|  GT-2 factor                                        146   8e-35    
gb|KDO83728.1|  hypothetical protein CISIN_1g007316mg                   146   8e-35    
gb|KDO83726.1|  hypothetical protein CISIN_1g006925mg                   146   8e-35    
ref|XP_009769494.1|  PREDICTED: trihelix transcription factor GT-...    147   9e-35    
ref|XP_006473055.1|  PREDICTED: trihelix transcription factor GT-...    146   9e-35    
ref|XP_009401789.1|  PREDICTED: trihelix transcription factor GTL...    147   9e-35    
ref|XP_009401788.1|  PREDICTED: trihelix transcription factor GTL...    147   9e-35    
ref|XP_010533325.1|  PREDICTED: trihelix transcription factor GT-...    139   9e-35    
gb|KEH43422.1|  trihelix transcription factor                           145   9e-35    
ref|XP_007019483.1|  Duplicated homeodomain-like superfamily prot...    145   1e-34    
ref|XP_010919360.1|  PREDICTED: trihelix transcription factor GTL...    147   1e-34    
ref|XP_010250883.1|  PREDICTED: trihelix transcription factor GTL...    147   1e-34    
gb|AER42647.1|  GTL1                                                    147   1e-34    
ref|XP_007039269.1|  Duplicated homeodomain-like superfamily prot...    147   1e-34    
ref|XP_009618661.1|  PREDICTED: trihelix transcription factor GTL...    146   1e-34    
ref|XP_009411482.1|  PREDICTED: trihelix transcription factor GTL...    147   1e-34    
gb|AFW63214.1|  putative homeodomain-like transcription factor su...    145   1e-34    
ref|XP_006473053.1|  PREDICTED: trihelix transcription factor GT-...    145   1e-34    
ref|XP_009389204.1|  PREDICTED: trihelix transcription factor GTL...    146   1e-34    
ref|XP_011038062.1|  PREDICTED: trihelix transcription factor GTL...    145   1e-34    
ref|XP_010919359.1|  PREDICTED: trihelix transcription factor GTL...    147   1e-34    
ref|XP_011081350.1|  PREDICTED: trihelix transcription factor GTL...    145   1e-34    
ref|XP_008791631.1|  PREDICTED: trihelix transcription factor GTL...    146   2e-34    
ref|XP_008239289.1|  PREDICTED: trihelix transcription factor GTL...    146   2e-34    
gb|EYU17439.1|  hypothetical protein MIMGU_mgv1a026923mg                145   2e-34    
ref|XP_009389196.1|  PREDICTED: trihelix transcription factor GTL...    146   2e-34    
gb|AIB05523.1|  trihelix transcription factor                           145   2e-34    
ref|XP_004496472.1|  PREDICTED: trihelix transcription factor GT-...    145   2e-34    
ref|XP_008791630.1|  PREDICTED: trihelix transcription factor GTL...    147   2e-34    
ref|XP_007210347.1|  hypothetical protein PRUPE_ppa001704mg             146   2e-34    
ref|XP_007152027.1|  hypothetical protein PHAVU_004G095400g             145   2e-34    
ref|XP_007019482.1|  Duplicated homeodomain-like superfamily prot...    145   2e-34    
ref|XP_010539731.1|  PREDICTED: trihelix transcription factor GT-...    144   2e-34    
ref|XP_009398860.1|  PREDICTED: trihelix transcription factor GTL...    145   2e-34    
ref|XP_008678885.1|  PREDICTED: trihelix transcription factor GTL1      145   2e-34    
ref|XP_011038059.1|  PREDICTED: trihelix transcription factor GTL...    145   2e-34    
ref|XP_011038057.1|  PREDICTED: trihelix transcription factor GTL...    145   2e-34    
ref|XP_011038056.1|  PREDICTED: trihelix transcription factor GTL...    145   2e-34    
ref|XP_007039268.1|  Duplicated homeodomain-like superfamily prot...    146   3e-34    
ref|XP_011038058.1|  PREDICTED: trihelix transcription factor GTL...    145   3e-34    
ref|XP_011038063.1|  PREDICTED: trihelix transcription factor GTL...    146   3e-34    
ref|XP_004986012.1|  PREDICTED: trihelix transcription factor GTL...    145   3e-34    
ref|XP_011081349.1|  PREDICTED: trihelix transcription factor GTL...    145   3e-34    
ref|XP_008239287.1|  PREDICTED: trihelix transcription factor GTL...    146   3e-34    
emb|CAE02791.2|  OSJNBa0011L07.15                                       145   3e-34    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004986013.1|  PREDICTED: trihelix transcription factor GTL...    145   3e-34    
ref|XP_006854553.1|  hypothetical protein AMTR_s00030p00088210          144   3e-34    
ref|XP_006476232.1|  PREDICTED: trihelix transcription factor GTL...    145   4e-34    
ref|XP_010240191.1|  PREDICTED: trihelix transcription factor GTL...    145   4e-34    
ref|XP_006590202.1|  PREDICTED: trihelix transcription factor GT-...    144   4e-34    
gb|KHN17009.1|  Trihelix transcription factor GT-2                      144   4e-34    
ref|XP_003637930.1|  GT-2 factor                                        144   4e-34    
ref|XP_011004381.1|  PREDICTED: trihelix transcription factor GTL...    145   5e-34    
dbj|BAJ90122.1|  predicted protein                                      145   5e-34    
ref|XP_010537280.1|  PREDICTED: trihelix transcription factor GT-...    143   5e-34    
emb|CAA48328.1|  gt-2                                                   145   5e-34    Oryza sativa [red rice]
ref|XP_006439158.1|  hypothetical protein CICLE_v10018915mg             145   5e-34    
ref|XP_006476231.1|  PREDICTED: trihelix transcription factor GTL...    145   5e-34    
ref|XP_010240190.1|  PREDICTED: trihelix transcription factor GTL...    145   5e-34    
ref|XP_002518968.1|  transcription factor, putative                     145   5e-34    Ricinus communis
ref|NP_001146293.1|  hypothetical protein                               144   6e-34    Zea mays [maize]
ref|XP_008360729.1|  PREDICTED: trihelix transcription factor GTL...    144   6e-34    
gb|AFK49328.1|  unknown                                                 142   6e-34    
ref|XP_011004382.1|  PREDICTED: trihelix transcription factor GTL...    144   6e-34    
tpg|DAA36644.1|  TPA: hypothetical protein ZEAMMB73_231314              144   6e-34    
ref|XP_002317033.2|  hypothetical protein POPTR_0011s15050g             142   7e-34    Populus trichocarpa [western balsam poplar]
ref|XP_009104654.1|  PREDICTED: trihelix transcription factor GT-2      143   7e-34    
ref|XP_002452839.1|  hypothetical protein SORBIDRAFT_04g033390          144   7e-34    Sorghum bicolor [broomcorn]
ref|XP_003592112.1|  GT-2 factor                                        143   7e-34    
ref|XP_006434455.1|  hypothetical protein CICLE_v10000593mg             143   7e-34    
ref|XP_010933773.1|  PREDICTED: trihelix transcription factor GTL...    144   8e-34    
ref|XP_011004380.1|  PREDICTED: trihelix transcription factor GTL...    145   8e-34    
dbj|BAB41080.1|  DNA-binding protein DF1                                143   1e-33    
ref|XP_008810715.1|  PREDICTED: trihelix transcription factor GTL...    144   1e-33    
ref|XP_010933772.1|  PREDICTED: trihelix transcription factor GTL...    144   1e-33    
ref|XP_006851901.1|  hypothetical protein AMTR_s00041p00147950          143   1e-33    
ref|XP_008360728.1|  PREDICTED: trihelix transcription factor GTL...    144   1e-33    
emb|CDX88320.1|  BnaC06g37640D                                          142   1e-33    
ref|XP_008667826.1|  PREDICTED: uncharacterized protein LOC100279...    144   2e-33    
ref|XP_009398096.1|  PREDICTED: trihelix transcription factor GTL...    143   2e-33    
ref|XP_007143537.1|  hypothetical protein PHAVU_007G079800g             142   2e-33    
ref|XP_004953289.1|  PREDICTED: trihelix transcription factor GTL...    142   2e-33    
ref|XP_009360258.1|  PREDICTED: trihelix transcription factor GTL...    142   2e-33    
ref|XP_009398095.1|  PREDICTED: trihelix transcription factor GTL...    143   2e-33    
gb|KHN46418.1|  Trihelix transcription factor GT-2                      142   2e-33    
gb|EPS57242.1|  hypothetical protein M569_17578                         140   2e-33    
ref|XP_009398094.1|  PREDICTED: trihelix transcription factor GTL...    143   3e-33    
ref|XP_006606164.1|  PREDICTED: trihelix transcription factor GT-...    142   3e-33    
ref|XP_004145967.1|  PREDICTED: uncharacterized protein LOC101212243    142   3e-33    
gb|KHG29020.1|  Trihelix transcription factor GTL1 -like protein        142   3e-33    
ref|XP_009104653.1|  PREDICTED: LOW QUALITY PROTEIN: trihelix tra...    141   3e-33    
ref|XP_004953287.1|  PREDICTED: trihelix transcription factor GTL...    142   4e-33    
ref|XP_009360257.1|  PREDICTED: trihelix transcription factor GTL...    142   5e-33    
ref|XP_008445774.1|  PREDICTED: trihelix transcription factor GTL1      141   5e-33    
gb|EEC67312.1|  hypothetical protein OsI_34323                          142   5e-33    
ref|XP_004140891.1|  PREDICTED: uncharacterized protein LOC101205810    141   6e-33    
emb|CBI34193.3|  unnamed protein product                                139   8e-33    
ref|XP_008375439.1|  PREDICTED: trihelix transcription factor GTL...    141   8e-33    
ref|XP_006647608.1|  PREDICTED: trihelix transcription factor GTL...    140   9e-33    
emb|CDY04893.1|  BnaAnng00750D                                          139   9e-33    
gb|KHN41269.1|  Trihelix transcription factor GT-2                      139   1e-32    
gb|AAK39576.1|AC025296_11  putative transcription factor                141   1e-32    
ref|XP_003548983.2|  PREDICTED: trihelix transcription factor GT-...    139   2e-32    
gb|EEE51268.1|  hypothetical protein OsJ_32161                          140   2e-32    
ref|XP_008375438.1|  PREDICTED: trihelix transcription factor GTL...    140   2e-32    
gb|EEE57477.1|  hypothetical protein OsJ_07722                          138   2e-32    
gb|EEC73697.1|  hypothetical protein OsI_08282                          139   2e-32    
emb|CDY10364.1|  BnaCnng02650D                                          138   3e-32    
ref|XP_009418089.1|  PREDICTED: trihelix transcription factor GTL...    139   3e-32    
gb|EYU23825.1|  hypothetical protein MIMGU_mgv1a002587mg                139   3e-32    
dbj|BAD25534.1|  putative DNA-binding protein Gt-2                      139   3e-32    
ref|XP_007152025.1|  hypothetical protein PHAVU_004G095200g             138   4e-32    
ref|XP_002465995.1|  hypothetical protein SORBIDRAFT_01g049740          139   4e-32    
ref|XP_002448251.1|  hypothetical protein SORBIDRAFT_06g023980          139   4e-32    
gb|KHG05349.1|  Trihelix transcription factor GTL1 -like protein        139   5e-32    
ref|XP_010542309.1|  PREDICTED: trihelix transcription factor GTL...    138   6e-32    
ref|XP_009380043.1|  PREDICTED: trihelix transcription factor GTL...    139   6e-32    
gb|AAO17016.1|  Hypothetical protein                                    139   7e-32    
ref|XP_002464376.1|  hypothetical protein SORBIDRAFT_01g017120          139   8e-32    
gb|EEE58198.1|  hypothetical protein OsJ_09149                          139   8e-32    
dbj|BAJ89037.1|  predicted protein                                      139   9e-32    
ref|XP_009107946.1|  PREDICTED: trihelix transcription factor GTL...    136   9e-32    
ref|XP_008665814.1|  PREDICTED: trihelix transcription factor GTL...    139   1e-31    
ref|XP_006574804.1|  PREDICTED: trihelix transcription factor GT-...    137   1e-31    
ref|XP_010542301.1|  PREDICTED: trihelix transcription factor GTL...    137   1e-31    
ref|XP_004150493.1|  PREDICTED: trihelix transcription factor GT-...    135   1e-31    
ref|XP_002882649.1|  hypothetical protein ARALYDRAFT_341138             135   2e-31    
ref|XP_008446778.1|  PREDICTED: trihelix transcription factor PTL...    135   2e-31    
ref|XP_009107944.1|  PREDICTED: trihelix transcription factor GTL...    136   2e-31    
ref|XP_009398097.1|  PREDICTED: trihelix transcription factor GTL...    136   2e-31    
ref|XP_010486582.1|  PREDICTED: trihelix transcription factor PTL...    135   2e-31    
ref|NP_001167728.1|  hypothetical protein                               137   2e-31    
ref|XP_010230299.1|  PREDICTED: trihelix transcription factor GTL...    136   3e-31    
emb|CDY11266.1|  BnaA03g01020D                                          134   4e-31    
dbj|BAJ85645.1|  predicted protein                                      137   5e-31    
ref|XP_010479725.1|  PREDICTED: trihelix transcription factor PTL...    133   8e-31    
ref|XP_007204127.1|  hypothetical protein PRUPE_ppa024278mg             133   8e-31    
ref|XP_008241284.1|  PREDICTED: trihelix transcription factor PTL       134   9e-31    
ref|XP_010538885.1|  PREDICTED: trihelix transcription factor GTL...    134   9e-31    
ref|XP_009123748.1|  PREDICTED: trihelix transcription factor GTL...    133   1e-30    
ref|XP_010538884.1|  PREDICTED: trihelix transcription factor GTL...    134   1e-30    
ref|XP_010538886.1|  PREDICTED: trihelix transcription factor GTL...    134   2e-30    
ref|XP_010464660.1|  PREDICTED: trihelix transcription factor PTL...    132   2e-30    
gb|KHG04249.1|  Trihelix transcription factor GT-2 -like protein        133   2e-30    
gb|KHN00764.1|  Trihelix transcription factor GT-2                      130   2e-30    
ref|XP_010534754.1|  PREDICTED: trihelix transcription factor GT-...    130   2e-30    
ref|XP_009123747.1|  PREDICTED: trihelix transcription factor GTL...    133   2e-30    
ref|XP_004308550.1|  PREDICTED: trihelix transcription factor GT-...    131   3e-30    
ref|XP_002516129.1|  conserved hypothetical protein                     133   3e-30    
gb|AAM98226.1|  DNA-binding factor, putative                            130   3e-30    
ref|XP_010499863.1|  PREDICTED: trihelix transcription factor GTL...    132   3e-30    
ref|XP_006307050.1|  hypothetical protein CARUB_v10008638mg             132   3e-30    
ref|XP_010478741.1|  PREDICTED: trihelix transcription factor GTL...    132   3e-30    
gb|KDP34035.1|  hypothetical protein JCGZ_07606                         132   3e-30    
ref|XP_009408117.1|  PREDICTED: trihelix transcription factor GTL...    133   4e-30    
ref|XP_010461139.1|  PREDICTED: trihelix transcription factor GTL...    132   4e-30    
emb|CAA05996.1|  GTL2                                                   131   4e-30    
ref|XP_009352991.1|  PREDICTED: trihelix transcription factor PTL...    131   4e-30    
ref|XP_009412898.1|  PREDICTED: trihelix transcription factor PTL...    130   4e-30    
ref|XP_007010380.1|  Transcription factor, putative                     132   4e-30    
ref|XP_008391755.1|  PREDICTED: trihelix transcription factor PTL...    131   5e-30    
ref|XP_008437493.1|  PREDICTED: trihelix transcription factor GTL...    131   5e-30    
ref|XP_002965455.1|  hypothetical protein SELMODRAFT_85122              129   5e-30    
ref|XP_006415118.1|  hypothetical protein EUTSA_v10007000mg             132   5e-30    
ref|XP_008386941.1|  PREDICTED: trihelix transcription factor PTL       131   5e-30    
ref|XP_009365339.1|  PREDICTED: trihelix transcription factor PTL       131   5e-30    
gb|KHG24798.1|  Trihelix transcription factor GT-2 -like protein        131   5e-30    
ref|XP_008445762.1|  PREDICTED: trihelix transcription factor GT-...    131   6e-30    
ref|XP_002316512.2|  hypothetical protein POPTR_0010s24140g             130   6e-30    
ref|XP_002279929.1|  PREDICTED: trihelix transcription factor GTL...    132   6e-30    
ref|XP_002984536.1|  hypothetical protein SELMODRAFT_120369             128   6e-30    
gb|EMS66886.1|  Trihelix transcription factor GT-2                      133   6e-30    
ref|XP_004305362.1|  PREDICTED: trihelix transcription factor GT-...    131   7e-30    
ref|XP_010499862.1|  PREDICTED: trihelix transcription factor GTL...    132   7e-30    
ref|XP_010461138.1|  PREDICTED: trihelix transcription factor GTL...    132   8e-30    
ref|XP_010478740.1|  PREDICTED: trihelix transcription factor GTL...    132   8e-30    
gb|KFK45057.1|  hypothetical protein AALP_AA1G338300                    132   8e-30    
ref|XP_010461140.1|  PREDICTED: trihelix transcription factor GTL...    132   8e-30    
emb|CAA05995.1|  GTL1                                                   131   9e-30    
sp|Q9C882.2|GTL1_ARATH  RecName: Full=Trihelix transcription fact...    131   9e-30    
ref|XP_006415119.1|  hypothetical protein EUTSA_v10007000mg             132   9e-30    
gb|AAG51283.1|AC027035_6  trihelix DNA-binding protein (GTL1)           131   9e-30    
ref|XP_008437492.1|  PREDICTED: trihelix transcription factor GTL...    131   1e-29    
ref|XP_006388152.1|  hypothetical protein POPTR_0310s002001g            128   1e-29    
ref|XP_008796930.1|  PREDICTED: trihelix transcription factor GTL...    132   1e-29    
ref|XP_007027628.1|  Duplicated homeodomain-like superfamily prot...    130   1e-29    
ref|XP_009373707.1|  PREDICTED: trihelix transcription factor GTL...    131   1e-29    
ref|XP_010529094.1|  PREDICTED: trihelix transcription factor GT-...    128   1e-29    
ref|XP_011032809.1|  PREDICTED: trihelix transcription factor PTL...    130   1e-29    
ref|XP_002966488.1|  hypothetical protein SELMODRAFT_24518              124   1e-29    
ref|XP_004137874.1|  PREDICTED: trihelix transcription factor GT-...    130   1e-29    
ref|XP_008442805.1|  PREDICTED: trihelix transcription factor PTL       130   2e-29    
emb|CDX80883.1|  BnaC03g01370D                                          129   2e-29    
ref|XP_010032102.1|  PREDICTED: trihelix transcription factor PTL...    129   2e-29    
ref|XP_009613783.1|  PREDICTED: trihelix transcription factor PTL...    130   2e-29    
ref|XP_010941148.1|  PREDICTED: trihelix transcription factor GT-...    130   2e-29    
ref|XP_009336990.1|  PREDICTED: trihelix transcription factor PTL...    130   2e-29    
gb|KGN46016.1|  hypothetical protein Csa_6G042990                       130   2e-29    
ref|XP_004163886.1|  PREDICTED: LOW QUALITY PROTEIN: trihelix tra...    129   2e-29    
gb|AGV68673.1|  PTL                                                     130   2e-29    
ref|XP_002893757.1|  hypothetical protein ARALYDRAFT_473497             131   2e-29    
emb|CDX70293.1|  BnaA10g26420D                                          130   2e-29    
ref|NP_174594.1|  trihelix transcription factor GTL1                    131   2e-29    
ref|XP_010036725.1|  PREDICTED: trihelix transcription factor PTL       129   2e-29    
ref|XP_004140984.1|  PREDICTED: trihelix transcription factor GT-...    129   2e-29    
emb|CDP15371.1|  unnamed protein product                                129   2e-29    
ref|XP_011094408.1|  PREDICTED: trihelix transcription factor PTL       129   3e-29    
ref|XP_006430288.1|  hypothetical protein CICLE_v10011338mg             130   3e-29    
ref|XP_006481882.1|  PREDICTED: trihelix transcription factor PTL...    130   3e-29    
ref|XP_009415425.1|  PREDICTED: trihelix transcription factor GTL...    130   3e-29    
ref|XP_011010883.1|  PREDICTED: trihelix transcription factor GT-...    128   4e-29    
ref|XP_011011132.1|  PREDICTED: trihelix transcription factor GTL...    128   4e-29    
ref|XP_008375584.1|  PREDICTED: trihelix transcription factor PTL...    129   4e-29    
ref|XP_004494146.1|  PREDICTED: trihelix transcription factor PTL...    128   4e-29    
ref|XP_010278209.1|  PREDICTED: trihelix transcription factor PTL...    129   4e-29    
ref|XP_010243802.1|  PREDICTED: trihelix transcription factor PTL       129   5e-29    
ref|XP_009789130.1|  PREDICTED: trihelix transcription factor PTL       128   5e-29    
ref|XP_002324189.2|  hypothetical protein POPTR_0018s05520g             129   5e-29    
ref|XP_010934944.1|  PREDICTED: LOW QUALITY PROTEIN: trihelix tra...    130   5e-29    
ref|XP_002311966.2|  hypothetical protein POPTR_0008s02580g             129   5e-29    
ref|XP_002324190.2|  hypothetical protein POPTR_0018s05540g             127   5e-29    
gb|KHN00918.1|  Trihelix transcription factor GT-2                      127   8e-29    
ref|XP_006299692.1|  hypothetical protein CARUB_v10015883mg             127   8e-29    
ref|XP_002308526.2|  hypothetical protein POPTR_0006s23800g             129   8e-29    
ref|XP_004497606.1|  PREDICTED: trihelix transcription factor PTL...    127   1e-28    
ref|XP_009122682.1|  PREDICTED: trihelix transcription factor PTL       127   1e-28    
ref|XP_009778190.1|  PREDICTED: trihelix transcription factor PTL...    127   1e-28    
ref|XP_004162514.1|  PREDICTED: LOW QUALITY PROTEIN: trihelix tra...    124   2e-28    
ref|XP_010543461.1|  PREDICTED: trihelix transcription factor PTL       127   2e-28    
gb|ACU18455.1|  unknown                                                 121   2e-28    
ref|XP_007012413.1|  Duplicated homeodomain-like superfamily prot...    127   2e-28    
emb|CDP13459.1|  unnamed protein product                                127   2e-28    
ref|XP_004249788.1|  PREDICTED: trihelix transcription factor PTL...    125   2e-28    
ref|XP_009385751.1|  PREDICTED: trihelix transcription factor GTL...    127   2e-28    
ref|NP_187611.2|  embryo sac development arrest protein 31              126   2e-28    
ref|XP_011019357.1|  PREDICTED: trihelix transcription factor GTL...    126   3e-28    
ref|XP_006829028.1|  hypothetical protein AMTR_s00001p00251940          126   3e-28    
gb|KDO46107.1|  hypothetical protein CISIN_1g010601mg                   125   3e-28    
ref|XP_006851630.1|  hypothetical protein AMTR_s00040p00200990          125   3e-28    
ref|XP_006436672.1|  hypothetical protein CICLE_v10031295mg             125   4e-28    
ref|XP_010934597.1|  PREDICTED: trihelix transcription factor GTL...    126   4e-28    
gb|KHN37845.1|  Trihelix transcription factor GT-2                      126   4e-28    
ref|XP_003555461.1|  PREDICTED: trihelix transcription factor PTL...    125   4e-28    
ref|XP_008345531.1|  PREDICTED: trihelix transcription factor PTL...    126   4e-28    
ref|XP_010110171.1|  Trihelix transcription factor GT-2                 126   7e-28    
ref|XP_003535498.2|  PREDICTED: trihelix transcription factor PTL...    125   8e-28    
ref|XP_009385847.1|  PREDICTED: trihelix transcription factor GTL...    126   1e-27    
ref|XP_010539732.1|  PREDICTED: trihelix transcription factor GT-...    124   1e-27    
gb|EYU38616.1|  hypothetical protein MIMGU_mgv1a022400mg                124   1e-27    
ref|XP_007143826.1|  hypothetical protein PHAVU_007G104900g             124   1e-27    
ref|XP_004139609.1|  PREDICTED: uncharacterized protein LOC101216718    122   3e-27    
emb|CAA05998.1|  GTL1                                                   122   3e-27    
gb|KHG14861.1|  Trihelix transcription factor GT-2 -like protein        121   5e-27    
ref|XP_004496179.1|  PREDICTED: trihelix transcription factor PTL...    122   6e-27    
emb|CDY44964.1|  BnaA08g06640D                                          120   7e-27    
ref|XP_006650971.1|  PREDICTED: trihelix transcription factor GTL...    117   2e-26    
ref|XP_006453007.1|  hypothetical protein CICLE_v10010595mg             119   4e-26    
ref|XP_006474486.1|  PREDICTED: trihelix transcription factor GT-...    120   4e-26    
ref|XP_002323120.1|  hypothetical protein POPTR_0016s00760g             118   4e-26    
ref|XP_003534745.1|  PREDICTED: trihelix transcription factor GTL...    117   5e-26    
gb|KHN40789.1|  Trihelix transcription factor GT-2                      117   5e-26    
gb|KDO73612.1|  hypothetical protein CISIN_1g009174mg                   119   6e-26    
gb|EMT01729.1|  hypothetical protein F775_26337                         117   8e-26    
ref|XP_004495792.1|  PREDICTED: trihelix transcription factor GTL...    119   9e-26    
ref|XP_002993558.1|  hypothetical protein SELMODRAFT_48639              113   1e-25    
ref|XP_002972103.1|  hypothetical protein SELMODRAFT_66294              113   1e-25    
ref|XP_007147613.1|  hypothetical protein PHAVU_006G139200g             115   2e-25    
ref|XP_009609923.1|  PREDICTED: trihelix transcription factor GT-...    118   2e-25    
ref|XP_008220566.1|  PREDICTED: trihelix transcription factor GTL...    118   2e-25    
ref|XP_004486347.1|  PREDICTED: trihelix transcription factor GT-...    114   4e-25    
ref|XP_009782860.1|  PREDICTED: trihelix transcription factor GT-...    117   4e-25    
ref|NP_001189853.1|  embryo sac development arrest protein 31           116   5e-25    
gb|AAF04423.1|AC010927_16  hypothetical protein                         116   6e-25    
ref|XP_010087663.1|  hypothetical protein L484_010615                   114   7e-25    
ref|XP_010646634.1|  PREDICTED: trihelix transcription factor GT-2      112   7e-25    
ref|XP_007224165.1|  hypothetical protein PRUPE_ppa016464mg             116   9e-25    
gb|AFW66826.1|  hypothetical protein ZEAMMB73_815554                    117   1e-24    
ref|XP_004305610.1|  PREDICTED: uncharacterized protein LOC101310342    115   1e-24    
ref|NP_001047580.2|  Os02g0648300                                       114   2e-24    
ref|XP_006367058.1|  PREDICTED: trihelix transcription factor GTL...    114   2e-24    
ref|XP_003547291.1|  PREDICTED: trihelix transcription factor GTL...    112   3e-24    
emb|CBI20718.3|  unnamed protein product                                114   4e-24    
ref|XP_008794787.1|  PREDICTED: trihelix transcription factor GTL...    114   7e-24    
emb|CDY48546.1|  BnaC06g18740D                                          111   1e-23    
gb|KHG07895.1|  Trihelix transcription factor GT-2 -like protein        111   1e-23    
ref|XP_003626419.1|  Trihelix transcription factor                      112   1e-23    
ref|XP_003635505.1|  PREDICTED: trihelix transcription factor GT-...    110   3e-23    
gb|EMS58105.1|  Trihelix transcription factor GT-2                      112   3e-23    
gb|AFW66827.1|  hypothetical protein ZEAMMB73_815554                    107   5e-23    
tpg|DAA42892.1|  TPA: hypothetical protein ZEAMMB73_884435              111   8e-23    
ref|XP_008224631.1|  PREDICTED: trihelix transcription factor GTL1      108   8e-23    
tpg|DAA42893.1|  TPA: hypothetical protein ZEAMMB73_884435              111   8e-23    



>ref|XP_004249868.1| PREDICTED: trihelix transcription factor GT-2-like [Solanum lycopersicum]
Length=495

 Score =   345 bits (885),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 216/372 (58%), Positives = 260/372 (70%), Gaps = 43/372 (12%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWPHEETL LLKIRSEMD+AFRDS LK PLWDE+SRKM E GY R+AKKCREKFENIYKY
Sbjct  54   RWPHEETLALLKIRSEMDVAFRDSNLKSPLWDEISRKMAELGYNRNAKKCREKFENIYKY  113

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQ-------SHNKIGGaaaaeppelaspspvA  658
            H+RTK+GRSGRQTGKNYRFFEQLE+ D+         +H++I      E   +  P P+ 
Sbjct  114  HKRTKDGRSGRQTGKNYRFFEQLELLDSQSLFSSPPLNHSQIN---RMETMPVPMPMPMT  170

Query  657  MIKPNTNIVQDFRM---RPHGF--GADADVLsaststtyssggssGRKRKLAGYFEKMMK  493
            MIKP  +  QDF M   R  GF  G  +   S ++S+   S GS  +KRKLA YFE++MK
Sbjct  171  MIKPAASGCQDFGMDHSRVRGFNPGFMSTSTSTTSSSGKESDGSVKKKRKLASYFERLMK  230

Query  492  EVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaav  313
            EVL+KQEDLQ KFLEA+E+CE +R+AR+EAWK QEI RLK+EQE+LA ERAI+ AKDAAV
Sbjct  231  EVLDKQEDLQNKFLEAMEKCEKDRIARDEAWKMQEIARLKKEQEALAHERAISAAKDAAV  290

Query  312  iAFLQKISKQ------PILVPHK---------------------PQSEDVQEFAAQTKEN  214
            IAFLQK+S Q      P  +PH+                      Q  D +    Q  ++
Sbjct  291  IAFLQKVSDQTIQLQLPTDLPHRHTEERESESMKTIGNQENVVMQQDNDKENIDKQEIDS  350

Query  213  GSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNG-SKGPLWEDISAEMKKLGYDR  37
               ++    ++SSSRWPK E+EALI++RTN+DLQ+ DNG SKGPLWEDIS  MKKLGYDR
Sbjct  351  AGENSNSFQTNSSSRWPKAEVEALIKLRTNVDLQYQDNGSSKGPLWEDISCGMKKLGYDR  410

Query  36   NAKRCKEKWENI  1
            NAKRCKEKWENI
Sbjct  411  NAKRCKEKWENI  422


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 61/86 (71%), Gaps = 2/86 (2%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDS-TLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYK  820
            RWP  E   L+K+R+ +DL ++D+ + KGPLW+++S  M++ GY R+AK+C+EK+ENI K
Sbjct  365  RWPKAEVEALIKLRTNVDLQYQDNGSSKGPLWEDISCGMKKLGYDRNAKRCKEKWENINK  424

Query  819  YHRRTKEGRSGR-QTGKNYRFFEQLE  745
            Y+RR KE +  R +  K   +F QL+
Sbjct  425  YYRRVKESQKKRPEDSKTCPYFHQLD  450



>ref|XP_009626647.1| PREDICTED: trihelix transcription factor GT-2-like [Nicotiana 
tomentosiformis]
Length=502

 Score =   343 bits (880),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 214/363 (59%), Positives = 261/363 (72%), Gaps = 38/363 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWPH+ETL LLKIRS+MDLAFRDS  KGPLWDE+SRKM E GY R+AKKCREKFENIYKY
Sbjct  64   RWPHDETLALLKIRSQMDLAFRDSNFKGPLWDEISRKMGELGYNRNAKKCREKFENIYKY  123

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIG--GaaaaeppelaspspvAMIKPN  643
            H+RTK+GRSGRQTGKNYRFFEQLE+ D     N+I            +  P P+ MIKP 
Sbjct  124  HKRTKDGRSGRQTGKNYRFFEQLELLD-----NQINRMDTTTLISMPVPMPMPMTMIKPA  178

Query  642  TNIVQDFRMRPHGFGAD--ADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQED  469
            T+  QDF  R  GF  +  +   S ++S+   S GS  +KRKLAGYFE++MK+VL+KQED
Sbjct  179  TSGCQDFSYRNQGFNPEFMSTSTSTTSSSGKESDGSVKKKRKLAGYFERLMKQVLDKQED  238

Query  468  LQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKIS  289
            LQ KFLEAIE+CE +R+AREEAWK QEI RLK+E+E+LA ERAI+ AKDAAVIAFLQKIS
Sbjct  239  LQNKFLEAIEKCERDRIAREEAWKMQEIARLKKEKEALANERAISAAKDAAVIAFLQKIS  298

Query  288  KQ------PILVPHKPQSEDVQEFAAQTKEN--------------------GSGDTTIss  187
            +Q      P+ + H+ ++E+      +++EN                     +G+ +   
Sbjct  299  EQTVQVQSPMDLSHEKKTENSSVKTVESQENVLQQDNDKHENMLDKQDIIDSAGENSFHM  358

Query  186  ssssSRWPKPEIEALIQIRTNLDLQHHDNGS-KGPLWEDISAEMKKLGYDRNAKRCKEKW  10
            SS   RWPK E+EALI++RTN+DLQ+ DNGS KGPLWEDIS+ MKKLGYDRNAKRCKEKW
Sbjct  359  SSC--RWPKAEVEALIKLRTNVDLQYPDNGSPKGPLWEDISSGMKKLGYDRNAKRCKEKW  416

Query  9    ENI  1
            ENI
Sbjct  417  ENI  419


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDS-TLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYK  820
            RWP  E   L+K+R+ +DL + D+ + KGPLW+++S  M++ GY R+AK+C+EK+ENI K
Sbjct  362  RWPKAEVEALIKLRTNVDLQYPDNGSPKGPLWEDISSGMKKLGYDRNAKRCKEKWENINK  421

Query  819  YHRRTKEGRSGR-QTGKNYRFFEQLE  745
            Y+RR KE    R +  K   +F  L+
Sbjct  422  YYRRVKESHKRRPEDSKTCPYFHLLD  447



>ref|XP_006351020.1| PREDICTED: trihelix transcription factor GT-2-like [Solanum tuberosum]
Length=503

 Score =   343 bits (880),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 233/429 (54%), Positives = 284/429 (66%), Gaps = 57/429 (13%)
 Frame = -3

Query  1125  MLETAVLLDNPgggggaa--AVAEPQNDggggeeeggnqnsggg---------NRWPHEE  979
             MLE++VLL+N   G   A    AE +NDG G    GG+   G           NRWPHEE
Sbjct  1     MLESSVLLENTATGVAVADGEAAELKNDGSGVGGGGGSVGGGSEEEDKNFSGGNRWPHEE  60

Query  978   TLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKYHRRTKE  799
             TL LLKIRSEMD+AFRDS LK PLWDE+SRKM E GY R+AKKCREKFENIYKYH+RTK+
Sbjct  61    TLALLKIRSEMDVAFRDSNLKSPLWDEISRKMAELGYIRNAKKCREKFENIYKYHKRTKD  120

Query  798   GRSGRQTGKNYRFFEQLEVFDAMQ-------SHNKIGGaaaaeppelaspspvAMIKPNT  640
             GRSGRQTGKNYRFFEQLE+ D+         +H++I      +   +  P P+ MIKP  
Sbjct  121   GRSGRQTGKNYRFFEQLELLDSQSLFSSPPLNHSQIN---RMDTMPVPMPMPMTMIKPAA  177

Query  639   NIVQDFRM---RPHGFGAD--ADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQ  475
             +  QDFRM   R  GF  +  +   S ++S+   S GS  +KRKLA YFE++MKEVL+KQ
Sbjct  178   SGCQDFRMDLSRVRGFNPEFMSTSTSTTSSSGKESDGSMKKKRKLASYFERLMKEVLDKQ  237

Query  474   EDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQK  295
             EDLQ KFLEA+E+CE +R+AR+EAWK +EI RLK+EQE+L  ERAI+ AKDAAVIAFLQK
Sbjct  238   EDLQNKFLEAMEKCEKDRVARDEAWKMKEIARLKKEQEALTHERAISAAKDAAVIAFLQK  297

Query  294   ISKQPI---------LVPHK--------------------PQSEDVQEFAAQTKENGSGD  202
             IS+QPI          V H+                     Q  D +    Q  ++   +
Sbjct  298   ISEQPIQLQLPTDLPQVSHRHTEERESESMKTIGNQENVMQQDNDKENIDKQEIDSAGEN  357

Query  201   TTIssssssSRWPKPEIEALIQIRTNLDLQHHDN--GSKGPLWEDISAEMKKLGYDRNAK  28
             +    ++SSSRWPK E+EALI++RTN+DLQ+ DN   SKGPLWEDIS  MKKLGYDRNAK
Sbjct  358   SNSFQTNSSSRWPKAEVEALIKLRTNVDLQYQDNNGSSKGPLWEDISCGMKKLGYDRNAK  417

Query  27    RCKEKWENI  1
             RCKEKWENI
Sbjct  418   RCKEKWENI  426


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 61/87 (70%), Gaps = 3/87 (3%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDS--TLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIY  823
            RWP  E   L+K+R+ +DL ++D+  + KGPLW+++S  M++ GY R+AK+C+EK+ENI 
Sbjct  368  RWPKAEVEALIKLRTNVDLQYQDNNGSSKGPLWEDISCGMKKLGYDRNAKRCKEKWENIN  427

Query  822  KYHRRTKEGRSGR-QTGKNYRFFEQLE  745
            KY+RR KE +  R +  K   +F QL+
Sbjct  428  KYYRRVKESQKKRPEDSKTCPYFHQLD  454



>ref|XP_009766495.1| PREDICTED: trihelix transcription factor GT-2-like [Nicotiana 
sylvestris]
Length=502

 Score =   341 bits (875),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 205/361 (57%), Positives = 255/361 (71%), Gaps = 34/361 (9%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWPH+ETL LLKIRS+MD+AFRDS LKGPLWDE+SRKM E GY R+AKKCREKFENIYKY
Sbjct  64   RWPHDETLALLKIRSQMDIAFRDSNLKGPLWDEISRKMVELGYNRNAKKCREKFENIYKY  123

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            H+RTK+GRSGRQTGKNYRFFEQLE+ D   +      + +   P     + +      T+
Sbjct  124  HKRTKDGRSGRQTGKNYRFFEQLELLDNQVNRTDTTTSISMPVPMPMPMTMIKPA---TS  180

Query  636  IVQDFRMRPHGFGAD--ADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQ  463
              QDF  R  GF  +  +   S ++S+   S GS  +KRKLAGYFE++MK+VL+KQEDLQ
Sbjct  181  GCQDFTYRNQGFNPEFMSTSTSTTSSSGKESDGSVKKKRKLAGYFERLMKQVLDKQEDLQ  240

Query  462  KKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISKQ  283
             KFLEAIE+CE +R+ REE WK QEI RLK+E+E+LA ERAI+ AKDAAVIAFLQKIS+Q
Sbjct  241  NKFLEAIEKCERDRIEREETWKMQEIARLKKEKEALANERAISAAKDAAVIAFLQKISEQ  300

Query  282  ------PILVPHKPQSEDVQEFAAQTKEN--------------------GSGDTTIssss  181
                  P+ + H+ ++E+      +++EN                     +G+ +   SS
Sbjct  301  TVQVQSPMKLSHEKKTENSSVKTVESQENVLQQDNDKQENMLDKQDIIDSAGENSFHMSS  360

Query  180  ssSRWPKPEIEALIQIRTNLDLQHHDNGS-KGPLWEDISAEMKKLGYDRNAKRCKEKWEN  4
               RWPK E+EALI++RTN+DLQ+ DNGS KGPLWEDIS+ MKKLGYDRNAKRCKEKWEN
Sbjct  361  C--RWPKAEVEALIKLRTNVDLQYPDNGSPKGPLWEDISSGMKKLGYDRNAKRCKEKWEN  418

Query  3    I  1
            I
Sbjct  419  I  419


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 59/86 (69%), Gaps = 2/86 (2%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDS-TLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYK  820
            RWP  E   L+K+R+ +DL + D+ + KGPLW+++S  M++ GY R+AK+C+EK+ENI K
Sbjct  362  RWPKAEVEALIKLRTNVDLQYPDNGSPKGPLWEDISSGMKKLGYDRNAKRCKEKWENINK  421

Query  819  YHRRTKEGRSGR-QTGKNYRFFEQLE  745
            Y+RR KE +  R +  K   +F  L+
Sbjct  422  YYRRVKESQKRRPEDSKTCPYFHLLD  447



>ref|XP_011099803.1| PREDICTED: trihelix transcription factor GT-2-like [Sesamum indicum]
Length=524

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 221/411 (54%), Positives = 278/411 (68%), Gaps = 36/411 (9%)
 Frame = -3

Query  1125  MLETAVLLDNPgggggaa---AVAEPQNDggggeeeggnqnsgggNRWPHEETLTLLKIR  955
             ML+++V L+N GGGGG+       E +N+GG          +  GNRWP EETL LLKIR
Sbjct  1     MLDSSVFLENSGGGGGSGSDGVAVELRNEGGSAGAGDEGDRNSAGNRWPREETLALLKIR  60

Query  954   SEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKYHRRTKEGRSGRQTG  775
             S+MDLAFRDSTLK PLWDEVSRK+ E G+ RSAKKC+EKFENIYKYH+RTK+GRS RQ G
Sbjct  61    SDMDLAFRDSTLKAPLWDEVSRKLGELGFHRSAKKCKEKFENIYKYHKRTKDGRSSRQNG  120

Query  774   KNYRFFEQLEVFDAMQS-----HNKIGGaaaaeppelaspspvAMIKPNTNIVQDFRMRP  610
             KNYRFFEQLE+ D   S      N+I   A        S    +++    +  QDF +  
Sbjct  121   KNYRFFEQLELLDGHFSVPSTPLNQIPSYAMETAAIATSTPTTSVMAKPISSSQDFTIPC  180

Query  609   HGFGADADVLsaststt----yssggssGRKRKLAGYFEKMMKEVLEKQEDLQKKFLEAI  442
                  +A+ +SASTST       S GS  +KRKL  YFE++MK+VL+KQEDLQ KFLEAI
Sbjct  181   SNQDPNAEFMSASTSTASSSGKDSEGSVRKKRKLVDYFERLMKDVLQKQEDLQNKFLEAI  240

Query  441   ERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISKQP------  280
             E+CE +R+AREEAWK QE+ R+KREQE LA+ERAI  AKDAAV+AFLQKI++Q       
Sbjct  241   EKCEKDRIAREEAWKVQEMARIKREQEFLAQERAITAAKDAAVLAFLQKITQQTLPLQMS  300

Query  279   -ILVPHKPQSEDVQEFAAQ-----TKENGSGDTT------------IssssssSRWPKPE  154
              IL P   +  D QE   +     +++NG G+T+            I+  +SSSRWPK E
Sbjct  301   EILTPLFDKPSDKQENILEKQQGYSQDNGVGETSMHADKQDHSAGEIAIQTSSSRWPKAE  360

Query  153   IEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             +EALI ++T+LDL++ D+G KGPLWE++S  MKKLGYDR+AKRCKEKWENI
Sbjct  361   VEALIMLKTDLDLKYQDSGPKGPLWEEVSTCMKKLGYDRSAKRCKEKWENI  411


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 64/102 (63%), Gaps = 5/102 (5%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +++++DL ++DS  KGPLW+EVS  M++ GY RSAK+C+EK+ENI KY
Sbjct  355  RWPKAEVEALIMLKTDLDLKYQDSGPKGPLWEEVSTCMKKLGYDRSAKRCKEKWENINKY  414

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQS----HNKIGG  706
            ++R +E    R Q  K   +F  LE   A +S    HN   G
Sbjct  415  YKRVRESNKKRPQDSKTCPYFNMLESLYAKKSKKSEHNSDNG  456



>ref|XP_002276933.1| PREDICTED: trihelix transcription factor GT-2 [Vitis vinifera]
Length=510

 Score =   315 bits (808),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 196/343 (57%), Positives = 253/343 (74%), Gaps = 21/343 (6%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EETL LLKIRS+MD+ FRDS+LK PLW+EVSRK+ E GY R+AKKC+EKFENI+KY
Sbjct  51   RWPREETLALLKIRSDMDVVFRDSSLKAPLWEEVSRKLGELGYHRNAKKCKEKFENIFKY  110

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPN--  643
            H+RTKEGRS RQ GKNYRFFEQLE  D    ++ +    +    E ++P   +M + N  
Sbjct  111  HKRTKEGRSNRQNGKNYRFFEQLEALD----NHPLMPPPSPVKYETSTPMAASMPQTNPI  166

Query  642  --TNIVQDFRMRPHGFGADA-DVLsaststtyssggss----GRKRKLAGYFEKMMKEVL  484
              TN+ Q     P      A D ++ASTSTT SSG  S     +KRK   +FEK+MKEV+
Sbjct  167  DVTNVSQGINAVPCSIQKPAVDCVAASTSTTSSSGKESEGSRKKKRKWGVFFEKLMKEVI  226

Query  483  EKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAF  304
            EKQE+LQ+KF+EAIE+CE +R+AREEAWK QE++R+KRE E L +ER+IA AKDAAV+AF
Sbjct  227  EKQENLQRKFIEAIEKCEQDRIAREEAWKLQELDRIKREHEILVQERSIAAAKDAAVLAF  286

Query  303  LQKISKQ--PILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIR  130
            LQKI++Q  P+ +P  P SE V E     ++N +G+ +I  SSS  RWPK E+EALI++R
Sbjct  287  LQKIAEQAGPVQLPENPSSEKVFE----KQDNSNGENSIQMSSS--RWPKAEVEALIRLR  340

Query  129  TNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            TN D+Q+ ++G KGPLWE+IS  M+K+GY+R+AKRCKEKWENI
Sbjct  341  TNFDMQYQESGPKGPLWEEISLAMRKIGYERSAKRCKEKWENI  383


 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+++R+  D+ +++S  KGPLW+E+S  M + GY+RSAK+C+EK+ENI KY
Sbjct  327  RWPKAEVEALIRLRTNFDMQYQESGPKGPLWEEISLAMRKIGYERSAKRCKEKWENINKY  386

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             +R ++    R +  K   +F QL+  
Sbjct  387  FKRVRDSNKRRPEDSKTCPYFHQLDAL  413



>gb|KDP35327.1| hypothetical protein JCGZ_09486 [Jatropha curcas]
Length=492

 Score =   311 bits (797),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 188/344 (55%), Positives = 236/344 (69%), Gaps = 18/344 (5%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET+ LLKIRS+MD+AFR++ LK PLW+EVSRK+ E GY RSAKKC+EKFENIYKY
Sbjct  45   RWPRQETMALLKIRSDMDVAFREAGLKAPLWEEVSRKLSELGYNRSAKKCKEKFENIYKY  104

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            HRRTKEGRSG+  GK YRFFEQLE  D  Q    +  ++        +   V  +  NT+
Sbjct  105  HRRTKEGRSGKGNGKAYRFFEQLEALDNNQVL--LSSSSTDIAHSSMAAVAVNPVNINTS  162

Query  636  IVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQKK  457
             +      P     D    SA+++++  S G+  +KRKL  +FEK+MKEV+EKQE LQ+K
Sbjct  163  TILSSIQSPSINFVDNGSTSATSTSSEESEGTRKKKRKLTEFFEKLMKEVIEKQESLQRK  222

Query  456  FLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISKQPI  277
            FL+AIE+ E +RM REEAWK QE++R+KRE+E L +ER+IA AKDAAV++FLQK S+Q  
Sbjct  223  FLDAIEKYEKDRMTREEAWKMQELDRIKRERELLIQERSIAAAKDAAVLSFLQKFSEQTS  282

Query  276  LVPHKPQSEDVQEFAAQTKENG------------SGDTTIssssssSRWPKPEIEALIQI  133
             V    QS D Q    Q  EN             + +       SSSRWPK EIEALI +
Sbjct  283  SV----QSPDNQLIPVQLPENQIVPAEKVVMAQENNNIESFGHMSSSRWPKEEIEALISL  338

Query  132  RTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RT LD+Q+ DNG KGPLWE+ISAEMKKLGY+RNAKRCKEKWEN+
Sbjct  339  RTKLDMQYQDNGPKGPLWEEISAEMKKLGYNRNAKRCKEKWENM  382


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+ +R+++D+ ++D+  KGPLW+E+S +M++ GY R+AK+C+EK+EN+ KY
Sbjct  326  RWPKEEIEALISLRTKLDMQYQDNGPKGPLWEEISAEMKKLGYNRNAKRCKEKWENMNKY  385

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             +R KE    R +  K   +F QL+  
Sbjct  386  FKRVKESNKKRPEDSKTCPYFHQLDAI  412



>ref|XP_011045710.1| PREDICTED: trihelix transcription factor GT-2-like [Populus euphratica]
Length=502

 Score =   310 bits (795),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 193/368 (52%), Positives = 245/368 (67%), Gaps = 50/368 (14%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+AF+DS LK PLW+EVS+K+ E GY RSAKKC+EKFENIYKY
Sbjct  42   RWPKQETLALLKIRSDMDVAFKDSGLKAPLWEEVSKKLNELGYNRSAKKCKEKFENIYKY  101

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS----------HNKIGGaaaaeppelasps  667
            HRRTKEGRSGR  GK YRFFEQL+  D  ++          H  +  A       + +  
Sbjct  102  HRRTKEGRSGRSNGKTYRFFEQLQALDNTEALLPPPSSDKVHTSMAAALVNPVSFIPNAV  161

Query  666  pvAMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEV  487
            P ++  P  N V            D    S +++++  + G+  +KRKL  +FE++MKEV
Sbjct  162  PCSIQSPGMNFV------------DTTSTSTASASSEEAEGTRKKKRKLTDFFERLMKEV  209

Query  486  LEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviA  307
            ++KQE+LQ KFLEAIE+CE ER+AREEAWK QE +R+KREQE L +ERAIA+AKDAAV+A
Sbjct  210  IDKQENLQNKFLEAIEKCEQERIAREEAWKMQEFDRIKREQELLVRERAIADAKDAAVLA  269

Query  306  FLQKISKQPI--------LVPHK---------PQSEDVQ---------EFAAQTKENGSG  205
            FLQK S+Q I        +VP K         P S  VQ         E   +T+EN S 
Sbjct  270  FLQKFSEQGISVQLPDNPIVPMKFPDNQTVPVPSSAPVQLPKNQAVPVENVVKTRENSSI  329

Query  204  DTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKR  25
            ++ ++ S S  RWPK EIEALI +RT L+ Q+ +NG KGPLWE+ISA MKKLGYDR+AKR
Sbjct  330  ESFVNISPS--RWPKEEIEALIGLRTKLEFQYEENGPKGPLWEEISASMKKLGYDRSAKR  387

Query  24   CKEKWENI  1
            CKEKWEN+
Sbjct  388  CKEKWENM  395


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+ +R++++  + ++  KGPLW+E+S  M++ GY RSAK+C+EK+EN+ KY
Sbjct  339  RWPKEEIEALIGLRTKLEFQYEENGPKGPLWEEISASMKKLGYDRSAKRCKEKWENMNKY  398

Query  816  HRRTKEGRSGRQ-TGKNYRFFEQLEVF  739
             +R KE    R    K   +F+QL+  
Sbjct  399  FKRVKESNKRRPGDSKTCPYFQQLDAL  425



>ref|XP_007048236.1| Duplicated homeodomain-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOX92393.1| Duplicated homeodomain-like superfamily protein, putative [Theobroma 
cacao]
Length=471

 Score =   309 bits (791),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 191/346 (55%), Positives = 236/346 (68%), Gaps = 39/346 (11%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+AFRDS +K PLW+EVSRK+ E GY RSAKKC+EKFENIYKY
Sbjct  40   RWPRQETLALLKIRSDMDVAFRDSGVKAPLWEEVSRKLAELGYNRSAKKCKEKFENIYKY  99

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            HRRTKEGRSGR  GKNYRFFEQLE  D   S                      ++ P T 
Sbjct  100  HRRTKEGRSGRSNGKNYRFFEQLEALDHHPS----------------------LLPPATG  137

Query  636  IVQDFRMRPHGFGADA-------DVLs-------aststtyssggssGRKRKLAGYFEKM  499
             + +  M+P     DA        VLS        ++S+   S G   +KRKL  +F ++
Sbjct  138  HI-NTSMQPFSVIRDAIPCSIRNPVLSFNETSASTTSSSGKESDGMRKKKRKLTEFFGRL  196

Query  498  MKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakda  319
            M+EV+EKQE+LQKKF+EAIE+ E +RMAREEAWK QE++R+KRE+E L +ER+IA AKDA
Sbjct  197  MREVMEKQENLQKKFIEAIEKSEQDRMAREEAWKMQELDRIKRERELLVQERSIAAAKDA  256

Query  318  aviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALI  139
            AV+AFLQK S Q   V   P++    E   + +EN +G  +    SSS RWPK E+EALI
Sbjct  257  AVLAFLQKFSDQATSV-RLPETPFPVEKVVERQENSNGSESYMHLSSS-RWPKDEVEALI  314

Query  138  QIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ++R NLDLQ+ DNG KGPLWE+IS  MKKLGYDR+AKRCKEKWEN+
Sbjct  315  RLRANLDLQYQDNGPKGPLWEEISTAMKKLGYDRSAKRCKEKWENM  360


 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +E   L+++R+ +DL ++D+  KGPLW+E+S  M++ GY RSAK+C+EK+EN+ KY
Sbjct  304  RWPKDEVEALIRLRANLDLQYQDNGPKGPLWEEISTAMKKLGYDRSAKRCKEKWENMNKY  363

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             +R KE    R +  K   +F QL+  
Sbjct  364  FKRVKESNKKRPEDSKTCPYFHQLDAL  390



>ref|XP_002298711.2| hypothetical protein POPTR_0001s31660g [Populus trichocarpa]
 gb|EEE83516.2| hypothetical protein POPTR_0001s31660g [Populus trichocarpa]
Length=502

 Score =   308 bits (790),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 193/368 (52%), Positives = 244/368 (66%), Gaps = 50/368 (14%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+AF+DS LK PLW+EVS+K+ E GY RSAKKC+EKFENIYKY
Sbjct  42   RWPKQETLALLKIRSDMDVAFKDSGLKAPLWEEVSKKLNELGYNRSAKKCKEKFENIYKY  101

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS----------HNKIGGaaaaeppelasps  667
            HRRTKEGRSGR  GK YRFFEQL+  D  +           H  +  A       + +  
Sbjct  102  HRRTKEGRSGRPNGKTYRFFEQLQALDNTEVLLPPPSSDKVHTSMAAALVNPVSFIPNAV  161

Query  666  pvAMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEV  487
            P ++  P  N V            D    S +++++    G+  +K+KL G+FE++MKEV
Sbjct  162  PCSIQSPGMNFV------------DTTSTSTASTSSEEEEGTRKKKQKLTGFFERLMKEV  209

Query  486  LEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviA  307
            +EKQE+LQ KFLEAIE+CE ER+AREEAWK QE++R+KRE+E L +ERAIA AKDAAV+A
Sbjct  210  IEKQENLQNKFLEAIEKCEQERIAREEAWKMQELDRIKRERELLVRERAIAAAKDAAVLA  269

Query  306  FLQKISKQPI--------LVPHK---------PQSEDVQ---------EFAAQTKENGSG  205
            FLQK S+Q I        +VP K         P S  VQ         E   +T+EN S 
Sbjct  270  FLQKFSEQGISVQLPDNPIVPMKFPDNQTVPVPSSAPVQLPKNQAVPVENIVKTRENSSI  329

Query  204  DTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKR  25
            ++ ++ S S  RWPK EIEALI +RT L+ Q+ +NG KGPLWE+ISA MKKLGYDR+AKR
Sbjct  330  ESFVNISPS--RWPKEEIEALIGLRTKLEFQYEENGPKGPLWEEISASMKKLGYDRSAKR  387

Query  24   CKEKWENI  1
            CKEKWEN+
Sbjct  388  CKEKWENM  395


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+ +R++++  + ++  KGPLW+E+S  M++ GY RSAK+C+EK+EN+ KY
Sbjct  339  RWPKEEIEALIGLRTKLEFQYEENGPKGPLWEEISASMKKLGYDRSAKRCKEKWENMNKY  398

Query  816  HRRTKEGRSGRQ-TGKNYRFFEQLEVF  739
             +R KE    R    K   +F+QL+  
Sbjct  399  FKRVKESNKRRPGDSKTCPYFQQLDAL  425



>ref|XP_006427884.1| hypothetical protein CICLE_v10025533mg [Citrus clementina]
 ref|XP_006464545.1| PREDICTED: trihelix transcription factor GT-2-like [Citrus sinensis]
 gb|ESR41124.1| hypothetical protein CICLE_v10025533mg [Citrus clementina]
Length=472

 Score =   303 bits (777),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 230/332 (69%), Gaps = 13/332 (4%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LLKIRSEMD AF+DS LK PLW+E SRK+ + GY RSAKKC+EKFENIYKY
Sbjct  41   RWPKHETLALLKIRSEMDAAFKDSGLKAPLWEEASRKLSQLGYNRSAKKCKEKFENIYKY  100

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            HRRT+EGRS    GK YRFF+QL+  D   S   I                   + P + 
Sbjct  101  HRRTREGRS----GKTYRFFDQLQALDNSHSFLPISSPERINSSMAID------VDPISE  150

Query  636  IVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQKK  457
            I  D + +   F  D    + STS+  S G  + +KRKL  +FE++M+EV+EKQE+LQKK
Sbjct  151  IKNDIQNQISSF-MDVSTSTTSTSSKESDGTQTEKKRKLTEFFERLMREVIEKQENLQKK  209

Query  456  FLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISKQPI  277
            F+EAIE+CE ER+AREEAWK QE+ R+KRE+E L +ER+IA AKDAAV+AFLQK S QP 
Sbjct  210  FIEAIEKCEQERIAREEAWKMQELARIKRERELLVQERSIAAAKDAAVLAFLQKFSDQPC  269

Query  276  LVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNG  97
             V        V E A + +EN +G  +  +   SSRWPK E+EALI++R+NLD  +H++G
Sbjct  270  PVQLSATPISV-EKAVERQENCNGCESF-NHIGSSRWPKDEVEALIRLRSNLDGHYHESG  327

Query  96   SKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             KGPLWEDISA MKKLGYDR+AKRCKEKWEN+
Sbjct  328  PKGPLWEDISAAMKKLGYDRSAKRCKEKWENM  359


 Score = 80.5 bits (197),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +E   L+++RS +D  + +S  KGPLW+++S  M++ GY RSAK+C+EK+EN+ KY
Sbjct  303  RWPKDEVEALIRLRSNLDGHYHESGPKGPLWEDISAAMKKLGYDRSAKRCKEKWENMNKY  362

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  363  FKKVKESNKKRPEDAKTCPYFHQLDAL  389



>gb|KDO53356.1| hypothetical protein CISIN_1g012030mg [Citrus sinensis]
Length=472

 Score =   303 bits (777),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 230/332 (69%), Gaps = 13/332 (4%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LLKIRSEMD AF+DS LK PLW+E SRK+ + GY RSAKKC+EKFENIYKY
Sbjct  41   RWPKHETLALLKIRSEMDAAFKDSGLKAPLWEEASRKLSQLGYNRSAKKCKEKFENIYKY  100

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            HRRT+EGRS    GK YRFF+QL+  D   S   I                   + P + 
Sbjct  101  HRRTREGRS----GKTYRFFDQLQALDNSHSFLPISSPERINSSMAID------VDPISE  150

Query  636  IVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQKK  457
            I  D + +   F  D    + STS+  S G  + +KRKL  +FE++M+EV+EKQE+LQKK
Sbjct  151  IKNDIQNQISSF-MDVSTSTTSTSSKESDGTQTKKKRKLTEFFERLMREVIEKQENLQKK  209

Query  456  FLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISKQPI  277
            F+EAIE+CE ER+AREEAWK QE+ R+KRE+E L +ER+IA AKDAAV+AFLQK S QP 
Sbjct  210  FIEAIEKCEQERIAREEAWKMQELARIKRERELLVQERSIAAAKDAAVLAFLQKFSDQPC  269

Query  276  LVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNG  97
             V        V E A + +EN +G  +  +   SSRWPK E+EALI++R+NLD  +H++G
Sbjct  270  PVQLSATPISV-EKAVERQENCNGCESF-NHIGSSRWPKDEVEALIRLRSNLDGHYHESG  327

Query  96   SKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             KGPLWEDISA MKKLGYDR+AKRCKEKWEN+
Sbjct  328  PKGPLWEDISAAMKKLGYDRSAKRCKEKWENM  359


 Score = 80.5 bits (197),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +E   L+++RS +D  + +S  KGPLW+++S  M++ GY RSAK+C+EK+EN+ KY
Sbjct  303  RWPKDEVEALIRLRSNLDGHYHESGPKGPLWEDISAAMKKLGYDRSAKRCKEKWENMNKY  362

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  363  FKKVKESNKKRPEDAKTCPYFHQLDAL  389



>ref|XP_010098893.1| Trihelix transcription factor GT-2 [Morus notabilis]
 gb|EXB76035.1| Trihelix transcription factor GT-2 [Morus notabilis]
Length=493

 Score =   303 bits (776),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 241/351 (69%), Gaps = 31/351 (9%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD  FRDS++K PLW+++SRKM E GY RSAKKC+EKFENIYKY
Sbjct  42   RWPRQETLALLEIRSDMDSKFRDSSVKAPLWEDISRKMGELGYNRSAKKCKEKFENIYKY  101

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT-  640
            H+RT++GRSGR  GKNYRFFEQLE  D    H+          P     +    I PN  
Sbjct  102  HKRTRDGRSGRANGKNYRFFEQLEALD----HHSF-------DPPSMEETRPTTIPPNNV  150

Query  639  --NIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDL  466
              N +     +P     D +  S+++S+   S G+  +KRKL  +FE++MKEV+E+QE L
Sbjct  151  VLNAIPCSVHKPVEANFDENSSSSTSSSGEESEGARKKKRKLTRFFERLMKEVMERQESL  210

Query  465  QKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISK  286
            Q+KF+E +E+CE +R+AREEAWK QE+ERLKRE E L  ERAIA AKDAAV+AFL+K S+
Sbjct  211  QRKFIETLEKCEQDRIAREEAWKAQELERLKRESELLVHERAIAAAKDAAVLAFLKKFSE  270

Query  285  QP--ILVPHKP--------------QSEDVQEFAAQTKENGSGDTTIssssssSRWPKPE  154
            Q   +  P  P              Q  ++++ + +++E GS     S  SSS RWPK E
Sbjct  271  QSDQVQFPENPIASFQKDGDKQEKSQGGNLEQVSLESQEKGSNHRNFSQMSSS-RWPKDE  329

Query  153  IEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ++ALI++RTNLD+Q+ DNG KGPLWEDISA M+K+GYDR++KRCKEKWENI
Sbjct  330  VDALIRLRTNLDVQYQDNGPKGPLWEDISAAMRKIGYDRSSKRCKEKWENI  380


 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +E   L+++R+ +D+ ++D+  KGPLW+++S  M + GY RS+K+C+EK+ENI KY
Sbjct  324  RWPKDEVDALIRLRTNLDVQYQDNGPKGPLWEDISAAMRKIGYDRSSKRCKEKWENINKY  383

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             +R K+    R +  K   +F QL+  
Sbjct  384  FKRVKDSNKKRVEDSKTCPYFYQLDAL  410



>emb|CDP12790.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   300 bits (769),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 189/382 (49%), Positives = 248/382 (65%), Gaps = 61/382 (16%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EETL LLKIR++MDLAFRDST+K PLWDEV+RK+ E GY RSA+KC+EKFENI+KY
Sbjct  30   RWPREETLALLKIRADMDLAFRDSTVKAPLWDEVTRKLGELGYHRSARKCKEKFENIFKY  89

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD-----------AMQSHNKIGGaaaaeppelasp  670
            H+RTK+ RSGRQ GKNYRFFEQLE FD            +Q+H        AE  +  + 
Sbjct  90   HKRTKDCRSGRQNGKNYRFFEQLERFDNQPSLPSPPLSQIQTH-------VAETTQTTTI  142

Query  669  spvAMIKPNTNIVQDFRMRPH-----GFGADADVLsaststtyssggssGRKRKLAGYFE  505
            +   +IK  +  +    M PH              S ++S+   S GS  +KRKL+ YFE
Sbjct  143  AAPTIIKVTSGSLDS--MVPHPSENPNMEFVTPSTSTTSSSGRESEGSVKKKRKLSDYFE  200

Query  504  KMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeak  325
            K+MKE+LEKQE+LQ + L A+E+CE +R+AREEAW+ Q+++R+++EQE LA ERAI+ A+
Sbjct  201  KLMKEILEKQENLQNQLLAALEKCERDRIAREEAWRLQQMDRIRKEQEYLANERAISAAR  260

Query  324  daaviAFLQKISKQPILV-----------------------PHKPQSEDVQE--------  238
            DA V+AFLQKIS+Q I                         P  P + + QE        
Sbjct  261  DATVMAFLQKISEQAIPGQFAEAATPISEKHPDKQQVQTPGPFTPGTIENQELGTSIGRQ  320

Query  237  ---FAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDIS  67
               F    + NG G+++I +++S  RWPK E+EAL+++RTNL +Q  DNG KGPLWE+IS
Sbjct  321  EDAFDVDKRGNGFGESSIQATTS--RWPKAEVEALVRLRTNLGMQFQDNGLKGPLWEEIS  378

Query  66   AEMKKLGYDRNAKRCKEKWENI  1
            + MKKLGYDR+AKRCKEKWENI
Sbjct  379  SAMKKLGYDRSAKRCKEKWENI  400


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+++R+ + + F+D+ LKGPLW+E+S  M++ GY RSAK+C+EK+ENI KY
Sbjct  344  RWPKAEVEALVRLRTNLGMQFQDNGLKGPLWEEISSAMKKLGYDRSAKRCKEKWENINKY  403

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLE  745
            ++R +E    R ++ K   +F  LE
Sbjct  404  YKRVRESHKRRPESSKTCPYFHLLE  428



>ref|XP_006371015.1| hypothetical protein POPTR_0019s02650g, partial [Populus trichocarpa]
 gb|ERP48812.1| hypothetical protein POPTR_0019s02650g, partial [Populus trichocarpa]
Length=520

 Score =   298 bits (763),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 187/355 (53%), Positives = 237/355 (67%), Gaps = 30/355 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD+AFRDS +K PLW+EVSRK+ E GY RSAKKC+EKFENIYKY
Sbjct  42   RWPKQETLALLEIRSDMDVAFRDSVVKAPLWEEVSRKLNELGYNRSAKKCKEKFENIYKY  101

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPN--  643
            HRRTK  +SGR  GK YRFFEQL+  D   +      +        ++        PN  
Sbjct  102  HRRTKGSQSGRPNGKTYRFFEQLQALDKTNALVSPTSSDKDHCLMPSASVIPVSFIPNDV  161

Query  642  TNIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQ  463
               VQ  RM       DA   S +++++  S G+  +KR+L  +FE++MKEV+EKQE+LQ
Sbjct  162  PCSVQSPRMN----CTDATSTSTASTSSEESEGTRKKKRRLTDFFERLMKEVIEKQENLQ  217

Query  462  KKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISKQ  283
             KFLEAIE+CE ER+AREE WK QE++R+KREQE L  ERAIA AKDAAV+AFLQK S+Q
Sbjct  218  NKFLEAIEKCEQERIAREEVWKMQELDRIKREQELLVHERAIAAAKDAAVLAFLQKFSEQ  277

Query  282  --PILVPHKP-------------------QSEDVQEFAAQTKENGSGDTTIssssssSRW  166
              P+ +P  P                   Q+  V E   +T EN S ++ ++ SSS  RW
Sbjct  278  GIPVQLPDNPTVPMKFPDNQTSPALLSKNQAVPV-ENVVKTHENSSVESFVNMSSS--RW  334

Query  165  PKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            PK EIE+LI+IRT L+ Q+ +NG KGPLWE+IS  MK LGYDR+AKRCKEKWEN+
Sbjct  335  PKEEIESLIKIRTYLEFQYQENGPKGPLWEEISTSMKNLGYDRSAKRCKEKWENM  389


 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE  +L+KIR+ ++  ++++  KGPLW+E+S  M+  GY RSAK+C+EK+EN+ KY
Sbjct  333  RWPKEEIESLIKIRTYLEFQYQENGPKGPLWEEISTSMKNLGYDRSAKRCKEKWENMNKY  392

Query  816  HRRTKEGRSGRQ-TGKNYRFFEQLEVF  739
             +R K+    R    K   +F+QL+  
Sbjct  393  FKRVKDSNKKRPGDSKTCPYFQQLDAL  419



>ref|XP_011046370.1| PREDICTED: trihelix transcription factor GT-2-like [Populus euphratica]
Length=496

 Score =   292 bits (748),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 183/355 (52%), Positives = 234/355 (66%), Gaps = 30/355 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD+AFRDS +K PLW+EVSRK++E GY RSAKKC+EKFENIYKY
Sbjct  42   RWPKQETLALLEIRSDMDVAFRDSVVKAPLWEEVSRKLKELGYNRSAKKCKEKFENIYKY  101

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            HRRTK  +SGR  GK YRFFEQL+  D   +      +         +      + P + 
Sbjct  102  HRRTKGSQSGRPNGKTYRFFEQLQALDKTNALVSPASSDKDHCLMPLAS-----VNPVSF  156

Query  636  IVQDFRMR---PHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDL  466
            I  D       P     DA   S +++++  S G+  +KR+L  +FE++M EV+EKQE+L
Sbjct  157  IPHDVPCSIQSPSMNCTDATSTSTASTSSEESEGTRKKKRRLTNFFERLMNEVIEKQENL  216

Query  465  QKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISK  286
            Q KFLEAIE+ E ER+AREEAWK QE +++KREQE L  ERAIA  KDAAV+AFLQK S+
Sbjct  217  QNKFLEAIEKREQERIAREEAWKMQEWDKIKREQELLDHERAIAAVKDAAVLAFLQKFSE  276

Query  285  Q--PILVPHKPQSE----DVQEFAAQ--------------TKENGSGDTTIssssssSRW  166
            Q  P+ +P  P       D+Q   AQ              T EN S ++ ++ SSS  RW
Sbjct  277  QGIPVQLPDNPTVPMKFPDIQTSPAQLSKNQAVPVENVVKTPENSSIESFVNMSSS--RW  334

Query  165  PKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            PK EIE+LI+IRT L+ Q+ +NG KGPLWE+IS  MK LGYDR+AKRCKEKWEN+
Sbjct  335  PKEEIESLIKIRTYLEFQYQENGPKGPLWEEISTSMKNLGYDRSAKRCKEKWENM  389


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE  +L+KIR+ ++  ++++  KGPLW+E+S  M+  GY RSAK+C+EK+EN+ KY
Sbjct  333  RWPKEEIESLIKIRTYLEFQYQENGPKGPLWEEISTSMKNLGYDRSAKRCKEKWENMNKY  392

Query  816  HRRTKEGRSGRQ-TGKNYRFFEQLEVF  739
             +R K+    R    K   +F+QL+  
Sbjct  393  FKRVKDSNKKRPGDSKTCPYFQQLDAL  419



>ref|XP_011046366.1| PREDICTED: trihelix transcription factor GT-2-like [Populus euphratica]
Length=496

 Score =   292 bits (747),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 183/355 (52%), Positives = 234/355 (66%), Gaps = 30/355 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD+AFRDS +K PLW+EVSRK++E GY RSAKKC+EKFENIYKY
Sbjct  42   RWPKQETLALLEIRSDMDVAFRDSVVKAPLWEEVSRKLKELGYNRSAKKCKEKFENIYKY  101

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            HRRTK  +SGR  GK YRFFEQL+  D   +      +         +      + P + 
Sbjct  102  HRRTKGSQSGRPNGKTYRFFEQLQALDKTNALVSPASSDKDHCLMPLAS-----VNPVSF  156

Query  636  IVQDFRMR---PHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDL  466
            I  D       P     DA   S +++++  S G+  +KR+L  +FE++M EV+EKQE+L
Sbjct  157  IPHDVPCSIQSPSMNCTDATSTSTASTSSEESEGTRKKKRRLTDFFERLMNEVIEKQENL  216

Query  465  QKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISK  286
            Q KFLEAIE+ E ER+AREEAWK QE +++KREQE L  ERAIA  KDAAV+AFLQK S+
Sbjct  217  QNKFLEAIEKREQERIAREEAWKMQEWDKIKREQELLDHERAIAAVKDAAVLAFLQKFSE  276

Query  285  Q--PILVPHKPQSE----DVQEFAAQ--------------TKENGSGDTTIssssssSRW  166
            Q  P+ +P  P       D+Q   AQ              T EN S ++ ++ SSS  RW
Sbjct  277  QGIPVQLPDNPTVPMKFPDIQTSPAQLSKNQAVPVENVVKTPENSSIESFVNMSSS--RW  334

Query  165  PKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            PK EIE+LI+IRT L+ Q+ +NG KGPLWE+IS  MK LGYDR+AKRCKEKWEN+
Sbjct  335  PKEEIESLIKIRTYLEFQYQENGPKGPLWEEISTSMKNLGYDRSAKRCKEKWENM  389


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE  +L+KIR+ ++  ++++  KGPLW+E+S  M+  GY RSAK+C+EK+EN+ KY
Sbjct  333  RWPKEEIESLIKIRTYLEFQYQENGPKGPLWEEISTSMKNLGYDRSAKRCKEKWENMNKY  392

Query  816  HRRTKEGRSGRQ-TGKNYRFFEQLEVF  739
             +R K+    R    K   +F+QL+  
Sbjct  393  FKRVKDSNKKRPGDSKTCPYFQQLDAL  419



>ref|XP_004169667.1| PREDICTED: trihelix transcription factor GT-2-like [Cucumis sativus]
 gb|KGN62133.1| hypothetical protein Csa_2G301510 [Cucumis sativus]
Length=499

 Score =   291 bits (745),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 179/349 (51%), Positives = 238/349 (68%), Gaps = 28/349 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EET+ LLK+RS MD AFRD++LK PLW+EVSRK+ E GY R+AKKC+EKFENIYKY
Sbjct  45   RWPREETMALLKVRSSMDTAFRDASLKAPLWEEVSRKLGELGYNRNAKKCKEKFENIYKY  104

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            H+RTK+GRSG+  GKNYR+FEQLE  D   +H+ +   A +             I PN  
Sbjct  105  HKRTKDGRSGKSNGKNYRYFEQLEALD---NHSLLPSQADSMEEIPR-------IIPNNV  154

Query  636  IVQDFRMRPHGFGAD-------ADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEK  478
            +           GA+       +   S ++S++  SGG+  +KRK   +FE++M EV+EK
Sbjct  155  VHNAIPCSVVNPGANFVETTTTSLSTSTTSSSSKESGGTRKKKRKFVEFFERLMNEVIEK  214

Query  477  QEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQ  298
            QE LQKKF+EA+E+CE ER+AREE WK QE+ R+K+E+E L +ER+IA AKDAAV++FL+
Sbjct  215  QEKLQKKFVEALEKCEVERLAREEEWKMQELARIKKERERLNQERSIAAAKDAAVLSFLK  274

Query  297  KISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssss----------ssSRWPKPEIE  148
              S+Q   V   P++  + E   + +++ +G+   S+            SSSRWPK EI+
Sbjct  275  VFSEQGGTVQF-PENLLLMENLTEKQDDANGERNTSTQENINNGNSNQISSSRWPKEEID  333

Query  147  ALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ALIQ+RTNL +++ DNG KGPLWE+IS  MKKLGYDRNAKRCKEKWENI
Sbjct  334  ALIQLRTNLQMKYQDNGPKGPLWEEISLAMKKLGYDRNAKRCKEKWENI  382


 Score = 84.0 bits (206),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++R+ + + ++D+  KGPLW+E+S  M++ GY R+AK+C+EK+ENI KY
Sbjct  326  RWPKEEIDALIQLRTNLQMKYQDNGPKGPLWEEISLAMKKLGYDRNAKRCKEKWENINKY  385

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             +R KE    R +  K   +F+QL+  
Sbjct  386  FKRVKESNKKRPEDSKTCPYFQQLDAL  412



>ref|XP_008460913.1| PREDICTED: trihelix transcription factor GT-2-like [Cucumis melo]
Length=500

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 178/352 (51%), Positives = 240/352 (68%), Gaps = 34/352 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EET+ LLK+RS MD AFRD++LK PLW+EVSRK+ E GY R+AKKC+EKFENIYKY
Sbjct  47   RWPREETMALLKVRSSMDTAFRDASLKAPLWEEVSRKLGELGYNRNAKKCKEKFENIYKY  106

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD----------AMQSHNKIGGaaaaeppelasps  667
            H+RTK+GRSG+  GKNYR+FEQLE  D          +M+   KI          + +  
Sbjct  107  HKRTKDGRSGKSNGKNYRYFEQLEALDNHPLLPSQADSMEEIPKI-----IPNNVVHNAI  161

Query  666  pvAMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEV  487
            P +++ P  N V+            +   S ++ ++  SGG+  +KRK   +FE++M EV
Sbjct  162  PCSVVNPGANFVET--------TTTSLSTSTTSCSSKESGGTRKKKRKFVEFFERLMNEV  213

Query  486  LEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviA  307
            +EKQE LQKKF+EA+E+CE ER+AREE WK QE+ R+K+E+E L +ER+IA AKDAAV++
Sbjct  214  IEKQEKLQKKFVEALEKCEVERLAREEEWKMQELARIKKERERLNQERSIAAAKDAAVLS  273

Query  306  FLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssss----------ssSRWPKP  157
            FL+ IS+Q   V   P++  + E   + +++ +G+   S+            SSSRWPK 
Sbjct  274  FLKVISEQGGTVQF-PENLLLMENLTEKQDDANGERNTSTQENINNGNSNQISSSRWPKE  332

Query  156  EIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            EI+ALIQ+RTNL +++ D+G KGPLWE+IS  MKKLGYDRNAKRCKEKWENI
Sbjct  333  EIDALIQLRTNLQMKYQDSGPKGPLWEEISLAMKKLGYDRNAKRCKEKWENI  384


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++R+ + + ++DS  KGPLW+E+S  M++ GY R+AK+C+EK+ENI KY
Sbjct  328  RWPKEEIDALIQLRTNLQMKYQDSGPKGPLWEEISLAMKKLGYDRNAKRCKEKWENINKY  387

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             +R KE    R +  K   +F+QL+  
Sbjct  388  FKRVKESNKKRPEDSKTCPYFQQLDAL  414



>gb|EYU43477.1| hypothetical protein MIMGU_mgv1a004878mg [Erythranthe guttata]
Length=506

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 230/346 (66%), Gaps = 14/346 (4%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EETL LLKIRSEMD AFRDS LK PLWDEVSRK+ E GY R+AKKC+EKFENIYKY
Sbjct  47   RWPREETLALLKIRSEMDTAFRDSNLKAPLWDEVSRKLGELGYNRNAKKCKEKFENIYKY  106

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMI-KPNT  640
            H+RTK+GRS R  GKNY+FF+QLE+ D+  S      +         +     ++ KP T
Sbjct  107  HKRTKDGRSIRHKGKNYKFFDQLELLDSQFSVPSTPLSQIPSYATEMTQIATTLLPKPVT  166

Query  639  NIVQDFRMRPHGFGADADVLsaststt--yssggssGRKRKLAGYFEKMMKEVLEKQEDL  466
            N+ QDF ++           S+S   +   S      +KRKL  Y E ++K++LEKQ ++
Sbjct  167  NLFQDFTIQSELMSDSTSTSSSSGKDSQGSSKKKKKKKKRKLEDYLEGLVKDILEKQGEM  226

Query  465  QKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISK  286
            Q KFLEA+E+ +N+RMAR EAW  QE+  +KRE++ LA+ER+ A AKDA V+ FL+KI+ 
Sbjct  227  QNKFLEAVEKSQNDRMARTEAWLSQEMATIKRERQILAQERSTASAKDAYVLDFLKKITH  286

Query  285  QPILVPH-----------KPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALI  139
            Q + + H           KP   + QE A     +     + S  +SSSRWPK E+E+LI
Sbjct  287  QDLPITHISEILDPLFNNKPCDNNEQENAIVNVNSIGEKNSSSVQTSSSRWPKAEVESLI  346

Query  138  QIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             ++T+LD+Q+ +NG KGPLWE+ISA MKKLG++R+AKRCKEKWENI
Sbjct  347  LLKTDLDMQYEENGPKGPLWEEISACMKKLGFERSAKRCKEKWENI  392


 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E  +L+ +++++D+ + ++  KGPLW+E+S  M++ G++RSAK+C+EK+ENI KY
Sbjct  336  RWPKAEVESLILLKTDLDMQYEENGPKGPLWEEISACMKKLGFERSAKRCKEKWENINKY  395

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQS  724
            ++R K+G   R Q  K   +F  LE   A +S
Sbjct  396  YKRVKDGNKKRPQDSKTCPYFSMLESIYANKS  427



>emb|CBI37606.3| unnamed protein product [Vitis vinifera]
Length=539

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 222/341 (65%), Gaps = 53/341 (16%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EETL LLKIRS+MD+ FRDS+LK PLW+EVSRK+ E GY R+AKKC+EKFENI+KY
Sbjct  67   RWPREETLALLKIRSDMDVVFRDSSLKAPLWEEVSRKLGELGYHRNAKKCKEKFENIFKY  126

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPN--  643
            H+RTKEGRS RQ GKNYRFFEQLE  D    ++ +    +    E ++P   +M + N  
Sbjct  127  HKRTKEGRSNRQNGKNYRFFEQLEALD----NHPLMPPPSPVKYETSTPMAASMPQTNPI  182

Query  642  --TNIVQDFRMRPHGFGADA-DVLsaststtyssggss----GRKRKLAGYFEKMMKEVL  484
              TN+ Q     P      A D ++ASTSTT SSG  S     +KRK   +FEK+MKEV+
Sbjct  183  DVTNVSQGINAVPCSIQKPAVDCVAASTSTTSSSGKESEGSRKKKRKWGVFFEKLMKEVI  242

Query  483  EKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAF  304
            EKQE+LQ+KF+EAIE+CE +R+AREEAWK QE++R+KRE E L                 
Sbjct  243  EKQENLQRKFIEAIEKCEQDRIAREEAWKLQELDRIKREHEIL-----------------  285

Query  303  LQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTN  124
                               VQE +    ++ +    +    SSSRWPK E+EALI++RTN
Sbjct  286  -------------------VQERSIAAAKDAANSIQM----SSSRWPKAEVEALIRLRTN  322

Query  123  LDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             D+Q+ ++G KGPLWE+IS  M+K+GY+R+AKRCKEKWENI
Sbjct  323  FDMQYQESGPKGPLWEEISLAMRKIGYERSAKRCKEKWENI  363


 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+++R+  D+ +++S  KGPLW+E+S  M + GY+RSAK+C+EK+ENI KY
Sbjct  307  RWPKAEVEALIRLRTNFDMQYQESGPKGPLWEEISLAMRKIGYERSAKRCKEKWENINKY  366

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             +R ++    R +  K   +F QL+  
Sbjct  367  FKRVRDSNKRRPEDSKTCPYFHQLDAL  393



>ref|XP_010680281.1| PREDICTED: trihelix transcription factor GT-2-like [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   278 bits (712),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 172/342 (50%), Positives = 223/342 (65%), Gaps = 22/342 (6%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET+ LL+IRSEMD+AFRDS  K PLWDEVSR+M E GYQRSAKKC+EKFENIYKY
Sbjct  58   RWPQQETMALLRIRSEMDVAFRDSGSKAPLWDEVSRRMTELGYQRSAKKCKEKFENIYKY  117

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            HRR K G  G+   K YRFF+QLE     Q   +   +   +      P  V+ I  +  
Sbjct  118  HRRLKNGSYGQTNKKTYRFFDQLEALSHHQISFQTSSSEPTDTFMNDKPFVVSPISSHPQ  177

Query  636  IVQDFRMRPHGFGADADVLsaststtyssggssGR--KRKLAGYFEKMMKEVLEKQEDLQ  463
             V    M P     D+  +S ST++T  S     R  KRK A +F+ +MK VL+KQE LQ
Sbjct  178  CVPQMAM-PTSVNFDSFTISTSTASTSGSESEGARTKKRKWADFFDTLMKSVLQKQEALQ  236

Query  462  KKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISKQ  283
              FLEAI++CE +R AREEAWK QE+ R+KREQE L +ER+I+ AKDAA++AFLQKIS+Q
Sbjct  237  NNFLEAIDKCERDRQAREEAWKMQEMVRIKREQELLTQERSISAAKDAAILAFLQKISEQ  296

Query  282  --------PILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRT  127
                    P+L   +  S+++     + K+NG   ++        RWPK E+EAL++I+T
Sbjct  297  GKCPGISGPML---ENVSQEMSIICQKEKDNGENSSS--------RWPKEEVEALVKIKT  345

Query  126  NLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            N++L+    G KGP+WE++S  MK  GYDRNAKRCKEKWENI
Sbjct  346  NMELEFQRVGPKGPMWEEVSFAMKNSGYDRNAKRCKEKWENI  387


 Score = 80.5 bits (197),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+KI++ M+L F+    KGP+W+EVS  M+  GY R+AK+C+EK+ENI KY
Sbjct  331  RWPKEEVEALVKIKTNMELEFQRVGPKGPMWEEVSFAMKNSGYDRNAKRCKEKWENINKY  390

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVFDAMQS  724
            +RR K+    R    K   +F  L+    +++
Sbjct  391  YRRVKDSNKQRHVDSKTCPYFHLLDQLHNLKT  422



>ref|XP_004147355.1| PREDICTED: LOW QUALITY PROTEIN: trihelix transcription factor 
GT-2-like [Cucumis sativus]
Length=440

 Score =   276 bits (707),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 173/342 (51%), Positives = 232/342 (68%), Gaps = 28/342 (8%)
 Frame = -3

Query  975  LTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKYHRRTKEG  796
            + LLK+RS MD AFRD++LK PLW+EVSRK+ E GY R+AKKC+EKFENIYKYH+RTK+G
Sbjct  1    MALLKVRSSMDTAFRDASLKAPLWEEVSRKLGELGYNRNAKKCKEKFENIYKYHKRTKDG  60

Query  795  RSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTNIVQDFRM  616
            RSG+  GKNYR+FEQLE  D   +H+ +   A +             I PN  +      
Sbjct  61   RSGKSNGKNYRYFEQLEALD---NHSLLPSQADSMEEIPR-------IIPNNVVHNAIPC  110

Query  615  RPHGFGAD-------ADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQKK  457
                 GA+       +   S ++S++  SGG+  +KRK   +FE++M EV+EKQE LQKK
Sbjct  111  SVVNPGANFVETTTTSLSTSTTSSSSKESGGTRKKKRKFVEFFERLMNEVIEKQEKLQKK  170

Query  456  FLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISKQPI  277
            F+EA+E+CE ER+AREE WK QE+ R+K+E+E L +ER+IA AKDAAV++FL+  S+Q  
Sbjct  171  FVEALEKCEVERLAREEEWKMQELARIKKERERLNQERSIAAAKDAAVLSFLKVFSEQGG  230

Query  276  LVPHKPQSEDVQEFAAQTKENGSGDTTIssss----------ssSRWPKPEIEALIQIRT  127
             V   P++  + E   + +++ +G+   S+            SSSRWPK EI+ALIQ+RT
Sbjct  231  TVQF-PENLLLMENLTEKQDDANGERNTSTQENINNGNSNQISSSRWPKEEIDALIQLRT  289

Query  126  NLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            NL +++ DNG KGPLWE+IS  MKKLGYDRNAKRCKEKWENI
Sbjct  290  NLQMKYQDNGPKGPLWEEISLAMKKLGYDRNAKRCKEKWENI  331


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 55/86 (64%), Gaps = 7/86 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++R+ + + ++D+  KGPLW+E+S  M++ GY R+AK+C+EK+ENI   
Sbjct  275  RWPKEEIDALIQLRTNLQMKYQDNGPKGPLWEEISLAMKKLGYDRNAKRCKEKWENIXSN  334

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
             +R ++        K   +F+QL+  
Sbjct  335  KKRPED-------SKTCPYFQQLDAL  353



>gb|KHG24952.1| Trihelix transcription factor GT-2 -like protein [Gossypium arboreum]
Length=492

 Score =   275 bits (704),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 174/334 (52%), Positives = 225/334 (67%), Gaps = 22/334 (7%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MDL FR++++KGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  59   RWPRQETLALLKIRSDMDLTFREASVKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKY  118

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            H+RTK+GRSG+  GK YRF +QLE F    S          + P     +  A I  + +
Sbjct  119  HKRTKDGRSGKADGKTYRFCDQLEAFQNQPS---------IQWPPRPPMTAAATINQSIS  169

Query  636  IVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQKK  457
             VQ          +D ++            G   RKRK   +FE++MKEV++KQ+ +QK 
Sbjct  170  AVQMSNSISSSTSSDLEL-----------QGRKKRKRKWMDFFERLMKEVIQKQQVMQKT  218

Query  456  FLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISKQPI  277
            FLEAIE+ E ER+ R+EAWK QE+ RL  E+E LA+ER+IA AKDAA++AFLQK+S++  
Sbjct  219  FLEAIEKHERERIVRDEAWKVQEMSRLNTEREILAQERSIAAAKDAAIMAFLQKLSEKQN  278

Query  276  L--VPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHD  103
            L    + P        AA      +G+   + +SSSSRWPK EIEALI+IRT+LD ++ D
Sbjct  279  LGQSQNGPLPPPAVVPAAVAPPPDNGNQIQTHTSSSSRWPKVEIEALIKIRTSLDSKYQD  338

Query  102  NGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            N  KGPLWE+IS EMKKLGY+RNAKRCKEKWENI
Sbjct  339  NSPKGPLWEEISNEMKKLGYNRNAKRCKEKWENI  372


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+KIR+ +D  ++D++ KGPLW+E+S +M++ GY R+AK+C+EK+ENI KY
Sbjct  316  RWPKVEIEALIKIRTSLDSKYQDNSPKGPLWEEISNEMKKLGYNRNAKRCKEKWENINKY  375

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F  L+V 
Sbjct  376  FKKVKESNKRRPVDSKTCPYFHLLDVL  402



>ref|XP_003533931.1| PREDICTED: trihelix transcription factor GT-2-like [Glycine max]
Length=490

 Score =   275 bits (702),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 173/369 (47%), Positives = 227/369 (62%), Gaps = 64/369 (17%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EET+ LLKIRSEMD+AF+D+ LK PLW++VSRK+ E GY RSAKKC+EKFENIYKY
Sbjct  42   RWPREETMALLKIRSEMDVAFKDANLKAPLWEQVSRKLSELGYNRSAKKCKEKFENIYKY  101

Query  816  HRRTKEGRSGRQTG-KNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            HRRTKEGR G+  G K YRFFEQLE  D   S                      ++ P T
Sbjct  102  HRRTKEGRFGKSNGAKTYRFFEQLEALDGNHS----------------------LLPPTT  139

Query  639  NIVQDFRMR--PHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDL  466
             +  D  +   P    A A        ++ ++  S  +KRKL  + E +M+EV+EKQE L
Sbjct  140  TVGDDVVLNAVPCSVSAAA-----HEHSSSTTSCSGKKKRKLTQFLEGLMREVIEKQETL  194

Query  465  QKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISK  286
            Q+KF+E +++CE +RMAREEAWKK+E+ER+K+E+E LA+ER+IA AKD  V+AFL+K ++
Sbjct  195  QRKFVEVLDKCEKDRMAREEAWKKEELERIKKERELLAQERSIAAAKDEVVLAFLRKFAE  254

Query  285  --------QPILVPHKPQSEDVQE-------------FAAQTKENGSGDTTIssss----  181
                    + I V +  Q    Q                    +   G+T +  S     
Sbjct  255  AEGTVQLLEKIQVQNDKQKNMKQNGGNDNANGGGGVTVVTDMDKQECGNTNVRVSVGNFV  314

Query  180  --ssSRWPKPEIEALIQIRTNLDLQHH-------DNGSKGPLWEDISAEMKKLGYDRNAK  28
              SSSRWPK E+EALI++RT +D+Q         ++GSKGPLWE+IS+ MK LGYDR+AK
Sbjct  315  HMSSSRWPKDEVEALIRLRTQIDVQAQWNNNNNNNDGSKGPLWEEISSAMKSLGYDRSAK  374

Query  27   RCKEKWENI  1
            RCKEKWENI
Sbjct  375  RCKEKWENI  383


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 10/95 (11%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFR-------DSTLKGPLWDEVSRKMEEFGYQRSAKKCREK  838
            RWP +E   L+++R+++D+  +       +   KGPLW+E+S  M+  GY RSAK+C+EK
Sbjct  320  RWPKDEVEALIRLRTQIDVQAQWNNNNNNNDGSKGPLWEEISSAMKSLGYDRSAKRCKEK  379

Query  837  FENIYKYHRRTKEGRSGR--QTGKNYRFFEQLEVF  739
            +ENI KY +R KE +S R  Q  K   ++  LE  
Sbjct  380  WENINKYFKRIKE-KSKRKPQDSKTCPYYHHLEAL  413



>gb|EPS67979.1| hypothetical protein M569_06795, partial [Genlisea aurea]
Length=388

 Score =   270 bits (689),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 162/342 (47%), Positives = 228/342 (67%), Gaps = 15/342 (4%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRSEMD+ FRDS+ KGPLW+EVSRKM E G++R+ KKC+EKFEN+YKY
Sbjct  10   RWPKQETLALLRIRSEMDVDFRDSSFKGPLWEEVSRKMAELGFKRTGKKCKEKFENVYKY  69

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD-AMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            HRRTKE RS +  GK YRFF+QL+  +     H+ +   +      +        I   +
Sbjct  70   HRRTKESRSSKSDGKTYRFFDQLQALEENAPPHDTVSSMSPKPITVVPPVPANDPINAPS  129

Query  639  NIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAG-----YFEKMMKEVLEKQ  475
              +  F   P      + +LS ++S++ +S      +R+        +F  ++++V+ KQ
Sbjct  130  PPIHSFPTDPPQIQFPSGLLSTTSSSSSTSSDGDVHRRRGRKRRWKEFFHGLLRDVIHKQ  189

Query  474  EDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQK  295
            E+L + FLE +E+ E ERMAR+EAWK +EI R+ RE E LA+ER++A AKDAAVI+FLQK
Sbjct  190  EELHRNFLETVEKRERERMARDEAWKAREISRMNREHELLARERSMAAAKDAAVISFLQK  249

Query  294  ISKQ---PILVPH-KPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRT  127
            +S+     I + +  P +  + E  A T+ +  G+      SSSSRWPK E++ALI++RT
Sbjct  250  VSEHTDFSISIGNITPTAVSLPE-DADTRHHTPGENA----SSSSRWPKTEVQALIKVRT  304

Query  126  NLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            N+DL++HD G+KGPLWED+S+ M KLGY R+AKRCKEKWENI
Sbjct  305  NMDLKYHDGGAKGPLWEDVSSAMAKLGYTRSAKRCKEKWENI  346


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ MDL + D   KGPLW++VS  M + GY RSAK+C+EK+ENI KY
Sbjct  290  RWPKTEVQALIKVRTNMDLKYHDGGAKGPLWEDVSSAMAKLGYTRSAKRCKEKWENINKY  349

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F +L+  
Sbjct  350  FKKVKETNKRRPEDSKTCPYFHELDAI  376



>gb|KHN15835.1| Trihelix transcription factor GT-2 [Glycine soja]
Length=488

 Score =   273 bits (697),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 171/367 (47%), Positives = 224/367 (61%), Gaps = 62/367 (17%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EET+ LL IRSEMD+AF+D+ LK PLW++VSRK+ E GY RSAKKC+EKFENIYKY
Sbjct  42   RWPREETMALLNIRSEMDVAFKDANLKAPLWEQVSRKLSELGYNRSAKKCKEKFENIYKY  101

Query  816  HRRTKEGRSGRQTG-KNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            HRRTKEGR G+  G K YRFFEQLE  D   S                      ++ P T
Sbjct  102  HRRTKEGRFGKSNGAKTYRFFEQLEALDGNHS----------------------LLPPTT  139

Query  639  NIVQDFRMR--PHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDL  466
             +  D  +   P    A A        ++ ++  S  +KRKL  + E +M+EV+EKQE L
Sbjct  140  TVGDDVVLNAVPCSVSAAA-----HEHSSSTTSCSGKKKRKLTQFLEGLMREVIEKQETL  194

Query  465  QKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISK  286
            Q+KF+E +++CE +RMAREEAWKK+E+ER+K+E+E LA+ER+IA AKD  V+AFL+K ++
Sbjct  195  QRKFMEVLDKCEKDRMAREEAWKKEELERIKKERELLAQERSIAAAKDEVVLAFLRKFAE  254

Query  285  Q--PILVPHKPQSED-----------------------VQEFAAQTKENGSGDTTIssss  181
                + +  K Q ++                       V +   Q   N           
Sbjct  255  AEGTVQLLEKIQVQNDKQKNMKQNGGNDNANGGGGVTVVTDMDKQECGNNGVSVGNFVHM  314

Query  180  ssSRWPKPEIEALIQIRTNLDLQHH-------DNGSKGPLWEDISAEMKKLGYDRNAKRC  22
            SSSRWPK E+EALI++RT +D+Q         +NGSKGPLWE+IS+ MK LGYDR+AKRC
Sbjct  315  SSSRWPKDEVEALIRLRTQIDVQAQWNNNNNNNNGSKGPLWEEISSAMKSLGYDRSAKRC  374

Query  21   KEKWENI  1
            KEKWENI
Sbjct  375  KEKWENI  381


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 10/95 (11%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFR-------DSTLKGPLWDEVSRKMEEFGYQRSAKKCREK  838
            RWP +E   L+++R+++D+  +       ++  KGPLW+E+S  M+  GY RSAK+C+EK
Sbjct  318  RWPKDEVEALIRLRTQIDVQAQWNNNNNNNNGSKGPLWEEISSAMKSLGYDRSAKRCKEK  377

Query  837  FENIYKYHRRTKEGRSGR--QTGKNYRFFEQLEVF  739
            +ENI KY +R KE +S R  Q  K   ++  LE  
Sbjct  378  WENINKYFKRIKE-KSKRKPQDSKTCPYYHHLEAL  411



>ref|XP_010241710.1| PREDICTED: trihelix transcription factor GT-2-like [Nelumbo nucifera]
Length=534

 Score =   270 bits (689),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 240/356 (67%), Gaps = 24/356 (7%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEM +AFRDSTLKGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  53   RWPRQETLALLKIRSEMGVAFRDSTLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKY  112

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD-----AMQSHNKIGGaaaaeppelaspspvAMI  652
            H+RTK GR+ +  GK YRFFEQLE  D      +  H  +    A  PP  A+ +   M 
Sbjct  113  HKRTKGGRASKHDGKTYRFFEQLEALDNHPLPPLSPHKVMQTPTATVPPTTATMTATTMA  172

Query  651  K---PNTNIVQDFRMRPHGFGADADVLsaststtyssggss----GRKRK--LAGYFEKM  499
                P   +  +         A+ + +S S +T+ S+         RK+K  L  +FE++
Sbjct  173  TANPPGVVVQHNVPASVQNLSANTEFVSTSATTSSSTDSDEESEGTRKKKMKLMTFFERL  232

Query  498  MKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakda  319
            MKE++EKQE LQK+FLEAIE+ E ERM REEAWK QE+ R+ RE E L +ER+IA AKDA
Sbjct  233  MKEMIEKQETLQKRFLEAIEKRERERMEREEAWKVQEMARMNRELEMLVQERSIAAAKDA  292

Query  318  aviAFLQKISKQP-------ILVPHK--PQSEDVQEFAAQTKENGSGDTTIs-sssssSR  169
            AVIAFLQKIS+Q        + +P K  P  + V    A++ +N + +  ++ S  SSSR
Sbjct  293  AVIAFLQKISEQSSAVQLMEVQLPEKQAPPEKAVDPPRAESTDNVNANAVVTFSPVSSSR  352

Query  168  WPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            WPK E++ALI +RT LDL++ +NG KGPLWE+IS+ MKKLGY+R+AKRCKEKWENI
Sbjct  353  WPKAEVQALINLRTTLDLKYQENGPKGPLWEEISSAMKKLGYNRSAKRCKEKWENI  408


 Score = 83.6 bits (205),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +DL ++++  KGPLW+E+S  M++ GY RSAK+C+EK+ENI KY
Sbjct  352  RWPKAEVQALINLRTTLDLKYQENGPKGPLWEEISSAMKKLGYNRSAKRCKEKWENINKY  411

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  412  FKKVKESNKKRPEDSKTCPYFHQLDAL  438



>emb|CDY65284.1| BnaCnng46430D [Brassica napus]
Length=554

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 171/368 (46%), Positives = 231/368 (63%), Gaps = 36/368 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+M +AF D+T+KGPLW+EVSRKM E GY R+AKKC+EKFEN+YKY
Sbjct  55   RWPRQETLALLKIRSDMGIAFGDATVKGPLWEEVSRKMGELGYIRNAKKCKEKFENVYKY  114

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA------------MQSHNKIGGaaaaeppelas  673
            H+RTKEGR+G+  GK YRFF+QLE  +              Q HN     +   P     
Sbjct  115  HKRTKEGRTGKSEGKTYRFFDQLEALETHATSSSHHHQPQSQPHNNSSMFSTPPPVTTVI  174

Query  672  pspvAMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGY---FEK  502
            P    +     NI  DF        + +   S+      +   ++ +K++   +   FE+
Sbjct  175  PPTRNITPSFPNISGDFLSDNSTSSSSSYSTSSDVEVGDTKTTTTRKKKRKRKWKEFFER  234

Query  501  MMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakd  322
            +MK+V+ KQE+LQ+KFLEA+E+ E+ERM REE+W+ QEI R+ RE E LA+ER+++ AKD
Sbjct  235  LMKQVVGKQEELQRKFLEAVEKREHERMVREESWRVQEIARINREHEILAQERSMSAAKD  294

Query  321  aaviAFLQKISKQPI-----------------LVPHKPQSEDVQEFAAQTKENGSGDTTI  193
            AAV AFLQK S++P                  L  H      +    + T +  +GD  +
Sbjct  295  AAVTAFLQKFSEKPNPQCQLSTTTSRRHSSKRLKRHLLPLLPLLPLLSHTMKTDNGDQNM  354

Query  192  ssss----ssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKR  25
            +  S    SSSRWPK EIEALI++RTNLD ++ +NG KGPLWEDISA M++LG++RN+KR
Sbjct  355  TPVSAGALSSSRWPKVEIEALIKLRTNLDSKYEENGPKGPLWEDISAGMRRLGFNRNSKR  414

Query  24   CKEKWENI  1
            CKEKWENI
Sbjct  415  CKEKWENI  422


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  + ++  KGPLW+++S  M   G+ R++K+C+EK+ENI KY
Sbjct  366  RWPKVEIEALIKLRTNLDSKYEENGPKGPLWEDISAGMRRLGFNRNSKRCKEKWENINKY  425

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF----DAMQSHNKIGGaaaaeppelaspspvAMI  652
            +++ KE    R +  K   +F QL+      +   ++N +  +++         S   M+
Sbjct  426  YKKVKESNKKRPEDSKTCPYFHQLDALYRERNKFHTNNNVASSSSTSGLVKPDNSVPLMV  485

Query  651  KP  646
            +P
Sbjct  486  QP  487



>ref|XP_006302034.1| hypothetical protein CARUB_v10020016mg [Capsella rubella]
 gb|EOA34932.1| hypothetical protein CARUB_v10020016mg [Capsella rubella]
Length=597

 Score =   267 bits (683),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 173/383 (45%), Positives = 238/383 (62%), Gaps = 51/383 (13%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+M +AFRD+++KGPLW+EVSRKM E GY R+AKKC+EKFEN+YKY
Sbjct  67   RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMAELGYIRNAKKCKEKFENVYKY  126

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKI-------------GGaaaaeppela  676
            H+RTKEGR+G+  GK YRFF+QLE  +   + +                           
Sbjct  127  HKRTKEGRTGKSDGKTYRFFDQLEALETQSTTSHHHHHNNNNNSSIFSTPPPVTTVLPSV  186

Query  675  spspvAMIKPNT-----NIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGY  511
            +  P + I P T     NI  DF        + +   S+      ++     RKRK   +
Sbjct  187  ATLPSSSIPPYTLPSFPNISADFLSDNSTSSSSSYSTSSDMDMGGATTNRKKRKRKWKDF  246

Query  510  FEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiae  331
            FE++MK+V++KQEDLQ+KFLEA+E+ E+ER+ REE+W+ QEI R+ RE E LA+ER+++ 
Sbjct  247  FERLMKQVVDKQEDLQRKFLEAVEKREHERLVREESWRVQEIARINREHEILAQERSMSA  306

Query  330  akdaaviAFLQKISKQPILVPHKPQSEDVQEF----------------------------  235
            AKDAAV+AFLQK+S++    P  PQ + V+                              
Sbjct  307  AKDAAVMAFLQKLSEKQPNHPTVPQPQQVRPQMQLNNNNNQQQTQPPPPLPQPIQALVPT  366

Query  234  AAQTKENGSGDTTIs-----sssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDI  70
             + T +  +GD  ++      S+SSSRWPK EIEALI++RTNLD ++ +NG KGPLWE+I
Sbjct  367  TSDTVKTDNGDQHMTPASASGSASSSRWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEI  426

Query  69   SAEMKKLGYDRNAKRCKEKWENI  1
            SA M++LG++RN+KRCKEKWENI
Sbjct  427  SAGMRRLGFNRNSKRCKEKWENI  449


 Score = 75.5 bits (184),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M   G+ R++K+C+EK+ENI KY
Sbjct  393  RWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMRRLGFNRNSKRCKEKWENINKY  452

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  453  FKKVKESNKKRPEDSKTCPYFHQLDAL  479



>emb|CDY45955.1| BnaA02g17810D [Brassica napus]
Length=440

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 171/370 (46%), Positives = 229/370 (62%), Gaps = 38/370 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+M +AFRD+T+KGPLW+EVSRKM E GY R+AKKC+EKFEN+YKY
Sbjct  55   RWPRQETLALLKIRSDMGIAFRDATVKGPLWEEVSRKMGELGYIRNAKKCKEKFENVYKY  114

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAM------------QSHNKIGGaaaaeppelas  673
            H+RTKEGR+ +  GK YRFF+QLE  +              Q HN     +   P     
Sbjct  115  HKRTKEGRTEKSEGKTYRFFDQLEALETHSTSSSHHHQPQSQPHNNSSMFSTPPPVTTVI  174

Query  672  pspvAMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYF-EKMM  496
            P    +     NI  DF        + +         T ++     ++++    F E++M
Sbjct  175  PPTTNITPSFPNISGDFLSDNSTSSSYSTSSDVEVGDTKTTTTRRKKRKRKWKEFFERLM  234

Query  495  KEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaa  316
            K+V+ KQE+LQ+KFLE +E+ E+ERM REE+W+ QEI R+ RE E LA+ER+++ AKDAA
Sbjct  235  KQVVGKQEELQRKFLETVEKREHERMVREESWRVQEIARINREHEILAQERSMSAAKDAA  294

Query  315  viAFLQKISKQP---ILVPHKPQSEDVQE------------------FAAQTKENGSGDT  199
            V AFLQK S++P        +PQ E +                     A  T +  +GD 
Sbjct  295  VTAFLQKFSEKPNPQCQSIAQPQMEVIHNNQQATQQQTPPPRPPQPLSALDTMKTDNGDQ  354

Query  198  TIssss----ssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNA  31
             ++  S    SSSRWPK EIEALI++RTNLD ++ +NG KGPLWEDISA M++LG++RN+
Sbjct  355  NMTPVSAGALSSSRWPKVEIEALIKLRTNLDSKYEENGPKGPLWEDISAGMRRLGFNRNS  414

Query  30   KRCKEKWENI  1
            KRCKEKWENI
Sbjct  415  KRCKEKWENI  424


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  + ++  KGPLW+++S  M   G+ R++K+C+EK+ENI KY
Sbjct  368  RWPKVEIEALIKLRTNLDSKYEENGPKGPLWEDISAGMRRLGFNRNSKRCKEKWENINKY  427

Query  816  HRR  808
            +++
Sbjct  428  YKK  430



>ref|XP_007137690.1| hypothetical protein PHAVU_009G147500g [Phaseolus vulgaris]
 gb|ESW09684.1| hypothetical protein PHAVU_009G147500g [Phaseolus vulgaris]
Length=514

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 173/361 (48%), Positives = 219/361 (61%), Gaps = 32/361 (9%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EET+ LL IRS+MD+AFRD+  K PLW++VSRK+ E GY RSAKKCREKFENIYKY
Sbjct  42   RWPKEETMALLNIRSDMDVAFRDTNPKAPLWEQVSRKLAELGYIRSAKKCREKFENIYKY  101

Query  816  HRRTKEGRSGRQTG-KNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            HRR KEGRSG+  G K YRFFEQLE  +   S      +         +  P   I P+ 
Sbjct  102  HRRIKEGRSGKSNGSKTYRFFEQLEALEGHHSLLPPSVSDPETTTTTTTHVPHNKINPSN  161

Query  639  NIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQK  460
            N        P    A A      +S+T S  G   RK+KL  + E +M+EV+EKQE LQ+
Sbjct  162  NFDVILDAVPCSVSAYAG---EHSSSTTSCSGKEFRKKKLTRFLEGLMREVIEKQETLQR  218

Query  459  KFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISK--  286
            KF+E +E+CE +R+AREEAWKK+E+  +K+E+E LA+ER+IA AKD  V+AFL+K ++  
Sbjct  219  KFMEVLEKCEKDRVAREEAWKKEELALIKKERELLAQERSIAAAKDEVVLAFLRKFAQAE  278

Query  285  ------QPILVPHKPQSEDVQEFAAQTKENGSGDTTIsss--------------sssSRW  166
                  + I V +       Q        NG GD +                   SSSRW
Sbjct  279  GTVQLLEKIQVQNDKHRNMQQSGNINFSANGGGDVSDVDKRECGNNLSVRNFVHMSSSRW  338

Query  165  PKPEIEALIQIRTNLDLQHHDNG------SKGPLWEDISAEMKKLGYDRNAKRCKEKWEN  4
            PK E+EALI++RT LD+Q   N       SKGPLWE+IS  MK LGY+R+AKRCKEKWEN
Sbjct  339  PKDEVEALIRLRTQLDVQSQGNSNSSNGVSKGPLWEEISLAMKGLGYNRSAKRCKEKWEN  398

Query  3    I  1
            I
Sbjct  399  I  399


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 7/93 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFR------DSTLKGPLWDEVSRKMEEFGYQRSAKKCREKF  835
            RWP +E   L+++R+++D+  +      +   KGPLW+E+S  M+  GY RSAK+C+EK+
Sbjct  337  RWPKDEVEALIRLRTQLDVQSQGNSNSSNGVSKGPLWEEISLAMKGLGYNRSAKRCKEKW  396

Query  834  ENIYKYHRRTKE-GRSGRQTGKNYRFFEQLEVF  739
            ENI KY +R KE  +   +  K   ++  LEV 
Sbjct  397  ENINKYFKRMKEKNKRKPEDSKTCPYYHHLEVL  429



>gb|EPS64836.1| hypothetical protein M569_09942, partial [Genlisea aurea]
Length=503

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 182/362 (50%), Positives = 240/362 (66%), Gaps = 34/362 (9%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLK-GPLWDEVSRKMEEFGYQRSAKKCREKFENIYK  820
            RWP EET+ LLKIRS+MD+AFRD+T +  PLWDEVSRK+ E GY RSAKKC+EKFENI+K
Sbjct  27   RWPREETIALLKIRSDMDVAFRDNTPRRAPLWDEVSRKLSELGYHRSAKKCKEKFENIFK  86

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH--NKIGGaaaaeppelaspspvAMIKP  646
            YH+RTKE RS +   +NYRFFEQLE+ D+  S+  N+I   +    P   S +   M   
Sbjct  87   YHKRTKESRSSKHNARNYRFFEQLELLDSHFSNPSNRIPSYSMETTPPTPSGA---MPTK  143

Query  645  NTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDL  466
              +  Q+F          +   S  +S+   S GS  RKRKL  YFE +MK+VLEKQE+L
Sbjct  144  ALSSGQEFTFPLPDNRVPSVSTSTESSSGKESEGSIKRKRKLVDYFESLMKDVLEKQEEL  203

Query  465  QKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISK  286
            Q KFLEA+E+CE E++AREEAWK QE+ R+KRE+E LA+ERA++EAKDAAVIAFLQK+++
Sbjct  204  QNKFLEALEKCEKEQIAREEAWKLQEMARMKREKELLAQERAMSEAKDAAVIAFLQKLTQ  263

Query  285  Q--PILVP-----HKP--------------QSEDVQEFAAQTKENGSGDTTIssssssSR  169
               P+ VP      KP              Q   + E +A   +N + ++T+   S+SSR
Sbjct  264  HTAPLHVPDIILFDKPPENVGNALEKHSELQENRIGESSAARLDNSTVESTL-LMSTSSR  322

Query  168  WPKPEIEALIQIRTNLDLQHH------DNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWE  7
            WPK E+EALI+++T+LD ++         G KG +WE+IS  +K+LGYDR  KRCKEKWE
Sbjct  323  WPKSEVEALIRLKTDLDSKYQGSGGGGGGGPKGSIWEEISTSLKRLGYDRAPKRCKEKWE  382

Query  6    NI  1
            NI
Sbjct  383  NI  384


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 59/104 (57%), Gaps = 7/104 (7%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGP------LWDEVSRKMEEFGYQRSAKKCREKF  835
            RWP  E   L+++++++D  ++ S   G       +W+E+S  ++  GY R+ K+C+EK+
Sbjct  322  RWPKSEVEALIRLKTDLDSKYQGSGGGGGGGPKGSIWEEISTSLKRLGYDRAPKRCKEKW  381

Query  834  ENIYKYHRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKIGG  706
            ENI KY++R K+ +  R +  K   +F  L+   A +S    GG
Sbjct  382  ENINKYYKRVKDSKKRRPEDSKTCPYFNLLDSVYAKKSKKFDGG  425



>ref|NP_001236630.1| trihelix transcription factor [Glycine max]
 gb|ABQ42349.1| trihelix transcription factor [Glycine max]
Length=500

 Score =   262 bits (670),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 170/368 (46%), Positives = 229/368 (62%), Gaps = 54/368 (15%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EET+ LL IRSEMD+AF+D+ LK PLW++VSRK+ E GY RSAKKC+EKFENIYKY
Sbjct  42   RWPREETMALLNIRSEMDVAFKDANLKAPLWEQVSRKLSELGYNRSAKKCKEKFENIYKY  101

Query  816  HRRTKEGRSGRQTG-KNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            HRRTKEGR G+  G K YRFFEQLE  D   +H+ +            +     ++    
Sbjct  102  HRRTKEGRFGKSNGAKTYRFFEQLEALDG--NHSLLPPTTTDNNNNNNNVGDDVVL----  155

Query  639  NIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQK  460
            N V      P    A A        ++ ++  S  +KRKL  + E +M+EV+EKQE LQ+
Sbjct  156  NAV------PCSVSAAA-----HEHSSSTTSCSGKKKRKLTQFLEGLMREVIEKQETLQR  204

Query  459  KFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISK--  286
            KF+E +++CE +RMAREEAWKK+E+ER+K+E+E LA+ER+IA AKD AV+AFL+K ++  
Sbjct  205  KFVEVLDKCEKDRMAREEAWKKEELERIKKERELLAQERSIAAAKDEAVLAFLRKFAEAE  264

Query  285  ------QPILVPHKPQSEDVQEFAAQTKENGSGDTTIsss--------------------  184
                  + I V +  Q +++++       NG G   + +                     
Sbjct  265  DTVQLLEKIQVQNDKQ-KNMKQNGGSDNANGGGGVAVVTDVDKQECGNTNVRVSVGNFVH  323

Query  183  sssSRWPKPEIEALIQIRTNLDLQHH-------DNGSKGPLWEDISAEMKKLGYDRNAKR  25
             SSS WP+ E EALI++RT +D+Q         +NGSKGPLWE+IS+ MK LGYDR+AKR
Sbjct  324  MSSSCWPRDEAEALIRLRTQIDVQAQWNSNNNNNNGSKGPLWEEISSAMKSLGYDRSAKR  383

Query  24   CKEKWENI  1
            CKEKWENI
Sbjct  384  CKEKWENI  391


 Score = 70.9 bits (172),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 58/94 (62%), Gaps = 10/94 (11%)
 Frame = -3

Query  993  WPHEETLTLLKIRSEMDLAFR-------DSTLKGPLWDEVSRKMEEFGYQRSAKKCREKF  835
            WP +E   L+++R+++D+  +       ++  KGPLW+E+S  M+  GY RSAK+C+EK+
Sbjct  329  WPRDEAEALIRLRTQIDVQAQWNSNNNNNNGSKGPLWEEISSAMKSLGYDRSAKRCKEKW  388

Query  834  ENIYKYHRRTKEGRSGR--QTGKNYRFFEQLEVF  739
            ENI KY +R KE +S R  Q  K   ++  LE  
Sbjct  389  ENINKYFKRIKE-KSKRKPQDSKTCPYYHHLEAL  421



>emb|CDY48545.1| BnaC06g18750D [Brassica napus]
Length=568

 Score =   264 bits (675),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 163/378 (43%), Positives = 235/378 (62%), Gaps = 51/378 (13%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+M +AFRD+++KGPLW+EVSRKM E GY R+AKKC+EKFEN+YKY
Sbjct  50   RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMAELGYIRNAKKCKEKFENVYKY  109

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKI---GGaaaaeppelaspspvAMIKP  646
            H+RTKEGR+G+  GK YRFF+QLE  +   + + I            +     P   ++P
Sbjct  110  HKRTKEGRTGKSEGKTYRFFDQLEALETRPTSSSIHHQQQQQPPPQTQPQPLQPQPPLRP  169

Query  645  NTNI----------------VQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAG  514
            + N                 + +    P+   A+       +    S   +S  +   + 
Sbjct  170  HNNNSPMFSTSPPVTTITPQITNTTFPPYTQPANVPSFPNISGDFLSDNSTSSSRSTSSD  229

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++ ++V++KQE+LQ+KFLEA+E+ E+ER+ REE+W+ QEI R+ RE++ LA+ER+++
Sbjct  230  FFERLTRQVVDKQEELQRKFLEAVEKREDERLVREESWRVQEIARINRERDILAQERSMS  289

Query  333  eakdaaviAFLQKISKQPILVPHKPQSEDVQEF--------------------AAQTKEN  214
             AKDAAV+AFLQK+S++P      PQ + +                          T + 
Sbjct  290  AAKDAAVMAFLQKLSEKP-----NPQGQSIIPQPQPQPQQAPSQMQPTQPVTPTVDTSKT  344

Query  213  GSGDTTIs-------sssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMK  55
             +GD  ++        + SSSRWPK EIEALI++RTNLD ++ +NG KGPLWE+ISA MK
Sbjct  345  DNGDQNMTPVSASAAGAVSSSRWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMK  404

Query  54   KLGYDRNAKRCKEKWENI  1
            +LG++RN+KRCKEKWENI
Sbjct  405  RLGFNRNSKRCKEKWENI  422


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M+  G+ R++K+C+EK+ENI KY
Sbjct  366  RWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMKRLGFNRNSKRCKEKWENINKY  425

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  426  FKKVKESNKKRPEDSKTCPYFHQLDAL  452



>emb|CDY13568.1| BnaC02g23790D [Brassica napus]
Length=493

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 167/358 (47%), Positives = 222/358 (62%), Gaps = 26/358 (7%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL+IRSEMD AFRDSTLK PLW+E+SRKM EFGY+RSAKKC+EKFEN+YKY
Sbjct  26   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMEFGYKRSAKKCKEKFENVYKY  85

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH--NKIGGaaaaeppelaspspvAMIKPN  643
            H+RTKEGR+G+  GK YRFFE+L+  +A+ S+          +        +  ++I  N
Sbjct  86   HKRTKEGRTGKSEGKTYRFFEELQALEALNSYPPEPESQPLKSSTATTTVTTTTSLIPNN  145

Query  642  TNIVQDFRMRPHGFGADADVLsaststtys-----------sggssGRKRKLAGY----F  508
                 D   RP       +V S +  ++ +                 R RK   Y    F
Sbjct  146  HATTIDTGFRPTSNDLINNVSSLNLFSSSTSSSTASDEEEDHHHQDKRSRKKRKYWKRLF  205

Query  507  EKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaea  328
             K+ KE++ KQE +QK+FLE  E  E ER++REEAW+ QE+ R+ RE ++L  ER+ A A
Sbjct  206  TKLTKELMAKQEKVQKRFLEIFENQERERISREEAWRVQEVARINREHKTLVHERSNAVA  265

Query  327  kdaaviAFLQKIS-------KQPILVPHKPQSEDVQEFAAQTKENGSG--DTTIssssss  175
            KDAA+I+FL KIS       +Q   VP + Q         ++KE      D+  S S SS
Sbjct  266  KDAAIISFLHKISGGQQQQPRQKHKVPQRKQYHSEHSITFESKEPRPVLFDSNHSLSPSS  325

Query  174  SRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            SRWPK E+E LI+IR NL+  + +NG++GPLWE+IS  M++LGY+R+AKRCKEKWENI
Sbjct  326  SRWPKTEVEVLIRIRKNLEANYQENGTRGPLWEEISGGMRRLGYNRSAKRCKEKWENI  383


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 56/98 (57%), Gaps = 3/98 (3%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR  ++  ++++  +GPLW+E+S  M   GY RSAK+C+EK+ENI KY
Sbjct  327  RWPKTEVEVLIRIRKNLEANYQENGTRGPLWEEISGGMRRLGYNRSAKRCKEKWENINKY  386

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVFDAMQSHNKIGG  706
             ++ KE    R    K   +F QLE        NK G 
Sbjct  387  FKKVKESNKKRPLDSKTCPYFNQLEAL--YNERNKSGA  422



>ref|XP_010537279.1| PREDICTED: trihelix transcription factor GT-2-like [Tarenaya 
hassleriana]
Length=512

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 167/350 (48%), Positives = 220/350 (63%), Gaps = 26/350 (7%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD AFR ++ KGPLWDEVSRKM E GY RSAKKCREKFEN+YKY
Sbjct  44   RWPRQETLALLKIRSDMDTAFRHASAKGPLWDEVSRKMLEIGYNRSAKKCREKFENVYKY  103

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA-------------MQSHNKIGGaaaaeppela  676
            H+RTKEGR+ +  GK YRFF+QL+                 + + N      A       
Sbjct  104  HKRTKEGRTRKSQGKTYRFFDQLDALQTQPQPQSQSPQPPSVNADNPPTCGVALATVTST  163

Query  675  spspvAMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMM  496
             P P   + P  +I  DF        + +  +     T          K+K   +FE+M+
Sbjct  164  MPPPYTSVPPVPDIFCDFPSDSAPSSSSSSDMETGGGTRKKR------KKKWKDFFERMV  217

Query  495  KEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaa  316
            K+V+EKQE+LQ +FLE +E+ ENERM REEAW+ +E+ R+KRE+E L++ER+ A AKDA 
Sbjct  218  KKVVEKQEELQTQFLETLEKRENERMVREEAWRMEEMARIKREREILSQERSNAAAKDAT  277

Query  315  viAFLQK-ISKQPI---LVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIE  148
            V+  LQK +S+ P    L  H P     Q       +    +T    S S SRWPK EIE
Sbjct  278  VMTLLQKQLSENPSLSHLSTHAPPPPQTQILQPPPPQTQPNETAT--SPSPSRWPKVEIE  335

Query  147  ALIQIRTNLDLQHHDNGS-KGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ALI++RTNLD ++H+NGS KGP+WE++SA M++LG++R+AKRCKEKWENI
Sbjct  336  ALIKLRTNLDSKYHENGSQKGPMWEEVSAGMRRLGFNRSAKRCKEKWENI  385


 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 55/88 (63%), Gaps = 2/88 (2%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDS-TLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYK  820
            RWP  E   L+K+R+ +D  + ++ + KGP+W+EVS  M   G+ RSAK+C+EK+ENI K
Sbjct  328  RWPKVEIEALIKLRTNLDSKYHENGSQKGPMWEEVSAGMRRLGFNRSAKRCKEKWENINK  387

Query  819  YHRRTKEGRSGRQT-GKNYRFFEQLEVF  739
            Y ++ KE    R    K   ++ QL+V 
Sbjct  388  YFKKVKESNKKRPVDSKTCPYYHQLDVL  415



>ref|XP_007213893.1| hypothetical protein PRUPE_ppa003808mg [Prunus persica]
 gb|EMJ15092.1| hypothetical protein PRUPE_ppa003808mg [Prunus persica]
Length=547

 Score =   261 bits (668),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 176/394 (45%), Positives = 231/394 (59%), Gaps = 69/394 (18%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD  F+++++K PLW EVSRKM E G+ R+AKKC+EKFENIYKY
Sbjct  53   RWPRQETLALLKIRSDMDAEFKEASIKVPLWQEVSRKMGELGHNRTAKKCKEKFENIYKY  112

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            HRRTKE  SGR  GK YRFFEQLE  D    H+           ++ +        P TN
Sbjct  113  HRRTKE--SGRPNGKAYRFFEQLEALD----HHDFELPPPPASEKVQTSVAEIATNP-TN  165

Query  636  IVQDFRMRPHGFGADADVLsa----ststtyssggssGRKRKLAGYFEKMMKEVLEKQED  469
            +V +          D+  +      ++S++  S G+  +KR+L  +FE+MM EV++KQE+
Sbjct  166  VVYNAIPCSSIQHPDSSFVENSSSTTSSSSKESEGTHKKKRRLTEFFERMMNEVIDKQEN  225

Query  468  LQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKIS  289
            LQKKF+E +E+ E +R+AREEAWK QE+ R+KRE+E L +ER++A AKDAAV+AFLQK S
Sbjct  226  LQKKFVEVLEKHEQDRIAREEAWKMQELARIKREREILVQERSVAAAKDAAVLAFLQKFS  285

Query  288  KQ------------------------------PILVPHKPQSEDV--QEFAAQTKENGSG  205
            +Q                              P+ +P +P S     Q    Q   N   
Sbjct  286  EQSGTMQFPEQAFSVHFPAQPPSSMQFPEQPSPVQLPEQPPSGQFPEQSTPVQLPVNSQA  345

Query  204  DTTIssss--------------------------ssSRWPKPEIEALIQIRTNLDLQHHD  103
            DT +                              SSSRWPK E+EALI+IR + DLQ+ +
Sbjct  346  DTLMEKQEKTNDANVVHMSLDKQERNNGRSYMHMSSSRWPKEEVEALIKIRADFDLQYQE  405

Query  102  NGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            +G KGPLWE+ISA M KLGYDR+AKRCKEKWENI
Sbjct  406  SGPKGPLWEEISAAMVKLGYDRSAKRCKEKWENI  439


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 65/94 (69%), Gaps = 4/94 (4%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+KIR++ DL +++S  KGPLW+E+S  M + GY RSAK+C+EK+ENI KY
Sbjct  383  RWPKEEVEALIKIRADFDLQYQESGPKGPLWEEISAAMVKLGYDRSAKRCKEKWENINKY  442

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNK  715
            +RR KE  S ++  ++ +    + + DA+  HNK
Sbjct  443  YRRIKE--SNKKRPEDSKTCGYVRLLDAL--HNK  472



>ref|XP_009128203.1| PREDICTED: trihelix transcription factor GT-2-like [Brassica 
rapa]
Length=556

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 170/370 (46%), Positives = 228/370 (62%), Gaps = 38/370 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+M +AFRD+T+KGPLW+EVSRKM E GY R+AKKC+EKFEN+YKY
Sbjct  55   RWPRQETLALLKIRSDMGIAFRDATVKGPLWEEVSRKMGELGYIRNAKKCKEKFENVYKY  114

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAM------------QSHNKIGGaaaaeppelas  673
            H+RTKEGR+ +  GK YRFF+QLE  +              Q HN     +   P     
Sbjct  115  HKRTKEGRTEKSEGKTYRFFDQLEALETHSTSSSHHHQPQSQPHNNSSMFSTPPPVTTVI  174

Query  672  pspvAMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYF-EKMM  496
            P    +     NI  DF        + +         T ++     ++++    F E++M
Sbjct  175  PPTTNITPSFPNISGDFLSDNSTSSSYSTSSDVEVGDTKTTTTRRKKRKRKWKEFFERLM  234

Query  495  KEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaa  316
            K+V+ KQE+LQ+KFLE +E+ E+ERM REE+W+ QEI R+ RE E LA+ER+++ AKDAA
Sbjct  235  KQVVGKQEELQRKFLETVEKREHERMVREESWRVQEIARINREHEILAQERSMSAAKDAA  294

Query  315  viAFLQKISKQP---ILVPHKPQSEDVQE------------------FAAQTKENGSGDT  199
            V AFLQK S++P        +PQ E +                     A  T +  +GD 
Sbjct  295  VTAFLQKFSEKPNPQCQSIAQPQMEVIHNNQQATQQQTPPPRPPQPLSALDTMKTDNGDQ  354

Query  198  TIssss----ssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNA  31
             ++  S    SSSRWPK  IEALI++RTNLD ++ +NG KGPLWEDISA M++LG++RN+
Sbjct  355  NMTPVSAGALSSSRWPKVGIEALIKLRTNLDSKYEENGPKGPLWEDISAGMRRLGFNRNS  414

Query  30   KRCKEKWENI  1
            KRCKEKWENI
Sbjct  415  KRCKEKWENI  424


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP      L+K+R+ +D  + ++  KGPLW+++S  M   G+ R++K+C+EK+ENI KY
Sbjct  368  RWPKVGIEALIKLRTNLDSKYEENGPKGPLWEDISAGMRRLGFNRNSKRCKEKWENINKY  427

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF----DAMQSHNKIGGaaaaeppelaspspvAMI  652
            +++ KE    R +  K   +F QL+      +   ++N +  +++         S   M+
Sbjct  428  YKKVKESNKKRPEDSKTCPYFHQLDALYRERNKFHTNNNVASSSSTSGLVKPDNSVPLMV  487

Query  651  KP  646
            +P
Sbjct  488  QP  489



>emb|CDY45957.1| BnaA02g17830D [Brassica napus]
Length=488

 Score =   256 bits (655),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 164/360 (46%), Positives = 216/360 (60%), Gaps = 28/360 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL+IRSEMD AFRDSTLK PLW+EVSRKM+E GY+RSAKKC+EKFEN+YKY
Sbjct  26   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEVSRKMKELGYKRSAKKCKEKFENVYKY  85

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            H+RTKEGR+G+  GK YRFFE+L+  +A+ S+    G+   +     +  P         
Sbjct  86   HKRTKEGRTGKSEGKTYRFFEELQALEALNSYPPEPGSQPLKSSTATTTQPSPTTPFPIY  145

Query  636  IVQDFRMRPHGFGADADVLsasts----------------ttyssggssGRKRKLAGYFE  505
                      GF   ++ L  + S                          R RK   Y++
Sbjct  146  SNNHATTIDTGFSPTSNDLINNVSSLNLFSSSTSSSTASDEEEDHHHQDNRSRKKRKYWK  205

Query  504  KMM----KEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakerai  337
             +      E++EKQE +QK+FLE  E  E ER++REEAW+ QE+ R+ RE E+L  ER+ 
Sbjct  206  GLFTKLTNELMEKQEKVQKRFLETFENQERERISREEAWRVQEVARINREHETLVHERSN  265

Query  336  aeakdaaviAFLQKISKQPIL------VPHKPQSEDVQEFAAQTKENGSG--DTTIssss  181
            A AKDA +I+FL KIS           VP + Q         ++KE      D+  S S 
Sbjct  266  AVAKDAVIISFLHKISGGQQQQQQKHEVPQRKQYHSEHSITFESKEPRPVLFDSNHSLSP  325

Query  180  ssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            SSSRWPK E+EALI+IR NL+  + +NG++GPLWE+IS  M++LGY+R+AKRCKEKWENI
Sbjct  326  SSSRWPKTEVEALIRIRKNLEANYQENGTRGPLWEEISGGMRRLGYNRSAKRCKEKWENI  385


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR  ++  ++++  +GPLW+E+S  M   GY RSAK+C+EK+ENI KY
Sbjct  329  RWPKTEVEALIRIRKNLEANYQENGTRGPLWEEISGGMRRLGYNRSAKRCKEKWENINKY  388

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F QLE  
Sbjct  389  FKKVKESNKKRPLDSKTCPYFNQLEAL  415



>ref|XP_008232997.1| PREDICTED: trihelix transcription factor GTL1-like [Prunus mume]
Length=546

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 175/395 (44%), Positives = 230/395 (58%), Gaps = 72/395 (18%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD  F+++++K PLW EVSRKM E G+ R+ KKC+EKFENIYKY
Sbjct  53   RWPRQETLALLKIRSDMDAEFKEASIKVPLWQEVSRKMGELGHNRTGKKCKEKFENIYKY  112

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            HRRTKE  SGR  GK YRFFEQLE  D    H+           ++ +        P TN
Sbjct  113  HRRTKE--SGRPNGKAYRFFEQLEALD----HHDFELPPPPASEKVQTSVAEIATNP-TN  165

Query  636  IVQDFRMRPHGF-GADADVLsa----ststtyssggssGRKRKLAGYFEKMMKEVLEKQE  472
            +V  +   P      D+  +      ++S++  S G+  +KR+L  +FE+MM EV++KQE
Sbjct  166  VV--YNAIPCSIQHPDSSFVENSSSTTSSSSKESEGTHKKKRRLTEFFERMMNEVIDKQE  223

Query  471  DLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKI  292
            +LQKKF+E +E+ E +R+ REEAWK QE+ R+KRE+E L +ER++A AKDAAV+AFLQK 
Sbjct  224  NLQKKFVEVLEKHEQDRITREEAWKMQELARIKREREILVQERSVAAAKDAAVLAFLQKF  283

Query  291  SKQ------------------------------PILVPHKPQSEDV--QEFAAQTKENGS  208
            S+Q                              P+ +P +P S     Q    Q   N  
Sbjct  284  SEQSGTMQFPEQAFSVHFPAQPPSSMQFPEQPSPVQLPEQPPSGQFPEQSTPVQLPVNSQ  343

Query  207  GDTTIssss--------------------------ssSRWPKPEIEALIQIRTNLDLQHH  106
             DT +                              SSSRWPK E+EALI+IR + DLQ+ 
Sbjct  344  ADTFMDKQEKTNDANVVHMSLDKQERNNGRSYMHMSSSRWPKEEVEALIKIRADFDLQYQ  403

Query  105  DNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ++G KGPLWE+ISA M KLGYDR+AKRCKEKWENI
Sbjct  404  ESGPKGPLWEEISAAMVKLGYDRSAKRCKEKWENI  438


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 65/94 (69%), Gaps = 4/94 (4%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+KIR++ DL +++S  KGPLW+E+S  M + GY RSAK+C+EK+ENI KY
Sbjct  382  RWPKEEVEALIKIRADFDLQYQESGPKGPLWEEISAAMVKLGYDRSAKRCKEKWENINKY  441

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNK  715
            +RR KE  S ++  ++ +    + + DA+  HNK
Sbjct  442  YRRIKE--SNKKRPEDSKTCGYVRLLDAL--HNK  471



>ref|XP_003526850.1| PREDICTED: trihelix transcription factor GT-2-like isoform X1 
[Glycine max]
Length=497

 Score =   252 bits (644),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 173/362 (48%), Positives = 228/362 (63%), Gaps = 47/362 (13%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EET+ LLKIRSEMD+AF+D+  K PLW++VSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  42   RWPREETMALLKIRSEMDVAFKDANPKAPLWEQVSRKLAELGYNRSAKKCKEKFENVYKY  101

Query  816  HRRTKEGRSGRQTG-KNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            HRRTKEGR G+  G K YRFFEQLE   A+  ++ +                  ++    
Sbjct  102  HRRTKEGRFGKSNGAKTYRFFEQLE---ALDGNHSLPPPTTTTDNNNNVDDDDVIL----  154

Query  639  NIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQK  460
            N V      P    A A    A   ++ ++  S   KRKL  + E +M+EV+EKQE LQ+
Sbjct  155  NAV------PCSVIAAA----AHEHSSSTTSSSGKMKRKLTRFLEGLMREVIEKQETLQR  204

Query  459  KFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISKQ-  283
            KF+E +++CE +RMAREEAWKK+E+ER+K+E+E LA ER+IA AKD AV+AFL+K ++  
Sbjct  205  KFMEVLDKCEKDRMAREEAWKKEELERIKKERELLAHERSIAAAKDEAVLAFLKKFAEAE  264

Query  282  -PILVPHKPQSE-DVQEFAAQTKENGS--GDTTIss------------------ssssSR  169
              + +  K Q + D Q+   Q   N +  GD T+ +                    SSSR
Sbjct  265  GTVQLLEKIQVQNDKQKNKHQNGANANRGGDVTVVTDMDKQECGNNGVSVGNFVHMSSSR  324

Query  168  WPKPEIEALIQIRTNLDLQHH------DNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWE  7
            WPK E+EALI++RT  D+Q        +NGSKGPLWE+IS  MK +GYDR+AKRCKEKWE
Sbjct  325  WPKDEVEALIRLRTEFDVQAQGNNNNSNNGSKGPLWEEISLAMKSIGYDRSAKRCKEKWE  384

Query  6    NI  1
            NI
Sbjct  385  NI  386


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 7/93 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTL------KGPLWDEVSRKMEEFGYQRSAKKCREKF  835
            RWP +E   L+++R+E D+  + +        KGPLW+E+S  M+  GY RSAK+C+EK+
Sbjct  324  RWPKDEVEALIRLRTEFDVQAQGNNNNSNNGSKGPLWEEISLAMKSIGYDRSAKRCKEKW  383

Query  834  ENIYKYHRRTKE-GRSGRQTGKNYRFFEQLEVF  739
            ENI KY +R KE  +   Q  K   ++  LE  
Sbjct  384  ENINKYFKRIKEKNKRKPQDSKTCPYYHHLEAL  416



>ref|XP_004306599.1| PREDICTED: trihelix transcription factor GT-2-like [Fragaria 
vesca subsp. vesca]
Length=564

 Score =   250 bits (638),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 169/393 (43%), Positives = 234/393 (60%), Gaps = 64/393 (16%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LLKIRS+MD  F+ ++ K PLW+EVSRKM E GY R AKKC+EKFENIYKY
Sbjct  53   RWPRPETLALLKIRSDMDAEFKAASPKLPLWEEVSRKMGEAGYSRDAKKCKEKFENIYKY  112

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            H+RT+E R  R  GK Y++FEQLE  +  Q H++    A       A  +  +     +N
Sbjct  113  HKRTRESRGARSAGKTYKYFEQLEAIE--QHHSEHPPPAETVQASTAETAAASPKDGVSN  170

Query  636  IVQDFRMRPHGFGADAD-VLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQK  460
             +    M+ H   +  D     ++ ++  S G+  +KR++  +FEK+MK+V++KQE+LQ 
Sbjct  171  AIPCSSMQ-HQLSSFVDNSTPTTSCSSKESEGTHKKKRRVTEFFEKLMKQVIDKQENLQT  229

Query  459  KFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISKQP  280
            KF+E +++ E ER+AREEAWK QE+ R++RE+E LA+ER++A AKDAAV+AFLQK S+Q 
Sbjct  230  KFVEVLDKYEQERIAREEAWKMQELTRIERERELLAQERSVAAAKDAAVLAFLQKFSEQA  289

Query  279  -----------ILVPHKPQSE--------------------DVQEFAA--QTKENGSGDT  199
                       + +P++P S                      VQ  A   Q   N S   
Sbjct  290  ASVNLPSQSCSVQIPNQPSSVHLPLQACSVQLPNQVSSAQLPVQASAVRVQMPANSSVAN  349

Query  198  TIs---------------------------sssssSRWPKPEIEALIQIRTNLDLQHHDN  100
            T+S                           + ++S+RWP+ E+  LI++R+N DLQ+ +N
Sbjct  350  TVSEKQKKDEDWELVRRSLESPDKNNGRSRTPTNSTRWPREEVSDLIRLRSNYDLQYQEN  409

Query  99   GSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            GSKG LWE+I+A MKKLGYDRNAKRCKEKWENI
Sbjct  410  GSKGHLWEEIAASMKKLGYDRNAKRCKEKWENI  442


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++RS  DL ++++  KG LW+E++  M++ GY R+AK+C+EK+ENI KY
Sbjct  386  RWPREEVSDLIRLRSNYDLQYQENGSKGHLWEEIAASMKKLGYDRNAKRCKEKWENINKY  445

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
            +RR K+    R +  K   + E L+  
Sbjct  446  YRRLKDSNKKRPEDSKTCAYVEMLDSL  472



>emb|CDX68080.1| BnaA07g21200D [Brassica napus]
Length=579

 Score =   249 bits (637),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 170/384 (44%), Positives = 230/384 (60%), Gaps = 56/384 (15%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+M +AFRDS++KGPLW+EVSRKM E GY R+AKKC+EKFEN+YKY
Sbjct  53   RWPRQETLALLKIRSDMGIAFRDSSVKGPLWEEVSRKMAELGYIRNAKKCKEKFENVYKY  112

Query  816  HRRTKEGRSGRQTGKNYRFF---EQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKP  646
            H+RTKEGR+G+  GK YRFF   E LE      S +           +     P   ++P
Sbjct  113  HKRTKEGRTGKSEGKTYRFFDQLEALETRPTSSSLHHQQQPQPPPQTQPQPLQPQPPLRP  172

Query  645  NTNIVQDFRMRPHGFGA------DADVLsaststtyssggssG-------------RKRK  523
            + N    F   P             D LS  ++++  S  S               RKRK
Sbjct  173  HNNNSSMFSTPPPPVNVPLFPNISGDFLSDDSTSSSHSTSSDVEVGDGTTTTRKKKRKRK  232

Query  522  LAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLaker  343
               +FE++ ++V++KQE+LQ+KFLEA+E+ E+ER+ REE+W+ QEI R+ RE++ LA+ER
Sbjct  233  WKEFFERLTRQVVDKQEELQRKFLEAVEKREHERLVREESWRVQEIARINRERDILAQER  292

Query  342  aiaeakdaaviAFLQKISKQP------------------------------ILVPHKPQS  253
            +++ AKDAAV+AFLQK+S++P                                 P  P  
Sbjct  293  SMSAAKDAAVMAFLQKLSEKPNPQGQSIPQQQPQPQQPPSQMQVNNNNNQQTPQPPPPPI  352

Query  252  EDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWED  73
                +    T +    D  +SSS    RWPK EIEALI++RTNLD ++ +NG KGPLWE+
Sbjct  353  SQPTQPVTPTVDTSKTDNALSSS----RWPKVEIEALIKLRTNLDSKYQENGPKGPLWEE  408

Query  72   ISAEMKKLGYDRNAKRCKEKWENI  1
            ISA MK+LG++RN+KRCKEKWENI
Sbjct  409  ISAGMKRLGFNRNSKRCKEKWENI  432


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M+  G+ R++K+C+EK+ENI KY
Sbjct  376  RWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMKRLGFNRNSKRCKEKWENINKY  435

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  436  FKKVKESNKKRPEDSKTCPYFHQLDAL  462



>emb|CBI34644.3| unnamed protein product [Vitis vinifera]
Length=497

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 146/337 (43%), Positives = 199/337 (59%), Gaps = 44/337 (13%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD+AFRD+TLKGPLW++VSRK+ E GY RSAKKC+EKFEN++KY
Sbjct  102  RWPRQETLALLKIRSEMDVAFRDATLKGPLWEDVSRKLAELGYSRSAKKCKEKFENVHKY  161

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN---KIGGaaaaeppelaspspvAMIKP  646
            ++RTKEGR+GRQ GK+YRFF QLE   +  + N       +        ++     M  P
Sbjct  162  YKRTKEGRAGRQDGKSYRFFSQLEALHSTATSNVNPMPVSSVRIPSASPSTMGASPMFPP  221

Query  645  NTNIVQDFRMRPHGFGADADVLsaststty--ssggssGRKRKLAGYFEKMMKEVLEKQE  472
              ++       P G  A     +A T T    S   ++   R++  +FE +MK+V+EKQE
Sbjct  222  --DLSSGMITAPSGSAAATAPAAAPTHTALGISFSSNTSNSRRMMDFFESLMKQVMEKQE  279

Query  471  DLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKI  292
             +Q++FLE IE+ E +RM REEAWK+QE+ RL                        +  I
Sbjct  280  VMQQRFLETIEKREQDRMIREEAWKRQEMARLP-------------------TGTLVMAI  320

Query  291  SKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQ  112
             +Q +     PQ  D+       + +            SSRWPK E+ ALI +R+ LD +
Sbjct  321  PEQQV----PPQ--DISSGGGSLESS------------SSRWPKTEVLALINLRSGLDSR  362

Query  111  HHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            + + G KGPLWE+ISA M+++GY R+AKRCKEKWENI
Sbjct  363  YQEAGPKGPLWEEISAGMQQMGYKRSAKRCKEKWENI  399


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+ +RS +D  ++++  KGPLW+E+S  M++ GY+RSAK+C+EK+ENI KY
Sbjct  343  RWPKTEVLALINLRSGLDSRYQEAGPKGPLWEEISAGMQQMGYKRSAKRCKEKWENINKY  402

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  403  FKKVKESNKKRPEDAKTCPYFHQLDAL  429



>ref|XP_009106347.1| PREDICTED: trihelix transcription factor GT-2-like [Brassica 
rapa]
Length=551

 Score =   246 bits (629),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 173/366 (47%), Positives = 232/366 (63%), Gaps = 35/366 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET+ LLKIRS+M +AFRD++ KGPLW+EVSRKM E GY R+AKKC+EKFEN+YKY
Sbjct  58   RWPRQETVALLKIRSDMGIAFRDASAKGPLWEEVSRKMGELGYIRNAKKCKEKFENVYKY  117

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA----------MQSHNKIGGaaaaeppelasps  667
            H+RTKEGR+G+  GK YRFF+QLE  +           ++ HN      +  PP   +  
Sbjct  118  HKRTKEGRTGKSEGKTYRFFDQLEALETHHQPQTQPPPLRPHNNNSSMFSTPPPVTTTII  177

Query  666  pvAMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEV  487
            P        NI  DF        + +   S+             RKRK   +FE++MK+V
Sbjct  178  PPTTTPSFPNISGDFMSDNSTSSSSSYSTSSDVDIGGGGRNKKKRKRKWKEFFERLMKQV  237

Query  486  LEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviA  307
            ++KQE+LQ++FLEA+E+ E ERMAREE+W+ QEI R+ RE+E LA+ER+++ AKDAAV+A
Sbjct  238  VDKQEELQRQFLEAVEKRERERMAREESWRAQEIARINREREILAQERSMSAAKDAAVMA  297

Query  306  FLQKISKQPILVPHKPQSEDVQEF------------------------AAQTKENGSGDT  199
            FLQK S++P            Q                           A+T +NG    
Sbjct  298  FLQKFSEKPNPQGQPQPQPQPQVNNNNNQQTSQTPQPPPPPLPQPTLDTAKT-DNGDQIM  356

Query  198  TIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCK  19
            T  +S+SSSRWPK EIEALI++RTNLD ++ +NG KGPLWE+ISA M++LG++RN+KRCK
Sbjct  357  TTPASASSSRWPKVEIEALIKLRTNLDSKYLENGPKGPLWEEISAGMRRLGFNRNSKRCK  416

Query  18   EKWENI  1
            EKWENI
Sbjct  417  EKWENI  422


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  + ++  KGPLW+E+S  M   G+ R++K+C+EK+ENI KY
Sbjct  366  RWPKVEIEALIKLRTNLDSKYLENGPKGPLWEEISAGMRRLGFNRNSKRCKEKWENINKY  425

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R Q  K   +F QL+  
Sbjct  426  FKKVKESNKKRPQDSKTCPYFHQLDAL  452



>ref|XP_001755752.1| predicted protein [Physcomitrella patens]
 gb|EDQ79425.1| predicted protein [Physcomitrella patens]
Length=476

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 155/388 (40%), Positives = 218/388 (56%), Gaps = 59/388 (15%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL L+KIRS+MD  FRDS LKGPLW++VS+K+ E GY RSAKKC+EKFEN++KY
Sbjct  54   RWPRQETLALIKIRSDMDANFRDSGLKGPLWEDVSKKLAELGYNRSAKKCKEKFENVHKY  113

Query  816  HRRTKEGRSGRQTGKNYRFFEQLE-VFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            +++TK+GR+GRQ GKNYRFF QLE ++   Q+  ++    +       +        P  
Sbjct  114  YKKTKDGRAGRQDGKNYRFFSQLEALYGGQQTSAQL---ESNVAEVAVASLLAGSTVPGI  170

Query  639  NIVQDFRM---RPHGF--------GADADVLsaststtyssggssGRKRKLAG-------  514
                D+ +   RP            ++ D     +    +   S  RKR   G       
Sbjct  171  AATDDYNISAPRPSEVSTGVTLSDSSEDDYDELGSGEADNQEKSRKRKRMEGGKSGTSKL  230

Query  513  -YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakerai  337
             YFE +MK +++KQE +Q+KFLE +ER E +R  REEAW++QEI R+ RE E  A+E A+
Sbjct  231  DYFESLMKNLMDKQESMQRKFLEFMERREQDRQVREEAWRRQEIARMAREHELRAQEHAL  290

Query  336  aeakdaaviAFLQKISKQPILVPH---------KPQSEDVQEFAAQTKENGSG-------  205
            A  +DAA++AFLQK++ Q + +P           P S D    AAQ +++          
Sbjct  291  AATRDAALVAFLQKVTGQTLQIPQFPSRPPIVTVPPSIDSVVAAAQKQQSTPTPVTPVPA  350

Query  204  --------------------DTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGP  85
                                D       +S RWPKPE+  LI++R++++ +  + G KGP
Sbjct  351  PAAPPTTASQQLVVANVDDIDKDSPIDPNSKRWPKPEVLTLIKLRSDMESRFQEAGPKGP  410

Query  84   LWEDISAEMKKLGYDRNAKRCKEKWENI  1
            LWE+IS  M  LGY+RN KRCKEKWENI
Sbjct  411  LWEEISQGMACLGYNRNQKRCKEKWENI  438


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E LTL+K+RS+M+  F+++  KGPLW+E+S+ M   GY R+ K+C+EK+ENI KY
Sbjct  382  RWPKPEVLTLIKLRSDMESRFQEAGPKGPLWEEISQGMACLGYNRNQKRCKEKWENINKY  441

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             R+TKE    R +  K   +F QLEV 
Sbjct  442  FRKTKESNKKRPENAKTCPYFHQLEVL  468



>dbj|BAK06689.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=633

 Score =   246 bits (628),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 161/353 (46%), Positives = 213/353 (60%), Gaps = 44/353 (12%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EET+ L++IRSEMD AFR++ LK P+W+EVSRK+ E GY RSAKKC+EKFEN+ KY
Sbjct  98   RWPREETVALIRIRSEMDAAFRNAALKAPVWEEVSRKLAELGYCRSAKKCKEKFENVDKY  157

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS-HNKIGGaaaaeppelaspspvAMIKPNT  640
            +RRTKEGR+GRQ GKNYRFFE+LE   A    HN                     +   T
Sbjct  158  YRRTKEGRAGRQDGKNYRFFEELEALHAAAPQHNHP-------------------MATAT  198

Query  639  NIVQDFR---MRPHGFGADADVLsaststtyssggssGRKRKLAG-----------YFEK  502
             I+ D R   M P    A    LS S+++   S   S      AG            FE 
Sbjct  199  TILPDPRPLAMAPAYPAAGLPDLSLSSNSESESDDGSDEGEDQAGGGGRSNESMMALFEG  258

Query  501  MMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakd  322
            M+K++ EKQ+  Q+ FLE +E+ E +R AREEAW++QE+ R+ RE+E  A+ERA A A+D
Sbjct  259  MIKQITEKQDATQRLFLETLEKWEADRTAREEAWRRQELTRISREREQHARERAAAAARD  318

Query  321  aaviAFLQKISKQPIL------VPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPK  160
            AA+IAFLQ++    +L            +  +Q   A ++E G  ++        SRWPK
Sbjct  319  AALIAFLQRVGGNSVLPTPMPAPHPDAPAASLQLVVAASEEGGRRESGA----GMSRWPK  374

Query  159  PEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             E+ ALIQ+R   D    D G+KGPLWEDISA M+++GY+R++KRCKEKWENI
Sbjct  375  EEVHALIQLRMEKDEHCQDMGAKGPLWEDISAGMRRIGYNRSSKRCKEKWENI  427


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++R E D   +D   KGPLW+++S  M   GY RS+K+C+EK+ENI KY
Sbjct  371  RWPKEEVHALIQLRMEKDEHCQDMGAKGPLWEDISAGMRRIGYNRSSKRCKEKWENINKY  430

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R    K   +F QL+  
Sbjct  431  FKKVKESNKRRPDDSKTCPYFHQLDAI  457



>dbj|BAK07324.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=632

 Score =   246 bits (628),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 161/353 (46%), Positives = 213/353 (60%), Gaps = 44/353 (12%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EET+ L++IRSEMD AFR++ LK P+W+EVSRK+ E GY RSAKKC+EKFEN+ KY
Sbjct  98   RWPREETVALIRIRSEMDAAFRNAALKAPVWEEVSRKLAELGYCRSAKKCKEKFENVDKY  157

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS-HNKIGGaaaaeppelaspspvAMIKPNT  640
            +RRTKEGR+GRQ GKNYRFFE+LE   A    HN                     +   T
Sbjct  158  YRRTKEGRAGRQDGKNYRFFEELEALHAAAPQHNHP-------------------MATAT  198

Query  639  NIVQDFR---MRPHGFGADADVLsaststtyssggssGRKRKLAG-----------YFEK  502
             I+ D R   M P    A    LS S+++   S   S      AG            FE 
Sbjct  199  TILPDPRPLAMAPAYPAAGLPDLSLSSNSESESDDGSDEGEDQAGGGGRSNESMMALFEG  258

Query  501  MMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakd  322
            M+K++ EKQ+  Q+ FLE +E+ E +R AREEAW++QE+ R+ RE+E  A+ERA A A+D
Sbjct  259  MIKQITEKQDATQRLFLETLEKWEADRTAREEAWRRQELTRISREREQHARERAAAAARD  318

Query  321  aaviAFLQKISKQPIL------VPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPK  160
            AA+IAFLQ++    +L            +  +Q   A ++E G  ++        SRWPK
Sbjct  319  AALIAFLQRVGGNSVLPTPMPAPHPDAPAASLQLVVAASEEGGRRESGA----GMSRWPK  374

Query  159  PEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             E+ ALIQ+R   D    D G+KGPLWEDISA M+++GY+R++KRCKEKWENI
Sbjct  375  EEVHALIQLRMEKDEHCQDMGAKGPLWEDISAGMRRIGYNRSSKRCKEKWENI  427


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++R E D   +D   KGPLW+++S  M   GY RS+K+C+EK+ENI KY
Sbjct  371  RWPKEEVHALIQLRMEKDEHCQDMGAKGPLWEDISAGMRRIGYNRSSKRCKEKWENINKY  430

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R    K   +F QL+  
Sbjct  431  FKKVKESNKRRPDDSKTCPYFHQLDAI  457



>gb|KHN09580.1| Trihelix transcription factor GT-2 [Glycine soja]
Length=449

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 167/355 (47%), Positives = 222/355 (63%), Gaps = 47/355 (13%)
 Frame = -3

Query  975  LTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKYHRRTKEG  796
            + LLKIRSEMD+AF+D+  K PLW++VSRK+ E GY RSAKKC+EKFEN+YKYHRRTKEG
Sbjct  1    MALLKIRSEMDVAFKDANPKAPLWEQVSRKLAELGYNRSAKKCKEKFENVYKYHRRTKEG  60

Query  795  RSGRQTG-KNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTNIVQDFR  619
            R G+  G K YRFFEQLE   A+  ++ +                  ++    N V    
Sbjct  61   RFGKSNGAKTYRFFEQLE---ALDGNHSLPPPTTTTDNNNNVDDDDVIL----NAV----  109

Query  618  MRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIE  439
              P    A A    A   ++ ++  S   KRKL  + E +M+EV+EKQE LQ+KF+E ++
Sbjct  110  --PCSVIAAA----AHEHSSSTTSSSGKMKRKLTRFLEGLMREVIEKQETLQRKFMEVLD  163

Query  438  RCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISKQ--PILVPH  265
            +CE +RMAREEAWKK+E+ER+K+E+E LA ER+IA AKD AV+AFL+K ++    + +  
Sbjct  164  KCEKDRMAREEAWKKEELERIKKERELLAHERSIAAAKDEAVLAFLKKFAEAEGTVQLLE  223

Query  264  KPQSE-DVQEFAAQTKENGS--GDTTIss------------------ssssSRWPKPEIE  148
            K Q + D Q+   Q   N +  GD T+ +                    SSSRWPK E+E
Sbjct  224  KIQVQNDKQKNKHQNGANANRGGDVTVVTDMDKQECGNNGVSVGNFVHMSSSRWPKDEVE  283

Query  147  ALIQIRTNLDLQHH------DNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ALI++RT  D+Q        +NGSKGPLWE+IS  MK +GYDR+AKRCKEKWENI
Sbjct  284  ALIRLRTEFDVQAQGNNNNSNNGSKGPLWEEISLAMKSIGYDRSAKRCKEKWENI  338


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 7/93 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTL------KGPLWDEVSRKMEEFGYQRSAKKCREKF  835
            RWP +E   L+++R+E D+  + +        KGPLW+E+S  M+  GY RSAK+C+EK+
Sbjct  276  RWPKDEVEALIRLRTEFDVQAQGNNNNSNNGSKGPLWEEISLAMKSIGYDRSAKRCKEKW  335

Query  834  ENIYKYHRRTKE-GRSGRQTGKNYRFFEQLEVF  739
            ENI KY +R KE  +   Q  K   ++  LE  
Sbjct  336  ENINKYFKRIKEKNKRKPQDSKTCPYYHHLEAL  368



>ref|XP_010539733.1| PREDICTED: trihelix transcription factor GT-2 [Tarenaya hassleriana]
Length=598

 Score =   238 bits (608),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 182/408 (45%), Positives = 240/408 (59%), Gaps = 77/408 (19%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD AFRD+++KGPLWDEVSRKM E GY RS+KKC+EKFEN++KY
Sbjct  52   RWPRQETLALLKIRSDMDTAFRDASVKGPLWDEVSRKMSELGYSRSSKKCKEKFENVFKY  111

Query  816  HRRTKEGRSGRQTGKNYRF---FEQLE--------------------------------V  742
            H+RTKEGR+G+  GK YRF    E LE                                V
Sbjct  112  HKRTKEGRTGKSEGKTYRFFDQLEALENQSSSMVHHHQPQTQTQMPPRHHQHNNNNNSIV  171

Query  741  FDAMQSHNKIGGaaaaeppelaspspvAMIKPNTNIV-----QDFRMRPHGFGADADVLs  577
            F A  +      A    P    +    AM  PNT +          + P   G   D LS
Sbjct  172  FSATLTQPAAANAENPPPGVALTTVTSAMPLPNTAVAFTQPPVPTSLNPTFHGGSGDFLS  231

Query  576  aststtyssg----------gssGRKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCEN  427
             ST ++ S+               RKRK   +FE++MK+V+EKQE+LQ++FLEA+E+ E 
Sbjct  232  DSTYSSSSTSTSSDVEIGGGTRKKRKRKWKDFFERLMKQVVEKQEELQRRFLEAVEKRER  291

Query  426  ERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISK-----QPILVPHK  262
            ERM REEAW+ QE+ R+ RE+E LA+ER++A AKDAAV+ FLQK+S+     Q I +P +
Sbjct  292  ERMVREEAWRMQEMARINREREILAQERSMAAAKDAAVMKFLQKLSENTNVSQSIQLPPQ  351

Query  261  PQSED---------------------VQEFAAQTKENGSGDTTIssssssSRWPKPEIEA  145
            PQ +                      V   A    +  +GD   + +SSS RWPK EIEA
Sbjct  352  PQPQQPPPQTQTQTPQPQPQPQTQLAVTARAIDMTKTDNGDQNFTPASSS-RWPKVEIEA  410

Query  144  LIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            LI++RTNLD ++ +NG KGPLWE+ISA M++LG++R++KRCKEKWENI
Sbjct  411  LIKLRTNLDSKYQENGPKGPLWEEISAGMRRLGFNRSSKRCKEKWENI  458


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M   G+ RS+K+C+EK+ENI KY
Sbjct  402  RWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMRRLGFNRSSKRCKEKWENINKY  461

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  462  FKKVKESNKKRPEDSKTCPYFHQLDAL  488



>ref|XP_001766573.1| predicted protein [Physcomitrella patens]
 gb|EDQ68638.1| predicted protein [Physcomitrella patens]
Length=567

 Score =   236 bits (603),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 151/388 (39%), Positives = 219/388 (56%), Gaps = 61/388 (16%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL L+KIRS+MD  FRDS LKGPLW++VS+K+ E GY RSAKKC+EKFEN++KY
Sbjct  54   RWPRQETLALIKIRSDMDANFRDSGLKGPLWEDVSKKLAELGYSRSAKKCKEKFENVHKY  113

Query  816  HRRTKEGRSGRQTGKNYRFFEQLE-VFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            +++TK+GR+GRQ GK+YRFF QLE ++   Q+  ++    +      A+        P  
Sbjct  114  YKKTKDGRAGRQDGKSYRFFSQLEALYGGQQTSAQL---ESNAAVVAAANLLTGSAIPGK  170

Query  639  NIVQDFRM---RPHGFGADADVLsast---------sttyssggssGRKRKLAG------  514
             + +D+ +   RP        +  +S                  S  RKR   G      
Sbjct  171  VVNEDYNVSTQRPSEVSTGVTLSESSEDDYDEPGGGEADNQEKSSKKRKRMEGGKSGTSK  230

Query  513  --YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakera  340
              +FE +MK +++KQE +Q+KFLE +ER E +R   EEAW++QE+ RL RE E  A+E+A
Sbjct  231  LDFFESLMKNLMDKQESMQRKFLEFMERREQDRQVWEEAWRRQEMTRLAREHELRAQEQA  290

Query  339  iaeakdaaviAFLQKISKQ-----------PIL------------------------VPH  265
            +A  +DAA++AFLQK++ Q           P++                         P 
Sbjct  291  LAATRDAALVAFLQKVTGQTLQLPQFPTRPPVVAVPPSIDSVVAAQKHQPTPPPTTSAPA  350

Query  264  KPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGP  85
             P +   Q+      ++   D+ I    +S RWPKPE+  LI++R++++ +  + G KGP
Sbjct  351  VPPTTTSQQLVVSNVDDHDKDSPI--DPNSKRWPKPEVLTLIKLRSDMETRFQEAGPKGP  408

Query  84   LWEDISAEMKKLGYDRNAKRCKEKWENI  1
            LWE+IS  M  LGY+RN KRCKEKWENI
Sbjct  409  LWEEISQGMACLGYNRNQKRCKEKWENI  436


 Score = 92.0 bits (227),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E LTL+K+RS+M+  F+++  KGPLW+E+S+ M   GY R+ K+C+EK+ENI KY
Sbjct  380  RWPKPEVLTLIKLRSDMETRFQEAGPKGPLWEEISQGMACLGYNRNQKRCKEKWENINKY  439

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             R+TKE    R +  K   +F QLEV 
Sbjct  440  FRKTKESNKKRPENAKTCPYFHQLEVL  466



>ref|XP_010474373.1| PREDICTED: trihelix transcription factor GTL1 [Camelina sativa]
Length=570

 Score =   233 bits (595),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 165/393 (42%), Positives = 229/393 (58%), Gaps = 80/393 (20%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+M +AFRD+++KGPLW+EVSRKM E GY R+AKKC+EKFEN+YKY
Sbjct  67   RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMGELGYIRNAKKCKEKFENVYKY  126

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAM---------------QSHNKIGGaaaaeppe  682
            H+RTKEGR+G+  GK YRFF+QLE  +                 Q++N I          
Sbjct  127  HKRTKEGRTGKSDGKTYRFFDQLEALETHHHHHHQPLRPHQHQHQNNNSIFSTPPPITTV  186

Query  681  laspspvAMIKPNT---NIVQDFRMRPHGFGAD-------------ADVLsaststtyss  550
            +    P   I P T   N+   F   P  F +D             +D+      TT ++
Sbjct  187  MPPSVPSTSIPPYTQQLNVPSSF---PTDFLSDNSTSSSSSSYSTSSDMDIGGGGTTTTT  243

Query  549  ggssGRKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKR  370
                 RKRK   +FE++MK+V++KQEDLQ+KFLEA+E+ E+ER+ RE++W+ QEI R+ R
Sbjct  244  TNRKKRKRKWKEFFERLMKQVVDKQEDLQRKFLEAVEKREHERLVREDSWRVQEIARINR  303

Query  369  EQESLakeraiaeakdaaviAFLQKIS-KQPILVPHKPQS--------------------  253
            +QE LA+ER+++ AKDAAV+AFLQK+S KQP   P                         
Sbjct  304  DQEILAQERSMSAAKDAAVMAFLQKLSEKQPNQPPTTTVQPQQQVRPPQMQLLNNNNNQQ  363

Query  252  -----------------EDVQEFAAQTKENGSGDTTIss--------ssssSRWPKPEIE  148
                             + V   +++T++  +GD ++ +        S+SSSRWPK EIE
Sbjct  364  QTPQPSPPAPPPLLQPIQAVLPSSSETRKTDNGDQSMMTPASASASGSASSSRWPKVEIE  423

Query  147  ALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKL  49
            ALI++RTNLD ++ +NG KGPLWE+ISA M+  
Sbjct  424  ALIKLRTNLDSKYQENGPKGPLWEEISAGMRSF  456


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++ +   D   KGPLWE++S +M +LGY RNAK+CKEK+EN+
Sbjct  67   RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMGELGYIRNAKKCKEKFENV  123



>ref|NP_001146214.1| uncharacterized protein LOC100279784 [Zea mays]
 ref|XP_008643480.1| PREDICTED: uncharacterized protein LOC100279784 isoform X1 [Zea 
mays]
 ref|XP_008643481.1| PREDICTED: uncharacterized protein LOC100279784 isoform X1 [Zea 
mays]
 gb|ACL53479.1| unknown [Zea mays]
 gb|ACN34664.1| unknown [Zea mays]
 gb|AFW72561.1| putative homeodomain-like transcription factor superfamily protein 
[Zea mays]
 gb|AIB04871.1| trihelix transcription factor, partial [Zea mays]
Length=672

 Score =   232 bits (592),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 157/383 (41%), Positives = 213/383 (56%), Gaps = 64/383 (17%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EETL L++IR+EMD  FR++ LK PLW++V+RK+   GY RSAKKC+EKFEN++KY
Sbjct  100  RWPREETLALIRIRTEMDADFRNAPLKAPLWEDVARKLAGLGYHRSAKKCKEKFENVHKY  159

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            ++RTK+  +GRQ GK+YRFF QLE   A     +             S        P+  
Sbjct  160  YKRTKDAHAGRQDGKSYRFFSQLEALHAAAPQPQ-----------PPSGMTTVQAGPHHP  208

Query  636  IVQDFRMRPHGFGADA-----DVLsaststtyssggssGRKRKLAG--------------  514
            +   +   P   G  A     D+  +S S + S   S       AG              
Sbjct  209  MALAWTAGPTALGPAAGAGLPDLSFSSMSGSESEYDSDDDDDDDAGEEGLGRGEYHREMM  268

Query  513  -YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakerai  337
              FE MMK+V +KQ+ +Q+ FLE +ER E ER AREEAW++QE+ R+ RE+E LA+ERA 
Sbjct  269  AIFEGMMKQVTDKQDAMQRVFLETLERWEAERTAREEAWRRQEVARMNRERERLARERAA  328

Query  336  aeakdaaviAFLQKIS---KQPILVPHKPQSEDVQEFAAQTKEN--------GSGDTTIs  190
            A ++DAA+IAFLQ +     QP+ +P  P S       A  K +         +  T++ 
Sbjct  329  AASRDAALIAFLQCVGGGQGQPVRLP--PHSAGASVVPAPPKPDCAPPSPRLDAAATSLQ  386

Query  189  sssssS--------------------RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDI  70
                +                     RWPK E+EALIQ+R   D Q+HD G KGPLWEDI
Sbjct  387  QLVPAQLKAVEALAWAGGEGGGSTSSRWPKEEVEALIQVRNEKDEQYHDAGGKGPLWEDI  446

Query  69   SAEMKKLGYDRNAKRCKEKWENI  1
            +A M+++GY+R+AKRCKEKWENI
Sbjct  447  AAGMRRIGYNRSAKRCKEKWENI  469


 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++R+E D  + D+  KGPLW++++  M   GY RSAK+C+EK+ENI KY
Sbjct  413  RWPKEEVEALIQVRNEKDEQYHDAGGKGPLWEDIAAGMRRIGYNRSAKRCKEKWENINKY  472

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
            +++ KE    R +  K   +F QL+  
Sbjct  473  YKKVKESNKRRPEDSKTCPYFHQLDAM  499



>ref|XP_008810373.1| PREDICTED: trihelix transcription factor GTL1-like isoform X2 
[Phoenix dactylifera]
Length=606

 Score =   230 bits (586),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 149/361 (41%), Positives = 215/361 (60%), Gaps = 36/361 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RW  +ETL LLKIRSEMD  F+D TLKGPLW+ VSRK+ E GY RSAKKC+EKFENI KY
Sbjct  94   RWTQQETLGLLKIRSEMDAGFQDVTLKGPLWEVVSRKLSELGYNRSAKKCKEKFENIQKY  153

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            H+R KEGR+GRQ GK+Y F  QLE    + + +      +   P +A      +  P T 
Sbjct  154  HKRAKEGRAGRQHGKSYCFSGQLEALHDITATST----TSTIDPVVAPTDINTVSNPATA  209

Query  636  IVQ-DFRMRPHGFGADADVLsaststtyssggssGRKRK----LAGYFEKMMKEVLEKQE  472
            I      +    F + +D      ++         +  K    +  +FE++M++V+E+Q+
Sbjct  210  IANTSLSLSNTTFSSGSDDSKVEGASRKGQKRKREKGSKTSKTMMTFFEELMRQVVERQD  269

Query  471  DLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKI  292
             ++++FLEA+E  E +RM RE+AW++QE+ RL RE+E +A+ERA   +++ A+I FL+KI
Sbjct  270  AMEQQFLEALENRERDRMVREQAWRRQEMVRLTREKELMAQERASIASREQAIITFLRKI  329

Query  291  SKQPILVPHKPQ------------------------SEDVQEFAAQTKENGSGDTTIsss  184
            S Q + +P                            +E +    A  +E  +G+TT+   
Sbjct  330  SGQEVPIPPLSTTTTTTTTPQPSSPQQQQQKQSSNDTELIIIPIAGHQEMLTGNTTM--E  387

Query  183  sssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWEN  4
              SSRWPK E+ ALI++RTNL+   +  G KGPLWE I+  M++LGY+R+AK+CKEKWEN
Sbjct  388  LMSSRWPKMEVHALIKLRTNLE-PFYQEGLKGPLWEQIAMGMRRLGYNRSAKKCKEKWEN  446

Query  3    I  1
            I
Sbjct  447  I  447


 Score = 80.9 bits (198),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ ++  F    LKGPLW++++  M   GY RSAKKC+EK+ENI KY
Sbjct  392  RWPKMEVHALIKLRTNLE-PFYQEGLKGPLWEQIAMGMRRLGYNRSAKKCKEKWENINKY  450

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             +R KE    R Q  +   +F QL+ F
Sbjct  451  FKRVKESNKNRPQNSRTCPYFHQLDAF  477



>ref|XP_008810371.1| PREDICTED: trihelix transcription factor GTL1-like isoform X1 
[Phoenix dactylifera]
Length=608

 Score =   230 bits (586),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 149/361 (41%), Positives = 215/361 (60%), Gaps = 36/361 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RW  +ETL LLKIRSEMD  F+D TLKGPLW+ VSRK+ E GY RSAKKC+EKFENI KY
Sbjct  94   RWTQQETLGLLKIRSEMDAGFQDVTLKGPLWEVVSRKLSELGYNRSAKKCKEKFENIQKY  153

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            H+R KEGR+GRQ GK+Y F  QLE    + + +      +   P +A      +  P T 
Sbjct  154  HKRAKEGRAGRQHGKSYCFSGQLEALHDITATST----TSTIDPVVAPTDINTVSNPATA  209

Query  636  IVQ-DFRMRPHGFGADADVLsaststtyssggssGRKRK----LAGYFEKMMKEVLEKQE  472
            I      +    F + +D      ++         +  K    +  +FE++M++V+E+Q+
Sbjct  210  IANTSLSLSNTTFSSGSDDSKVEGASRKGQKRKREKGSKTSKTMMTFFEELMRQVVERQD  269

Query  471  DLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKI  292
             ++++FLEA+E  E +RM RE+AW++QE+ RL RE+E +A+ERA   +++ A+I FL+KI
Sbjct  270  AMEQQFLEALENRERDRMVREQAWRRQEMVRLTREKELMAQERASIASREQAIITFLRKI  329

Query  291  SKQPILVPHKPQ------------------------SEDVQEFAAQTKENGSGDTTIsss  184
            S Q + +P                            +E +    A  +E  +G+TT+   
Sbjct  330  SGQEVPIPPLSTTTTTTTTPQPSSPQQQQQKQSSNDTELIIIPIAGHQEMLTGNTTM--E  387

Query  183  sssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWEN  4
              SSRWPK E+ ALI++RTNL+   +  G KGPLWE I+  M++LGY+R+AK+CKEKWEN
Sbjct  388  LMSSRWPKMEVHALIKLRTNLE-PFYQEGLKGPLWEQIAMGMRRLGYNRSAKKCKEKWEN  446

Query  3    I  1
            I
Sbjct  447  I  447


 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ ++  F    LKGPLW++++  M   GY RSAKKC+EK+ENI KY
Sbjct  392  RWPKMEVHALIKLRTNLE-PFYQEGLKGPLWEQIAMGMRRLGYNRSAKKCKEKWENINKY  450

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             +R KE    R Q  +   +F QL+ F
Sbjct  451  FKRVKESNKNRPQNSRTCPYFHQLDAF  477



>emb|CDX93785.1| BnaA09g23850D [Brassica napus]
Length=589

 Score =   229 bits (584),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 150/359 (42%), Positives = 208/359 (58%), Gaps = 27/359 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EETL LL+IRSEMD  FRD+TLK PLW+ VSRK+ E GY+RSAKKC+EKFEN+ KY
Sbjct  53   RWPREETLALLRIRSEMDSTFRDATLKAPLWEHVSRKLLELGYKRSAKKCKEKFENVQKY  112

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelas--------pspv  661
            ++RTKE R GR  GK Y+FF QLE  +     + +     +  P   S        P P+
Sbjct  113  YKRTKETRGGRHDGKAYKFFSQLEALNTTPPSSSLDATPLSTQPHTVSFTPNVPPPPPPM  172

Query  660  AMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKR---KLAGYFEKMMKE  490
                P             G G+D + +        SS       R   K+   F+ ++++
Sbjct  173  GPTFPGATFSSHSSSTASGMGSDDEDIMDVDQAGPSSRKRKRGNRGGGKMMELFDGLVRQ  232

Query  489  VLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaavi  310
            V++KQ  +Q+ FLEA+E+ E ER+ REEAWK+QE+ RL RE E +++ERA + ++DAA+I
Sbjct  233  VMQKQAAMQRSFLEALEKREQERLHREEAWKRQEMSRLAREHEIMSQERAASASRDAAII  292

Query  309  AFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIsssss----------------  178
            + +QKI+   I +P    S+         K   S    +    +                
Sbjct  293  SLIQKITGHTIQLPPSFSSQPSPPPPPAAKRPSSQPPQLQPIMAIPQQQVIMSSDQSSPS  352

Query  177  sSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            SSRWPK EI ALI +R+ ++ ++ DN  KG LWE+IS+ MK++GY+RNAKRCKEKWENI
Sbjct  353  SSRWPKAEILALINLRSGMEPRYQDNVPKGLLWEEISSSMKRMGYNRNAKRCKEKWENI  411


 Score = 80.5 bits (197),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+ +RS M+  ++D+  KG LW+E+S  M+  GY R+AK+C+EK+ENI KY
Sbjct  355  RWPKAEILALINLRSGMEPRYQDNVPKGLLWEEISSSMKRMGYNRNAKRCKEKWENINKY  414

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
            +++ KE    R Q  K   +F +L++ 
Sbjct  415  YKKVKESNKERPQDAKTCPYFHRLDLL  441



>emb|CDY71745.1| BnaAnng38690D, partial [Brassica napus]
Length=572

 Score =   226 bits (577),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 204/359 (57%), Gaps = 33/359 (9%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EETL LL+IRSEMD  FRD+TLK PLW+ VSRK+ E GY+R+AKKC+EKFEN+ KY
Sbjct  51   RWPREETLALLRIRSEMDSTFRDATLKAPLWEHVSRKLLELGYKRNAKKCKEKFENVQKY  110

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            H+RTKE R GR  GK Y+FF QLE        N       +            + +P++ 
Sbjct  111  HKRTKETRGGRHEGKTYKFFSQLEAL------NTSAPLPPSSLDVTPLSVANPVQQPSSQ  164

Query  636  I-VQDFRMRP------HGFGADADVLsaststtyssggssGRKR------KLAGYFEKMM  496
              V      P       G G+D D           +G SS +++      K+   F+ ++
Sbjct  165  FPVFSLTQTPPPSSTASGMGSDDDDDDDDDMDVDQAGPSSHKRKRENRGGKMMELFQGLV  224

Query  495  KEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaa  316
            ++V++KQ  +Q+ FLEA+E+ E ER+AREEAWK+QE+ RL RE E + +ERA + ++DAA
Sbjct  225  RQVMQKQAAMQRSFLEALEKREQERLAREEAWKRQEMSRLAREHEIMTQERAASASRDAA  284

Query  315  viAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssS------------  172
            +I+ +QKI+   I +P    S          K                            
Sbjct  285  IISLIQKITGHTIQLPPSLSSSQPSPPPPPAKLLPPPPHQPPPQQQQQEMIMSSDQSLPS  344

Query  171  --RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
              RWPK EI ALI +R+ ++ ++ DN  KG LWE+IS+ MK++GY+RNAKRCKEKWENI
Sbjct  345  SSRWPKEEILALINLRSGMEPRYQDNVPKGLLWEEISSSMKRMGYNRNAKRCKEKWENI  403


 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE L L+ +RS M+  ++D+  KG LW+E+S  M+  GY R+AK+C+EK+ENI KY
Sbjct  347  RWPKEEILALINLRSGMEPRYQDNVPKGLLWEEISSSMKRMGYNRNAKRCKEKWENINKY  406

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
            +++ KE    R Q  K   ++ +L++ 
Sbjct  407  YKKVKESNKKRPQDAKTCPYYHRLDLL  433


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -3

Query  252  EDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWED  73
            E++  F+A   + G      SSSSS +RWP+ E  AL++IR+ +D    D   K PLWE 
Sbjct  24   EELMRFSAAADDGGGLGGGSSSSSSGNRWPREETLALLRIRSEMDSTFRDATLKAPLWEH  83

Query  72   ISAEMKKLGYDRNAKRCKEKWENI  1
            +S ++ +LGY RNAK+CKEK+EN+
Sbjct  84   VSRKLLELGYKRNAKKCKEKFENV  107



>ref|XP_010252772.1| PREDICTED: trihelix transcription factor GTL1-like [Nelumbo nucifera]
Length=615

 Score =   206 bits (523),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 133/344 (39%), Positives = 193/344 (56%), Gaps = 24/344 (7%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LLKIRSEMD  FR++  KGPLW+ VSRK+E  GY R+ KKC+EKFENIYKY
Sbjct  223  RWPQAETLALLKIRSEMDAEFRNAKPKGPLWEIVSRKLEGLGYHRNPKKCKEKFENIYKY  282

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            ++RTK+ ++G    K Y+F  +LE       +NK   +           SP  +  P  N
Sbjct  283  YKRTKQRQAGGHGDKTYKFVGELEAL--FNQNNKNPSSETLSLDVTRIQSPEPVQNPRQN  340

Query  636  IVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAG------------YFEKMMK  493
            I  D    P  F +D    S+S+        S      + G            + + +MK
Sbjct  341  ISSD--TNPVDFLSDFISSSSSSDDDDDDSMSEDITESMNGKRKRKTRKKLDLFLDNLMK  398

Query  492  EVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaav  313
            +V++KQE++ +  +E +E+ E +RM REE WKKQE+ER+K+++E     RA   ++  A+
Sbjct  399  KVIKKQEEMHRHLIETLEKRERDRMIREEEWKKQEMERIKKDKE----MRAQETSRSLAL  454

Query  312  iAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQI  133
            ++F+QK+  Q   VP  P+      +  + ++     T  S   S+ RWPK E++ALI +
Sbjct  455  LSFIQKVLGQQFYVPQSPE----LSYLGEEQDEKHDKTDYSFDPSNRRWPKAEVQALITL  510

Query  132  RTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            R ++D +      K PLWE+IS  M  +GY R AK+CKEKWENI
Sbjct  511  RISMDHKFRTTVPKVPLWEEISLAMSAMGYSRTAKKCKEKWENI  554


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R  MD  FR +  K PLW+E+S  M   GY R+AKKC+EK+ENI KY
Sbjct  498  RWPKAEVQALITLRISMDHKFRTTVPKVPLWEEISLAMSAMGYSRTAKKCKEKWENINKY  557

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             +R+ E R  R +  K   +F +L + 
Sbjct  558  FKRSIENRKTRPENAKTCPYFHELAIL  584



>ref|XP_002277307.2| PREDICTED: trihelix transcription factor PTL [Vitis vinifera]
 emb|CBI30254.3| unnamed protein product [Vitis vinifera]
Length=561

 Score =   204 bits (518),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 141/356 (40%), Positives = 206/356 (58%), Gaps = 28/356 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  115  RWPRQETLTLLEIRSRLDSKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  174

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH------NKIGGaaaaeppelaspspvA  658
            Y+++TKEG++GRQ GK+YRFF QLE      S+      N + G          + + + 
Sbjct  175  YYKKTKEGKAGRQDGKHYRFFRQLEALYGDTSNAVSVPENHLAG----SSLTFHTATNLN  230

Query  657  MIKPNTNIVQDFRMRPH-----------GFGADADVLsaststtyssggssGRKRK----  523
            +   N  I Q  ++                  D D  +   +   S+   + R R+    
Sbjct  231  IATQNQEIFQTPKLCDSLSLSNSSDFDTSSSEDDDHNNTGPTENGSTDKKNRRSRRSWKV  290

Query  522  -LAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLake  346
             +  + +  M++++EKQE   +K L+A+E  E ER+ REE W+KQE  RL RE +  A +
Sbjct  291  KIKDFIDSQMRKLMEKQEAWLEKMLKALEHKEQERILREEEWRKQEAARLDREHKFWATQ  350

Query  345  raiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRW  166
            RA  EA+DAA++  LQK++ + + VP   +    Q      ++N +G  T+S+S     W
Sbjct  351  RAWIEARDAALMDTLQKLTGRELKVPSPEELMATQHRNPGERQNENGSETVSNSVKGDSW  410

Query  165  PKPEIEALIQIRTNLDLQHHDNG-SKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            P+ EI  L+Q+RTN++ +    G S+  LWEDI+ +M  LGYDR+A  CK+KW +I
Sbjct  411  PESEITRLMQLRTNMESRFQQAGSSEEVLWEDIAGKMACLGYDRSAIMCKDKWNSI  466



>emb|CDY62151.1| BnaCnng39380D [Brassica napus]
Length=545

 Score =   203 bits (516),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 143/356 (40%), Positives = 197/356 (55%), Gaps = 40/356 (11%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EETL LL+IRSEMD  FRD+TLK PLW+ VSRK+ E GY+R+AKKC+EKFEN+ KY
Sbjct  57   RWPREETLALLRIRSEMDSTFRDATLKAPLWEHVSRKLLELGYKRNAKKCKEKFENVQKY  116

Query  816  HRRTKE---GRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKP  646
            H+RTKE   GR   +T K +   E L         + +     +    +  PS  +   P
Sbjct  117  HKRTKETRGGRHEGKTYKFFSQLEALNTSTTPAPPSSLDVTPLSVANPVQQPSSSSSQFP  176

Query  645  NTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKR--------KLAGYFEKMMKE  490
              ++ Q         G  +                  RKR        K+   FE ++++
Sbjct  177  VFSLTQTPPPSSTASGMGSH----------------KRKRENRGTGGGKMMELFEGLVRQ  220

Query  489  VLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaavi  310
            V++KQ  +Q+ FLEA+E+ E ER+AREEAWK+QE+ RL RE E +A+ERA + ++DAA+I
Sbjct  221  VMQKQAAMQRSFLEALEKREQERLAREEAWKRQEMSRLAREHEIMAQERAASASRDAAII  280

Query  309  AFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssS-------------R  169
            + +QKI+   I +PH   S+      A                                R
Sbjct  281  SLIQKITGHTIQLPHSLSSQPSPPPPAAKLLPPPPPHQPQQQQQQEMIMSSDQSLPSSSR  340

Query  168  WPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            WPK EI ALI +R+ ++ ++ DN  KG LWE+IS  MK++GY+RNAKRCKEKWENI
Sbjct  341  WPKEEILALINLRSGMEPRYQDNVPKGLLWEEISTSMKRMGYNRNAKRCKEKWENI  396


 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE L L+ +RS M+  ++D+  KG LW+E+S  M+  GY R+AK+C+EK+ENI KY
Sbjct  340  RWPKEEILALINLRSGMEPRYQDNVPKGLLWEEISTSMKRMGYNRNAKRCKEKWENINKY  399

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
            +++ KE    R Q  K   ++ +L++ 
Sbjct  400  YKKVKESNKKRPQDAKTCPYYHRLDLL  426



>emb|CAN71904.1| hypothetical protein VITISV_035582 [Vitis vinifera]
Length=636

 Score =   203 bits (517),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 141/356 (40%), Positives = 205/356 (58%), Gaps = 28/356 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  113  RWPRQETLTLLEIRSRLDSKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  172

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH------NKIGGaaaaeppelaspspvA  658
            Y+++TKEG++GRQ GK+YRFF QLE      S+      N + G          + + + 
Sbjct  173  YYKKTKEGKAGRQDGKHYRFFRQLEALYGDTSNAVSVPENHLAG----SSLTFHTATNLN  228

Query  657  MIKPNTNIVQDFRMRPH-----------GFGADADVLsaststtyssggssGRKRK----  523
            +   N  I Q  ++                  D D  +   +   S+   + R R+    
Sbjct  229  IATQNQEIFQTPKLCDSLSLSNSSDFDTSSSEDDDHNNTGPTENGSTDKKNRRSRRSWKV  288

Query  522  -LAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLake  346
             +  + +  M++++EKQE   +K L+A+E  E ER+ REE W+KQE  RL RE +  A +
Sbjct  289  KIKDFIDSQMRKLMEKQEAWLEKMLKALEHKEQERILREEEWRKQEAARLDREHKFWATQ  348

Query  345  raiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRW  166
            RA  EA+DAA++  LQK++ + + VP   +    Q      ++N +G  T+S+S     W
Sbjct  349  RAWIEARDAALMDTLQKLTGRELKVPSPEELMATQHRNPGERQNENGSETVSNSVKGDSW  408

Query  165  PKPEIEALIQIRTNLDLQHHDNGSK-GPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            P+ EI  L+Q+RTN++ +    GS    LWEDI+ +M  LGYDR+A  CK+KW +I
Sbjct  409  PESEITRLMQLRTNMESRFQQAGSSEEVLWEDIAGKMACLGYDRSAIMCKDKWNSI  464



>ref|XP_010243939.1| PREDICTED: trihelix transcription factor GTL1 [Nelumbo nucifera]
Length=526

 Score =   200 bits (509),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 128/342 (37%), Positives = 194/342 (57%), Gaps = 25/342 (7%)
 Frame = -3

Query  993  WPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKYH  814
            W  E+TL LLKIRSEMD  FRD+   GPLW+ VSRK+E  GY ++ K C+EKF+NIYK +
Sbjct  138  WSQEDTLALLKIRSEMDAEFRDTNPSGPLWEIVSRKLEGLGYHKNPKNCKEKFKNIYKSY  197

Query  813  RRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGa----aaaeppelaspspvAMIKP  646
            +R+K+ +   Q  K Y+F ++LE   +  ++N          A         +   +I  
Sbjct  198  KRSKQKQVSNQGDKMYKFVDELEALCSQNNNNPTAETLKLDDARIQTPDPVQNSHQIINV  257

Query  645  NTNIV---QDFRMRPHGFGADADVLsaststtyssggssGRKRK----LAGYFEKMMKEV  487
             TN +    DF        +D D    S S       +  RKRK    L  +FE +M +V
Sbjct  258  GTNSIDFWSDFS------SSDEDNNDDSMSEDIIEPMNWKRKRKTRMKLEVFFENLMHKV  311

Query  486  LEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviA  307
            ++KQE++ ++ +E IE+ E +R+ REE WK+QE+ER+KR++E     RA   ++  A+I+
Sbjct  312  IKKQEEMHRQLMEIIEKRERDRIIREEEWKQQEMERVKRDKE----MRAQEASRSLAIIS  367

Query  306  FLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRT  127
            F++K   Q   +P  P+      +  + ++     T  S   ++ RWPK E++ALI +RT
Sbjct  368  FIEKAMGQQFYIPPSPE----YLYPGEEQDEKHDKTDHSFDPNNRRWPKSEVQALITLRT  423

Query  126  NLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ++D Q    G K P+WE+IS  M  +GY R+AK+CKEKWENI
Sbjct  424  SMDRQFRSTGPKVPMWEEISLAMSSMGYSRSAKKCKEKWENI  465


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ MD  FR +  K P+W+E+S  M   GY RSAKKC+EK+ENI KY
Sbjct  409  RWPKSEVQALITLRTSMDRQFRSTGPKVPMWEEISLAMSSMGYSRSAKKCKEKWENINKY  468

Query  816  HRRTKE-GRSGRQTGKNYRFFEQLEVF  739
             +R+ E G+   +  K   +F +L + 
Sbjct  469  FKRSIESGKKRPENAKTCPYFHELAIL  495



>ref|XP_010236837.1| PREDICTED: LOW QUALITY PROTEIN: trihelix transcription factor 
GT-2-like, partial [Brachypodium distachyon]
Length=544

 Score =   200 bits (508),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 143/362 (40%), Positives = 206/362 (57%), Gaps = 40/362 (11%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWPH+ETL L++IRSEMD  FR++ LK P+W+EVSRK+ + GY+RSAKKC+EKFEN+ KY
Sbjct  148  RWPHDETLALIEIRSEMDSVFRNAGLKAPVWEEVSRKLAQRGYRRSAKKCKEKFENVDKY  207

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            ++R+KE R+GR   K+YR+F QLE   A          AA      A+  P+AM  P   
Sbjct  208  YKRSKEDRAGRPDNKSYRYFAQLEALHAADPPQH---QAAPMAMAAAAARPLAMAHPGAG  264

Query  636  IVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQKK  457
            ++    +  HGF ++ +  S + S     GG     + L    ++++K+V ++Q+ +Q+ 
Sbjct  265  LL----LPDHGFWSNTEPDSDNESDDEEEGGGGISYKMLTVLVKRLIKQVTKRQDAMQQL  320

Query  456  FLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKI-----  292
             L+ +ER E ER  RE+AW+  E+ R+K E E LA+ERA    +DAA+I  LQ+I     
Sbjct  321  LLDKLERWEAERTKREQAWRAHELTRIKCEWEQLAQERATGATRDAALIMLLQRIITSGN  380

Query  291  ----------------SKQPIL-----VPHKPQS--EDVQEFAA--QTKENGSGDTTIss  187
                             K P++     + H  ++    +Q   A     E+  GD     
Sbjct  381  SVSLPPSFSSLAAANKQKAPVIQNTSQIHHHIEALIASMQSVVASRSVGESSEGDNN---  437

Query  186  ssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWE  7
             S   RWPK E++ALIQ+R   D    D G K  LW+DISA M+ +GY R++KRCKEKWE
Sbjct  438  GSGMPRWPKEEVDALIQLRMEKDELWQDLGGKALLWDDISAAMRNMGYHRSSKRCKEKWE  497

Query  6    NI  1
            NI
Sbjct  498  NI  499


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++R E D  ++D   K  LWD++S  M   GY RS+K+C+EK+ENI KY
Sbjct  443  RWPKEEVDALIQLRMEKDELWQDLGGKALLWDDISAAMRNMGYHRSSKRCKEKWENINKY  502

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLE  745
             ++ KE +  R    K   +F QLE
Sbjct  503  FKKVKESKKRRPXDAKTCPYFHQLE  527



>ref|XP_006838982.1| hypothetical protein AMTR_s00002p00271480 [Amborella trichopoda]
 gb|ERN01551.1| hypothetical protein AMTR_s00002p00271480 [Amborella trichopoda]
Length=636

 Score =   200 bits (509),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 139/367 (38%), Positives = 208/367 (57%), Gaps = 44/367 (12%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EETL LLKIRS ++    DS +KGP+W+ VSRK+ E G+ RSAKKC+EKFEN+ KY
Sbjct  101  RWPREETLALLKIRSSIEAGMGDSNVKGPIWEHVSRKLAELGFNRSAKKCKEKFENVSKY  160

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            +++T++  + RQ G++YRFF +    +A+ +    GG    +P E  S     + K  TN
Sbjct  161  YKKTRDSANTRQDGRSYRFFNE---LEALYN----GGNNQFKPVETLSQQKTTVQK--TN  211

Query  636  IVQDFRMRPHGF--GADADVLsaststtyssggssGRKRK---------LAGYFEKMMKE  490
               +  +  H     ++ + L    +    S     RK++         + G+ E M+++
Sbjct  212  GEPNVCLNSHSSEGTSEEETLENPETHANPSASDQNRKKRKRKRSSLELMKGFCESMVEQ  271

Query  489  VLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaavi  310
            ++  QE+LQ + LEA+E+ + ER+ARE  WK QE+ RL RE E  A+E A+A  ++AA+I
Sbjct  272  LMHHQEELQNRLLEAVEKRDQERIAREGEWKMQEMARLNRETEIRAQEHALASDREAAII  331

Query  309  AFLQKIS------KQPILVP-----HKPQSEDVQEFAAQTKENGSGDTTIssssss----  175
             FL+K +      + P   P       P S +     A   EN S +    +   S    
Sbjct  332  EFLKKFTENSAENQSPTQAPDPKPEEAPSSANPTNSLALPPENHSPNPNPITEEKSDQSG  391

Query  174  ---------SRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRC  22
                      RWP+ E+  LI++R+NLD + +++GSKG LWE+IS  M +LGY+R+AKRC
Sbjct  392  VVNNGGFHLKRWPRSEVICLIRLRSNLDQRFNESGSKGSLWENISKGMAQLGYNRSAKRC  451

Query  21   KEKWENI  1
            KEKWENI
Sbjct  452  KEKWENI  458


 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E + L+++RS +D  F +S  KG LW+ +S+ M + GY RSAK+C+EK+ENI KY
Sbjct  402  RWPRSEVICLIRLRSNLDQRFNESGSKGSLWENISKGMAQLGYNRSAKRCKEKWENINKY  461

Query  816  HRRTKEGRSGR  784
             R+TK+    R
Sbjct  462  FRKTKDATKSR  472



>ref|XP_009389116.1| PREDICTED: trihelix transcription factor GTL1-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=642

 Score =   200 bits (509),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 125/280 (45%), Positives = 179/280 (64%), Gaps = 32/280 (11%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD AFRD+TLKGPLW+EVSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  91   RWPRQETLALLQIRSDMDSAFRDATLKGPLWEEVSRKLAELGYKRSAKKCKEKFENVHKY  150

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF-----DAMQSHNKIGGaaaaeppelaspspvAMI  652
            ++RTK+GR+GRQ GK+YRFF QLE               + G  A+    +++ +P  + 
Sbjct  151  YKRTKDGRAGRQDGKSYRFFSQLEALHGGSSGGGGGATGMAGPPASRAQPISAVAPSTLT  210

Query  651  KPNTNIVQDFR--MRPHGFGADADV--------------LsaststtyssggssGRKRKL  520
             P   +V +    + PHG  + A V               S    T  +     GRKRK 
Sbjct  211  VPTRAVVPEPTPPLGPHGISSSAAVGISFSSNSSSSASSESDDEETEEAGESQEGRKRKR  270

Query  519  AG-----------YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLK  373
             G           +F+++MK+V+E+QE +Q++FL+AIE+ E +RM R+EAW++QE+ RL 
Sbjct  271  GGGDSGSSRKMMAFFDRLMKQVMERQEAMQQRFLDAIEKREQDRMIRDEAWRRQEMTRLN  330

Query  372  REQESLakeraiaeakdaaviAFLQKISKQPILVPHKPQS  253
            REQE LA+ERA+A ++D A+I++LQK+S Q I +P  P +
Sbjct  331  REQELLAQERAMAASRDTAIISYLQKLSGQTIPMPTMPAT  370


 Score = 92.8 bits (229),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = -3

Query  258  QSEDVQEFAAQTKENGSGD-TTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPL  82
            QS    E    T+   + D   +   SSSSRWPK E+ ALI +R+ LD ++H+ G KGPL
Sbjct  429  QSSSGTELVLNTEPQDAEDGVNLEPMSSSSRWPKTEVHALINLRSGLDSKYHEAGPKGPL  488

Query  81   WEDISAEMKKLGYDRNAKRCKEKWENI  1
            WE+ISA M++LGY+R+AKRCKEKWENI
Sbjct  489  WEEISAGMQRLGYNRSAKRCKEKWENI  515


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +RS +D  + ++  KGPLW+E+S  M+  GY RSAK+C+EK+ENI KY
Sbjct  459  RWPKTEVHALINLRSGLDSKYHEAGPKGPLWEEISAGMQRLGYNRSAKRCKEKWENINKY  518

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ K+    R    K   +F QL+  
Sbjct  519  FKKVKDSNKHRPDDSKTCPYFHQLDAL  545


 Score = 71.2 bits (173),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+++D    D   KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  91   RWPRQETLALLQIRSDMDSAFRDATLKGPLWEEVSRKLAELGYKRSAKKCKEKFENV  147



>ref|XP_009389115.1| PREDICTED: trihelix transcription factor GTL1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=720

 Score =   200 bits (509),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 125/280 (45%), Positives = 179/280 (64%), Gaps = 32/280 (11%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD AFRD+TLKGPLW+EVSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  91   RWPRQETLALLQIRSDMDSAFRDATLKGPLWEEVSRKLAELGYKRSAKKCKEKFENVHKY  150

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF-----DAMQSHNKIGGaaaaeppelaspspvAMI  652
            ++RTK+GR+GRQ GK+YRFF QLE               + G  A+    +++ +P  + 
Sbjct  151  YKRTKDGRAGRQDGKSYRFFSQLEALHGGSSGGGGGATGMAGPPASRAQPISAVAPSTLT  210

Query  651  KPNTNIVQDFR--MRPHGFGADADV--------------LsaststtyssggssGRKRKL  520
             P   +V +    + PHG  + A V               S    T  +     GRKRK 
Sbjct  211  VPTRAVVPEPTPPLGPHGISSSAAVGISFSSNSSSSASSESDDEETEEAGESQEGRKRKR  270

Query  519  AG-----------YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLK  373
             G           +F+++MK+V+E+QE +Q++FL+AIE+ E +RM R+EAW++QE+ RL 
Sbjct  271  GGGDSGSSRKMMAFFDRLMKQVMERQEAMQQRFLDAIEKREQDRMIRDEAWRRQEMTRLN  330

Query  372  REQESLakeraiaeakdaaviAFLQKISKQPILVPHKPQS  253
            REQE LA+ERA+A ++D A+I++LQK+S Q I +P  P +
Sbjct  331  REQELLAQERAMAASRDTAIISYLQKLSGQTIPMPTMPAT  370


 Score = 92.8 bits (229),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI +R+ LD ++H+ G KGPLWE+ISA M++LGY+R+AKRCKEKWENI
Sbjct  459  RWPKTEVHALINLRSGLDSKYHEAGPKGPLWEEISAGMQRLGYNRSAKRCKEKWENI  515


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +RS +D  + ++  KGPLW+E+S  M+  GY RSAK+C+EK+ENI KY
Sbjct  459  RWPKTEVHALINLRSGLDSKYHEAGPKGPLWEEISAGMQRLGYNRSAKRCKEKWENINKY  518

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ K+    R    K   +F QL+  
Sbjct  519  FKKVKDSNKHRPDDSKTCPYFHQLDAL  545


 Score = 71.6 bits (174),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+++D    D   KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  91   RWPRQETLALLQIRSDMDSAFRDATLKGPLWEEVSRKLAELGYKRSAKKCKEKFENV  147



>dbj|BAK03748.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=515

 Score =   191 bits (486),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 183/318 (58%), Gaps = 44/318 (14%)
 Frame = -3

Query  891  RKMEEFGYQRSAKKCREKFENIYKYHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS-HNK  715
            RK+ E GY RSAKKC+EKFEN+ KY+RRTKEGR+GRQ GKNYRFFE+LE   A    HN 
Sbjct  15   RKLAELGYCRSAKKCKEKFENVDKYYRRTKEGRAGRQDGKNYRFFEELEALHAAAPQHNH  74

Query  714  IGGaaaaeppelaspspvAMIKPNTNIVQDFR---MRPHGFGADADVLsaststtyssgg  544
                                +   T I+ D R   M P    A    LS S+++   S  
Sbjct  75   P-------------------MATATTILPDPRPLAMAPAYPAAGLPDLSLSSNSESESDD  115

Query  543  ssGRKRKLAG-----------YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWK  397
             S      AG            FE M+K++ EKQ+  Q+ FLE +E+ E +R AREEAW+
Sbjct  116  GSDEGEDQAGGGGRSNESMMALFEGMIKQITEKQDATQRLFLETLEKWEADRTAREEAWR  175

Query  396  KQEIERLKREQESLakeraiaeakdaaviAFLQKISKQPIL------VPHKPQSEDVQEF  235
            +QE+ R+ RE+E  A+ERA A A+DAA+IAFLQ++    +L            +  +Q  
Sbjct  176  RQELTRISREREQHARERAAAAARDAALIAFLQRVGGNSVLPTPMPAPHPDAPAASLQLV  235

Query  234  AAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMK  55
             A ++E G  ++    S    RWPK E+ ALIQ+R   D    D G+KGPLWEDISA M+
Sbjct  236  VAASEEGGRRESGAGMS----RWPKEEVHALIQLRMEKDEHCQDMGAKGPLWEDISAGMR  291

Query  54   KLGYDRNAKRCKEKWENI  1
            ++GY+R++KRCKEKWENI
Sbjct  292  RIGYNRSSKRCKEKWENI  309


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++R E D   +D   KGPLW+++S  M   GY RS+K+C+EK+ENI KY
Sbjct  253  RWPKEEVHALIQLRMEKDEHCQDMGAKGPLWEDISAGMRRIGYNRSSKRCKEKWENINKY  312

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R    K   +F QL+  
Sbjct  313  FKKVKESNKRRPDDSKTCPYFHQLDAI  339



>ref|XP_011101506.1| PREDICTED: LOW QUALITY PROTEIN: trihelix transcription factor 
PTL-like [Sesamum indicum]
Length=512

 Score =   188 bits (478),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 134/348 (39%), Positives = 197/348 (57%), Gaps = 33/348 (9%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS ++  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  87   RWPRQETLTLLEIRSRLNPKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  146

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVF-------DAMQSHNK-IGGaaaaeppelaspsp  664
            Y+++TKEG++GRQ GK+YRFF QLE          A  S N+ +GG            + 
Sbjct  147  YYKKTKEGKAGRQDGKHYRFFRQLEALYGETNNSSASVSENQFLGG-----SFHYNFANN  201

Query  663  vAMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGR------KRKLAGYFEK  502
               +  N       ++        +D  + ++S          R      K K+ G+ + 
Sbjct  202  NVCLAHNQEPYPGLKLSDTSLSNSSDAYATNSSDDSDLNVEKKRRGKRSLKGKIRGFIDA  261

Query  501  MMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakd  322
             M +++EKQE   +K +  IE  E ERM REE W+KQ+  R++REQ+  A ERA  EA+D
Sbjct  262  QMSKLMEKQEAWMEKMMSIIEHKEQERMLREEEWRKQDSARIEREQKLWASERAWIEARD  321

Query  321  aaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEAL  142
            AA++    ++S + I V  + Q  +V    A  +    GD           WP+ EI  L
Sbjct  322  AALMEAFHRLSGKEIRVVSENQ--NVCGNKAMNQNYLRGDI----------WPESEIARL  369

Query  141  IQIRTNLDLQHHDNG-SKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            IQ+RT ++++  + G S+  LWE+I+ +M  LG++R+   CKEKW+++
Sbjct  370  IQLRTAMEVKFQERGVSEEMLWEEIANKMACLGHERSGFMCKEKWDSV  417



>ref|XP_003574172.1| PREDICTED: trihelix transcription factor GTL1-like [Brachypodium 
distachyon]
 ref|XP_010234894.1| PREDICTED: trihelix transcription factor GTL1-like [Brachypodium 
distachyon]
Length=769

 Score =   190 bits (483),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 172/270 (64%), Gaps = 35/270 (13%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD AFRD+TLKGPLW+EVSRK+ E GY+R+AKKC+EKFEN++KY
Sbjct  88   RWPRQETLVLLKIRSDMDAAFRDATLKGPLWEEVSRKLAEEGYRRNAKKCKEKFENVHKY  147

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            ++RTK+ R+GR  GK YRFF+QLE   A+Q      GA++  PP  A  +P     P   
Sbjct  148  YKRTKDSRAGRNDGKTYRFFQQLE---ALQGATPGAGASSVPPPATAVRAPAE--PPPQP  202

Query  636  IVQDFRMRPHGFG---------------ADADVLsaststtyssggssGRKR--------  526
            +V      P G G                D +  S    T   +   + RKR        
Sbjct  203  VVAGAMPTPMGVGNLSFSTSNTEEFSEDEDEEDDSDDEGTDDMAVVGNKRKRMSSDGVAA  262

Query  525  -------KLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKRE  367
                   K+  +FE +M++V+E+QE +Q++FLEAIE+ E +RM REEAW++QE+ RL RE
Sbjct  263  AGGHNNKKMMRFFEGLMRQVMERQEAMQQRFLEAIEKREQDRMIREEAWRRQEMARLARE  322

Query  366  QESLakeraiaeakdaaviAFLQKISKQPI  277
            QE+LA+ERA+A ++DAAV+ F+QKI+ Q +
Sbjct  323  QETLAQERAMAASRDAAVLGFIQKITGQSV  352


 Score = 93.6 bits (231),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALIQ+R+NLD ++ + G KGPLWE+ISA M+++GY R++KRCKEKWENI
Sbjct  455  RWPKAEVHALIQLRSNLDTRYQEAGPKGPLWEEISAGMRRMGYSRSSKRCKEKWENI  511


 Score = 82.0 bits (201),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+++RS +D  ++++  KGPLW+E+S  M   GY RS+K+C+EK+ENI KY
Sbjct  455  RWPKAEVHALIQLRSNLDTRYQEAGPKGPLWEEISAGMRRMGYSRSSKRCKEKWENINKY  514

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QLE  
Sbjct  515  FKKVKESNKKRPEDSKTCPYFHQLEAL  541


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E   L++IR+++D    D   KGPLWE++S ++ + GY RNAK+CKEK+EN+
Sbjct  88   RWPRQETLVLLKIRSDMDAAFRDATLKGPLWEEVSRKLAEEGYRRNAKKCKEKFENV  144



>emb|CBI40214.3| unnamed protein product [Vitis vinifera]
Length=551

 Score =   186 bits (473),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 132/334 (40%), Positives = 185/334 (55%), Gaps = 32/334 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLW EVSR M EE GYQRS KKCREKFEN+YK
Sbjct  102  RWPRQETLTLLEIRSRLDPKFKEANQKGPLWAEVSRIMAEEHGYQRSGKKCREKFENLYK  161

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+++TKEG++GRQ GK+YRFF QLE      S+                          T
Sbjct  162  YYKKTKEGKAGRQDGKHYRFFRQLEALYGETSNQ----------------------ASTT  199

Query  639  NIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQK  460
             I     M  H       V                 K K+  +    MK++++ QE   +
Sbjct  200  TIAY---MMNHSMEKKRGV----DDGQSYRRVRKSLKGKIKEFVGLHMKKIMDTQEAWME  252

Query  459  KFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISKQP  280
            K L  IE  E ER++REE W+KQE  R  RE +  A ERA  EA+DAA++  L+K + + 
Sbjct  253  KMLTTIEHKEQERLSREEEWRKQEAARFDREYKFWASERAWIEARDAALMEALKKFTGKE  312

Query  279  ILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDN  100
            + +   P     +E   Q +        +   ++ SRWP+ E+ +LI +RT+++ +  D+
Sbjct  313  LKLS-SPDGLMDKEIQDQNESMEDIVNEVPDDTTYSRWPEQELSSLIHLRTSMESRFQDS  371

Query  99   G-SKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            G S+  LWE+I+  M  LGY+R+A RCK+KWENI
Sbjct  372  GYSEESLWEEIATRMGCLGYERSAMRCKQKWENI  405


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 57/98 (58%), Gaps = 2/98 (2%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTL-KGPLWDEVSRKMEEFGYQRSAKKCREKFENIYK  820
            RWP +E  +L+ +R+ M+  F+DS   +  LW+E++ +M   GY+RSA +C++K+ENI  
Sbjct  348  RWPEQELSSLIHLRTSMESRFQDSGYSEESLWEEIATRMGCLGYERSAMRCKQKWENINI  407

Query  819  YHRRTKEGRSGRQTG-KNYRFFEQLEVFDAMQSHNKIG  709
            Y  +T E    R+   +   +F+ L+ +   +   K G
Sbjct  408  YLNKTTEHSKKRKENLRTCTYFQPLDPYHGQEIMAKQG  445



>ref|XP_002267674.3| PREDICTED: trihelix transcription factor PTL-like [Vitis vinifera]
Length=561

 Score =   186 bits (473),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 137/366 (37%), Positives = 200/366 (55%), Gaps = 38/366 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLW EVSR M EE GYQRS KKCREKFEN+YK
Sbjct  102  RWPRQETLTLLEIRSRLDPKFKEANQKGPLWAEVSRIMAEEHGYQRSGKKCREKFENLYK  161

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVF------DAMQSHNKIGGaaaaeppelaspspvA  658
            Y+++TKEG++GRQ GK+YRFF QLE         A  S   + G          + +   
Sbjct  162  YYKKTKEGKAGRQDGKHYRFFRQLEALYGETSNQASVSETHLAG---NTTLLYQTTNNTT  218

Query  657  MIKPNTNIVQDFRM-RPHGF------------------GADADVLsaststtyssggssG  535
            + + N   +QD +    H F                   A A +++ S            
Sbjct  219  INQANQEALQDHKFCESHSFSNSSEFETSSSENNDDDLSAIAYMMNHSMEKKRGVDDGQS  278

Query  534  RKR-------KLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERL  376
             +R       K+  +    MK++++ QE   +K L  IE  E ER++REE W+KQE  R 
Sbjct  279  YRRVRKSLKGKIKEFVGLHMKKIMDTQEAWMEKMLTTIEHKEQERLSREEEWRKQEAARF  338

Query  375  KREQESLakeraiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTT  196
             RE +  A ERA  EA+DAA++  L+K + + + +   P     +E   Q +        
Sbjct  339  DREYKFWASERAWIEARDAALMEALKKFTGKELKLS-SPDGLMDKEIQDQNESMEDIVNE  397

Query  195  IssssssSRWPKPEIEALIQIRTNLDLQHHDNG-SKGPLWEDISAEMKKLGYDRNAKRCK  19
            +   ++ SRWP+ E+ +LI +RT+++ +  D+G S+  LWE+I+  M  LGY+R+A RCK
Sbjct  398  VPDDTTYSRWPEQELSSLIHLRTSMESRFQDSGYSEESLWEEIATRMGCLGYERSAMRCK  457

Query  18   EKWENI  1
            +KWENI
Sbjct  458  QKWENI  463


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 57/98 (58%), Gaps = 2/98 (2%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTL-KGPLWDEVSRKMEEFGYQRSAKKCREKFENIYK  820
            RWP +E  +L+ +R+ M+  F+DS   +  LW+E++ +M   GY+RSA +C++K+ENI  
Sbjct  406  RWPEQELSSLIHLRTSMESRFQDSGYSEESLWEEIATRMGCLGYERSAMRCKQKWENINI  465

Query  819  YHRRTKEGRSGRQTG-KNYRFFEQLEVFDAMQSHNKIG  709
            Y  +T E    R+   +   +F+ L+ +   +   K G
Sbjct  466  YLNKTTEHSKKRKENLRTCTYFQPLDPYHGQEIMAKQG  503



>gb|KHN18737.1| Trihelix transcription factor GT-2 [Glycine soja]
Length=524

 Score =   181 bits (458),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 131/361 (36%), Positives = 201/361 (56%), Gaps = 29/361 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  63   RWPRQETLTLLEIRSRLDSKFKEANQKGPLWDEVSRNMSEEHGYQRSGKKCREKFENLYK  122

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+++TKEG++GRQ GK+YRFF QLE      S+             L   +      P+ 
Sbjct  123  YYKKTKEGKAGRQDGKHYRFFRQLEALYGENSNQASVPETNFGSGSLRFHTSSHNNNPSQ  182

Query  639  NIVQDFRMRPH--------------GFGADADVLsaststtyssggssGRKRKLAG----  514
               + F+ + H                  D D  S        +     R+++++G    
Sbjct  183  TNQEMFQSQKHCDSLSLTNSTDLDTSSSDDNDQNSTGRELNKDNDSMEKRRKRVSGRSWK  242

Query  513  -----YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
                 + +  M++++EKQE+   K  + +E+ E ER+ REE W++QE  RL+RE +  AK
Sbjct  243  VKIKDFIDSQMRKLVEKQEEWLDKLTKTLEQKEKERVLREEEWRRQESVRLEREHKFWAK  302

Query  348  eraiaeakdaaviAFLQKISKQPIL-VPHKPQS---EDVQEFAAQTKENGSGDTTIssss  181
            ERA  EA+DAA++  L K+++  I+   H  +      +Q  +    E+GS     +++ 
Sbjct  303  ERAWIEARDAALMEALHKLTRNEIMKSTHSHEGLMVTGIQIHSENQNEDGSEILNSTAAR  362

Query  180  ssSRWPKPEIEALIQIRTNLDLQHHDNG-SKGPLWEDISAEMKKLGYDRNAKRCKEKWEN  4
             +  WP+ EI  L Q+R  ++ ++  +G S+  +WE+I+ +M   GY+R+A   KEKWE+
Sbjct  363  GAESWPESEIARLRQLRAEMETRYMQSGFSEEVMWEEIATKMACFGYERSALVFKEKWES  422

Query  3    I  1
            I
Sbjct  423  I  423



>gb|KFK24832.1| hypothetical protein AALP_AA8G030800 [Arabis alpina]
Length=584

 Score =   180 bits (457),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 141/365 (39%), Positives = 203/365 (56%), Gaps = 36/365 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  115  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  174

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEV-------FDAMQSHNKIGGaaaaeppelaspspv  661
            Y+R+TKEG++GRQ GK+YRFF QLE          +  SHN       +           
Sbjct  175  YYRKTKEGKAGRQDGKHYRFFRQLEALYGDSNNLVSCPSHNT---QFMSNALHGFHTQNT  231

Query  660  AMIKPNTNIVQDFRMRPHGF------------GADADVLsaststtyssggssGR--KRK  523
              +   T+ + +     HGF             ++ +++++S+    SS     R  K K
Sbjct  232  MNVTTTTSNIHNVDSSVHGFHHQSLSLSNNYNSSELELMTSSSEGNDSSTIRKKRSWKAK  291

Query  522  LAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLaker  343
            +  + +  MK ++E+Q+   +K  + IE  E +RM +EE W+K E  R+ +E +  AKER
Sbjct  292  IKEFIDMNMKRLIERQDLWLEKLTKVIEDKEEQRMLKEEEWRKIEAARIDKEHKFWAKER  351

Query  342  aiaeakdaaviAFLQKISKQPILVPHKPQSED----VQEFAAQTKENGSGDT---TIsss  184
               EA+D AVI  LQ ++ +P++ P     E+      E      ENGS  T    +S  
Sbjct  352  ERMEARDVAVIEALQYLTGKPLIKPLCSSPEERINGNNEIQENQNENGSDQTMTNNVSVK  411

Query  183  sssSRWPKPEIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAKRCKE  16
             S S W + EI  L++IRT++D    +     S   LWE+I+A++ +LG+D R+A  CKE
Sbjct  412  GSGSCWNEQEIIKLMEIRTSMDSAFQEILGGCSDEFLWEEIAAKLTQLGFDQRSALLCKE  471

Query  15   KWENI  1
            KWE I
Sbjct  472  KWEWI  476



>ref|XP_003521447.2| PREDICTED: trihelix transcription factor PTL-like [Glycine max]
Length=582

 Score =   180 bits (456),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 131/361 (36%), Positives = 201/361 (56%), Gaps = 29/361 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  121  RWPRQETLTLLEIRSRLDSKFKEANQKGPLWDEVSRNMSEEHGYQRSGKKCREKFENLYK  180

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+++TKEG++GRQ GK+YRFF QLE      S+             L   +      P+ 
Sbjct  181  YYKKTKEGKAGRQDGKHYRFFRQLEALYGENSNQASVPETNFGSGSLRFHTSSHNNNPSQ  240

Query  639  NIVQDFRMRPH--------------GFGADADVLsaststtyssggssGRKRKLAG----  514
               + F+ + H                  D D  S        +     R+++++G    
Sbjct  241  TNQEMFQSQKHCDSLSLTNSTDLDTSSSDDNDQNSTGRELNKDNDSMEKRRKRVSGRSWK  300

Query  513  -----YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
                 + +  M++++EKQE+   K  + +E+ E ER+ REE W++QE  RL+RE +  AK
Sbjct  301  VKIKDFIDSQMRKLVEKQEEWLDKLTKTLEQKEKERVLREEEWRRQESVRLEREHKFWAK  360

Query  348  eraiaeakdaaviAFLQKISKQPIL-VPHKPQS---EDVQEFAAQTKENGSGDTTIssss  181
            ERA  EA+DAA++  L K+++  I+   H  +      +Q  +    E+GS     +++ 
Sbjct  361  ERAWIEARDAALMEALHKLTRNEIMKSTHSHEGLMVTGIQIHSENQNEDGSEILNSTAAR  420

Query  180  ssSRWPKPEIEALIQIRTNLDLQHHDNG-SKGPLWEDISAEMKKLGYDRNAKRCKEKWEN  4
             +  WP+ EI  L Q+R  ++ ++  +G S+  +WE+I+ +M   GY+R+A   KEKWE+
Sbjct  421  GAESWPESEIARLQQLRAEMETRYMQSGFSEEVMWEEIATKMACFGYERSALVFKEKWES  480

Query  3    I  1
            I
Sbjct  481  I  481



>gb|KFK24833.1| hypothetical protein AALP_AA8G030800 [Arabis alpina]
Length=559

 Score =   177 bits (450),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 136/358 (38%), Positives = 198/358 (55%), Gaps = 47/358 (13%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  115  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  174

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEV-------FDAMQSHNKIGGaaaaeppelaspspv  661
            Y+R+TKEG++GRQ GK+YRFF QLE          +  SHN       +           
Sbjct  175  YYRKTKEGKAGRQDGKHYRFFRQLEALYGDSNNLVSCPSHNT---QFMSNALHGFHTQNT  231

Query  660  AMIKPNTNIVQDFRMRPHGF------------GADADVLsaststtyssggssGR--KRK  523
              +   T+ + +     HGF             ++ +++++S+    SS     R  K K
Sbjct  232  MNVTTTTSNIHNVDSSVHGFHHQSLSLSNNYNSSELELMTSSSEGNDSSTIRKKRSWKAK  291

Query  522  LAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLaker  343
            +  + +  MK ++E+Q+   +K  + IE  E +RM +EE W+K E  R+ +E +  AKER
Sbjct  292  IKEFIDMNMKRLIERQDLWLEKLTKVIEDKEEQRMLKEEEWRKIEAARIDKEHKFWAKER  351

Query  342  aiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWP  163
               EA+D AVI  LQ ++ +P++ P     E+        + NGSG            W 
Sbjct  352  ERMEARDVAVIEALQYLTGKPLIKPLCSSPEE--------RINGSGSC----------WN  393

Query  162  KPEIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAKRCKEKWENI  1
            + EI  L++IRT++D    +     S   LWE+I+A++ +LG+D R+A  CKEKWE I
Sbjct  394  EQEIIKLMEIRTSMDSAFQEILGGCSDEFLWEEIAAKLTQLGFDQRSALLCKEKWEWI  451



>ref|XP_004246556.1| PREDICTED: trihelix transcription factor PTL [Solanum lycopersicum]
Length=543

 Score =   177 bits (448),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 136/375 (36%), Positives = 196/375 (52%), Gaps = 55/375 (15%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQR+ KKCREKFEN+YK
Sbjct  129  RWPRQETLTLLEIRSRLDPKFKEANQKGPLWDEVSRIMSEEHGYQRTGKKCREKFENLYK  188

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+++TKEG++GRQ GK+YRFF QLE      S+N    +          P          
Sbjct  189  YYKKTKEGKAGRQDGKHYRFFRQLEALYGETSNNISSTSTDILHQGSHFPY---------  239

Query  639  NIVQDFRMRPHGF-------------GADADVLsaststtyssggssGR------KRKLA  517
            N V +    PH F              +++  L+ S+S          R      K K+ 
Sbjct  240  NSVNNMSQDPHNFHHHQASKLSDSMSLSNSSELNTSSSDDSDHHDKKKRRGKRSLKAKIK  299

Query  516  GYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakerai  337
             + +  M++++EKQE+  +K ++ IE  E ER+ REE W+KQE  R+++E    A ERA 
Sbjct  300  DFIDGQMRKLMEKQEEWMEKMMKMIEHKEQERILREEEWRKQETIRIEKEHNFWANERAW  359

Query  336  aeakdaaviAFLQKISKQPI-LVPHKPQSEDVQEFAAQTKENGSGDTT-IssssssSRWP  163
             E +DAA++  + K+S + +      P+S D +        N +GD T          WP
Sbjct  360  IETRDAALMEAVNKLSGKDLKSTSSNPRSLDEEMVEIH---NRNGDVTDSLKDDVDQHWP  416

Query  162  KPEIEALIQIRTNLDLQHHDNGSKGP---------------------LWEDISAEMKKLG  46
              EI  LIQ+RT+++ +    G                         LWE+ISA+M  LG
Sbjct  417  DSEITRLIQLRTSMESRFQQLGISSSINDHDHDHDHDNDHSNNHDHVLWEEISAKMSILG  476

Query  45   YDRNAKRCKEKWENI  1
            YD++A  CK++W +I
Sbjct  477  YDKSATMCKKRWGSI  491



>ref|XP_007162858.1| hypothetical protein PHAVU_001G187000g [Phaseolus vulgaris]
 gb|ESW34852.1| hypothetical protein PHAVU_001G187000g [Phaseolus vulgaris]
Length=592

 Score =   177 bits (448),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 131/358 (37%), Positives = 200/358 (56%), Gaps = 29/358 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  138  RWPRQETLTLLEIRSRLDSKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  197

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+++TKEG++GRQ GK+YRFF QLE      S+              +         P+ 
Sbjct  198  YYKKTKEGKAGRQDGKHYRFFRQLEALYGENSNQT--SVPETNFGSSSLRFNANSHNPSQ  255

Query  639  NIVQDFRMRPH------GFGADADVLsaststtyss------ggssGRKRKLAG------  514
               + F  + H          D D  S+  +   S+        +  R+++L+G      
Sbjct  256  TNQEMFHSQKHCDSLSLTNSTDLDTSSSDDNDQNSTGGLKDNDSTEKRRKRLSGRSWKVK  315

Query  513  ---YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLaker  343
               + +  M++++EKQE+   K  + +E+ E ER+ REE W++QE  RL+RE +  AKER
Sbjct  316  IKDFIDSQMRKLVEKQEEWLDKLTKTLEQKEKERVFREEEWRRQEAVRLEREHKFWAKER  375

Query  342  aiaeakdaaviAFLQKISKQPIL----VPHKPQSEDVQEFAAQTKENGSGDTTIssssss  175
            A  EA+DAA++  LQK++   ++     P       +Q  +    E+GS     ++   +
Sbjct  376  AWIEARDAALMEALQKLTGNEMIKSTQSPEGRMVTGIQNHSENLNEDGSEILNSTTVRGA  435

Query  174  SRWPKPEIEALIQIRTNLDLQHHDNG-SKGPLWEDISAEMKKLGYDRNAKRCKEKWEN  4
              WP+ EI  L Q+R  ++ ++  +G S+  +WE+I+ +M   GY+R+A   KEKWE+
Sbjct  436  ESWPESEITRLQQLRAEMETRYMQSGCSEEIMWEEIATKMACFGYERSALVFKEKWES  493


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEM-KKLGYDRNAKRCKEKWENI  1
            RWP+ E   L++IR+ LD +  +   KGPLW+++S  M ++ GY R+ K+C+EK+EN+
Sbjct  138  RWPRQETLTLLEIRSRLDSKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENL  195



>ref|XP_003553586.1| PREDICTED: trihelix transcription factor PTL-like [Glycine max]
 gb|KHN02252.1| Trihelix transcription factor GT-2 [Glycine soja]
Length=578

 Score =   176 bits (445),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 132/360 (37%), Positives = 196/360 (54%), Gaps = 29/360 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLW EVSR M EE GYQRS KKCREKFEN+YK
Sbjct  120  RWPRQETLTLLEIRSRLDSKFKEANQKGPLWVEVSRIMSEEHGYQRSGKKCREKFENLYK  179

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+++TKEG++GRQ GK+YRFF QLE      S N+                  +   P+ 
Sbjct  180  YYKKTKEGKAGRQDGKHYRFFRQLEALYGENS-NQASVPETNFGSGSLRFHTSSHNNPSQ  238

Query  639  NIVQDFRMRPH--------------GFGADADVLsaststtyssggssGRKR--------  526
               + F+ + H                  D D  S       +      RKR        
Sbjct  239  TNQEMFQSQKHCDSLSLTNSTDLDTSSSDDNDQNSTGGGLKDNDSMEKRRKRVSGRSWKV  298

Query  525  KLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLake  346
            K+  + +  M++++EKQE+   K  + +E+ E ER+ REE W++QE  RL+RE +  AKE
Sbjct  299  KIKDFIDSQMRKLVEKQEEWLDKLTKTLEQKEKERVLREEEWRRQEAARLEREHKFWAKE  358

Query  345  raiaeakdaaviAFLQKISKQPIL-VPHKPQS---EDVQEFAAQTKENGSGDTTIsssss  178
            RA  EA+DAA++  L K++   I+   H P       +Q  +    E+GS     +++  
Sbjct  359  RAWIEARDAALMEALHKLTGNGIIKSTHSPDGLMVTGIQNHSENQNEDGSEILNSTTARG  418

Query  177  sSRWPKPEIEALIQIRTNLDLQHHDNG-SKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            +  W + EI  L Q+R  ++ ++  +G S+  +WE+I+ +M   GY+R+A   KEKWE+I
Sbjct  419  AESWTESEIARLQQLRAEMETRYMQSGCSEEVMWEEIATKMACFGYERSAVVFKEKWESI  478



>ref|XP_006341153.1| PREDICTED: trihelix transcription factor PTL-like [Solanum tuberosum]
Length=542

 Score =   175 bits (443),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 130/371 (35%), Positives = 194/371 (52%), Gaps = 62/371 (17%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQR+ KKCREKFEN+YK
Sbjct  125  RWPRQETLTLLEIRSRLDSKFKEANQKGPLWDEVSRIMSEEHGYQRTGKKCREKFENLYK  184

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+++TKEG++GRQ GK+YRFF QLE     ++ N I   +     + +     ++   N 
Sbjct  185  YYKKTKEGKAGRQDGKHYRFFRQLEALYG-ETSNNISSTSTEVLHQGSHFPYNSV---NN  240

Query  639  NIVQDFRMRPHGF-------------------------GADADVLsaststtyssggssG  535
            N+ QD    PH F                           D+D             G   
Sbjct  241  NMNQD----PHNFHHVHQGPKISDSISLSNSSEFNTTSSDDSD-----QEKKKKRRGKRS  291

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
             K K+  + +  M++++EKQE+  +K ++ IE  E ER+ REE W+ QE  R++RE +  
Sbjct  292  LKAKIKDFIDGQMRKLMEKQEEWLEKMMKMIEHKEQERILREEEWRNQETIRMEREHKFW  351

Query  354  akeraiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDT--TIssss  181
            A ERA  E +DAA++  + K+S + +                +  +N  GD   ++    
Sbjct  352  ANERAWIETRDAALMEAVNKLSGKDL----------KSTLDEEMVDNRRGDVRDSLKDDD  401

Query  180  ssSRWPKPEIEALIQIRTNLDLQHHDNGSKGP-----------LWEDISAEMKKLGYDRN  34
                WP  EI  LIQ+RT+++ ++   G               LWE+IS +M  LGY+++
Sbjct  402  VDQHWPDSEITRLIQLRTSMESRYQQLGISSSIDDHDNDHDHVLWEEISEKMAILGYEKS  461

Query  33   AKRCKEKWENI  1
            A  CK++W +I
Sbjct  462  ATMCKKRWGSI  472



>ref|XP_010558209.1| PREDICTED: trihelix transcription factor PTL-like [Tarenaya hassleriana]
Length=571

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 133/356 (37%), Positives = 200/356 (56%), Gaps = 24/356 (7%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GY RS KKCREKFEN+YK
Sbjct  123  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYNRSGKKCREKFENLYK  182

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNK-------IGGaaaaeppelaspspv  661
            Y+R+TKEG++GRQ GK+YRFF QLE      +H+        IG   A  P      + +
Sbjct  183  YYRKTKEGKAGRQDGKHYRFFRQLEALYGDTNHSVSLPETQFIGNVNANPPNSNNPGAVI  242

Query  660  AMIKP-NTNIVQDFRMRPHGFGADADVLsaststtyssggssGR---KRKLAGYFEKMMK  493
              + P +  I+ D  +        +++ ++S+    +      R   K K+  + +  MK
Sbjct  243  NGLHPLHQKILTDNSLSLSNNYNSSELDTSSSDDDGNHSTRRKRRGWKAKIKEFIDLQMK  302

Query  492  EVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaav  313
             ++E+QE   ++  + IE  E +RM REE W++ E  R+ +E    A+ER   EA+D A+
Sbjct  303  RLIERQEAWLERLAKTIEDKEQQRMIREEEWRRLEAARIGKEHSFWARERERMEARDIAL  362

Query  312  iAFLQKISKQPI--LVPHKP----QSEDVQEFAAQTKENGSGDTTIss-ssssSRWPKPE  154
            I  LQ ++ +P+       P        +Q  +    ENGS  TT +      + W + E
Sbjct  363  IEALQCLTGRPLRKAACSSPDERINGNAIQNHSENQNENGSDQTTNNVCLKGDTGWIEAE  422

Query  153  IEALIQIRTNLDLQHHDNGSKGP----LWEDISAEMKKLGYD-RNAKRCKEKWENI  1
            I  L+++RT+++ +     + G     LWE+ISA++ +LG+D R+A  CKEKWE I
Sbjct  423  ITKLMEMRTSMESEFQQAMAGGCSDEFLWEEISAKLARLGFDQRSALTCKEKWEWI  478



>ref|XP_009394024.1| PREDICTED: trihelix transcription factor PTL [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 190/345 (55%), Gaps = 28/345 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL++RS +D  FR++  KGPLWDEVSR M EE GY RS KKCREK EN+YK
Sbjct  92   RWPRQETLTLLEVRSRLDSRFREAAHKGPLWDEVSRIMAEEHGYHRSGKKCREKLENLYK  151

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+++TKEG++GRQ GK+YRFF QLE      S      A A      + P+  + +  N 
Sbjct  152  YYKKTKEGKAGRQDGKHYRFFRQLEALYGGSSS-----ATAEIIQPCSKPTYASALPSNR  206

Query  639  NIVQDFRMRPHG-------FGADADVLsaststtyssggssGRKRKLAGYFEKMMKE---  490
              +Q  R   +        F   +           S   +   ++      E+++ E   
Sbjct  207  EALQVSRFSGNVSLSSSSEFDGTSSTGEEGEQEDGSMRRAKTGRKSWKSKVEELVDEQIK  266

Query  489  -VLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaav  313
              +E QE    + L  +E  E  R++REE W++QE ER+ RE    A ERA  EA+DAA+
Sbjct  267  RFIEVQETWMNQMLRTLEHMEQARISREEDWRRQEAERVDREYGLWASERAWMEARDAAI  326

Query  312  iAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQI  133
            I  L+KIS++ +    +PQ +           NG        + ++ RWP+ E  +L++I
Sbjct  327  IQALEKISRRELR--SQPQED--------RSANGEHGDEADGNWAAQRWPESETASLVRI  376

Query  132  RTNLDLQHHDNGS-KGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            R +++ +  + GS K  LW ++SA M  LG +R+AK CKEKW+++
Sbjct  377  RRSMEAEFGEGGSGKVGLWGEVSAAMACLGTNRSAKGCKEKWDDV  421


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDS-TLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYK  820
            RWP  ET +L++IR  M+  F +  + K  LW EVS  M   G  RSAK C+EK++++ K
Sbjct  364  RWPESETASLVRIRRSMEAEFGEGGSGKVGLWGEVSAAMACLGTNRSAKGCKEKWDDVNK  423

Query  819  YHRRTKE  799
              R+ KE
Sbjct  424  RSRKAKE  430


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = -3

Query  204  DTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEM-KKLGYDRNAK  28
            +T         RWP+ E   L+++R+ LD +  +   KGPLW+++S  M ++ GY R+ K
Sbjct  81   ETAFGGGGGQGRWPRQETLTLLEVRSRLDSRFREAAHKGPLWDEVSRIMAEEHGYHRSGK  140

Query  27   RCKEKWENI  1
            +C+EK EN+
Sbjct  141  KCREKLENL  149



>ref|XP_010490858.1| PREDICTED: trihelix transcription factor PTL-like [Camelina sativa]
Length=594

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 138/362 (38%), Positives = 203/362 (56%), Gaps = 33/362 (9%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  124  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  183

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+R+TKEG++GRQ GK+YRFF QLE      S+N +           ++        P  
Sbjct  184  YYRKTKEGKAGRQDGKHYRFFRQLEALYG-DSNNLVSCPNHNTQFMSSAIHGFHTQNPMN  242

Query  639  NIVQDFRMRP----HGF-----------GADADVLsaststtyssggssGR--KRKLAGY  511
                   +      HGF            ++ +++++S+    SS     R  K K+  +
Sbjct  243  VTTTTSNIHNVDSVHGFHQSLSLSNNYNSSELELMTSSSEGNDSSSRRKTRSWKGKIKEF  302

Query  510  FEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiae  331
             +  MK+++E+Q+   +K  + IE  E +RM +EE W+K E  R+ +E    AKERA  E
Sbjct  303  IDANMKKLIERQDVWLEKLTKVIEDKEEQRMMKEEEWRKTEAARIDKEHLFWAKERARME  362

Query  330  akdaaviAFLQKISKQPILVPHKPQSE-------DVQEFAAQTKENGSGDT---TIssss  181
            A+D AVI  LQ ++ +P++ P     E       +++  +    ENGS  T    ++   
Sbjct  363  ARDVAVIEALQYLTGKPLIKPLCSSPEERINGNNEIRNNSENQNENGSDQTMTNNVTVKG  422

Query  180  ssSRWPKPEIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAKRCKEK  13
            S S W + EI  L++IRT++D    +     S   LWE+I+A++ +LG+D R+A  CKEK
Sbjct  423  SGSCWDEQEIIKLMEIRTSMDSAFQEILGGCSDEFLWEEIAAKLVQLGFDQRSALLCKEK  482

Query  12   WE  7
            WE
Sbjct  483  WE  484


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEM-KKLGYDRNAKRCKEKWENI  1
            RWP+ E   L++IR+ LD +  +   KGPLW+++S  M ++ GY R+ K+C+EK+EN+
Sbjct  124  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENL  181



>ref|XP_007145244.1| hypothetical protein PHAVU_007G222800g [Phaseolus vulgaris]
 gb|ESW17238.1| hypothetical protein PHAVU_007G222800g [Phaseolus vulgaris]
Length=599

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 133/360 (37%), Positives = 199/360 (55%), Gaps = 29/360 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  134  RWPRQETLTLLEIRSRLDPKFKEANHKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  193

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH-------NKIGGaaaaeppelaspspv  661
            Y+++TK+G++GR  GK+YRFF QLE      S        N +G           S +  
Sbjct  194  YYKKTKDGKAGRHDGKHYRFFRQLEALYGENSSTVSVPETNVVGSIHFQASSHAPSQTNQ  253

Query  660  AMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKRK----------LAGY  511
               + + +   D     +    D                S  ++RK          +  +
Sbjct  254  DKFQSHNSKNCDSLSLTNSTNFDTTSSDDDNDHHSMENESIEKRRKSNSGRSWKVKIKDF  313

Query  510  FEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiae  331
             +  M++++EKQ++   K ++ +E  E ERM REE W+KQE  RL+REQE  AKERA  E
Sbjct  314  IDSQMRKLVEKQKEWLDKLVKTLEEKEKERMLREEEWRKQEANRLEREQEFWAKERAWIE  373

Query  330  akdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSG----DTTIsssss-----  178
            A+DAA++  LQK++ + I+    P ++ +   AA+ + +       D +I  +SS     
Sbjct  374  ARDAALMEALQKLTGREIMKAETP-NDGINITAAEVQNHSENQNNEDESIMLNSSNVIRG  432

Query  177  sSRWPKPEIEALIQIRTNLDLQH-HDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            + RWP+ EI  L Q+R  ++ +  +   S+   W+ ++ +M   GY+R+A  CKEKWE+I
Sbjct  433  ADRWPESEITRLQQLRAEIETRFPYSEISEEVSWDVVATKMACFGYERSALMCKEKWESI  492


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 1/79 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPL-WDEVSRKMEEFGYQRSAKKCREKFENIYK  820
            RWP  E   L ++R+E++  F  S +   + WD V+ KM  FGY+RSA  C+EK+E+I  
Sbjct  435  RWPESEITRLQQLRAEIETRFPYSEISEEVSWDVVATKMACFGYERSALMCKEKWESISN  494

Query  819  YHRRTKEGRSGRQTGKNYR  763
            Y R        ++  +N R
Sbjct  495  YPREGDNKEDSKKCKENSR  513



>ref|XP_010452262.1| PREDICTED: trihelix transcription factor PTL isoform X1 [Camelina 
sativa]
 ref|XP_010452263.1| PREDICTED: trihelix transcription factor PTL isoform X2 [Camelina 
sativa]
Length=593

 Score =   174 bits (442),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 206/365 (56%), Gaps = 35/365 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  123  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  182

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKP--  646
            Y+R+TKEG++GRQ GK+YRFF QLE      S+N +           ++        P  
Sbjct  183  YYRKTKEGKAGRQDGKHYRFFRQLEALYG-DSNNLVSCPNHNTQFMSSAIHGFHTQNPLN  241

Query  645  ---NTNIVQDFRMRPHGF-----------GADADVLsaststtyssggssGR--KRKLAG  514
                T+ + +     HGF            ++ +++++S+    SS     R  K K+  
Sbjct  242  VTTTTSNIHNVD-SVHGFHQSLSLSNNYNSSELELMTSSSEGNDSSSRRKTRNWKGKIKE  300

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            + +  MK ++E+Q+   +K  + IE  E +RM +EE W+K E  R+ +E    AKERA  
Sbjct  301  FIDANMKRLIERQDVWLEKLTKVIEDKEEQRMMKEEEWRKTEAARIDKEHLFWAKERARM  360

Query  333  eakdaaviAFLQKISKQPILVPHKPQSE-------DVQEFAAQTKENGSGDT---TIsss  184
            EA+D AVI  LQ ++ +P++ P     E       +++  +    ENGS  T    ++  
Sbjct  361  EARDVAVIEALQYLTGKPLIKPLCSSPEERINGNNEIRNNSENQNENGSDQTMTNNVTVK  420

Query  183  sssSRWPKPEIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAKRCKE  16
             S S W + EI  L++IRT++D    +     S   LWE+I+A++ +LG+D R+A  CKE
Sbjct  421  GSGSCWDEQEIIKLMEIRTSMDSAFQEILGGCSDEFLWEEIAAKLVQLGFDQRSALLCKE  480

Query  15   KWENI  1
            KWE I
Sbjct  481  KWEWI  485



>ref|XP_010423677.1| PREDICTED: trihelix transcription factor PTL-like isoform X1 
[Camelina sativa]
Length=592

 Score =   174 bits (442),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 205/364 (56%), Gaps = 33/364 (9%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  124  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  183

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+R+TKEG++GRQ GK+YRFF QLE      S+N +           ++        P  
Sbjct  184  YYRKTKEGKAGRQDGKHYRFFRQLEALYG-DSNNLVSCPNHNTQFMSSAIHGFHTQNPMN  242

Query  639  NIVQDFRMRP----HGF-----------GADADVLsaststtyssggssGR--KRKLAGY  511
                   +      HGF            ++ +++++S+    SS     R  K K+  +
Sbjct  243  VTTTTSNIHNVDSVHGFHQSLSLSNNYNSSELELMTSSSEGNDSSSRRKTRSWKGKIKEF  302

Query  510  FEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiae  331
             +  MK ++E+Q+   +K  + IE  E +RM +EE W+K E  R+ +E    AKERA  E
Sbjct  303  IDANMKRLIERQDVWLEKLTKVIEDKEEQRMMKEEEWRKTEAARIDKEHLFWAKERARME  362

Query  330  akdaaviAFLQKISKQPILVP--HKPQ-----SEDVQEFAAQTKENGSGDT---TIssss  181
            A+D AVI  LQ ++ +P++ P    P+     + +++  +    ENGS  T    ++   
Sbjct  363  ARDVAVIEALQYLTGKPLIKPLCSSPEERINGNNEIRNNSENQNENGSDQTMTNNVTVKG  422

Query  180  ssSRWPKPEIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAKRCKEK  13
            S S W + EI  L++IRT++D    +     S   LWE+I+A++ +LG+D R+A  CKEK
Sbjct  423  SGSCWDEQEIIKLMEIRTSMDSAFQEILGGCSDEFLWEEIAAKLVQLGFDQRSALLCKEK  482

Query  12   WENI  1
            WE I
Sbjct  483  WEWI  486



>ref|XP_006287334.1| hypothetical protein CARUB_v10000532mg [Capsella rubella]
 gb|EOA20232.1| hypothetical protein CARUB_v10000532mg [Capsella rubella]
Length=593

 Score =   174 bits (442),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 143/365 (39%), Positives = 206/365 (56%), Gaps = 39/365 (11%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  125  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  184

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVF-------DAMQSHNKIGGaaaaeppelaspspv  661
            Y+R+TKEG++GRQ GK+YRFF QLE          +  +HN    + A       +P  V
Sbjct  185  YYRKTKEGKAGRQDGKHYRFFRQLEALYGDSTNVVSCPNHNTQFMSNALHGFHTQNPMNV  244

Query  660  AMIKPNTNIVQDFRMRPHGF-----------GADADVLsaststtyssggssGR--KRKL  520
                 N + V       HGF            ++ +++++S+    SS     R  K K+
Sbjct  245  TTTTSNIHNVDSV----HGFHQSLSLSNNYNSSELELMTSSSEGNDSSSRRKKRSWKAKI  300

Query  519  AGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakera  340
              + +  MK ++E+Q+   +K  + IE  E +RM +EE W+K E  R+ +E    AKER 
Sbjct  301  KEFIDANMKRLIERQDVWLEKLTKVIEDKEEQRMMKEEEWRKIEAARIDKEHLFWAKERE  360

Query  339  iaeakdaaviAFLQKISKQPILVPHKPQSED-------VQEFAAQTKENGSGDT---TIs  190
              EA+D AVI  LQ ++ +P++ P     E+       ++  +    ENGS  T    +S
Sbjct  361  RMEARDVAVIEALQYLTGKPLIKPLCSSPEERIIGNNKIRNNSENQNENGSDQTMTNNVS  420

Query  189  sssssSRWPKPEIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAKRC  22
               SSS W + EI  L++IRT++D    +     S   LWE+I+A++ +LG+D R+A  C
Sbjct  421  VKGSSSCWDEQEIIKLMEIRTSMDSAFQEILGGCSDEYLWEEIAAKLVQLGFDRRSALLC  480

Query  21   KEKWE  7
            KEKWE
Sbjct  481  KEKWE  485


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEM-KKLGYDRNAKRCKEKWENI  1
            RWP+ E   L++IR+ LD +  +   KGPLW+++S  M ++ GY R+ K+C+EK+EN+
Sbjct  125  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENL  182



>ref|XP_010423678.1| PREDICTED: trihelix transcription factor PTL-like isoform X2 
[Camelina sativa]
Length=592

 Score =   174 bits (442),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 206/365 (56%), Gaps = 35/365 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  124  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  183

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKP--  646
            Y+R+TKEG++GRQ GK+YRFF QLE      S+N +           ++        P  
Sbjct  184  YYRKTKEGKAGRQDGKHYRFFRQLEALYG-DSNNLVSCPNHNTQFMSSAIHGFHTQNPLN  242

Query  645  ---NTNIVQDFRMRPHGF-----------GADADVLsaststtyssggssGR--KRKLAG  514
                T+ + +     HGF            ++ +++++S+    SS     R  K K+  
Sbjct  243  VTTTTSNIHNVD-SVHGFHQSLSLSNNYNSSELELMTSSSEGNDSSSRRKTRNWKGKIKE  301

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            + +  MK ++E+Q+   +K  + IE  E +RM +EE W+K E  R+ +E    AKERA  
Sbjct  302  FIDANMKRLIERQDVWLEKLTKVIEDKEEQRMMKEEEWRKTEAARIDKEHLFWAKERARM  361

Query  333  eakdaaviAFLQKISKQPILVPHKPQSE-------DVQEFAAQTKENGSGDT---TIsss  184
            EA+D AVI  LQ ++ +P++ P     E       +++  +    ENGS  T    ++  
Sbjct  362  EARDVAVIEALQYLTGKPLIKPLCSSPEERINGNNEIRNNSENQNENGSDQTMTNNVTVK  421

Query  183  sssSRWPKPEIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAKRCKE  16
             S S W + EI  L++IRT++D    +     S   LWE+I+A++ +LG+D R+A  CKE
Sbjct  422  GSGSCWDEQEIIKLMEIRTSMDSAFQEILGGCSDEFLWEEIAAKLVQLGFDQRSALLCKE  481

Query  15   KWENI  1
            KWE I
Sbjct  482  KWEWI  486



>ref|NP_195988.1| trihelix transcription factor PTL [Arabidopsis thaliana]
 sp|Q9LZS0.1|PTL_ARATH RecName: Full=Trihelix transcription factor PTL; AltName: Full=Trihelix 
DNA-binding protein PETAL LOSS [Arabidopsis thaliana]
 emb|CAB82933.1| GT2-like protein [Arabidopsis thaliana]
 gb|AED90641.1| trihelix transcription factor PTL [Arabidopsis thaliana]
Length=591

 Score =   173 bits (439),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 140/364 (38%), Positives = 203/364 (56%), Gaps = 33/364 (9%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  119  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  178

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+R+TKEG++GRQ GK+YRFF QLE      S+N +           ++        P  
Sbjct  179  YYRKTKEGKAGRQDGKHYRFFRQLEALYG-DSNNLVSCPNHNTQFMSSALHGFHTQNPMN  237

Query  639  NIVQDFRMRP----HGF-----------GADADVLsaststtyssggssGR--KRKLAGY  511
                   +      HGF            ++ +++++S+    SS     R  K K+  +
Sbjct  238  VTTTTSNIHNVDSVHGFHQSLSLSNNYNSSELELMTSSSEGNDSSSRRKKRSWKAKIKEF  297

Query  510  FEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiae  331
             +  MK ++E+Q+   +K  + IE  E +RM +EE W+K E  R+ +E    AKERA  E
Sbjct  298  IDTNMKRLIERQDVWLEKLTKVIEDKEEQRMMKEEEWRKIEAARIDKEHLFWAKERARME  357

Query  330  akdaaviAFLQKISKQPILVPHKPQSE-------DVQEFAAQTKENGSGDT---TIssss  181
            A+D AVI  LQ ++ +P++ P     E       +++  +    ENGS  T    +    
Sbjct  358  ARDVAVIEALQYLTGKPLIKPLCSSPEERTNGNNEIRNNSETQNENGSDQTMTNNVCVKG  417

Query  180  ssSRWPKPEIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAKRCKEK  13
            SSS W + EI  L++IRT++D    +     S   LWE+I+A++ +LG+D R+A  CKEK
Sbjct  418  SSSCWGEQEILKLMEIRTSMDSTFQEILGGCSDEFLWEEIAAKLIQLGFDQRSALLCKEK  477

Query  12   WENI  1
            WE I
Sbjct  478  WEWI  481



>ref|XP_002530882.1| transcription factor, putative [Ricinus communis]
 gb|EEF31488.1| transcription factor, putative [Ricinus communis]
Length=551

 Score =   173 bits (438),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 143/386 (37%), Positives = 202/386 (52%), Gaps = 64/386 (17%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  FR++  KGPLWDEVSR M +E GYQRS KKCREKFEN+YK
Sbjct  84   RWPRQETLTLLEIRSRLDSRFREANQKGPLWDEVSRIMADEHGYQRSGKKCREKFENLYK  143

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+++TK+G++GRQ GK+YRFF QLE     ++ N+I  A+        + + +    P+ 
Sbjct  144  YYKKTKDGKAGRQDGKHYRFFRQLEALYG-ETSNQIASASETTHLTNTNTTFLYQ-PPSN  201

Query  639  NIVQD----FRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQE  472
            NI Q+    F+   +     +   S ++    SS  ++        Y   MMK  +EKQ+
Sbjct  202  NINQENQESFQETNNKHSEQSLSFSNTSEFETSSSENNDEDLSAIAY---MMKRSMEKQK  258

Query  471  DLQ---------------------------KKFLEA-----------IERCENERMAREE  406
             L                            KK LE+           IE  E ERM REE
Sbjct  259  GLSTESQSYTCTKAKKNWKGKVKNFVDIQMKKLLESQEAWMERMIKTIEDREQERMFREE  318

Query  405  AWKKQEIERLKREQESLakeraiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQ  226
             W KQE  RL R  E  AKERA  EA+D A++  L+K + + + +     S  +++ A  
Sbjct  319  EWTKQESARLDRIHEFWAKERAWMEARDVALMEILRKCTGKGLDL-----SSSIEKIAIA  373

Query  225  TKE-------NGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKG----PLW  79
            T+        N            +SRW +PEI +LIQIRT ++ +  ++ + G     LW
Sbjct  374  TQNHYNNQDRNAKKIGIDHEVLKASRWSEPEIFSLIQIRTTMESRFQESSNSGYSKENLW  433

Query  78   EDISAEMKKLGYDRNAKRCKEKWENI  1
            E+I+ +M  LGYDR    CKEKW+N+
Sbjct  434  EEIAGKMANLGYDRGVDECKEKWKNM  459


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 53/97 (55%), Gaps = 11/97 (11%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKG----PLWDEVSRKMEEFGYQRSAKKCREKFEN  829
            RW   E  +L++IR+ M+  F++S+  G     LW+E++ KM   GY R   +C+EK++N
Sbjct  399  RWSEPEIFSLIQIRTTMESRFQESSNSGYSKENLWEEIAGKMANLGYDRGVDECKEKWKN  458

Query  828  IYKYHRRTKEGRSGRQ-----TGKNYRFFEQLEVFDA  733
            +  +     EG   ++     T  NY  F+QL+ ++ 
Sbjct  459  MNVFFNMATEGEGFKKRKEDLTTSNY--FQQLDPYNG  493



>ref|XP_002871053.1| hypothetical protein ARALYDRAFT_487148 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47312.1| hypothetical protein ARALYDRAFT_487148 [Arabidopsis lyrata subsp. 
lyrata]
Length=590

 Score =   173 bits (438),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 144/366 (39%), Positives = 208/366 (57%), Gaps = 38/366 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  121  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  180

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLE-------VFDAMQSHNKIGGaaaaeppelaspspv  661
            Y+R+TKEG++GRQ GK+YRFF QLE          +  +HN    ++A       +P  V
Sbjct  181  YYRKTKEGKAGRQDGKHYRFFRQLEALYGDSNTLVSCPNHNTQFMSSALHGFHTQNPMNV  240

Query  660  AMIKPNTNIVQDFRMRPHGF-----------GADADVLsaststtyssggssGR--KRKL  520
                 N + V       HGF            ++ +++++S+    SS     R  K K+
Sbjct  241  TTTTSNIHNVDSV----HGFHQSLSLSNNYNSSELELMTSSSEGNDSSSRRKKRSWKAKI  296

Query  519  AGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakera  340
              + +  MK ++E+Q+   +K  + IE  E +RM +EE W+K E  R+ +E    AKERA
Sbjct  297  KEFIDTNMKRLIERQDVWLEKLTKVIEDKEEQRMMKEEEWRKIEAARIDKEHLFWAKERA  356

Query  339  iaeakdaaviAFLQKISKQPILVPHKPQSE------DVQEFAAQTKENGSGDT---TIss  187
              EA+D AVI  LQ ++ +P++ P     E      +++  +    ENGS  T    +S 
Sbjct  357  RMEARDVAVIEALQYLTGKPLIKPLCSSPEEINGNNEIRNNSENQNENGSDQTMTNNVSV  416

Query  186  ssssSRWPKPEIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAKRCK  19
              SSS W + EI  L++IRT++D    +     S   LWE I++++ +LG+D R+A  CK
Sbjct  417  KGSSSCWDEQEILKLMEIRTSMDSAFQEILGGCSDEFLWEQIASKLIQLGFDQRSALLCK  476

Query  18   EKWENI  1
            EKWE I
Sbjct  477  EKWEWI  482



>ref|XP_010089408.1| Trihelix transcription factor GT-2 [Morus notabilis]
 gb|EXB37761.1| Trihelix transcription factor GT-2 [Morus notabilis]
Length=600

 Score =   172 bits (437),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 204/354 (58%), Gaps = 23/354 (6%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  149  RWPRQETLTLLEIRSRLDSKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  208

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+++TKEG++GRQ GK+YRFF QLE     ++ N++            +   +    P++
Sbjct  209  YYKKTKEGKAGRQDGKHYRFFRQLEALYG-ETGNQVSVPDHQTQYMSNNLQFLTSTNPSS  267

Query  639  N------IVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGY--FEKMMKEVL  484
            +      +  +   + H   + ++     +S++  +  S  RK +  G   ++  +KE +
Sbjct  268  STHHQDQLAYNNNNQSHNSLSLSNSSEFESSSSDDNDSSEKRKNRRGGSRGWKAKIKEFI  327

Query  483  EKQ----EDLQKKFLEAI----ERCENERMAREEAWKKQEIERLKREQESLakeraiaea  328
            + Q     + Q+ +LE +    E+ E ER  REE W+KQE  R+++E +  AKERA  EA
Sbjct  328  DAQMRKLMEKQEAWLEKLVKTLEQKEKERSLREEEWRKQEAARIEKEHKFWAKERAWIEA  387

Query  327  kdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDT----TIssssssSRWPK  160
            +D+A++  L+ I+ + I       S    +   Q  +   G T      ++    S W +
Sbjct  388  RDSALMDALKNITGKEIDYKGIVLSSSPDQGLNQDHDQDHGSTEIENNNNNIHHQSNWLE  447

Query  159  PEIEALIQIRTNLDLQHHDNG-SKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            PEI  LIQ+RT++D +    G S+  LWEDI+A+M  LGYDRN   C+EKWE+I
Sbjct  448  PEITRLIQLRTSMDSRFSQGGFSEEVLWEDIAAKMACLGYDRNGFMCREKWESI  501



>emb|CDX87564.1| BnaA07g33090D [Brassica napus]
Length=427

 Score =   170 bits (430),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 119/249 (48%), Positives = 168/249 (67%), Gaps = 10/249 (4%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET+ LLKIRS+M +AFRD++ KGPLW+EVSRKM E GY R+AKKC+EKFEN+YKY
Sbjct  58   RWPRQETVALLKIRSDMGIAFRDASAKGPLWEEVSRKMGELGYIRNAKKCKEKFENVYKY  117

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA---------MQSHNKIGGaaaaeppelaspsp  664
            H+RTKEGR+G+  GK YRFF+QLE  +          ++ HN      +  PP   +  P
Sbjct  118  HKRTKEGRTGKSEGKTYRFFDQLEALETHHQHQPQPPLRPHNNNSSMFSTPPPVTTTIIP  177

Query  663  vAMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKL-AGYFEKMMKEV  487
                    NI  DF        + +   S+        G +  ++++    +FE++MK+V
Sbjct  178  PTTTPSFPNISGDFMSDNSTSSSSSYSTSSDVDIGGGGGRNKKKRKRKWKEFFERLMKQV  237

Query  486  LEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviA  307
            ++KQE+LQ++FLEA+E+ E ERMAREE+W+ QEI R+ RE+E LA+ER+++ AKDAAV+A
Sbjct  238  VDKQEELQRQFLEAVEKRERERMAREESWRAQEIARINREREILAQERSMSAAKDAAVMA  297

Query  306  FLQKISKQP  280
            FLQK S++P
Sbjct  298  FLQKFSEKP  306


 Score = 74.3 bits (181),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++ +   D  +KGPLWE++S +M +LGY RNAK+CKEK+EN+
Sbjct  58   RWPRQETVALLKIRSDMGIAFRDASAKGPLWEEVSRKMGELGYIRNAKKCKEKFENV  114



>emb|CDX85981.1| BnaC06g21530D [Brassica napus]
Length=365

 Score =   168 bits (425),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 108/259 (42%), Positives = 155/259 (60%), Gaps = 16/259 (6%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EETL LL+IRSEMD  FRD+TLK PLW+ VSRK+ E GY+RSAKKC+EKFEN+ KY
Sbjct  69   RWPREETLALLRIRSEMDSTFRDATLKAPLWEHVSRKLLELGYKRSAKKCKEKFENVQKY  128

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIK----  649
            ++RTKE R GR  GK Y+FF QLE  +     + +     +    +  P   +       
Sbjct  129  YKRTKETRGGRHDGKAYKFFSQLEALNTTPPSSSLDATPLSVANPIQPPPSSSQFPVFPL  188

Query  648  ----PNTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKR-------KLAGYFEK  502
                P+            G G+D D           +G SS +++       K+   F+ 
Sbjct  189  PQTLPHMTFSSHSSSTASGMGSDDDDDEEDIMDVDQAGPSSRKRKRGNRGGGKMMELFDG  248

Query  501  MMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakd  322
            ++++V++KQ  +Q+ FLEA+E+ E ER+ REEAWK+QE+ RL RE E +++ERA + ++D
Sbjct  249  LVRQVMQKQASMQRSFLEALEKREQERLHREEAWKRQEMSRLAREHEIMSQERAASASRD  308

Query  321  aaviAFLQKISKQPI-LVP  268
            AA+I+ +QKI+   I L P
Sbjct  309  AAIISMIQKITGHTIQLAP  327


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D   K PLWE +S ++ +LGY R+AK+CKEK+EN+
Sbjct  69   RWPREETLALLRIRSEMDSTFRDATLKAPLWEHVSRKLLELGYKRSAKKCKEKFENV  125



>ref|XP_006588827.1| PREDICTED: trihelix transcription factor PTL-like isoform X1 
[Glycine max]
Length=594

 Score =   172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 135/360 (38%), Positives = 199/360 (55%), Gaps = 28/360 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  128  RWPRQETLTLLEIRSRLDPKFKEANHKGPLWDEVSRIMCEEHGYQRSGKKCREKFENLYK  187

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH-------NKIGGaaaaeppelaspspv  661
            Y+++TKEG++GR  GK+YRFF QLE      S+       N + G+   + P   +    
Sbjct  188  YYKKTKEGKAGRHDGKHYRFFRQLEALYGENSNTVSVPETNVVVGSIHFQGPSQTNQDNN  247

Query  660  AMIKPNTNIVQ-------------DFRMRPHGFGADADVLsaststtyssggssGRKRKL  520
                 N N  +             D        G D  + + S             K K+
Sbjct  248  KFQSHNNNNNRHCDSLSLTNSTNFDTSTSEGHDGNDHSMENESMEKRIKRKSGRSWKVKI  307

Query  519  AGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakera  340
              + +  M++++EKQ++   K ++ +E  E ERM REE W+KQE  RL+REQ+  AKERA
Sbjct  308  KDFIDSQMRKLVEKQKEWLDKLVKTLEEKEKERMLREEEWRKQEANRLEREQKFWAKERA  367

Query  339  iaeakdaaviAFLQKISKQPIL-VPHKPQSE-DVQEFAAQTKENGSGDTTIssssssSR-  169
              EA+DAA++  L K++ + I+ V   P+   +V   A    +N   ++ I +SS+  R 
Sbjct  368  WIEARDAALMEALHKLTGREIMKVETDPEGTINVMTAAEVQNQNNEDESEILNSSNVIRG  427

Query  168  ---WPKPEIEALIQIRTNLDLQH-HDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
               W + EI  L Q+R  ++ +  +   S+   W+ ++ +M   GY+R+A  CKEKWE+I
Sbjct  428  ADSWQESEITRLEQLRAEMETRFPYSEISEEVSWDVVATKMADFGYERSALMCKEKWESI  487



>gb|AAS64746.1| trihelix transcription factor [Arabidopsis thaliana]
Length=591

 Score =   172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 202/364 (55%), Gaps = 33/364 (9%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  119  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  178

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+R+TKEG++GRQ GK+YRFF QLE      S+N +           ++        P  
Sbjct  179  YYRKTKEGKAGRQDGKHYRFFRQLEALYG-DSNNLVSCPNHNTQFMSSALHGFHTQNPMN  237

Query  639  NIVQDFRMRP----HGF-----------GADADVLsaststtyssggssGR--KRKLAGY  511
                   +      HGF            ++ +++++S+    SS     R  K K+  +
Sbjct  238  VTTTTSNIHNVDSVHGFHQSLSLSNNYNSSELELMTSSSEGNDSSSRRKKRSWKAKIKEF  297

Query  510  FEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiae  331
             +  MK ++E+Q+   +K  + IE  E +RM +EE W+K E  R+ +E    AKERA  E
Sbjct  298  IDTNMKRLIERQDVWLEKLTKVIEDKEEQRMMKEEEWRKIEAARIDKEHLFWAKERARME  357

Query  330  akdaaviAFLQKISKQPILVPHKPQSE-------DVQEFAAQTKENGSGDT---TIssss  181
            A+D AVI  LQ ++ +P++ P     E       +++  +    ENGS  T    +    
Sbjct  358  ARDVAVIEALQYLTGKPLIKPLCSSPEERTNGNNEIRNNSETQNENGSDQTMTNNVCVKG  417

Query  180  ssSRWPKPEIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAKRCKEK  13
            SSS W + EI  L++IRT++D    +     S   LWE+I+ ++ +LG+D R+A  CKEK
Sbjct  418  SSSCWGEQEILKLMEIRTSMDSTFQEILGGCSDEFLWEEIAVKLIQLGFDQRSALLCKEK  477

Query  12   WENI  1
            WE I
Sbjct  478  WEWI  481



>gb|KHN45678.1| Trihelix transcription factor GT-2 [Glycine soja]
Length=592

 Score =   172 bits (435),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 135/360 (38%), Positives = 199/360 (55%), Gaps = 28/360 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  126  RWPRQETLTLLEIRSRLDPKFKEANHKGPLWDEVSRIMCEEHGYQRSGKKCREKFENLYK  185

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH-------NKIGGaaaaeppelaspspv  661
            Y+++TKEG++GR  GK+YRFF QLE      S+       N + G+   + P   +    
Sbjct  186  YYKKTKEGKAGRHDGKHYRFFRQLEALYGENSNTVSVPETNVVVGSIHFQGPSQTNQDNN  245

Query  660  AMIKPNTNIVQ-------------DFRMRPHGFGADADVLsaststtyssggssGRKRKL  520
                 N N  +             D        G D  + + S             K K+
Sbjct  246  KFQSHNNNNNRHCDSLSLTNSTNFDTSTSEGHDGNDHSMENESMEKRIKRKSGRSWKVKI  305

Query  519  AGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakera  340
              + +  M++++EKQ++   K ++ +E  E ERM REE W+KQE  RL+REQ+  AKERA
Sbjct  306  KDFIDSQMRKLVEKQKEWLDKLVKTLEEKEKERMLREEEWRKQEANRLEREQKFWAKERA  365

Query  339  iaeakdaaviAFLQKISKQPIL-VPHKPQSE-DVQEFAAQTKENGSGDTTIssssssSR-  169
              EA+DAA++  L K++ + I+ V   P+   +V   A    +N   ++ I +SS+  R 
Sbjct  366  WIEARDAALMEALHKLTGREIMKVETDPEGTINVMTAAEVQNQNNEDESEILNSSNVIRG  425

Query  168  ---WPKPEIEALIQIRTNLDLQH-HDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
               W + EI  L Q+R  ++ +  +   S+   W+ ++ +M   GY+R+A  CKEKWE+I
Sbjct  426  ADSWQESEITRLEQLRAEMETRFPYSEISEEVSWDVVATKMADFGYERSALMCKEKWESI  485



>ref|XP_008813676.1| PREDICTED: trihelix transcription factor PTL-like [Phoenix dactylifera]
Length=511

 Score =   170 bits (431),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 137/361 (38%), Positives = 196/361 (54%), Gaps = 42/361 (12%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL++R+ +D  FR++  K PLWDEVSR M EE GYQRS +KCREK EN+YK
Sbjct  78   RWPRQETLTLLEVRARLDSRFREAAHKAPLWDEVSRIMAEENGYQRSGRKCREKLENLYK  137

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+++TKEG++GRQ GK+YRFF QLE   A+   N              S +  A  +P  
Sbjct  138  YYKKTKEGKAGRQDGKHYRFFRQLE---ALYGGNNNAITNKPLLHATTSSATQANNEPLQ  194

Query  639  NIVQDFRMRPHG-FGADA-------------DVLsaststtyssggssGRKR-------K  523
             + +   +     FG+ +              +L+  ++      G+   KR       K
Sbjct  195  ALYESLVLSNSTEFGSSSTEEDGGEEGEDQNTILAFQSNELDMEKGTRSSKRSRNSWQSK  254

Query  522  LAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLaker  343
            +  + +  ++  +E QE   +K L  +E+ E ER++REEAW+KQE  RL RE    A E+
Sbjct  255  IKEFVDIQVRRFMEVQEAWLEKMLNTLEQMEQERISREEAWRKQEAARLDREYRLWASEK  314

Query  342  aiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAA------QTKENGSGDTTIssss  181
            A  EA+D+A++  L+KIS++ +    KPQ    +EFA+          NG        + 
Sbjct  315  AWIEARDSAIMEALEKISRREM----KPQ---FREFASIGILEGDVNHNGMESEIAHGNL  367

Query  180  ssSRWPKPEIEAL-IQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWEN  4
            SS RW   EI  L   I++ L    H   +KG LWE+ISA M  LGYD ++K CK+K E 
Sbjct  368  SSRRWLDSEIIGLKASIKSKLQEGGH---AKGDLWEEISAAMACLGYDPSSKGCKDKLEE  424

Query  3    I  1
            I
Sbjct  425  I  425



>ref|XP_006398825.1| hypothetical protein EUTSA_v10013048mg [Eutrema salsugineum]
 gb|ESQ40278.1| hypothetical protein EUTSA_v10013048mg [Eutrema salsugineum]
Length=591

 Score =   171 bits (434),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 139/368 (38%), Positives = 205/368 (56%), Gaps = 40/368 (11%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  121  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  180

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEV-------FDAMQSHNKIGGaaaaeppelaspspv  661
            Y+R+TKEG++GRQ GK+YRFF QLE          +  +HN    + A       +    
Sbjct  181  YYRKTKEGKAGRQDGKHYRFFRQLEALYGDSNNLVSCTNHNTQFMSNALHGFHTQAAMNA  240

Query  660  AMIKPNTNIVQDFRMRPHGF------------GADADVLsaststtyssggssGR--KRK  523
                 N + V       HGF             ++ +++++S+    SS     R  K K
Sbjct  241  TTTTSNIHNVDSV----HGFHHQSLSLSNNYNSSELELMTSSSEGNDSSSRRKKRSWKAK  296

Query  522  LAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLaker  343
            +  + +  MK ++E+Q+   +K  + IE  E +RM +EE W+K E  R+++E    AKER
Sbjct  297  IKEFIDVNMKRLIERQDVWLEKLTKVIEDKEEQRMMKEEEWRKIEAARIEKEHLFWAKER  356

Query  342  aiaeakdaaviAFLQKISKQPILVPHKPQSE-------DVQEFAAQTKENGSGDT---TI  193
               EA+D AVI  LQ ++ + ++ P     E       ++Q+ +    +NGS  T    +
Sbjct  357  ERMEARDVAVIEALQYLTGKSLIKPLCSSPEERINGNNEIQKNSENQNDNGSDQTMTNNV  416

Query  192  ssssssSRWPKPEIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAKR  25
            S   S S W + EI  L++IRT+LD    +     S   LWE+++A++ +LG++ R+A  
Sbjct  417  SIKGSGSCWNEQEIIKLMEIRTSLDSAFQEILGGCSDEFLWEEVAAKLIQLGFEQRSALM  476

Query  24   CKEKWENI  1
            CKEKWE I
Sbjct  477  CKEKWECI  484



>gb|KHG27281.1| Trihelix transcription factor GT-2 -like protein [Gossypium arboreum]
Length=515

 Score =   169 bits (427),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 121/348 (35%), Positives = 190/348 (55%), Gaps = 50/348 (14%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M E+ GYQRS KKCREKFEN+YK
Sbjct  126  RWPRQETLTLLEIRSRLDPKFKEANQKGPLWDEVSRIMCEDHGYQRSGKKCREKFENLYK  185

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVF-----DAMQSHNKIGGaaaaeppelaspspvAM  655
            Y+++TKEG++GRQ GK+YRFF QLE       +++  H   G +      +  +      
Sbjct  186  YYKKTKEGKAGRQDGKHYRFFRQLEALYGESSNSVSGHQFTGNSFGFHGTQNCNIGHSQK  245

Query  654  IKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGR----------KRKLAGYFE  505
            +  + ++   F   P     D D+ +       SS     +          K K+  + +
Sbjct  246  LCDSLSLSNSFEFEPSS-SDDNDLSTEMEINGGSSEKRKKKRSSGSSSKCWKAKIKEFID  304

Query  504  KMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeak  325
              M++++++QE   +K  + +E  E ER+ REE W+K+E  R++REQ+  AKERA  EA+
Sbjct  305  LQMRKLMDRQETWLEKLTKTLEEKEKERVLREEQWRKEEAARIEREQKLWAKERARIEAR  364

Query  324  daaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEA  145
            D+A++  LQ ++ + +    KP                              W + E+  
Sbjct  365  DSALMEALQNLTGKQLKDIVKPDD----------------------------WQETEVSR  396

Query  144  LIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            LIQ++T +     +  S+  LWE+++A+M  LG++++A  CK KWE+I
Sbjct  397  LIQLKTTM-----EGCSEEILWEEVAAKMACLGFEKSALMCKTKWESI  439



>ref|XP_009125516.1| PREDICTED: trihelix transcription factor PTL-like isoform X2 
[Brassica rapa]
Length=562

 Score =   168 bits (425),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 132/358 (37%), Positives = 192/358 (54%), Gaps = 48/358 (13%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  123  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  182

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDA-------MQSHNKIGGaaaaeppelaspspv  661
            Y+++T+EG++GRQ GK+YRFF QLE             SHN    + A       +   V
Sbjct  183  YYKKTREGKAGRQDGKHYRFFRQLEALYGDSNNLVPCPSHNTQFMSNALHGFHTQNGMNV  242

Query  660  AMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGR--------------KRK  523
                 N + V       HGF + +  LS + +++     +S                K K
Sbjct  243  TTTTSNIHNVDSV----HGFHSQSLSLSNNYNSSELELMTSSSEGNDSSRRRKKRSWKNK  298

Query  522  LAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLaker  343
            +  + +  MK ++E Q+   +K  + IE  E +RM +EE W+K E  R+ +E    +KER
Sbjct  299  IKEFIDVNMKRLIESQDVWLEKLTKVIEDKEEQRMMKEEEWRKSEAARIAKEHLFWSKER  358

Query  342  aiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWP  163
               EA+D AVI  LQ ++ + ++ P     E+        + NGSG            W 
Sbjct  359  ERMEARDVAVIEALQFLTGKTLIKPLCSSPEE--------RINGSGSC----------WN  400

Query  162  KPEIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAKRCKEKWENI  1
            + EI  L++IRT++D    +     S   LWE+++ +M +LG+D ++A  CKEKWE I
Sbjct  401  EQEITKLMEIRTSMDSAFQEILGGCSDDFLWEEVAGKMAQLGFDQKSALLCKEKWEWI  458



>ref|XP_008231992.1| PREDICTED: trihelix transcription factor PTL-like [Prunus mume]
Length=460

 Score =   166 bits (420),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 129/369 (35%), Positives = 180/369 (49%), Gaps = 50/369 (14%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKC+EKFEN+YK
Sbjct  13   RWPRQETLTLLEIRSGLDSKFKETNQKGPLWDEVSRIMGEEHGYQRSGKKCKEKFENLYK  72

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKP-N  643
            Y+++TKEG++GRQ GK+YRFF QLE     Q+ N+        P      +P   + P N
Sbjct  73   YYKKTKEGKAGRQDGKHYRFFRQLEAIYGDQTSNQSSTYGRLNPRLYHHTTPNDTVNPKN  132

Query  642  TNIVQD-----------------FRMRPHGFGADADV----------------Lsastst  562
              +VQD                 F         D D+                L     +
Sbjct  133  QEVVQDQKHISCESLSFSNNSTEFDQTSSSENNDDDLSISAIDYFMMNQSMGSLKNEKQS  192

Query  561  tyssggssGRKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIE  382
                      K K+  +    + +V+  QE   +K L++IE  E ER+A+EE W+KQ+  
Sbjct  193  CARPINKKSWKAKVEDFVNSQIGKVINTQEAWMEKMLKSIEHREEERIAQEEEWRKQQAA  252

Query  381  RLKREQESLakeraiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGD  202
            +  RE      +         A I        +P +  H    +D+             D
Sbjct  253  KFDREVHEFWAKERAWVESRDAAIMEALGTFSRPGISNHDKDKDDISNLQIPY------D  306

Query  201  TTIssssssSRWPKPEIEALIQ-IRTNLDLQHHDNGS-KGPLWEDISAEMKKLGYDRNAK  28
            T        +RW + E+ +LI+ IRT+L+L   D G  K  LWE+I+A+M  LGY R+  
Sbjct  307  TI-------NRWTEHEVASLIKLIRTSLELTIQDGGCFKEGLWEEIAAKMGCLGYRRSVG  359

Query  27   RCKEKWENI  1
             CKEKWEN+
Sbjct  360  ECKEKWENM  368


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 52/93 (56%), Gaps = 3/93 (3%)
 Frame = -3

Query  996  RWPHEETLTLLK-IRSEMDLAFRDS-TLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIY  823
            RW   E  +L+K IR+ ++L  +D    K  LW+E++ KM   GY+RS  +C+EK+EN+ 
Sbjct  310  RWTEHEVASLIKLIRTSLELTIQDGGCFKEGLWEEIAAKMGCLGYRRSVGECKEKWENMS  369

Query  822  KYHRRTKE-GRSGRQTGKNYRFFEQLEVFDAMQ  727
             + R T E  +  +Q  K   +  QL  ++  Q
Sbjct  370  VFPRMTAECNKKHKQDAKANMYHGQLSCYEGQQ  402



>ref|XP_009125515.1| PREDICTED: trihelix transcription factor PTL-like isoform X1 
[Brassica rapa]
Length=590

 Score =   167 bits (424),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 136/368 (37%), Positives = 199/368 (54%), Gaps = 40/368 (11%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  123  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  182

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDA-------MQSHNKIGGaaaaeppelaspspv  661
            Y+++T+EG++GRQ GK+YRFF QLE             SHN    + A       +   V
Sbjct  183  YYKKTREGKAGRQDGKHYRFFRQLEALYGDSNNLVPCPSHNTQFMSNALHGFHTQNGMNV  242

Query  660  AMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGR--------------KRK  523
                 N + V       HGF + +  LS + +++     +S                K K
Sbjct  243  TTTTSNIHNVDSV----HGFHSQSLSLSNNYNSSELELMTSSSEGNDSSRRRKKRSWKNK  298

Query  522  LAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLaker  343
            +  + +  MK ++E Q+   +K  + IE  E +RM +EE W+K E  R+ +E    +KER
Sbjct  299  IKEFIDVNMKRLIESQDVWLEKLTKVIEDKEEQRMMKEEEWRKSEAARIAKEHLFWSKER  358

Query  342  aiaeakdaaviAFLQKISKQPILVPHKPQSE-------DVQEFAAQTKENGSGDT---TI  193
               EA+D AVI  LQ ++ + ++ P     E       ++Q+ +    EN S  T    +
Sbjct  359  ERMEARDVAVIEALQFLTGKTLIKPLCSSPEERINGNIEIQKNSENQNENESDQTMTNNV  418

Query  192  ssssssSRWPKPEIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAKR  25
            S   S S W + EI  L++IRT++D    +     S   LWE+++ +M +LG+D ++A  
Sbjct  419  SIEGSGSCWNEQEITKLMEIRTSMDSAFQEILGGCSDDFLWEEVAGKMAQLGFDQKSALL  478

Query  24   CKEKWENI  1
            CKEKWE I
Sbjct  479  CKEKWEWI  486



>ref|XP_009130776.1| PREDICTED: trihelix transcription factor PTL-like [Brassica rapa]
Length=573

 Score =   167 bits (423),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 130/356 (37%), Positives = 195/356 (55%), Gaps = 29/356 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGP WDEVSR M EE+GYQRS KKCREKFEN+YK
Sbjct  117  RWPRQETLTLLEIRSRLDHKFKEANQKGPFWDEVSRIMSEEYGYQRSGKKCREKFENLYK  176

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIG----GaaaaeppelaspspvAMI  652
            Y+++TKEG++GRQ GK+YRFF QLE      S+N +                       I
Sbjct  177  YYKKTKEGKAGRQDGKHYRFFRQLEALYG-DSNNLVSFPNHNTQFMSHALGFHTQNAMNI  235

Query  651  KPNTNIVQDFRMRPHGF-------------GADADVLsaststtyssggssGR--KRKLA  517
               T+ + D     HG               ++ +++++S+    S      R  K K+ 
Sbjct  236  TATTSNIHDVD-SAHGLLHHQSLSISNNYNSSELELMTSSSEGNDSDSRRKKRSWKAKIK  294

Query  516  GYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakerai  337
             + +  MK ++E+Q+   +K  + IE  E +RM +EE W+K E  R+++     AKER  
Sbjct  295  EFIDVNMKRLIERQDIWLEKLTKVIEDKEEQRMMKEEEWRKSEAARVEQVHLFWAKERER  354

Query  336  aeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKP  157
             EA+D AV+  LQ ++ + ++   KP     +E      E  +    +S   S S W + 
Sbjct  355  MEARDVAVLEALQYLAGKTLI---KPSCSSPEERINGNNEIQNNSENVSLEGSGSCWNEQ  411

Query  156  EIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAKRCKEKWENI  1
            EI  L++IRT++D    +     S   LWE++SA++ +LG+D ++A  CKEKWE I
Sbjct  412  EIIKLMEIRTSMDTAFQEILGECSDEFLWEEVSAKLIQLGFDHKSALSCKEKWECI  467



>emb|CBI18200.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   166 bits (420),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 135/174 (78%), Gaps = 16/174 (9%)
 Frame = -3

Query  516  GYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakerai  337
             +F+++MK+V+E+QE+LQK+FLEAIE+ E++RM REEAWK QE+ R+ RE E L +ER+I
Sbjct  181  AFFQRLMKDVIERQEELQKRFLEAIEKREHDRMVREEAWKMQEMARMNREHELLVQERSI  240

Query  336  aeakdaaviAFLQKISKQ--PILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWP  163
            A AKDAAVIAFLQKIS+Q  P+L P K              +NG G   +  +SSS RWP
Sbjct  241  AAAKDAAVIAFLQKISEQQNPVLEPRK-------------MDNGGGAENLVPTSSS-RWP  286

Query  162  KPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            K E++ALI++RT+LD+++ +NG KGPLWE+ISA M+KLGY+RNAKRCKEKWENI
Sbjct  287  KAEVQALIRLRTSLDVKYQENGPKGPLWEEISAGMRKLGYNRNAKRCKEKWENI  340


 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  948  MDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKYHRRTKEGRSGRQTGKN  769
            MD+ FRDS+LKGPLW+EVSRK+ E GY RSAKKC+EKFEN++KYHRRTKEGR+ +  GK 
Sbjct  1    MDVTFRDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVFKYHRRTKEGRASKADGKT  60

Query  768  YRFFEQLEVFDAMQS  724
            YRFF+QLE  +   S
Sbjct  61   YRFFDQLEALETQPS  75


 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+++R+ +D+ ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  284  RWPKAEVQALIRLRTSLDVKYQENGPKGPLWEEISAGMRKLGYNRNAKRCKEKWENINKY  343

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QLE  
Sbjct  344  FKKVKESNKKRPEDSKTCPYFHQLEAL  370


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  LDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            +D+   D+  KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  1    MDVTFRDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENV  41



>emb|CDP11393.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   165 bits (418),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 136/183 (74%), Gaps = 7/183 (4%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +FE++MK V++KQE+LQKKFL+ +E+ E +RM REEAW+ QE+ R+ RE + L
Sbjct  184  RKRKWKDFFERLMKNVIDKQEELQKKFLDTLEKRERDRMIREEAWRVQEMARINREHDLL  243

Query  354  akeraiaeakdaaviAFLQKISKQPILVPHKPQSEDVQ-----EFAAQTKENGSGDTTIs  190
             +ER++A AKDAAVIAFLQKI++Q    P+ P S  +Q     +    T+   +   T  
Sbjct  244  VQERSMAAAKDAAVIAFLQKITEQ--QNPNNPNSTPIQLPAQLQLPETTRIPPAPPPTNF  301

Query  189  sssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKW  10
               SSSRWPK E++ALI++RTNLD+++ +NG KGPLWE+IS+ M+KLGY+RNAKRCKEKW
Sbjct  302  MQPSSSRWPKAEVQALIRMRTNLDVKYQENGPKGPLWEEISSGMRKLGYNRNAKRCKEKW  361

Query  9    ENI  1
            ENI
Sbjct  362  ENI  364


 Score =   122 bits (305),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  948  MDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKYHRRTKEGRSGRQTGKN  769
            MD+AFRDS+LKGPLW+EVSRKM E GYQRS+KKC+EKFEN++KYH+RTKEGR+ +  GK 
Sbjct  1    MDVAFRDSSLKGPLWEEVSRKMAELGYQRSSKKCKEKFENVFKYHKRTKEGRASKADGKT  60

Query  768  YRFFEQLEVFDAMQS  724
            YRFF+QLE  +   S
Sbjct  61   YRFFDQLEALETNPS  75


 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+++R+ +D+ ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  308  RWPKAEVQALIRMRTNLDVKYQENGPKGPLWEEISSGMRKLGYNRNAKRCKEKWENINKY  367

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  368  FKKVKESNKKRPEDSKTCPYFHQLDAL  394


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  LDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            +D+   D+  KGPLWE++S +M +LGY R++K+CKEK+EN+
Sbjct  1    MDVAFRDSSLKGPLWEEVSRKMAELGYQRSSKKCKEKFENV  41



>ref|XP_002528594.1| transcription factor, putative [Ricinus communis]
 gb|EEF33802.1| transcription factor, putative [Ricinus communis]
Length=529

 Score =   165 bits (417),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 132/360 (37%), Positives = 207/360 (58%), Gaps = 29/360 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  81   RWPRQETLTLLEIRSRLDSKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  140

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNK-------IGGaaaaeppelaspspv  661
            Y+++TKEG++GRQ GK+YRFF QLE      S+         +G +   +     S    
Sbjct  141  YYKKTKEGKAGRQDGKHYRFFRQLEALYGETSNPASVPDTQFVGNSLRFQSAANTSTQAN  200

Query  660  AMIKPNTNIVQDFRM-RPHGFGADA----DVLsaststtyssggssGR------KRKLAG  514
                 +  +          GF   +    D+ +A+     S      R      K K+  
Sbjct  201  HEAHHSQKLCDSLSFSNSSGFDTSSSEENDLSTATLVENDSMEKRRKRRDGKSWKAKIKE  260

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            + +  M++++E+QE    K  + +E+ E +RM REE W++QE  R+ RE +  AKERA  
Sbjct  261  FIDSQMRKLIERQEAWLDKLTKTLEQKEQQRMLREEEWRRQESARIDREHKFWAKERAWI  320

Query  333  eakdaaviAFLQKISKQPILVPHKPQ----SEDVQEFAAQTKENGSGDTTIsssss--sS  172
            EA+DAA++  L+K++ +  +    P+    ++ +++ +    ENGS D TI ++      
Sbjct  321  EARDAALMEALKKLTGRDQVDASSPEEQVGTQTIRKRSENLIENGS-DQTIHNNVKGDHH  379

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGS---KGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             WP+ E+  L+Q R++++ + + +G    +  LWE+I+AEM  +GY+R+A  CKEKW+++
Sbjct  380  SWPENEVTRLMQFRSSMESRFNQSGCIEEEEALWEEIAAEMACIGYERSALMCKEKWDSV  439



>gb|KDP45019.1| hypothetical protein JCGZ_01519 [Jatropha curcas]
Length=556

 Score =   164 bits (416),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 137/368 (37%), Positives = 198/368 (54%), Gaps = 40/368 (11%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  110  RWPRQETLTLLEIRSRLDSRFKEANQKGPLWDEVSRIMAEEHGYQRSGKKCREKFENLYK  169

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+++TKEG++GRQ GK+YRFF QLE     ++ N++  ++        + +      P  
Sbjct  170  YYKKTKEGKAGRQDGKHYRFFRQLEALYG-ETSNQLASSSETHLVNDTNRTSFLYPTP--  226

Query  639  NIVQDFRMRPHGF--GADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQE--  472
             I  + + R   F    +++ LS S ++ + +  S      L+     MM   + K +  
Sbjct  227  -INPENKERSLSFQENKNSESLSLSNTSEFETSSSDNNDDDLSAIAYDMMNRKIGKPKGR  285

Query  471  -------------DLQ-KKFLE-----------AIERCENERMAREEAWKKQEIERLKRE  367
                         DLQ  K LE            IE  E ER+ REE W KQE+ RL + 
Sbjct  286  LKKGWKGKVKDFVDLQMGKLLEKQEAWMERMLKTIEDREKERICREEEWAKQEMARLDQI  345

Query  366  QESLakeraiaeakdaaviAFLQKIS---KQPILVPHKPQSEDVQEFAAQTKENGSGDTT  196
             E  AKERA  EA+D A++  L+K +   ++  L     Q   V +   + K+  +    
Sbjct  346  HEYWAKERARIEARDVALMEELKKYADNCERLGLSSSVEQIVRVTQTHYKNKDQRNAKKI  405

Query  195  IssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGP---LWEDISAEMKKLGYDRNAKR  25
                 +  RW  PEI +LIQIRT ++ +  ++ S      LWE+I+++M  LGYDR+ + 
Sbjct  406  DIDEINFGRWSDPEICSLIQIRTAMEARFQESSSGYSEEFLWEEIASKMGSLGYDRDVEE  465

Query  24   CKEKWENI  1
             KEKWEN+
Sbjct  466  IKEKWENM  473



>gb|KHN48185.1| Trihelix transcription factor GT-2 [Glycine soja]
Length=607

 Score =   165 bits (417),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 129/370 (35%), Positives = 193/370 (52%), Gaps = 38/370 (10%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GY+RS KKCREKFEN+YK
Sbjct  135  RWPRQETLTLLEIRSRLDPKFKEANHKGPLWDEVSRIMCEEHGYKRSGKKCREKFENLYK  194

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN--------KIGGaaaaeppelaspsp  664
            Y+++TKEG++GR  GK+YRFF QLE      S+          +G       P   +   
Sbjct  195  YYKKTKEGKAGRHDGKHYRFFRQLEALYGENSNTVSLPETNVAVGSIHFQGSPSQTNQDN  254

Query  663  vAMIKPNTNIVQDFR----MRPHGFGADAD----VLsaststtyssggssGRKRK-----  523
                  N N  +            FG            S     +      RKRK     
Sbjct  255  NKFRSHNNNNTKHCDSLSLTNSSNFGTSTSEDDDGDGGSDHGMENESMEKRRKRKSGRSW  314

Query  522  ---LAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLa  352
               +  + +  M++++EKQ++   K ++ +E  E ERM REE W+KQE  RL+RE +  A
Sbjct  315  KVKIKDFIDSQMRKLVEKQKEWLDKLVKTLEEKEKERMLREEEWRKQEANRLEREHKFWA  374

Query  351  keraiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAA-------QTKENGSGDTTI  193
            KERA  EA+DAA++  L K++   I+ P       +    A       +  +N   ++ I
Sbjct  375  KERAWIEARDAALMEALHKLTGTEIMKPETDPEGTINAMPAEEVQNHRENNQNNEDESEI  434

Query  192  sssss-----sSRWPKPEIEALIQIRTNLDLQ-HHDNGSKGPLWEDISAEMKKLGYDRNA  31
             ++S+     +  W + EI  L Q+R  ++++  +   S+   W+ ++ +M   GY+R+A
Sbjct  435  LNNSNIVISGADSWQESEITRLQQLRAEMEIRFQYSEMSEEVSWDVVATKMACFGYERSA  494

Query  30   KRCKEKWENI  1
              CKEKWE+I
Sbjct  495  LMCKEKWESI  504



>ref|XP_010909888.1| PREDICTED: trihelix transcription factor PTL [Elaeis guineensis]
Length=525

 Score =   164 bits (414),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 135/362 (37%), Positives = 194/362 (54%), Gaps = 43/362 (12%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL++R+ +D  FR++  K  LWDEVSR M EE GYQRS +KCREK EN+YK
Sbjct  93   RWPRQETLTLLEVRARLDSRFREAAHKASLWDEVSRIMAEEHGYQRSGRKCREKLENLYK  152

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLE--------------VFDAMQSHNKIGGaaaaeppe  682
            Y+++TKEG++GRQ GK+YRFF QLE              +F A  S      A       
Sbjct  153  YYKKTKEGKAGRQNGKHYRFFRQLEALYGGNNNAITNKPLFHATNS--SATAANKELLQA  210

Query  681  laspspvAMIKPNTNIVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEK  502
                   +++  N++ +        G   D + + A  S        +   ++    ++ 
Sbjct  211  HRLYELESLVLSNSSDIGSVSTEEDG-EEDQNTIPALQSNELDMEKDTRTLKRSRNSWQS  269

Query  501  MMKEVLEKQE----DLQKKFLE----AIERCENERMAREEAWKKQEIERLKREQESLake  346
             +KE ++ Q     ++Q+ +LE     +E  E ER++REEAW+KQE  RL  E+   A E
Sbjct  270  KIKEFVDIQVRRFMEVQEAWLEKMLNTLEHMEQERISREEAWRKQEAARLDHERRLWASE  329

Query  345  raiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAA------QTKENGSGDTTIsss  184
            RA  EA+D A++  L+KIS++ +    KPQ    +EF +         +NG        +
Sbjct  330  RAWIEARDNAIMEALEKISRREM----KPQ---FREFTSIDILDDDVNQNGMESNITHGN  382

Query  183  sssSRWPKPEIEAL-IQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWE  7
             SS RW   EI  L  +I + L  + H   +KG LWE+ISA M  LGYD +AKRCK+K E
Sbjct  383  LSSRRWLDSEIICLKARIESKLQEEGH---AKGDLWEEISAAMACLGYDPSAKRCKDKLE  439

Query  6    NI  1
             I
Sbjct  440  EI  441



>ref|XP_010683862.1| PREDICTED: trihelix transcription factor PTL [Beta vulgaris subsp. 
vulgaris]
Length=499

 Score =   162 bits (411),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 134/360 (37%), Positives = 196/360 (54%), Gaps = 41/360 (11%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEV+R M EE GYQRS KKCREKFEN+YK
Sbjct  133  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVARIMSEEHGYQRSGKKCREKFENLYK  192

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+++TKEG++GRQ GK+YRFF QLE     Q +                   V     N 
Sbjct  193  YYKKTKEGKAGRQDGKHYRFFRQLEALYGDQHNTHHIHHPTTSDNTHHIAGNVPHFHNNP  252

Query  639  NIVQDFR--------MRPHGF-----------GADADV---LsaststtyssggssGRKR  526
            NI+            +RP               +D DV   + +         G    K 
Sbjct  253  NIIPSNLGNTDNHPILRPTSVSLSNSSEYETSSSDNDVGGSIESEEWKKKKKKGKRSWKA  312

Query  525  KLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLake  346
            K+  + +  M+++++KQE   +K ++ ++  E ERM REE W+KQE ER++RE +  A E
Sbjct  313  KVKEFIDYQMRKIMDKQEAWLEKMMKTLDSRERERMEREEEWRKQEGERIEREHKFWASE  372

Query  345  raiaeakdaaviAFLQKIS----KQPILVPHKPQSEDVQEFAAQTKENGSGDTTIsssss  178
            RA  EA+D+A++  L+K++    K+  +V  + +  D          N            
Sbjct  373  RAWIEARDSALMTALEKMTNSRDKEASIVVGRDRDRDHYHGRVGIIAN------------  420

Query  177  sSRWPKPEIEALIQIRTNLDLQHHDNG-SKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
              +W + E+  LIQ+RT+++ +    G S+  LWEDI+A+M  LGYDR+A  CKEKW++I
Sbjct  421  -DQWLETEVTRLIQLRTSMESRFQQCGFSEEVLWEDIAAKMAYLGYDRSAIVCKEKWDSI  479



>emb|CDY44379.1| BnaC02g02980D [Brassica napus]
Length=589

 Score =   162 bits (411),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 136/369 (37%), Positives = 202/369 (55%), Gaps = 41/369 (11%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  121  RWPRQETLTLLEIRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYQRSGKKCREKFENLYK  180

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDA-------MQSHN-KIGGaaaaeppelaspsp  664
            Y+++T+EG++GRQ GK+YRFF QLE             SHN +    A        + + 
Sbjct  181  YYKKTREGKAGRQDGKHYRFFRQLEALYGDSNNLVPCPSHNTQFMSNALHGFHTQNAMND  240

Query  663  vAMIKPNTNIVQDFRMRPHGF------------GADADVLsaststtyssggssGR--KR  526
            V     N + V       HGF             ++ +++++S+    SS     R  K 
Sbjct  241  VTTTTSNIHNVDSV----HGFHRQSLSLSNNYNSSELELVTSSSEGNDSSSRRKKRSWKN  296

Query  525  KLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLake  346
            K+  + +  MK ++E+Q+   +K  + IE  E +RM +EE W+K E  R+ +E    +KE
Sbjct  297  KIKEFIDVNMKRLMERQDVWLEKLTKVIEDKEEQRMMKEEEWRKSEAARIDKEHLFWSKE  356

Query  345  raiaeakdaaviAFLQKISKQPILVPHKPQSE-------DVQEFAAQTKENGSGDT---T  196
            R   EA+D AVI  LQ ++ + ++ P     E       ++Q+ +    EN S  T    
Sbjct  357  RERMEARDVAVIEALQFLTGKTLIKPLCSSPEERINGNNEIQKNSENQNENESDQTMTNN  416

Query  195  IssssssSRWPKPEIEALIQIRTNLDLQHHD---NGSKGPLWEDISAEMKKLGYD-RNAK  28
            +S   S S W +  I  L++IRT++D    +     S   LWE+++ +M +LG+D ++A 
Sbjct  417  VSIEGSGSCWNEQGITKLMEIRTSMDSAFQEILGGCSDDFLWEEVAGKMAQLGFDQKSAL  476

Query  27   RCKEKWENI  1
             CKEKWE I
Sbjct  477  LCKEKWEWI  485



>ref|XP_002522201.1| hypothetical protein RCOM_1731940 [Ricinus communis]
 gb|EEF40176.1| hypothetical protein RCOM_1731940 [Ricinus communis]
Length=408

 Score =   159 bits (403),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 132/182 (73%), Gaps = 14/182 (8%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++      +QE LQ+KFL+AIE+CE +RMAREEAWK QE++R+KRE+E L +ER+IA
Sbjct  120  FFEQLEALDNHQQESLQRKFLDAIEKCEQDRMAREEAWKMQELDRIKRERELLVQERSIA  179

Query  333  eakdaaviAFLQKISKQPILVPHKPQSEDVQ-----------EFAAQTKENGSGDTTIss  187
             AKDAAV++ LQK S Q   V   P+++ VQ           E   + +EN + +  +  
Sbjct  180  AAKDAAVLSILQKFSDQASSV-QLPENQIVQVQPTENQVVSIEKVVKAQENNNVENYVQL  238

Query  186  ssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWE  7
             S+  RWPK EIEALI++RTNLD+Q+ D+G KGPLWE+ISA MKKLGY+RNAKRCKEKWE
Sbjct  239  GST--RWPKEEIEALIRLRTNLDIQYQDSGPKGPLWEEISAAMKKLGYNRNAKRCKEKWE  296

Query  6    NI  1
            N+
Sbjct  297  NM  298


 Score =   150 bits (379),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD AFR++ LK PLWDEVSRK+ E GY RSAKKC+EKFENIYKY
Sbjct  42   RWPRQETLALLKIRSDMDFAFREAALKAPLWDEVSRKLSELGYNRSAKKCKEKFENIYKY  101

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQ  727
            HRRTKEGRSG+   K+YRFFEQLE  D  Q
Sbjct  102  HRRTKEGRSGKANCKSYRFFEQLEALDNHQ  131


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++R+ +D+ ++DS  KGPLW+E+S  M++ GY R+AK+C+EK+EN+ KY
Sbjct  242  RWPKEEIEALIRLRTNLDIQYQDSGPKGPLWEEISAAMKKLGYNRNAKRCKEKWENMNKY  301

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             +R KE    R    K   +F+QL+V 
Sbjct  302  FKRVKESNKRRPDDAKTCPYFQQLDVL  328


 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    +   K PLW+++S ++ +LGY+R+AK+CKEK+ENI
Sbjct  42   RWPRQETLALLKIRSDMDFAFREAALKAPLWDEVSRKLSELGYNRSAKKCKEKFENI  98



>ref|XP_011044212.1| PREDICTED: trihelix transcription factor GT-2-like [Populus euphratica]
Length=610

 Score =   161 bits (408),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 141/212 (67%), Gaps = 35/212 (17%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +FE++MKEV++KQE++QKKFLEAIER E+ERM REE+W+ QE+ R+ RE E L
Sbjct  281  RKRKWKDFFERLMKEVIQKQEEMQKKFLEAIERLEHERMVREESWRMQEMTRINRESEIL  340

Query  354  akeraiaeakdaaviAFLQKISKQPI------------------------LVPHKPQSED  247
            A+ER++A +K+A V+AFLQK+S++                          LVP  P    
Sbjct  341  AQERSVAASKNAEVMAFLQKLSEEQHPGQIQNNPPPSQPPRPPGRPPILQLVPTPPPPPP  400

Query  246  VQEFAAQTKE----------NGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNG  97
            +Q   A   +          + +GD   +S+S S RWPK E+EALI+IRTNLD ++ DNG
Sbjct  401  LQGAQAPLPQAVANVDMIMKSDNGDQNFTSASPS-RWPKVEVEALIRIRTNLDCKYQDNG  459

Query  96   SKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             KGPLWE+ISA M+KLGY+RNAKRCKEKWENI
Sbjct  460  PKGPLWEEISASMRKLGYNRNAKRCKEKWENI  491


 Score =   149 bits (377),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS MD+AFRD+++KGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  65   RWPRQETLALLKIRSGMDVAFRDASVKGPLWEEVSRKLAELGYNRSAKKCKEKFENVYKY  124

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA  733
            H+RTK+GR+G+Q GK YRFF+QLE F++
Sbjct  125  HKRTKDGRTGKQEGKTYRFFDQLEAFES  152


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 63/98 (64%), Gaps = 3/98 (3%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR+ +D  ++D+  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  435  RWPKVEVEALIRIRTNLDCKYQDNGPKGPLWEEISASMRKLGYNRNAKRCKEKWENINKY  494

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKIGG  706
             ++ KE +  R +  K   +F+QL+     +  NKI G
Sbjct  495  FKKVKESKKRRPEDSKTCPYFQQLDAL--YKEKNKIDG  530


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D   KGPLWE++S ++ +LGY+R+AK+CKEK+EN+
Sbjct  65   RWPRQETLALLKIRSGMDVAFRDASVKGPLWEEVSRKLAELGYNRSAKKCKEKFENV  121



>ref|XP_007220052.1| hypothetical protein PRUPE_ppa026265mg [Prunus persica]
 gb|EMJ21251.1| hypothetical protein PRUPE_ppa026265mg [Prunus persica]
Length=574

 Score =   160 bits (406),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 129/369 (35%), Positives = 180/369 (49%), Gaps = 50/369 (14%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKC+EKFEN+YK
Sbjct  122  RWPRQETLTLLEIRSGLDSKFKETNQKGPLWDEVSRIMGEEHGYQRSGKKCKEKFENLYK  181

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKP-N  643
            Y+++TKEG++GRQ GK+YRFF QLE     Q+ N+        P      +P   + P N
Sbjct  182  YYKKTKEGKAGRQDGKHYRFFRQLEAIYGDQTSNQSSTYGRLNPLLYHHTTPNDTVNPKN  241

Query  642  TNIVQD-----------------FRMRPHGFGADADV----------------Lsastst  562
              +VQD                 F         D D+                L     T
Sbjct  242  QEVVQDQKHISCESLSFSNNSTEFDQTSSSENNDDDLSISAIDYFMMNQSMGSLKNEKQT  301

Query  561  tyssggssGRKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIE  382
                      K K+  +    + +V+  QE   +K L++IE  E ER+A+EE W+KQ+  
Sbjct  302  CARPVNKKSWKAKVEDFVNSQIGKVINTQEAWMEKMLKSIEHREEERIAQEEEWRKQQAA  361

Query  381  RLKREQESLakeraiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGD  202
            +  RE      +         A I        +P +  H    +D+ +           D
Sbjct  362  KFDREVHEFWAKERAWVESRDAAIMEALGTFSRPGISNHDKDKDDISKLQIPN------D  415

Query  201  TTIssssssSRWPKPEIEALIQ-IRTNLDLQHHDNGS-KGPLWEDISAEMKKLGYDRNAK  28
            T        +RW + E+ +LI+ IRT+L+L   D G  K  LWE+I+A+M  LGY R+  
Sbjct  416  TI-------NRWTEHEVASLIELIRTSLELTTQDCGCFKEGLWEEIAAKMGCLGYRRSVG  468

Query  27   RCKEKWENI  1
             CKEK EN+
Sbjct  469  ECKEKLENM  477


 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 3/93 (3%)
 Frame = -3

Query  996  RWPHEETLTLLK-IRSEMDLAFRD-STLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIY  823
            RW   E  +L++ IR+ ++L  +D    K  LW+E++ KM   GY+RS  +C+EK EN+ 
Sbjct  419  RWTEHEVASLIELIRTSLELTTQDCGCFKEGLWEEIAAKMGCLGYRRSVGECKEKLENMS  478

Query  822  KYHRRTKE-GRSGRQTGKNYRFFEQLEVFDAMQ  727
             Y R T E  +  +Q  K   +  QL  ++  Q
Sbjct  479  VYPRMTAECNKKHKQDAKANMYHGQLSCYEGQQ  511



>ref|XP_010521043.1| PREDICTED: trihelix transcription factor GT-2-like [Tarenaya 
hassleriana]
Length=326

 Score =   156 bits (395),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 100/236 (42%), Positives = 137/236 (58%), Gaps = 6/236 (3%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL+IRSEM+LAFRDS LK PLW+++SRKM E G++RSAKKC+EKFEN+YKY
Sbjct  42   RWPRSETLALLRIRSEMELAFRDSNLKAPLWEQISRKMRELGFRRSAKKCKEKFENVYKY  101

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNTN  637
            H+RTKEGRSG++ GK Y+F       D +++   I             P          +
Sbjct  102  HKRTKEGRSGKREGKTYQFS------DELEAFENIHHYPTEPKSRPVKPPTTTTTTTAAS  155

Query  636  IVQDFRMRPHGFGADADVLsaststtyssggssGRKRKLAGYFEKMMKEVLEKQEDLQKK  457
            IV          G +  + +    T       S      +G+           QE++QK+
Sbjct  156  IVPWISSSNPSSGTNPTLFTKQQPTPPFVLNHSAHTVLGSGHKLTNPYNFARNQEEMQKR  215

Query  456  FLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakdaaviAFLQKIS  289
            FLE +E+ E ER+ RE+AW+ QE  R+ RE E +A ER+ + AKD A+I+FLQK+S
Sbjct  216  FLETLEKREKERIEREQAWRVQETARINREYEIIAHERSASAAKDTAIISFLQKVS  271


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ ++L   D+  K PLWE IS +M++LG+ R+AK+CKEK+EN+
Sbjct  42   RWPRSETLALLRIRSEMELAFRDSNLKAPLWEQISRKMRELGFRRSAKKCKEKFENV  98



>ref|XP_001755749.1| predicted protein [Physcomitrella patens]
 gb|EDQ79422.1| predicted protein [Physcomitrella patens]
Length=634

 Score =   161 bits (407),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 104/256 (41%), Positives = 154/256 (60%), Gaps = 23/256 (9%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL L++IRS++D +FRDS +KGPLW++VSRK+ E GY RS KKC+EKFENI+KY
Sbjct  272  RWPRAETLALIQIRSDLDSSFRDSGVKGPLWEDVSRKLAEMGYNRSGKKCKEKFENIHKY  331

Query  816  HRRTKEGRSGRQTGKNYRFFEQLE-VFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            ++++K+GR+GRQ GK+YRFF QL+ +F   Q+  ++    AA    + +  P+  I P  
Sbjct  332  YKKSKDGRAGRQDGKSYRFFAQLDALFGGQQTSTQVDTDTAAAVLLIGNAPPLG-ISPTD  390

Query  639  NIVQDFRMRPHGFGADADVLsaststty-----------ssggssGRKRKLA--------  517
              +     RP        V  +S                +   +  RKRKL         
Sbjct  391  QDLNASVQRPLEISTGITVSRSSGDDNDDDDGPGSGLRDNQQMTKNRKRKLMEDGKTGTH  450

Query  516  --GYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLaker  343
               +FE +MK +++KQE +Q+K LE +ER E +R A++E+W++QE+ R +RE    A E 
Sbjct  451  KLQFFETLMKNMIDKQEAMQRKLLETMERIEQDRQAKQESWRRQEMARWQREHALRAHEH  510

Query  342  aiaeakdaaviAFLQK  295
            A+  A+D A+I+FLQK
Sbjct  511  ALTTARDGALISFLQK  526


 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  ALIQIR++LD    D+G KGPLWED+S ++ ++GY+R+ K+CKEK+ENI
Sbjct  272  RWPRAETLALIQIRSDLDSSFRDSGVKGPLWEDVSRKLAEMGYNRSGKKCKEKFENI  328



>ref|XP_002300920.2| hypothetical protein POPTR_0002s06900g [Populus trichocarpa]
 gb|EEE80193.2| hypothetical protein POPTR_0002s06900g [Populus trichocarpa]
Length=593

 Score =   159 bits (402),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 132/193 (68%), Gaps = 26/193 (13%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++ ++V++KQEDLQ+KFLE IE+ E+ERMAREEAW+ QE+ R+ RE E+L +ER+ A
Sbjct  275  FFERLTRDVIKKQEDLQEKFLETIEKYEHERMAREEAWRMQEMARINREHETLIQERSTA  334

Query  333  eakdaaviAFLQKISKQPILVPHK----------------------PQSEDVQEFAAQTK  220
             AKDAAV+AFLQKIS Q   V  +                      P    V +     +
Sbjct  335  AAKDAAVVAFLQKISGQQNSVQTQEIPQPTTTPTAPPSQPLQLRPPPSLAPVAKLEVPKR  394

Query  219  ENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYD  40
            +NG   T     SSSSRWPK E++ALI +R NLD+++ +NG+KGPLWEDISA M+KLGY+
Sbjct  395  DNGDNFTV----SSSSRWPKVEVQALINLRANLDVKYQENGAKGPLWEDISAGMQKLGYN  450

Query  39   RNAKRCKEKWENI  1
            R+AKRCKEKWENI
Sbjct  451  RSAKRCKEKWENI  463


 Score =   146 bits (368),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD  FRDS LKGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  60   RWPRQETLALLKIRSDMDAVFRDSGLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKY  119

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            H+RTKEGR+G+  GK+Y+FF++LE F     H+
Sbjct  120  HKRTKEGRTGKSEGKSYKFFDELEAFQNHPPHS  152


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +D+ ++++  KGPLW+++S  M++ GY RSAK+C+EK+ENI KY
Sbjct  407  RWPKVEVQALINLRANLDVKYQENGAKGPLWEDISAGMQKLGYNRSAKRCKEKWENINKY  466

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F+QL+  
Sbjct  467  FKKVKESNKKRPEDSKTCPYFDQLDAL  493


 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D+G KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  60   RWPRQETLALLKIRSDMDAVFRDSGLKGPLWEEVSRKLAELGYHRSAKKCKEKFENV  116



>ref|XP_002306695.2| trihelix DNA-binding family protein [Populus trichocarpa]
 gb|EEE93691.2| trihelix DNA-binding family protein [Populus trichocarpa]
Length=580

 Score =   158 bits (400),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 137/198 (69%), Gaps = 30/198 (15%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV++KQE++QKKFLEAIER E+ERM REE+W+ QE+ R+ RE+E LA+ER++A
Sbjct  268  FFERLMKEVIQKQEEMQKKFLEAIERREHERMVREESWRMQEMTRINREREILAQERSVA  327

Query  333  eakdaaviAFLQKISKQ--------------------------PILVPHKPQSEDVQEFA  232
             +KDAAV+AFLQK+S++                          P+     P  + V    
Sbjct  328  ASKDAAVMAFLQKLSEEQNPGQIQNNPPPSQPPRPPAPPPISPPLQGAQAPLPQAVANVD  387

Query  231  AQTK-ENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMK  55
               K +NG  + T   S+S SRWPK E+EALI+IRTNLD ++ DNG KGPLWE+ISA M+
Sbjct  388  MIMKSDNGDQNFT---SASPSRWPKVEVEALIRIRTNLDCKYQDNGPKGPLWEEISARMR  444

Query  54   KLGYDRNAKRCKEKWENI  1
            KLGY+RNAKRCKEKWENI
Sbjct  445  KLGYNRNAKRCKEKWENI  462


 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS MD+AFRD+++KGPLW+EVSRK+ E GY RS KKC+EKFEN+YKY
Sbjct  66   RWPRQETLALLKIRSGMDVAFRDASVKGPLWEEVSRKLAELGYNRSGKKCKEKFENVYKY  125

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA  733
            H+RTK+GR+G+Q GK YRFF+QLE F++
Sbjct  126  HKRTKDGRTGKQEGKTYRFFDQLEAFES  153


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 64/98 (65%), Gaps = 3/98 (3%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR+ +D  ++D+  KGPLW+E+S +M + GY R+AK+C+EK+ENI KY
Sbjct  406  RWPKVEVEALIRIRTNLDCKYQDNGPKGPLWEEISARMRKLGYNRNAKRCKEKWENINKY  465

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKIGG  706
             ++ KE +  R +  K   +F+QL+     +  NKI G
Sbjct  466  FKKVKESKKKRPEDSKTCPYFQQLDAL--YKEKNKIDG  501


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D   KGPLWE++S ++ +LGY+R+ K+CKEK+EN+
Sbjct  66   RWPRQETLALLKIRSGMDVAFRDASVKGPLWEEVSRKLAELGYNRSGKKCKEKFENV  122



>gb|AEV53413.1| SANT DNA-binding domain-containing protein [Populus tomentosa]
Length=591

 Score =   157 bits (398),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 135/197 (69%), Gaps = 34/197 (17%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++ ++V++KQEDLQ+KFLE IE+ E+ERMAREEAW+ QE+ R+ RE E+L +ER+ A
Sbjct  275  FFERLTRDVIKKQEDLQEKFLETIEKYEHERMAREEAWRMQEMARINREHEALIQERSTA  334

Query  333  eakdaaviAFLQKISKQPILVPHKPQSEDVQ--------------------EFAAQTK--  220
             AKDAAV+AFLQKIS Q   V    Q++++                       A  TK  
Sbjct  335  AAKDAAVVAFLQKISGQQNSV----QTQEIPQPTTTPTAPPPQPLQLRPPPSLAPVTKLE  390

Query  219  ----ENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKK  52
                +NG   T     SSSSRWPK E+EALI +R NLD+++ +NG+KGPLWEDISA M+K
Sbjct  391  VPKRDNGDNFTV----SSSSRWPKVEVEALINLRANLDIKYQENGAKGPLWEDISAGMQK  446

Query  51   LGYDRNAKRCKEKWENI  1
            LGY+R+AKRCKEKWENI
Sbjct  447  LGYNRSAKRCKEKWENI  463


 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLK+RS+MD  FRDS LKGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  60   RWPRQETLALLKVRSDMDAVFRDSGLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKY  119

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            H+RTKEGR+G+  GK+Y+FF++LE F
Sbjct  120  HKRTKEGRTGKSEGKSYKFFDELEAF  145


 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +D+ ++++  KGPLW+++S  M++ GY RSAK+C+EK+ENI KY
Sbjct  407  RWPKVEVEALINLRANLDIKYQENGAKGPLWEDISAGMQKLGYNRSAKRCKEKWENIDKY  466

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F+QL+  
Sbjct  467  FKKVKESNKKRPEDSKTCPYFDQLDAL  493


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+++R+++D    D+G KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  60   RWPRQETLALLKVRSDMDAVFRDSGLKGPLWEEVSRKLAELGYHRSAKKCKEKFENV  116



>ref|XP_002266195.1| PREDICTED: trihelix transcription factor GT-2-like [Vitis vinifera]
Length=576

 Score =   157 bits (397),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 141/192 (73%), Gaps = 21/192 (11%)
 Frame = -3

Query  516  GYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakerai  337
             +F+++MK+V+E+QE+LQK+FLEAIE+ E++RM REEAWK QE+ R+ RE E L +ER+I
Sbjct  256  AFFQRLMKDVIERQEELQKRFLEAIEKREHDRMVREEAWKMQEMARMNREHELLVQERSI  315

Query  336  aeakdaaviAFLQKISKQ--PILV------------------PHKPQSEDVQEFAAQTKE  217
            A AKDAAVIAFLQKIS+Q  P+ +                  P +PQ + V+    +  +
Sbjct  316  AAAKDAAVIAFLQKISEQQNPVQLQDSTPPLPQPQAGPPQPPPPQPQLQLVKVLEPRKMD  375

Query  216  NGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDR  37
            NG G   +  +SSS RWPK E++ALI++RT+LD+++ +NG KGPLWE+ISA M+KLGY+R
Sbjct  376  NGGGAENLVPTSSS-RWPKAEVQALIRLRTSLDVKYQENGPKGPLWEEISAGMRKLGYNR  434

Query  36   NAKRCKEKWENI  1
            NAKRCKEKWENI
Sbjct  435  NAKRCKEKWENI  446


 Score =   145 bits (367),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+ FRDS+LKGPLW+EVSRK+ E GY RSAKKC+EKFEN++KY
Sbjct  60   RWPRQETLALLKIRSDMDVTFRDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVFKY  119

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS  724
            HRRTKEGR+ +  GK YRFF+QLE  +   S
Sbjct  120  HRRTKEGRASKADGKTYRFFDQLEALETQPS  150


 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+++R+ +D+ ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  390  RWPKAEVQALIRLRTSLDVKYQENGPKGPLWEEISAGMRKLGYNRNAKRCKEKWENINKY  449

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QLE  
Sbjct  450  FKKVKESNKKRPEDSKTCPYFHQLEAL  476


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D+  KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  60   RWPRQETLALLKIRSDMDVTFRDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENV  116



>ref|XP_007201190.1| hypothetical protein PRUPE_ppa002848mg [Prunus persica]
 gb|EMJ02389.1| hypothetical protein PRUPE_ppa002848mg [Prunus persica]
Length=628

 Score =   155 bits (392),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 143/213 (67%), Gaps = 35/213 (16%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +F+++MKEV++KQEDLQK+FLEAIE+ E+E+M REEAW+ QE+ R+ RE+E L
Sbjct  274  RKRKWKDFFQRLMKEVIQKQEDLQKRFLEAIEKREHEKMVREEAWRMQEMARVNREREIL  333

Query  354  akeraiaeakdaaviAFLQKISKQ---PILVPHKPQSE----------------------  250
            A+ER+IA AKDAAV++FLQKIS+Q   P   P   QS+                      
Sbjct  334  AQERSIAAAKDAAVMSFLQKISEQQQNPNQTPPPGQSQINNNLLQLQPPPLVPPPPRQPA  393

Query  249  ---------DVQEFAAQTK-ENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDN  100
                      V  F   TK  N   +  +SS +SSSRWPK E++ALI++RT+LD ++ +N
Sbjct  394  PQPQPQPQQPVTNFDLVTKPNNNGENNNLSSPASSSRWPKVEVQALIKLRTSLDSKYQEN  453

Query  99   GSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            G KGPLWE+IS  M+KLGY+R++KRCKEKWENI
Sbjct  454  GPKGPLWEEISGAMRKLGYNRSSKRCKEKWENI  486


 Score =   147 bits (372),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD+AFRD+++KGPLWDEVSRK+   GY RSAKKC+EKFEN+YKY
Sbjct  62   RWPRQETLALLQIRSDMDVAFRDASVKGPLWDEVSRKLAALGYHRSAKKCKEKFENVYKY  121

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            HRRTKEGR+G+  GK YRFF+QLE  +
Sbjct  122  HRRTKEGRTGKSEGKTYRFFDQLEALE  148


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M + GY RS+K+C+EK+ENI KY
Sbjct  430  RWPKVEVQALIKLRTSLDSKYQENGPKGPLWEEISGAMRKLGYNRSSKRCKEKWENINKY  489

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  490  FKKVKESNKRRPEDSKTCPYFHQLDSL  516


 Score = 72.4 bits (176),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+++D+   D   KGPLW+++S ++  LGY R+AK+CKEK+EN+
Sbjct  62   RWPRQETLALLQIRSDMDVAFRDASVKGPLWDEVSRKLAALGYHRSAKKCKEKFENV  118



>gb|AAL65124.1| GT-2 factor [Glycine max]
Length=355

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 137/215 (64%), Gaps = 46/215 (21%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV+EKQE LQ++FLEAIE+ E ER+ REEAW+ QE++R+ RE+E LA+ER+IA
Sbjct  22   FFERLMKEVIEKQEGLQRRFLEAIEKREQERVVREEAWRMQEMQRINREREILAQERSIA  81

Query  333  eakdaaviAFLQKISK--------QPIL--------------------------------  274
             AKDAAV+ FLQKI++        +P L                                
Sbjct  82   AAKDAAVMTFLQKIAEHQQQEINLEPALNNNNNSITVVPQQPVPQTTTTPTPTPQQAQTT  141

Query  273  -VPHKPQSEDVQEFAAQTKENGSGDTT---IssssssSRWPKPEIEALIQIRTNLDLQHH  106
             VP  PQ +  Q+      EN   D     ++  +SSSRWPK E++ALI +RT+L+ ++ 
Sbjct  142  IVPEAPQPQ--QQIVVSNVENNKADNNGENLTMGASSSRWPKMEVQALINLRTSLETKYQ  199

Query  105  DNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            +NG KGPLWE+ISA M+K+GY+RNAKRCKEKWENI
Sbjct  200  ENGPKGPLWEEISALMRKMGYNRNAKRCKEKWENI  234


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ ++  ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  178  RWPKMEVQALINLRTSLETKYQENGPKGPLWEEISALMRKMGYNRNAKRCKEKWENINKY  237

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QLE  
Sbjct  238  FKKVKESSKKRPEDSKTCPYFHQLEAL  264



>ref|XP_004290520.1| PREDICTED: trihelix transcription factor GT-2-like [Fragaria 
vesca subsp. vesca]
Length=639

 Score =   154 bits (390),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 143/226 (63%), Gaps = 48/226 (21%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +FE +MK+V+ KQEDLQK+FLEAIE+ E+ERMAREEAW+ QE+ R+ RE+E L
Sbjct  288  RKRKWKDFFETLMKQVVYKQEDLQKRFLEAIEKREHERMAREEAWRMQEMARINREREIL  347

Query  354  akeraiaeakdaaviAFLQKISKQ-------PILVPHK----------------------  262
            A+ER+IA AKD+AV++FLQKI++Q       P + P+                       
Sbjct  348  AQERSIAAAKDSAVMSFLQKIAEQQHNPQATPTITPNNHLVTSHPPQPHPPPAQQPAPPP  407

Query  261  ------PQSEDVQ-------EFAAQTKENGSGD------TTIssssssSRWPKPEIEALI  139
                  P    +Q        F    + NG  +       + +++ SSSRWP+ E+ +LI
Sbjct  408  QRQQTTPPPPALQITQAPITSFEITPRANGESNNDNNNMVSATTTPSSSRWPRVEVHSLI  467

Query  138  QIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ++RT+LD ++ +NG KGPLWE+ISA MKKLGY+R+AKRCKEKWENI
Sbjct  468  KLRTSLDSKYQENGPKGPLWEEISAGMKKLGYNRSAKRCKEKWENI  513


 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+AFRD+++KGPLWDEVSRK+ E G+ RSAKKC+EKFEN+YKY
Sbjct  66   RWPRQETLALLKIRSDMDVAFRDASVKGPLWDEVSRKLAELGFHRSAKKCKEKFENVYKY  125

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            HRRTKEGR+G+  GK YRFF+QL+  +
Sbjct  126  HRRTKEGRTGKSEGKTYRFFDQLQALE  152


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E  +L+K+R+ +D  ++++  KGPLW+E+S  M++ GY RSAK+C+EK+ENI KY
Sbjct  457  RWPRVEVHSLIKLRTSLDSKYQENGPKGPLWEEISAGMKKLGYNRSAKRCKEKWENINKY  516

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLE  745
             ++ KE    R +  K   +F  L+
Sbjct  517  FKKVKESNKKRPEDSKTCPYFHLLD  541


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLW+++S ++ +LG+ R+AK+CKEK+EN+
Sbjct  66   RWPRQETLALLKIRSDMDVAFRDASVKGPLWDEVSRKLAELGFHRSAKKCKEKFENV  122



>ref|XP_008237582.1| PREDICTED: trihelix transcription factor GT-2-like [Prunus mume]
Length=591

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD AFRDS+LK PLW++VSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  66   RWPRQETLALLKIRSQMDAAFRDSSLKAPLWEDVSRKLGELGYYRSAKKCKEKFENVYKY  125

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKI  712
            HRRTKEGRSG+Q GK YRFF++LE FD   +H  +
Sbjct  126  HRRTKEGRSGKQEGKTYRFFDELEAFDQQNNHPSV  160


 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 127/204 (62%), Gaps = 29/204 (14%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   +F ++ KEVLEKQE LQ+KFLEAI +CE++R  REEAW+ QE+ RL +E + L
Sbjct  269  KKRKWKYFFRRLTKEVLEKQEKLQEKFLEAIAKCEHQRTVREEAWRMQEMARLDKEHQIL  328

Query  354  akeraiaeakdaaviAFLQKISKQPIL------------VPHKPQSED------------  247
            A+ER+ A AKDAAVI FLQK+S Q  +            +P +PQ               
Sbjct  329  AQERSSAAAKDAAVIEFLQKVSGQQNVTNNIQAIEVNRPIPSRPQPLPVLMAPPPPAPVA  388

Query  246  --VQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWED  73
                 F     + G   T       S+RWP+ E+EALI +RT LD+++ + G KG LWE+
Sbjct  389  VITTSFEVPRLDKGDNSTI---PPGSTRWPRVEVEALINLRTCLDVRYQEAGPKGSLWEE  445

Query  72   ISAEMKKLGYDRNAKRCKEKWENI  1
            ISA M++LGY+R+AKRCKEKWENI
Sbjct  446  ISAGMRQLGYNRSAKRCKEKWENI  469


 Score = 77.8 bits (190),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 55/85 (65%), Gaps = 1/85 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +D+ ++++  KG LW+E+S  M + GY RSAK+C+EK+ENI KY
Sbjct  413  RWPRVEVEALINLRTCLDVRYQEAGPKGSLWEEISAGMRQLGYNRSAKRCKEKWENINKY  472

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLE  745
             ++ KE    R +  K   +F QLE
Sbjct  473  FKKVKESSKTRPEDSKTCPYFNQLE  497


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D+  K PLWED+S ++ +LGY R+AK+CKEK+EN+
Sbjct  66   RWPRQETLALLKIRSQMDAAFRDSSLKAPLWEDVSRKLGELGYYRSAKKCKEKFENV  122



>ref|XP_010471850.1| PREDICTED: trihelix transcription factor GT-2 [Camelina sativa]
Length=578

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 137/197 (70%), Gaps = 19/197 (10%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            R++   G+F K+ KE+++KQE +QK+FLE +E  E ER++REEAW+ QEI R+ RE E+L
Sbjct  258  RRKYWKGFFTKLTKELMDKQEKMQKRFLETLENREKERISREEAWRVQEIARINREHETL  317

Query  354  akeraiaeakdaaviAFLQKIS----KQPILVPHKP------QSEDVQEFAAQ-------  226
              ER+ A AKDAA+I+FL KIS    +QP    HKP      QS+    F ++       
Sbjct  318  IHERSNAAAKDAAIISFLHKISGGQQQQPQQQNHKPAQRKQYQSDHSITFESKEPRPVLL  377

Query  225  --TKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKK  52
              T + G+ DT  S S SSSRWPK E+EALI+IR NL+  + +NG+KGPLWE+ISA M++
Sbjct  378  DTTMKMGNYDTNQSISPSSSRWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRR  437

Query  51   LGYDRNAKRCKEKWENI  1
            LGY+R+AKRCKEKWENI
Sbjct  438  LGYNRSAKRCKEKWENI  454


 Score =   150 bits (378),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL++RSEMD AFRDSTLK PLW+E+SRKM E GY+RSAKKC+EKFEN+YKY
Sbjct  41   RWPRPETLALLRLRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSAKKCKEKFENVYKY  100

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTKEGR+G+  GK YRFFE+LE F+ + S+
Sbjct  101  HKRTKEGRTGKSEGKTYRFFEELEAFETLNSY  132


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR  ++  ++++  KGPLW+E+S  M   GY RSAK+C+EK+ENI KY
Sbjct  398  RWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRRLGYNRSAKRCKEKWENINKY  457

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F QLE  
Sbjct  458  FKKVKESNKKRPLDSKTCPYFHQLEAL  484


 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+PE  AL+++R+ +D    D+  K PLWE+IS +M +LGY R+AK+CKEK+EN+
Sbjct  41   RWPRPETLALLRLRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSAKKCKEKFENV  97



>ref|XP_010428752.1| PREDICTED: trihelix transcription factor GT-2-like [Camelina 
sativa]
Length=616

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 149/221 (67%), Gaps = 45/221 (20%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +FE++MK+V++KQE+LQ+KFLEA+E+ E+ER+ REE+W+ QEI R+ R+QE L
Sbjct  255  RKRKWKEFFERLMKQVVDKQEELQRKFLEAVEKREHERLVREESWRVQEIARINRDQEIL  314

Query  354  akeraiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEF--------------------  235
            A+ER+++ AKDAAV+AFLQK+S++    P++P +  VQ                      
Sbjct  315  AQERSMSAAKDAAVMAFLQKLSEK--QQPNQPSATTVQPQPQPQQVRPQMQQTPQPSPPA  372

Query  234  --------------AAQTKENGSGDTTIsss---------sssSRWPKPEIEALIQIRTN  124
                          +++T++  +GD ++  +         +SSSRWPK EIEALI++RTN
Sbjct  373  PPPLLQPIQAVLPSSSETRKTDNGDQSMMMTPASASASGSASSSRWPKVEIEALIKLRTN  432

Query  123  LDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            LD ++ +NG KGPLWE+ISA M++LG++RN+KRCKEKWENI
Sbjct  433  LDSKYQENGPKGPLWEEISAGMRRLGFNRNSKRCKEKWENI  473


 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+M +AFRD+++KGPLW+EVSRKM E GY R+AKKC+EKFEN+YKY
Sbjct  71   RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMGELGYIRNAKKCKEKFENVYKY  130

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA  733
            H+RTKEGR+G+  GK YRFF+QLE  + 
Sbjct  131  HKRTKEGRTGKSDGKTYRFFDQLEALET  158


 Score = 75.5 bits (184),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M   G+ R++K+C+EK+ENI KY
Sbjct  417  RWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMRRLGFNRNSKRCKEKWENINKY  476

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  477  FKKVKESNKKRPEDSKTCPYFHQLDAL  503


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++ +   D   KGPLWE++S +M +LGY RNAK+CKEK+EN+
Sbjct  71   RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMGELGYIRNAKKCKEKFENV  127



>ref|XP_006300884.1| hypothetical protein CARUB_v10019974mg, partial [Capsella rubella]
 gb|EOA33782.1| hypothetical protein CARUB_v10019974mg, partial [Capsella rubella]
Length=623

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 136/197 (69%), Gaps = 19/197 (10%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            R+R   G F K+ KE+++KQE +Q++FLE +E  E ER++REEAW+ QEI R+ RE E+ 
Sbjct  302  RRRYWKGLFTKLTKELMDKQEKMQRRFLETLENREKERISREEAWRVQEIARINREHETF  361

Query  354  akeraiaeakdaaviAFLQKIS----KQPILVPHKP------QSEDVQEFAAQ-------  226
              ER+ A AKDAA+I+FL KIS    +QP    HKP      QS+    F ++       
Sbjct  362  LHERSNAAAKDAAIISFLHKISGGQQQQPQQQNHKPSQRKQYQSDHSITFESKEPKTILL  421

Query  225  --TKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKK  52
              T + G+ DT+ S S SSSRWPK E+EALI+IR NL+  + +NG+KGPLWE+ISA M++
Sbjct  422  ETTTKIGNYDTSHSISPSSSRWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRR  481

Query  51   LGYDRNAKRCKEKWENI  1
            LGY+RNAKRCKEKWENI
Sbjct  482  LGYNRNAKRCKEKWENI  498


 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL+IRSEM  AFRDSTLK PLW+E+SRKM E GY+RSAKKC+EKFEN+YKY
Sbjct  88   RWPRPETLALLRIRSEMGKAFRDSTLKAPLWEEISRKMMELGYKRSAKKCKEKFENVYKY  147

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            H+RTKEGR+G+  GK YRFFE+LE F+ + S++
Sbjct  148  HKRTKEGRTGKSEGKTYRFFEELEAFETLNSYH  180


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR  ++  ++++  KGPLW+E+S  M   GY R+AK+C+EK+ENI KY
Sbjct  442  RWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRRLGYNRNAKRCKEKWENINKY  501

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F QLE  
Sbjct  502  FKKVKESNKKRPLDSKTCPYFHQLEAL  528


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+PE  AL++IR+ +     D+  K PLWE+IS +M +LGY R+AK+CKEK+EN+
Sbjct  88   RWPRPETLALLRIRSEMGKAFRDSTLKAPLWEEISRKMMELGYKRSAKKCKEKFENV  144



>gb|KHG04250.1| Trihelix transcription factor GT-2 -like protein [Gossypium arboreum]
Length=581

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 137/220 (62%), Gaps = 42/220 (19%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   +F ++ KEV+EKQE+LQ KFL+ IERCE +R+AREEAW+ QE+ R+ +E E L
Sbjct  218  KKRKWKEFFRRLTKEVIEKQEELQNKFLQTIERCEQQRLAREEAWRVQEMARINKEHELL  277

Query  354  akeraiaeakdaaviAFLQKIS-KQP---------------------ILVP---------  268
             +ER+ A AKDAAV AFLQK+S +QP                     +L P         
Sbjct  278  VQERSKAAAKDAAVFAFLQKVSGQQPNTVQGNPQPQPQPQPPPPAQPMLAPLSTSLPPPP  337

Query  267  -----------HKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNL  121
                       H P ++ +    ++    G    ++S S S SRWPK E+EALI++RTNL
Sbjct  338  PPPVQVPQPKTHPPPTQALNFDTSEMSNGGKSAVSVSLSPSPSRWPKVEVEALIKLRTNL  397

Query  120  DLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            D+++ DNG KGPLWE+ISA M+ LGY+R+AKRCKEKWENI
Sbjct  398  DIKYQDNGPKGPLWEEISAAMRNLGYNRSAKRCKEKWENI  437


 Score =   140 bits (352),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 76/93 (82%), Gaps = 2/93 (2%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD  FRDSTLKGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  43   RWPRQETLALLKIRSDMDSLFRDSTLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKY  102

Query  816  HRRTKEGRSGRQTG--KNYRFFEQLEVFDAMQS  724
            H+RTK+GR+ +  G  K YRFF++LE F  + S
Sbjct  103  HKRTKDGRTSKADGKTKTYRFFDELEAFQNLHS  135


 Score = 84.7 bits (208),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D+ ++D+  KGPLW+E+S  M   GY RSAK+C+EK+ENI KY
Sbjct  381  RWPKVEVEALIKLRTNLDIKYQDNGPKGPLWEEISAAMRNLGYNRSAKRCKEKWENINKY  440

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  441  FKKVKENNKTRPEDSKTCPYFHQLDAI  467


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D+  KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  43   RWPRQETLALLKIRSDMDSLFRDSTLKGPLWEEVSRKLAELGYHRSAKKCKEKFENV  99



>ref|XP_009368512.1| PREDICTED: trihelix transcription factor GT-2-like [Pyrus x bretschneideri]
Length=661

 Score =   154 bits (388),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 136/211 (64%), Gaps = 33/211 (16%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   +FE++MK+V++KQEDLQK+FLE IE+ E ER+ REEAW+ QEI R+ RE E L
Sbjct  298  KKRKWKDFFERLMKDVIQKQEDLQKRFLETIEKREQERIVREEAWRMQEIARINREHEIL  357

Query  354  akeraiaeakdaaviAFLQKISKQPIL--------VPHKPQSED----------------  247
            A+ER+I  AKDAAV++FLQK+S+Q            P++ Q                   
Sbjct  358  AQERSIKAAKDAAVMSFLQKVSEQHQNQNQNKNQSTPNQSQQLPLQPAPLPLPLRQPAPP  417

Query  246  --------VQEFAAQTKENGSGDT-TIssssssSRWPKPEIEALIQIRTNLDLQHHDNGS  94
                    V  F    K N +G+   +    SSSRWPK E++ALI++RT+LD ++ +NG 
Sbjct  418  PQAQPQQKVTTFDIVPKSNNNGENDNLMMPPSSSRWPKVEVQALIKLRTSLDSKYQENGP  477

Query  93   KGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            KGPLWE+IS  M+KLGY+RNAKRCKEKWENI
Sbjct  478  KGPLWEEISGGMRKLGYNRNAKRCKEKWENI  508


 Score =   142 bits (359),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRSEMD+AFRD+++KGPLW+EVS K+   GY RSAKKC+EKFEN+YKY
Sbjct  63   RWPRQETLALLRIRSEMDVAFRDASVKGPLWEEVSSKLAALGYHRSAKKCKEKFENVYKY  122

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            HRRTKEGR+G+  GK YRFF+QL   +
Sbjct  123  HRRTKEGRTGKSEGKTYRFFDQLNALE  149


 Score = 75.5 bits (184),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  452  RWPKVEVQALIKLRTSLDSKYQENGPKGPLWEEISGGMRKLGYNRNAKRCKEKWENINKY  511

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F  L+  
Sbjct  512  FKKVKESNKRRPEDSKTCPYFHLLDSL  538


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D   KGPLWE++S+++  LGY R+AK+CKEK+EN+
Sbjct  63   RWPRQETLALLRIRSEMDVAFRDASVKGPLWEEVSSKLAALGYHRSAKKCKEKFENV  119



>ref|XP_009343632.1| PREDICTED: trihelix transcription factor GT-2-like [Pyrus x bretschneideri]
Length=662

 Score =   153 bits (387),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 139/211 (66%), Gaps = 34/211 (16%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   +FE++MK+V++KQEDLQK+FLE IE+ E ERM REEAW+ QE+ R+ RE+E L
Sbjct  305  KKRKWKEFFERLMKDVIQKQEDLQKRFLETIEKREQERMVREEAWRMQEMTRINREREIL  364

Query  354  akeraiaeakdaaviAFLQKISKQPIL------VPHKPQSEDVQ----------------  241
            A+ER+I  AKDAA+++FLQ++S+Q         +P++ Q   +Q                
Sbjct  365  AQERSITAAKDAALMSFLQRVSEQQQNQNQHQSMPNQSQLLRLQPAPLPPPPRKPAPPPP  424

Query  240  -----------EFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGS  94
                       +   ++  NG  D  +    SSSRWPK E++ALI++RT+LD ++ +NG 
Sbjct  425  QAQPQQTAMNIDIVPKSNNNGEND-NLMMPPSSSRWPKVEVQALIKLRTSLDSKYQENGP  483

Query  93   KGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            KGPLWE+IS  M+KLGY+RNAKRCKEKWENI
Sbjct  484  KGPLWEEISGAMRKLGYNRNAKRCKEKWENI  514


 Score =   145 bits (365),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD+AFRD+++KGPLW+EVSRK+   GY RSAKKC+EKFEN+YKY
Sbjct  61   RWPRQETLALLQIRSDMDVAFRDASVKGPLWEEVSRKLAALGYHRSAKKCKEKFENVYKY  120

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            HRRTKEGR+G+  GK YRFF+QL  F+
Sbjct  121  HRRTKEGRTGKSEGKTYRFFDQLNAFE  147


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  458  RWPKVEVQALIKLRTSLDSKYQENGPKGPLWEEISGAMRKLGYNRNAKRCKEKWENINKY  517

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F  L+  
Sbjct  518  FKKVKESNKKRPEDSKTCPYFNLLDSL  544


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+++D+   D   KGPLWE++S ++  LGY R+AK+CKEK+EN+
Sbjct  61   RWPRQETLALLQIRSDMDVAFRDASVKGPLWEEVSRKLAALGYHRSAKKCKEKFENV  117



>emb|CAA05997.1| GT2 [Arabidopsis thaliana]
Length=575

 Score =   152 bits (385),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 134/198 (68%), Gaps = 20/198 (10%)
 Frame = -3

Query  534  RKRKL-AGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQES  358
            +KRK   G F K+ KE++EKQE +QK+FLE +E  E ER++REEAW+ QEI R+ RE E+
Sbjct  256  KKRKYWKGLFTKLTKELMEKQEKMQKRFLETLEYREKERISREEAWRVQEIGRINREHET  315

Query  357  LakeraiaeakdaaviAFLQKIS----KQPILVPHKP------QSEDVQEFAAQTKENGS  208
            L  ER+ A AKDAA+I+FL KIS    + P    HKP      QS+    F ++      
Sbjct  316  LIHERSNAAAKDAAIISFLHKISGGQPQHPQQHNHKPSQRKQYQSDHSITFESKEPRAVL  375

Query  207  GDTTI---------ssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMK  55
             DTTI         S S SSSRWPK E+EALI+IR NL+  + +NG+KGPLWE+ISA M+
Sbjct  376  LDTTIKMGNYDNNHSVSPSSSRWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMR  435

Query  54   KLGYDRNAKRCKEKWENI  1
            +LGY+R+AKRCKEKWENI
Sbjct  436  RLGYNRSAKRCKEKWENI  453


 Score =   150 bits (378),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL+IRSEMD AFRDSTLK PLW+E+SRKM E GY+RS+KKC+EKFEN+YKY
Sbjct  41   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSSKKCKEKFENVYKY  100

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTKEGR+G+  GK YRFFE+LE F+ + S+
Sbjct  101  HKRTKEGRTGKSEGKTYRFFEELEAFETLSSY  132


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR  ++  ++++  KGPLW+E+S  M   GY RSAK+C+EK+ENI KY
Sbjct  397  RWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRRLGYNRSAKRCKEKWENINKY  456

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F QLE  
Sbjct  457  FKKVKESNKKRPLDSKTCPYFHQLEAL  483


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+PE  AL++IR+ +D    D+  K PLWE+IS +M +LGY R++K+CKEK+EN+
Sbjct  41   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSSKKCKEKFENV  97



>ref|XP_010260937.1| PREDICTED: trihelix transcription factor GT-2-like [Nelumbo nucifera]
Length=530

 Score =   152 bits (384),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD+AFRDSTLKGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  51   RWPRQETLALLKIRSEMDVAFRDSTLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKY  110

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTK+GR+ +Q GK YRFF+QLE  D
Sbjct  111  HKRTKDGRAAKQDGKAYRFFDQLEALD  137


 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 137/184 (74%), Gaps = 6/184 (3%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +K+KL  +FEK+MKEV++KQE LQ +FLEA+E+ E ER+ REEAWK QE+ R+ RE E L
Sbjct  225  KKKKLMNFFEKLMKEVIDKQERLQMRFLEALEKRERERVEREEAWKIQEMARMNREHEIL  284

Query  354  akeraiaeakdaaviAFLQKISKQPILVPHK----PQSEDVQEFAAQTKENGSGDTTIss  187
             +ER+IA AKD AVIAFLQKIS+Q   V  +    P+++   E   +     + +  + +
Sbjct  285  VQERSIAAAKDTAVIAFLQKISEQSSPVQLREVQLPENQMPSEKTVEPPRTDNVNNVVET  344

Query  186  ss--ssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEK  13
             S  SSSRWPK E++ALI +RTNLDL++ +NG KGPLWE+IS+ MKKLGY+R+AKRCKEK
Sbjct  345  FSPLSSSRWPKSEVQALINLRTNLDLKYQENGPKGPLWEEISSSMKKLGYNRSAKRCKEK  404

Query  12   WENI  1
            WENI
Sbjct  405  WENI  408


 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +DL ++++  KGPLW+E+S  M++ GY RSAK+C+EK+ENI KY
Sbjct  352  RWPKSEVQALINLRTNLDLKYQENGPKGPLWEEISSSMKKLGYNRSAKRCKEKWENINKY  411

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  412  FKKVKESNKKRPEDSKTCPYFHQLDAL  438


 Score = 71.2 bits (173),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D+  KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  51   RWPRQETLALLKIRSEMDVAFRDSTLKGPLWEEVSRKLAELGYHRSAKKCKEKFENV  107



>ref|XP_004290519.1| PREDICTED: trihelix transcription factor GT-2-like [Fragaria 
vesca subsp. vesca]
Length=578

 Score =   152 bits (385),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 81/94 (86%), Gaps = 1/94 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD AFRDS+LK PLW++VSRK+ E GYQRSAKKC+EKFEN+YKY
Sbjct  63   RWPRQETLALLKIRSQMDPAFRDSSLKAPLWEDVSRKLGELGYQRSAKKCKEKFENVYKY  122

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQ-SHN  718
            HRRTKEGRSG+  GK YRFF++LE FD  Q SHN
Sbjct  123  HRRTKEGRSGKPEGKTYRFFDELEAFDHQQNSHN  156


 Score =   140 bits (352),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 131/221 (59%), Gaps = 46/221 (21%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +F ++ K+VLEKQE LQ+ FLEAI +C+ ERM +EEAW+ QE+ R+ R+ E L
Sbjct  254  RKRKWKYFFRRLTKQVLEKQERLQENFLEAIAKCDQERMVKEEAWRMQEMARIDRDHEVL  313

Query  354  akeraiaeakdaaviAFLQKISKQ---------------PILV------------PHKPQ  256
             +ER+ A AKDAA+I FLQK+S Q                +LV            P  P 
Sbjct  314  VQERSSAAAKDAALIQFLQKVSLQHNSNDTRSLEINDATAMLVIPPPTNVPRPPLPALPV  373

Query  255  SEDVQEF----------------AAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTN  124
            S  + +                 A +   NG  ++ +  SS   RWPK E++ALI +RT+
Sbjct  374  SWAIDQRGLTASSDGAVAPRNLEAKKVYGNGENNSAVMGSS---RWPKTEVQALIDLRTS  430

Query  123  LDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            LD+++ D G KG LWE+ISA M++LGY+R++KRCKEKWENI
Sbjct  431  LDVKYQDAGPKGSLWEEISAGMRRLGYNRSSKRCKEKWENI  471


 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +D+ ++D+  KG LW+E+S  M   GY RS+K+C+EK+ENI KY
Sbjct  415  RWPKTEVQALIDLRTSLDVKYQDAGPKGSLWEEISAGMRRLGYNRSSKRCKEKWENINKY  474

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKI  712
             ++ KE    R +  K   +F QLE     +++NKI
Sbjct  475  FKKVKESSKTRPEDSKTCPYFHQLEALYRNKNNNKI  510


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D+  K PLWED+S ++ +LGY R+AK+CKEK+EN+
Sbjct  63   RWPRQETLALLKIRSQMDPAFRDSSLKAPLWEDVSRKLGELGYQRSAKKCKEKFENV  119



>ref|XP_007200087.1| hypothetical protein PRUPE_ppa021097mg [Prunus persica]
 gb|EMJ01286.1| hypothetical protein PRUPE_ppa021097mg [Prunus persica]
Length=590

 Score =   152 bits (385),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD AFRDS+LK PLW++VSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  66   RWPRQETLALLKIRSQMDAAFRDSSLKAPLWEDVSRKLGEHGYYRSAKKCKEKFENVYKY  125

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKI  712
            HRRTKEGRSG+Q GK YRFF++LE FD   +H  +
Sbjct  126  HRRTKEGRSGKQEGKTYRFFDELEAFDQQNNHPSV  160


 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 126/204 (62%), Gaps = 29/204 (14%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   +F ++ KEVLEKQE LQ+KFLEAI + E++R  REEAW+ QE+ RL +E + L
Sbjct  269  KKRKWKYFFRRLTKEVLEKQEKLQEKFLEAIAKSEHQRTVREEAWRMQEMARLDKEHQIL  328

Query  354  akeraiaeakdaaviAFLQKISKQPIL------------VPHKPQSED------------  247
            A+ER+ A AKDAAVI FLQK+S Q  +            +P +PQ               
Sbjct  329  AQERSSAAAKDAAVIEFLQKVSGQQNVTNNIQAIEVNRTIPSRPQPLPVLMPPPPPAPVA  388

Query  246  --VQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWED  73
                 F     + G   T       S+RWP+ E+EALI +RT LD+++ + G KG LWE+
Sbjct  389  VITTSFEVPRLDKGDNSTI---PPGSTRWPRVEVEALINLRTCLDVRYQEAGPKGSLWEE  445

Query  72   ISAEMKKLGYDRNAKRCKEKWENI  1
            ISA M++LGY+R+AKRCKEKWENI
Sbjct  446  ISAGMRRLGYNRSAKRCKEKWENI  469


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +D+ ++++  KG LW+E+S  M   GY RSAK+C+EK+ENI KY
Sbjct  413  RWPRVEVEALINLRTCLDVRYQEAGPKGSLWEEISAGMRRLGYNRSAKRCKEKWENINKY  472

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLE  745
             ++ KE    R +  K   +F QLE
Sbjct  473  FKKVKESSKTRPEDSKTCPYFNQLE  497


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D+  K PLWED+S ++ + GY R+AK+CKEK+EN+
Sbjct  66   RWPRQETLALLKIRSQMDAAFRDSSLKAPLWEDVSRKLGEHGYYRSAKKCKEKFENV  122



>ref|XP_010428754.1| PREDICTED: trihelix transcription factor GT-2-like [Camelina 
sativa]
Length=574

 Score =   152 bits (385),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 134/198 (68%), Gaps = 20/198 (10%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            R++   G F K+ KE++EKQE +QK+FLE +E  E ER++REEAW+ QEI R+ RE E+L
Sbjct  255  RRKYWKGLFTKLTKELMEKQEKMQKRFLETLENREKERISREEAWRVQEIARINREHETL  314

Query  354  akeraiaeakdaaviAFLQKIS-----KQPILVPHKP------QSEDVQEFAAQ------  226
              ER+ A AKDAA+I+FL KIS     +      HKP      QS+    F ++      
Sbjct  315  IHERSNAAAKDAAIISFLHKISGGQQQQPQQQNHHKPAQRKQYQSDHSITFESKEPRPIL  374

Query  225  ---TKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMK  55
               T + G+ DT  S S SSSRWPK E+EALI+IR NL+  + +NG+KGPLWE+ISA M+
Sbjct  375  LDTTMKMGNYDTNHSISPSSSRWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMR  434

Query  54   KLGYDRNAKRCKEKWENI  1
            +LGY+R+AKRCKEKWENI
Sbjct  435  RLGYNRSAKRCKEKWENI  452


 Score =   149 bits (377),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL+IRSEMD AFRDSTLK PLW+E+SRKM E GY+RSAKKC+EKFEN+YKY
Sbjct  37   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSAKKCKEKFENVYKY  96

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTK+GR+G+  GK+YRFFE+LE F+ + S+
Sbjct  97   HKRTKDGRTGKSEGKSYRFFEELEAFETLNSY  128


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR  ++  ++++  KGPLW+E+S  M   GY RSAK+C+EK+ENI KY
Sbjct  396  RWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRRLGYNRSAKRCKEKWENINKY  455

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F QLE  
Sbjct  456  FKKVKESNKKRPLDSKTCPYFHQLEAL  482


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+PE  AL++IR+ +D    D+  K PLWE+IS +M +LGY R+AK+CKEK+EN+
Sbjct  37   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSAKKCKEKFENV  93



>ref|XP_008358288.1| PREDICTED: trihelix transcription factor GT-2-like [Malus domestica]
Length=616

 Score =   152 bits (385),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 140/212 (66%), Gaps = 35/212 (17%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   +FE++MK+V++KQEDLQK+FLE IE+ E ERM REEAW+ QE+ R+KRE+E L
Sbjct  306  KKRKWKEFFERLMKDVIQKQEDLQKRFLETIEKREQERMVREEAWRMQEMARIKREREIL  365

Query  354  akeraiaeakdaaviAFLQKISKQPIL--------VPHKPQSEDVQ--------------  241
            A+ER+I  AKDAAV++FLQ++S+Q           +P++ Q   +Q              
Sbjct  366  AQERSITAAKDAAVMSFLQRVSEQQQNQNQNQHQSMPNQSQLLLLQPAPLPPPRKPAPPP  425

Query  240  ------------EFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNG  97
                        +   ++  NG  D  +    SSSRWPK E++ALI++RT+LD ++ +NG
Sbjct  426  PQAQPQQTAMNIDIVPKSNNNGENDN-LMMPPSSSRWPKVEVQALIKLRTSLDSKYQENG  484

Query  96   SKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             KGPLWE+IS  M+KLGY+RNAKRCKEKWENI
Sbjct  485  PKGPLWEEISGAMRKLGYNRNAKRCKEKWENI  516


 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD+AFRD+++KGPLW+EVSRK+   GY RSAKKC+EKFEN+YKY
Sbjct  61   RWPRQETLALLQIRSDMDVAFRDASVKGPLWEEVSRKLAALGYHRSAKKCKEKFENVYKY  120

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            HRRTKEGR+G+  GK YRFF+QL  F+
Sbjct  121  HRRTKEGRTGKSEGKTYRFFDQLNAFE  147


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  460  RWPKVEVQALIKLRTSLDSKYQENGPKGPLWEEISGAMRKLGYNRNAKRCKEKWENINKY  519

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  520  FKKVKESNKKRPEDSKTCPYFHQLDSL  546


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+++D+   D   KGPLWE++S ++  LGY R+AK+CKEK+EN+
Sbjct  61   RWPRQETLALLQIRSDMDVAFRDASVKGPLWEEVSRKLAALGYHRSAKKCKEKFENV  117



>ref|XP_008339105.1| PREDICTED: trihelix transcription factor GT-2 [Malus domestica]
Length=665

 Score =   152 bits (385),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 137/211 (65%), Gaps = 33/211 (16%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   +FE++MK+V++KQEDLQK+FLE IE+ E ER+ REEAW+ QE+ R+ RE+E L
Sbjct  302  KKRKWKDFFERLMKDVIQKQEDLQKRFLETIEKREQERIVREEAWRMQEMARINREREIL  361

Query  354  akeraiaeakdaaviAFLQKISKQPIL--------VPHKPQSED----------------  247
            A+ER+I  AKDAAV++FLQK+S+Q            P++ Q                   
Sbjct  362  AQERSIKAAKDAAVMSFLQKVSEQQQNQNQNQNQSTPNQSQLLPLQPAPLPLAPRQPAPP  421

Query  246  --------VQEFAAQTKENGSGDT-TIssssssSRWPKPEIEALIQIRTNLDLQHHDNGS  94
                    V  F    K N +G+   +    SSSRWPK E++ALI++RT+LD ++ +NG 
Sbjct  422  PQPQPQQKVTNFDIVPKSNNNGENDNLMMPPSSSRWPKVEVQALIKLRTSLDSKYQENGP  481

Query  93   KGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            KGPLWE+IS  M+KLGY+RNAKRCKEKWENI
Sbjct  482  KGPLWEEISGGMRKLGYNRNAKRCKEKWENI  512


 Score =   141 bits (355),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD+AFRD+++KGPLW+EVS K+   GY RSAKKC+EKFEN+YKY
Sbjct  63   RWPRQETLALLQIRSDMDVAFRDASVKGPLWEEVSSKLAALGYHRSAKKCKEKFENVYKY  122

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            HRRTKEGR+G+  GK YRFF+QL   +
Sbjct  123  HRRTKEGRTGKSEGKTYRFFDQLNALE  149


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  456  RWPKVEVQALIKLRTSLDSKYQENGPKGPLWEEISGGMRKLGYNRNAKRCKEKWENINKY  515

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F  L+  
Sbjct  516  FKKVKESNKRRPEDSKTCPYFHLLDSL  542


 Score = 74.7 bits (182),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+++D+   D   KGPLWE++S+++  LGY R+AK+CKEK+EN+
Sbjct  63   RWPRQETLALLQIRSDMDVAFRDASVKGPLWEEVSSKLAALGYHRSAKKCKEKFENV  119



>ref|XP_003518601.1| PREDICTED: trihelix transcription factor GT-2 [Glycine max]
Length=631

 Score =   152 bits (384),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 137/215 (64%), Gaps = 46/215 (21%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV+EKQE LQ++FLEAIE+ E ER+ REEAW+ QE++R+ RE+E LA+ER+IA
Sbjct  298  FFERLMKEVIEKQEGLQRRFLEAIEKREQERVVREEAWRMQEMQRINREREILAQERSIA  357

Query  333  eakdaaviAFLQKISK--------QPIL--------------------------------  274
             AKDAAV+ FLQKI++        +P L                                
Sbjct  358  AAKDAAVMTFLQKIAEHQQQEINLEPALNNNNNSITVVPQQPVPQTTTTPTPTPQQAQTT  417

Query  273  -VPHKPQSEDVQEFAAQTKENGSGDTT---IssssssSRWPKPEIEALIQIRTNLDLQHH  106
             VP  PQ +  Q+      EN   D     ++  +SSSRWPK E++ALI +RT+L+ ++ 
Sbjct  418  IVPEAPQPQ--QQIVVSNVENNKADNNGENLTMGASSSRWPKMEVQALINLRTSLETKYQ  475

Query  105  DNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            +NG KGPLWE+ISA M+K+GY+RNAKRCKEKWENI
Sbjct  476  ENGPKGPLWEEISALMRKMGYNRNAKRCKEKWENI  510


 Score =   146 bits (369),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+AFRD+++KGPLW+EVSRK+ E GY R+AKKC+EKFEN+YKY
Sbjct  64   RWPRQETLALLKIRSDMDVAFRDASVKGPLWEEVSRKLAELGYHRNAKKCKEKFENVYKY  123

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTKEGRSG+  GK YRFF+QL+  +
Sbjct  124  HKRTKEGRSGKSEGKTYRFFDQLQALE  150


 Score = 77.8 bits (190),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ ++  ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  454  RWPKMEVQALINLRTSLETKYQENGPKGPLWEEISALMRKMGYNRNAKRCKEKWENINKY  513

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QLE  
Sbjct  514  FKKVKESSKKRPEDSKTCPYFHQLEAL  540


 Score = 74.3 bits (181),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLWE++S ++ +LGY RNAK+CKEK+EN+
Sbjct  64   RWPRQETLALLKIRSDMDVAFRDASVKGPLWEEVSRKLAELGYHRNAKKCKEKFENV  120



>ref|XP_008237583.1| PREDICTED: trihelix transcription factor GT-2-like [Prunus mume]
Length=640

 Score =   152 bits (384),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 142/213 (67%), Gaps = 35/213 (16%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +F+++MKEV++KQEDLQK+FLE IE+ E+E+M REEAW+ QE+ R+ RE+E L
Sbjct  284  RKRKWKDFFQRLMKEVIQKQEDLQKRFLETIEKREHEKMVREEAWRMQEMARVNREREIL  343

Query  354  akeraiaeakdaaviAFLQKISKQ---PILVPHKPQSE----------------------  250
            A+ER+IA AKDAAV++FLQKIS+Q   P   P   QS+                      
Sbjct  344  AQERSIAAAKDAAVMSFLQKISEQQQNPNQTPPPGQSQINNNLLQLQPPPLVPPPPRQPA  403

Query  249  ---------DVQEFAAQTK-ENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDN  100
                      V  F    K  N  G+  +SS +SSSRWPK E++ALI++RT+LD ++ +N
Sbjct  404  PPPQPQPQQPVTNFDVVPKPNNNGGNNNLSSPASSSRWPKVEVQALIKLRTSLDSKYQEN  463

Query  99   GSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            G KGPLWE+IS  M+KLGY+R++KRCKEKWENI
Sbjct  464  GPKGPLWEEISGAMRKLGYNRSSKRCKEKWENI  496


 Score =   148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD+AFRD+++KGPLWDEVSRK+   GY RSAKKC+EKFEN+YKY
Sbjct  67   RWPRQETLALLQIRSDMDVAFRDASVKGPLWDEVSRKLAALGYHRSAKKCKEKFENVYKY  126

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            HRRTKEGR+G+  GK YRFF+QLE  +
Sbjct  127  HRRTKEGRTGKSEGKTYRFFDQLEALE  153


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M + GY RS+K+C+EK+ENI KY
Sbjct  440  RWPKVEVQALIKLRTSLDSKYQENGPKGPLWEEISGAMRKLGYNRSSKRCKEKWENINKY  499

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLE  745
             ++ KE    R +  K   +F QL+
Sbjct  500  FKKVKESNKRRPEDSKTCPYFHQLD  524


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+++D+   D   KGPLW+++S ++  LGY R+AK+CKEK+EN+
Sbjct  67   RWPRQETLALLQIRSDMDVAFRDASVKGPLWDEVSRKLAALGYHRSAKKCKEKFENV  123



>ref|XP_004496473.1| PREDICTED: trihelix transcription factor GT-2-like [Cicer arietinum]
Length=626

 Score =   152 bits (383),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD+ FRD+++KGPLWDEVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  60   RWPRQETLALLRIRSDMDITFRDASVKGPLWDEVSRKLAELGYNRSAKKCKEKFENVYKY  119

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTK+GR G+  GK YRFF+QLE  D + +H
Sbjct  120  HKRTKDGRGGKSDGKTYRFFDQLEALDHIHNH  151


 Score = 94.4 bits (233),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = -3

Query  225  TKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLG  46
             K + +GD +I +SSS  RWPK E++ALI +RT LD ++ +NG KGPLWE+IS+ MK LG
Sbjct  433  VKFDNNGDNSIGASSS--RWPKVEVQALINLRTELDNKYQENGPKGPLWEEISSAMKNLG  490

Query  45   YDRNAKRCKEKWENI  1
            Y+RN KRCKEKWENI
Sbjct  491  YNRNPKRCKEKWENI  505


 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +FEK+MKEV+EKQE L K+FLEAIE+ E++RM REEAW+ QE++R+ RE+E L
Sbjct  273  RKRKWKDFFEKLMKEVIEKQEQLHKRFLEAIEKREHDRMVREEAWRAQEMQRINREREIL  332

Query  354  akeraiaeakdaaviAFLQKISKQPIL  274
            A+ER+I  AKDAAV++ LQKI++QP L
Sbjct  333  AQERSITAAKDAAVMSLLQKIAQQPNL  359


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+E+D  ++++  KGPLW+E+S  M+  GY R+ K+C+EK+ENI KY
Sbjct  449  RWPKVEVQALINLRTELDNKYQENGPKGPLWEEISSAMKNLGYNRNPKRCKEKWENINKY  508

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  509  FKKVKESNKKRPEDSKTCPYFHQLDAL  535


 Score = 72.4 bits (176),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLW+++S ++ +LGY+R+AK+CKEK+EN+
Sbjct  60   RWPRQETLALLRIRSDMDITFRDASVKGPLWDEVSRKLAELGYNRSAKKCKEKFENV  116



>gb|KHN46419.1| Trihelix transcription factor GT-2 [Glycine soja]
Length=552

 Score =   151 bits (381),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 141/218 (65%), Gaps = 47/218 (22%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV+EKQE+LQKKFLEAIE+ E++R+AREEAW+ QE++R+ RE+E LA+ER+IA
Sbjct  214  FFERLMKEVIEKQEELQKKFLEAIEKREHDRIAREEAWRVQEMQRINREREILAQERSIA  273

Query  333  eakdaaviAFLQKISKQ-------------------------------------------  283
             AKDAAV++FLQKI++Q                                           
Sbjct  274  AAKDAAVMSFLQKIAEQQNLGQALTNINLVQPQPQLQPQPPVQQQVTPPNPMQQPLPVIV  333

Query  282  --PILVPHKPQSEDVQEFAAQTKENGSGDTTIss--ssssSRWPKPEIEALIQIRTNLDL  115
              P+++P   Q  +++   A    N + +    +    SSSRWPK E++ALI++RT++D 
Sbjct  334  TQPVVLPVVSQVTNMEIMKADNNNNNNNNNNCENFLPPSSSRWPKVEVQALIKLRTSMDE  393

Query  114  QHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ++ +NG KGPLWE+ISA MKKLGY+RNAKRCKEKWENI
Sbjct  394  KYQENGPKGPLWEEISASMKKLGYNRNAKRCKEKWENI  431


 Score =   125 bits (314),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 69/77 (90%), Gaps = 3/77 (4%)
 Frame = -3

Query  948  MDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKYHRRTKEGRSGRQTGKN  769
            MD+AFRD+++KGPLW+EVSRKM E GY RS+KKC+EKFEN+YKYH+RTKEGRSG+Q GK 
Sbjct  1    MDVAFRDASVKGPLWEEVSRKMAELGYHRSSKKCKEKFENVYKYHKRTKEGRSGKQDGKT  60

Query  768  YRFFEQLEVFDAMQSHN  718
            YRFF+QL+   A+++H+
Sbjct  61   YRFFDQLQ---ALENHS  74


 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ MD  ++++  KGPLW+E+S  M++ GY R+AK+C+EK+ENI KY
Sbjct  375  RWPKVEVQALIKLRTSMDEKYQENGPKGPLWEEISASMKKLGYNRNAKRCKEKWENINKY  434

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  435  FKKVKESNKRRPEDSKTCPYFHQLDAL  461


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  LDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            +D+   D   KGPLWE++S +M +LGY R++K+CKEK+EN+
Sbjct  1    MDVAFRDASVKGPLWEEVSRKMAELGYHRSSKKCKEKFENV  41



>ref|XP_002307497.1| hypothetical protein POPTR_0005s21420g [Populus trichocarpa]
 gb|EEE94493.1| hypothetical protein POPTR_0005s21420g [Populus trichocarpa]
Length=587

 Score =   151 bits (382),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 130/192 (68%), Gaps = 25/192 (13%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +F ++ ++V++KQEDLQKKFLE +E+CE+ERMARE+AW+ +E+ R+ R+ E L +ER+ A
Sbjct  277  FFLRLTRDVIKKQEDLQKKFLETVEKCEHERMAREDAWRMKEMARMNRQHEILIQERSTA  336

Query  333  eakdaaviAFLQKIS-----------KQPILVPHKPQS----------EDVQEFAAQTKE  217
             AKDAAV AFLQKIS            QP L P   Q           E V        +
Sbjct  337  AAKDAAVFAFLQKISGQQNSTETQAIPQPKLTPPPTQPPQPRPPPTSLEPVTNLVVSKWD  396

Query  216  NGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDR  37
            NG   T     SSSSRWPK E++ALI +R +LD+++ ++G+KGPLWEDISA M+KLGY+R
Sbjct  397  NGENVTV----SSSSRWPKVEVQALISLRADLDIKYQEHGAKGPLWEDISAGMQKLGYNR  452

Query  36   NAKRCKEKWENI  1
            +AKRCKEKWENI
Sbjct  453  SAKRCKEKWENI  464


 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS MD  FRDS+LKGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  63   RWPRQETLALLKIRSAMDAVFRDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENLYKY  122

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            H+RTKEGR+G+  GK Y+FF++LE F    SH+
Sbjct  123  HKRTKEGRTGKSEGKTYKFFDELEAFQNHHSHS  155


 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+++D+ +++   KGPLW+++S  M++ GY RSAK+C+EK+ENI KY
Sbjct  408  RWPKVEVQALISLRADLDIKYQEHGAKGPLWEDISAGMQKLGYNRSAKRCKEKWENINKY  467

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F+QL+  
Sbjct  468  FKKVKESNRKRPGDSKTCPYFDQLDAL  494


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D+  KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  63   RWPRQETLALLKIRSAMDAVFRDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENL  119



>ref|XP_011044213.1| PREDICTED: trihelix transcription factor GT-2-like [Populus euphratica]
Length=586

 Score =   151 bits (381),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 131/188 (70%), Gaps = 21/188 (11%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +F ++ ++V++KQEDLQKKFLE +++CE+ERMARE+AW+ +E+ R+ R+ E L +ER+ A
Sbjct  277  FFLRLTRDVIKKQEDLQKKFLETVDKCEHERMAREDAWRMKEMARMNRQHEILIQERSTA  336

Query  333  eakdaaviAFLQKIS-----------KQPILVPHKPQS------EDVQEFAAQTKENGSG  205
             AKDAAV AFLQKIS            QP L P +P+       E V        +NG  
Sbjct  337  VAKDAAVFAFLQKISGQQNSTETQAIPQPKLTPPQPRPPVPTSLEPVTNLVVSKWDNGEN  396

Query  204  DTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKR  25
             T     SSSSRWPK E++ALI +R +LD+++ ++G+KGPLWEDISA M+KLGY+R+AK 
Sbjct  397  VTV----SSSSRWPKVEVQALISLRADLDIKYQEHGAKGPLWEDISAGMQKLGYNRSAKS  452

Query  24   CKEKWENI  1
            CKEKWENI
Sbjct  453  CKEKWENI  460


 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS MD  FRDS+LKGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  64   RWPRQETLALLKIRSAMDAVFRDSSLKGPLWEEVSRKLAELGYDRSAKKCKEKFENLYKY  123

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            H+RTKEGR+G+  GK Y+FF++LE F    S++
Sbjct  124  HKRTKEGRTGKSEGKTYKFFDELEAFQNHHSYS  156


 Score = 80.5 bits (197),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+++D+ +++   KGPLW+++S  M++ GY RSAK C+EK+ENI KY
Sbjct  404  RWPKVEVQALISLRADLDIKYQEHGAKGPLWEDISAGMQKLGYNRSAKSCKEKWENINKY  463

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F+QL+  
Sbjct  464  FKKVKESNRKRPGDSKTCPYFDQLDAL  490


 Score = 72.4 bits (176),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D+  KGPLWE++S ++ +LGYDR+AK+CKEK+EN+
Sbjct  64   RWPRQETLALLKIRSAMDAVFRDSSLKGPLWEEVSRKLAELGYDRSAKKCKEKFENL  120



>ref|XP_009621830.1| PREDICTED: trihelix transcription factor PTL-like [Nicotiana 
tomentosiformis]
 ref|XP_009621831.1| PREDICTED: trihelix transcription factor PTL-like [Nicotiana 
tomentosiformis]
Length=431

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 128/229 (56%), Gaps = 18/229 (8%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL++RS++D  F+++  KGPLWD VSR M EE GYQRS KKCREKFEN+YK
Sbjct  107  RWPRQETLTLLEVRSQLDSKFKEANQKGPLWDGVSRIMSEEHGYQRSGKKCREKFENLYK  166

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH-------NKIGGaaaaeppelaspspv  661
            Y+++TKEG++GRQ GK+YR+F QLE      S+       N IG +         +    
Sbjct  167  YYKKTKEGKAGRQDGKHYRYFRQLEALYGKTSNTISISETNNIGSSNFHYNAINNNNQEA  226

Query  660  AMIKP-------NTNIVQDFRMRPHGFGADADVLsaststtyssggssGR---KRKLAGY  511
                P       + N + D     H   +D   L+             G+   K  +  +
Sbjct  227  HNFHPEGPKLSDSLNNLSDSSDSDHATSSDDSELNTDNDLKKKRKKRRGKRSWKATIRDF  286

Query  510  FEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQ  364
             +  MK+++EKQE   +K ++ IE  E ER+ REE W+KQE  R++ EQ
Sbjct  287  VDIQMKKLIEKQEAWLEKMMKTIEHKEQERILREEEWRKQESIRIENEQ  335


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEM-KKLGYDRNAKRCKEKWENI  1
            RWP+ E   L+++R+ LD +  +   KGPLW+ +S  M ++ GY R+ K+C+EK+EN+
Sbjct  107  RWPRQETLTLLEVRSQLDSKFKEANQKGPLWDGVSRIMSEEHGYQRSGKKCREKFENL  164



>ref|XP_001766547.1| predicted protein [Physcomitrella patens]
 gb|EDQ68612.1| predicted protein [Physcomitrella patens]
Length=633

 Score =   151 bits (382),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 107/276 (39%), Positives = 161/276 (58%), Gaps = 34/276 (12%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSR----------------KMEEFGYQ  865
            RWP  ETL L++IRS++D  FRDS +KGPLW++VSR                K+ E GY 
Sbjct  220  RWPRAETLALIQIRSDLDANFRDSGVKGPLWEDVSRIYTGSWLFQATLNLEKKLAEMGYN  279

Query  864  RSAKKCREKFENIYKYHRRTKEGRSGRQTGKNYRFFEQLE-VFDAMQSHNKIGGaaaaep  688
            RS KKC+EKFENI+KY++++K+GR+GRQ GK+YRFF QL+ +F   Q+  ++    AA  
Sbjct  280  RSGKKCKEKFENIHKYYKKSKDGRAGRQDGKSYRFFAQLDALFGGQQTSTQVETDTAAAV  339

Query  687  pelaspspvAMIKPNTNI---VQDFRMRPHGF----GADADVLsaststtyssggssGRK  529
              + +  P+ +   + ++   VQ       G      +D D     +    +      RK
Sbjct  340  LLIGNAPPLGISPTDQDLNVSVQRASEVSTGVTVSKSSDDDYDGPGSGLRDNQDKKKNRK  399

Query  528  RKLA----------GYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIER  379
            RK             +FE +MK +++KQE +Q +FLE IE+ E +R A+E+AW++QE+ R
Sbjct  400  RKQIESVKFGTPKLDFFETLMKNMIDKQEAMQMRFLEMIEKMEQDRQAKEDAWRRQEVAR  459

Query  378  LKREQESLakeraiaeakdaaviAFLQKISKQPILV  271
             +RE +  A+E AIA A+D+A+I+FLQK     +LV
Sbjct  460  WQREHDLRAQENAIAAARDSALISFLQKKMNIIVLV  495


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 16/73 (22%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDIS----------------AEMKKLGYD  40
            RWP+ E  ALIQIR++LD    D+G KGPLWED+S                 ++ ++GY+
Sbjct  220  RWPRAETLALIQIRSDLDANFRDSGVKGPLWEDVSRIYTGSWLFQATLNLEKKLAEMGYN  279

Query  39   RNAKRCKEKWENI  1
            R+ K+CKEK+ENI
Sbjct  280  RSGKKCKEKFENI  292



>ref|XP_010416613.1| PREDICTED: trihelix transcription factor GT-2 [Camelina sativa]
Length=578

 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL+IRSEMD AFRDSTLK PLW+E+SRKM E GY+RSAKKC+EKFEN+YKY
Sbjct  41   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSAKKCKEKFENVYKY  100

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTKEGR+G+  GK YRFFE+LE F+ + S+
Sbjct  101  HKRTKEGRTGKSEGKTYRFFEELEAFETLNSY  132


 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 133/198 (67%), Gaps = 20/198 (10%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            R++   G F K+ KE+++KQE +QK+ LE +E  E ER++REEAW+ QEI R+ RE E+L
Sbjct  257  RRKYWKGLFTKLTKELMDKQEKMQKRLLETLENREKERISREEAWRVQEIARINREHETL  316

Query  354  akeraiaeakdaaviAFLQKIS-----KQPILVPHKP------QSEDVQEFAAQ------  226
              ER+ A AKDAA+I+FL KIS     +      HKP      QS+    F ++      
Sbjct  317  IHERSNAAAKDAAIISFLHKISGGQQQQPQQQNHHKPAQRKQYQSDHSITFESKEPRPVL  376

Query  225  ---TKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMK  55
               T + G+ DT  S S SSSRWPK E+EALI+IR NL+  + +NG+KGPLWE+ISA M+
Sbjct  377  LDTTMKMGNYDTNHSISPSSSRWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMR  436

Query  54   KLGYDRNAKRCKEKWENI  1
            +LGY+R+AKRCKEKWENI
Sbjct  437  RLGYNRSAKRCKEKWENI  454


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR  ++  ++++  KGPLW+E+S  M   GY RSAK+C+EK+ENI KY
Sbjct  398  RWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRRLGYNRSAKRCKEKWENINKY  457

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F QLE  
Sbjct  458  FKKVKESNKKRPLDSKTCPYFHQLEAL  484


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+PE  AL++IR+ +D    D+  K PLWE+IS +M +LGY R+AK+CKEK+EN+
Sbjct  41   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSAKKCKEKFENV  97



>gb|AAL65125.1| GT-2 factor [Glycine max]
Length=256

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+AFRD+++KGPLW+EVSRK+ E GY R+AKKC+EKFEN+YKY
Sbjct  44   RWPRQETLALLKIRSDMDVAFRDASVKGPLWEEVSRKLAELGYHRNAKKCKEKFENVYKY  103

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTKEGRSG+  GK YRFF+QL+  +
Sbjct  104  HKRTKEGRSGKSEGKTYRFFDQLQALE  130


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLWE++S ++ +LGY RNAK+CKEK+EN+
Sbjct  44   RWPRQETLALLKIRSDMDVAFRDASVKGPLWEEVSRKLAELGYHRNAKKCKEKFENV  100



>ref|XP_010660505.1| PREDICTED: trihelix transcription factor GTL1 isoform X2 [Vitis 
vinifera]
Length=734

 Score =   152 bits (384),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD+AFRD+TLKGPLW++VSRK+ E GY RSAKKC+EKFEN++KY
Sbjct  102  RWPRQETLALLKIRSEMDVAFRDATLKGPLWEDVSRKLAELGYSRSAKKCKEKFENVHKY  161

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            ++RTKEGR+GRQ GK+YRFF QLE   +  + N
Sbjct  162  YKRTKEGRAGRQDGKSYRFFSQLEALHSTATSN  194


 Score = 87.0 bits (214),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI +R+ LD ++ + G KGPLWE+ISA M+++GY R+AKRCKEKWENI
Sbjct  537  RWPKTEVLALINLRSGLDSRYQEAGPKGPLWEEISAGMQQMGYKRSAKRCKEKWENI  593


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+ +RS +D  ++++  KGPLW+E+S  M++ GY+RSAK+C+EK+ENI KY
Sbjct  537  RWPKTEVLALINLRSGLDSRYQEAGPKGPLWEEISAGMQQMGYKRSAKRCKEKWENINKY  596

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  597  FKKVKESNKKRPEDAKTCPYFHQLDAL  623


 Score = 77.8 bits (190),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE +MK+V+EKQE +Q++FLE IE+ E +RM REEAWK+QE+ RL RE + +A+ERA++
Sbjct  353  FFESLMKQVMEKQEVMQQRFLETIEKREQDRMIREEAWKRQEMARLSREHDLMAQERALS  412

Query  333  eakdaaviAFLQKISKQPILVP  268
             ++DAA+IAFLQKI+ Q I +P
Sbjct  413  ASRDAAIIAFLQKITGQTIQLP  434


 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D   KGPLWED+S ++ +LGY R+AK+CKEK+EN+
Sbjct  102  RWPRQETLALLKIRSEMDVAFRDATLKGPLWEDVSRKLAELGYSRSAKKCKEKFENV  158



>ref|XP_010660510.1| PREDICTED: trihelix transcription factor GTL1 isoform X3 [Vitis 
vinifera]
Length=733

 Score =   152 bits (384),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD+AFRD+TLKGPLW++VSRK+ E GY RSAKKC+EKFEN++KY
Sbjct  102  RWPRQETLALLKIRSEMDVAFRDATLKGPLWEDVSRKLAELGYSRSAKKCKEKFENVHKY  161

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            ++RTKEGR+GRQ GK+YRFF QLE   +  + N
Sbjct  162  YKRTKEGRAGRQDGKSYRFFSQLEALHSTATSN  194


 Score = 86.7 bits (213),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI +R+ LD ++ + G KGPLWE+ISA M+++GY R+AKRCKEKWENI
Sbjct  537  RWPKTEVLALINLRSGLDSRYQEAGPKGPLWEEISAGMQQMGYKRSAKRCKEKWENI  593


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+ +RS +D  ++++  KGPLW+E+S  M++ GY+RSAK+C+EK+ENI KY
Sbjct  537  RWPKTEVLALINLRSGLDSRYQEAGPKGPLWEEISAGMQQMGYKRSAKRCKEKWENINKY  596

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  597  FKKVKESNKKRPEDAKTCPYFHQLDAL  623


 Score = 77.8 bits (190),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE +MK+V+EKQE +Q++FLE IE+ E +RM REEAWK+QE+ RL RE + +A+ERA++
Sbjct  353  FFESLMKQVMEKQEVMQQRFLETIEKREQDRMIREEAWKRQEMARLSREHDLMAQERALS  412

Query  333  eakdaaviAFLQKISKQPILVP  268
             ++DAA+IAFLQKI+ Q I +P
Sbjct  413  ASRDAAIIAFLQKITGQTIQLP  434


 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D   KGPLWED+S ++ +LGY R+AK+CKEK+EN+
Sbjct  102  RWPRQETLALLKIRSEMDVAFRDATLKGPLWEDVSRKLAELGYSRSAKKCKEKFENV  158



>ref|XP_004237789.1| PREDICTED: trihelix transcription factor GT-2-like [Solanum lycopersicum]
Length=654

 Score =   151 bits (382),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET+ LLKIRSEMD+ FRDS+LKGPLW+EVSRKM + G+ RS+KKC+EKFEN+YKY
Sbjct  60   RWPRQETIALLKIRSEMDVIFRDSSLKGPLWEEVSRKMADLGFHRSSKKCKEKFENVYKY  119

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKI  712
            H+RTK+GR+ +  GKNYRFFEQLE  + + SH+ +
Sbjct  120  HKRTKDGRASKADGKNYRFFEQLEALENITSHHSL  154


 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 63/74 (85%), Gaps = 2/74 (3%)
 Frame = -3

Query  222  KENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGY  43
            K +  GD+   S +SSSRWPK E+EALI++RTNLD+++ +NG KGPLWE+IS+ MKK+GY
Sbjct  446  KSDNGGDS--YSPASSSRWPKAEVEALIKLRTNLDVKYQENGPKGPLWEEISSGMKKIGY  503

Query  42   DRNAKRCKEKWENI  1
            +RNAKRCKEKWENI
Sbjct  504  NRNAKRCKEKWENI  517


 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D+ ++++  KGPLW+E+S  M++ GY R+AK+C+EK+ENI KY
Sbjct  461  RWPKAEVEALIKLRTNLDVKYQENGPKGPLWEEISSGMKKIGYNRNAKRCKEKWENINKY  520

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  521  FKKVKESNKKRPEDSKTCPYFHQLDAL  547


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D+  KGPLWE++S +M  LG+ R++K+CKEK+EN+
Sbjct  60   RWPRQETIALLKIRSEMDVIFRDSSLKGPLWEEVSRKMADLGFHRSSKKCKEKFENV  116


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 70/96 (73%), Gaps = 5/96 (5%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            YFEK  K+V+ KQE+  ++FLE +E+ E++RM REEAWK +E+ R+ RE + L +ERA+A
Sbjct  282  YFEKFTKDVINKQEESHRRFLEKLEKREHDRMVREEAWKVEEMARMNREHDLLVQERAMA  341

Query  333  eakdaaviAFLQKIS-KQPILVPHK----PQSEDVQ  241
             AKDAAVI+FLQKI+ +Q I +P+     P S  VQ
Sbjct  342  AAKDAAVISFLQKITEQQNIQIPNSINVGPPSAQVQ  377



>gb|KFK42102.1| hypothetical protein AALP_AA2G210900 [Arabis alpina]
Length=574

 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 135/201 (67%), Gaps = 23/201 (11%)
 Frame = -3

Query  534  RKRKL-AGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQES  358
            +KRK   G F K+ KE++EKQE +QK+FLE +E  E ER++REEAW+ QEI R+ RE E+
Sbjct  252  KKRKYWKGLFTKLTKELMEKQEKMQKRFLETLENREKERISREEAWRVQEIARINREHET  311

Query  357  LakeraiaeakdaaviAFLQKIS-------KQPILVPHKP------QSEDVQEFAAQ---  226
            L  ER+ A  KDAA+I+FL KIS       +Q     HK       QSE+   F ++   
Sbjct  312  LVHERSNAATKDAAIISFLHKISGGQQQQPQQHAQQNHKVSQRKQYQSENSITFESKEPR  371

Query  225  ------TKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISA  64
                  T + G+ DT  S S SSSRWPK E+EALI+IR NL+  + +NG+KGPLWE+ISA
Sbjct  372  TILLDTTMKMGNYDTNHSVSPSSSRWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISA  431

Query  63   EMKKLGYDRNAKRCKEKWENI  1
             M++LGY+R+AKRCKEKWENI
Sbjct  432  GMRRLGYNRSAKRCKEKWENI  452


 Score =   149 bits (375),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL+IRSEMD AFRDSTLK PLW+E+SRKM + GY+RSAKKC+EKFEN+YKY
Sbjct  37   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMVDLGYKRSAKKCKEKFENVYKY  96

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTK+GR+G+  GK YRFFE+LE F+ + S+
Sbjct  97   HKRTKDGRTGKSEGKTYRFFEELEAFETLNSY  128


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR  ++  ++++  KGPLW+E+S  M   GY RSAK+C+EK+ENI KY
Sbjct  396  RWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRRLGYNRSAKRCKEKWENINKY  455

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F QLE  
Sbjct  456  FKKVKESNKKRPVDSKTCPYFHQLEAL  482


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+PE  AL++IR+ +D    D+  K PLWE+IS +M  LGY R+AK+CKEK+EN+
Sbjct  37   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMVDLGYKRSAKKCKEKFENV  93



>ref|NP_177815.1| trihelix transcription factor GT-2 [Arabidopsis thaliana]
 sp|Q39117.1|TGT2_ARATH RecName: Full=Trihelix transcription factor GT-2; AltName: Full=Trihelix 
DNA-binding protein GT-2 [Arabidopsis thaliana]
 gb|AAG51145.1|AC079283_2 trihelix DNA-binding protein (GT2) [Arabidopsis thaliana]
 emb|CAA51289.1| GT-2 factor [Arabidopsis thaliana]
 gb|ABO38776.1| At1g76890 [Arabidopsis thaliana]
 gb|AEE35899.1| trihelix transcription factor GT-2 [Arabidopsis thaliana]
Length=575

 Score =   150 bits (380),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 133/198 (67%), Gaps = 20/198 (10%)
 Frame = -3

Query  534  RKRKL-AGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQES  358
            +KRK   G F K+ KE++EKQE +QK+FLE +E  E ER++REEAW+ QEI R+ RE E+
Sbjct  256  KKRKYWKGLFTKLTKELMEKQEKMQKRFLETLEYREKERISREEAWRVQEIGRINREHET  315

Query  357  LakeraiaeakdaaviAFLQKISKQPILVP----HKP------QSEDVQEFAAQTKENGS  208
            L  ER+ A AKDAA+I+FL KIS      P    HKP      QS+    F ++      
Sbjct  316  LIHERSNAAAKDAAIISFLHKISGGQPQQPQQHNHKPSQRKQYQSDHSITFESKEPRAVL  375

Query  207  GDTTI---------ssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMK  55
             DTTI         S S SSSRWPK E+EALI+IR NL+  + +NG+KGPLWE+ISA M+
Sbjct  376  LDTTIKMGNYDNNHSVSPSSSRWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMR  435

Query  54   KLGYDRNAKRCKEKWENI  1
            +LGY+R+AKRCKEKWENI
Sbjct  436  RLGYNRSAKRCKEKWENI  453


 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL+IRSEMD AFRDSTLK PLW+E+SRKM E GY+RS+KKC+EKFEN+YKY
Sbjct  41   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSSKKCKEKFENVYKY  100

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTKEGR+G+  GK YRFFE+LE F+ + S+
Sbjct  101  HKRTKEGRTGKSEGKTYRFFEELEAFETLSSY  132


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR  ++  ++++  KGPLW+E+S  M   GY RSAK+C+EK+ENI KY
Sbjct  397  RWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRRLGYNRSAKRCKEKWENINKY  456

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F QLE  
Sbjct  457  FKKVKESNKKRPLDSKTCPYFHQLEAL  483


 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+PE  AL++IR+ +D    D+  K PLWE+IS +M +LGY R++K+CKEK+EN+
Sbjct  41   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSSKKCKEKFENV  97



>ref|XP_009594163.1| PREDICTED: trihelix transcription factor GTL1-like [Nicotiana 
tomentosiformis]
Length=652

 Score =   151 bits (382),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRSEMD+ FRDS+LKGPLW+EVSRK+ + GY RSAKKC+EKFEN+YKY
Sbjct  64   RWPRQETLALLRIRSEMDVVFRDSSLKGPLWEEVSRKLADLGYHRSAKKCKEKFENVYKY  123

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            HRRTK+GR+ +  GK YRFF+QL  F+   SHN
Sbjct  124  HRRTKDGRASKADGKTYRFFDQLAAFENSPSHN  156


 Score =   105 bits (263),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = -3

Query  261  PQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPL  82
            P    V+ F A   +NG  + +    +SSSRWPK EIEALI++RT+LDL++ DNG KGPL
Sbjct  434  PSLPVVKTFEAPKPDNGGENFS---PASSSRWPKEEIEALIRLRTSLDLKYQDNGPKGPL  490

Query  81   WEDISAEMKKLGYDRNAKRCKEKWENI  1
            WE+ISA M+KLGY+RNAKRCKEKWENI
Sbjct  491  WEEISAGMRKLGYNRNAKRCKEKWENI  517


 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++R+ +DL ++D+  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  461  RWPKEEIEALIRLRTSLDLKYQDNGPKGPLWEEISAGMRKLGYNRNAKRCKEKWENINKY  520

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKI  712
             ++ KE    R +  K   +F QLE     ++ N++
Sbjct  521  FKKVKESNKKRPEDSKTCPYFHQLEALYKEKAKNEV  556


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D+  KGPLWE++S ++  LGY R+AK+CKEK+EN+
Sbjct  64   RWPRQETLALLRIRSEMDVVFRDSSLKGPLWEEVSRKLADLGYHRSAKKCKEKFENV  120


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   +FE++ K+V+EKQE+LQKKFLE +E+ E ERM REE  + QE+ R+ RE + L
Sbjct  275  KKRKWKDFFERLTKDVIEKQEELQKKFLETLEKRERERMVREETLRLQEMTRMNREHDLL  334

Query  354  akeraiaeakdaaviAFLQKISKQ  283
             +ER++A AKDA +IAFLQKI++Q
Sbjct  335  VQERSMAAAKDATIIAFLQKITEQ  358



>gb|AAM64675.1| trihelix DNA-binding protein (GT2) [Arabidopsis thaliana]
Length=548

 Score =   150 bits (380),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 133/198 (67%), Gaps = 20/198 (10%)
 Frame = -3

Query  534  RKRKL-AGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQES  358
            +KRK   G F K+ KE++EKQE +QK+FLE +E  E ER++REEAW+ QEI R+ RE E+
Sbjct  229  KKRKYWKGLFTKLTKELMEKQEKMQKRFLETLEYREKERISREEAWRVQEIGRINREHET  288

Query  357  LakeraiaeakdaaviAFLQKISKQPILVP----HKP------QSEDVQEFAAQTKENGS  208
            L  ER+ A AKDAA+I+FL KIS      P    HKP      QS+    F ++      
Sbjct  289  LIHERSNAAAKDAAIISFLHKISGGQPQQPQQHNHKPSQRKQYQSDHSITFESKEPRAVL  348

Query  207  GDTTI---------ssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMK  55
             DTTI         S S SSSRWPK E+EALI+IR NL+  + +NG+KGPLWE+ISA M+
Sbjct  349  LDTTIKMGNYDNNHSVSPSSSRWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMR  408

Query  54   KLGYDRNAKRCKEKWENI  1
            +LGY+R+AKRCKEKWENI
Sbjct  409  RLGYNRSAKRCKEKWENI  426


 Score =   150 bits (379),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL+IRSEMD AFRDSTLK PLW+E+SRKM E GY+RS+KKC+EKFEN+YKY
Sbjct  14   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSSKKCKEKFENVYKY  73

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTKEGR+G+  GK YRFFE+LE F+ + S+
Sbjct  74   HKRTKEGRTGKSEGKTYRFFEELEAFETLSSY  105


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR  ++  ++++  KGPLW+E+S  M   GY RSAK+C+EK+ENI KY
Sbjct  370  RWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRRLGYNRSAKRCKEKWENINKY  429

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F QLE  
Sbjct  430  FKKVKESNKKRPLDSKTCPYFHQLEAL  456


 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+PE  AL++IR+ +D    D+  K PLWE+IS +M +LGY R++K+CKEK+EN+
Sbjct  14   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSSKKCKEKFENV  70



>ref|XP_002532429.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29944.1| conserved hypothetical protein [Ricinus communis]
Length=675

 Score =   151 bits (382),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+ FRD+++KGPLWDEVSRK+ E GY RSAKKC+EKFEN++KY
Sbjct  81   RWPRQETLALLKIRSDMDVTFRDASVKGPLWDEVSRKLAELGYNRSAKKCKEKFENVFKY  140

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA  733
            H+RTKEGR+G+Q GK YRFF+QLE F++
Sbjct  141  HKRTKEGRTGKQEGKTYRFFDQLEAFES  168


 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E++ALI +RTNLD ++ +NG KGPLWE+ISA M+KLGY+RNAKRCKEKWENI
Sbjct  481  RWPKVEVQALIDLRTNLDSKYQENGPKGPLWEEISAGMRKLGYNRNAKRCKEKWENI  537


 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 61/96 (64%), Gaps = 2/96 (2%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +D  ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  481  RWPKVEVQALIDLRTNLDSKYQENGPKGPLWEEISAGMRKLGYNRNAKRCKEKWENINKY  540

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKI  712
             ++ KE    R +  K   +F+QL+     + H+KI
Sbjct  541  FKKVKESNKRRPEDSKTCPYFQQLDAL-YKEKHSKI  575


 Score = 76.6 bits (187),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV+ KQED+Q+KFLEAIE+ E++RM REE+W+ QE+ R+ RE+E LA+ER+IA
Sbjct  312  FFERLMKEVIHKQEDMQRKFLEAIEKREHDRMVREESWRMQEMARINREREILAQERSIA  371

Query  333  eakdaaviAFLQKIS  289
             AKDAAV+AFLQK+S
Sbjct  372  AAKDAAVMAFLQKLS  386


 Score = 72.0 bits (175),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLW+++S ++ +LGY+R+AK+CKEK+EN+
Sbjct  81   RWPRQETLALLKIRSDMDVTFRDASVKGPLWDEVSRKLAELGYNRSAKKCKEKFENV  137



>ref|XP_006359818.1| PREDICTED: trihelix transcription factor GT-2-like [Solanum tuberosum]
Length=628

 Score =   150 bits (380),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET+ LLKIRSEMD+ FRDS+LKGPLW+EVSRKM + G+ RS+KKC+EKFEN+YKY
Sbjct  60   RWPRQETIALLKIRSEMDVIFRDSSLKGPLWEEVSRKMADLGFHRSSKKCKEKFENVYKY  119

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKI  712
            H+RTK+GR+ +  GKNYRFFEQLE  + + SH+ +
Sbjct  120  HKRTKDGRASKADGKNYRFFEQLEALENITSHHSL  154


 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 132/228 (58%), Gaps = 59/228 (26%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            YF+K  K+V+ KQE+  ++FLE +E+ E++RM REEAWK +E+ R+ RE + L +ERA+A
Sbjct  267  YFDKFTKDVINKQEESHRRFLEKLEKREHDRMVREEAWKLEEMARMNREHDLLVQERAMA  326

Query  333  eakdaaviAFLQKISKQP------------------ILVPHKPQSEDVQEFAAQT-----  223
             AKDAAVI+FLQKI++Q                   I +P  P    V   + Q      
Sbjct  327  AAKDAAVISFLQKITEQQNIQIPNSINVGPPSPQVQIQLPENPLPAPVPTHSPQIQPTVT  386

Query  222  ----------------------------------KENGSGDTTIssssssSRWPKPEIEA  145
                                              K +  GD+   S +SSSRWPK E+EA
Sbjct  387  AAPAPVPAPVPALLPSLSLPLTPPVPSKNMELVPKSDNGGDS--YSPASSSRWPKAEVEA  444

Query  144  LIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            LI++RTNLD+++ +NG KGPLWE+IS+ MKK+GY+RNAKRCKEKWENI
Sbjct  445  LIKLRTNLDVKYQENGPKGPLWEEISSGMKKIGYNRNAKRCKEKWENI  492


 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D+ ++++  KGPLW+E+S  M++ GY R+AK+C+EK+ENI KY
Sbjct  436  RWPKAEVEALIKLRTNLDVKYQENGPKGPLWEEISSGMKKIGYNRNAKRCKEKWENINKY  495

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  496  FKKVKESNKKRPEDSKTCPYFHQLDAL  522


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D+  KGPLWE++S +M  LG+ R++K+CKEK+EN+
Sbjct  60   RWPRQETIALLKIRSEMDVIFRDSSLKGPLWEEVSRKMADLGFHRSSKKCKEKFENV  116



>ref|XP_010416611.1| PREDICTED: trihelix transcription factor GT-2-like [Camelina 
sativa]
Length=616

 Score =   150 bits (380),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 145/218 (67%), Gaps = 47/218 (22%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MK+V++KQE+LQ+KFLEA+E+ E+ER+ REE+W+ QEI R+ R+QE LA+ER+++
Sbjct  258  FFERLMKQVVDKQEELQRKFLEAVEKREHERLVREESWRVQEIARINRDQEILAQERSMS  317

Query  333  eakdaaviAFLQKIS-KQPILVPHKPQSEDVQEF--------------------------  235
             AKDAAV+AFLQK+S KQP   P   Q + V+                            
Sbjct  318  AAKDAAVMAFLQKLSEKQPNQPPTTVQPQQVRPQMQLLNNNNNQQQTPQPSPPAPPPLLQ  377

Query  234  --------AAQTKENGSGDTTIss------------ssssSRWPKPEIEALIQIRTNLDL  115
                    +++T++  +GD ++ +            S+SSSRWPK EIEALI++RTNLD 
Sbjct  378  PIQAVLPSSSETRKTDNGDQSMMTPASASASASGSGSASSSRWPKVEIEALIKLRTNLDS  437

Query  114  QHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ++ +NG KGPLWE+ISA M++LG++RN+KRCKEKWENI
Sbjct  438  KYQENGPKGPLWEEISAGMRRLGFNRNSKRCKEKWENI  475


 Score =   142 bits (359),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLK+RS+M +AFRD+++KGPLW+EVSRKM E GY R+AKKC+EKFEN+YKY
Sbjct  70   RWPRQETLALLKLRSDMGIAFRDASVKGPLWEEVSRKMGELGYIRNAKKCKEKFENVYKY  129

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTKEGR+G+  GK YRFF+QLE  +    H
Sbjct  130  HKRTKEGRTGKSDGKTYRFFDQLEALETHDHH  161


 Score = 75.5 bits (184),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M   G+ R++K+C+EK+ENI KY
Sbjct  419  RWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMRRLGFNRNSKRCKEKWENINKY  478

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  479  FKKVKESNKKRPEDSKTCPYFHQLDAL  505


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+++R+++ +   D   KGPLWE++S +M +LGY RNAK+CKEK+EN+
Sbjct  70   RWPRQETLALLKLRSDMGIAFRDASVKGPLWEEVSRKMGELGYIRNAKKCKEKFENV  126



>ref|XP_002889107.1| hypothetical protein ARALYDRAFT_895570 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65366.1| hypothetical protein ARALYDRAFT_895570 [Arabidopsis lyrata subsp. 
lyrata]
Length=576

 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL+IRSEMD AFRDSTLK PLW+E+SRKM E GY+RS+KKC+EKFEN+YKY
Sbjct  41   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSSKKCKEKFENVYKY  100

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTKEGR+G+  GK YRFFE+LE F+ + S+
Sbjct  101  HKRTKEGRTGKSEGKTYRFFEELEAFETLSSY  132


 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 132/198 (67%), Gaps = 20/198 (10%)
 Frame = -3

Query  534  RKRKL-AGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQES  358
            +KRK   G F K+ KE++EKQE +QK+FLE +E  E ER+ REEAW+ QEI R+ RE E 
Sbjct  256  KKRKYWKGLFTKLTKELMEKQEKMQKRFLETLENREKERITREEAWRVQEIARINREHEI  315

Query  357  LakeraiaeakdaaviAFLQKISKQPILVP----HKP------QSEDVQEFAAQ------  226
            L  ER+ A AKDAA+I+FL KIS      P    HKP      +S+    F ++      
Sbjct  316  LIHERSNAAAKDAAIISFLNKISGGQPQQPQQHNHKPSQRKQYRSDHSITFESKEPRPVL  375

Query  225  ---TKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMK  55
               T + G+ D   S S SSSRWPK E+EALI+IR NL+  + +NG+KGPLWE+ISA MK
Sbjct  376  LDTTMKMGNYDNNHSVSPSSSRWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMK  435

Query  54   KLGYDRNAKRCKEKWENI  1
            +LGY+R+AKRCKEKWENI
Sbjct  436  RLGYNRSAKRCKEKWENI  453


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR  ++  ++++  KGPLW+E+S  M+  GY RSAK+C+EK+ENI KY
Sbjct  397  RWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMKRLGYNRSAKRCKEKWENINKY  456

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F QLE  
Sbjct  457  FKKVKESNKKRPLDSKTCPYFHQLEAL  483


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+PE  AL++IR+ +D    D+  K PLWE+IS +M +LGY R++K+CKEK+EN+
Sbjct  41   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSSKKCKEKFENV  97



>ref|XP_009128204.1| PREDICTED: trihelix transcription factor GT-2-like [Brassica 
rapa]
Length=517

 Score =   150 bits (378),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL+IRSEMD AFRDSTLK PLW+EVSRKM+E GY+RSAKKC+EKFEN+YKY
Sbjct  26   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEVSRKMKELGYKRSAKKCKEKFENVYKY  85

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTKEGR+G+  GK YRFFE+L+  +A+ S+
Sbjct  86   HKRTKEGRTGKSEGKTYRFFEELQALEALNSY  117


 Score =   143 bits (360),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 125/187 (67%), Gaps = 9/187 (5%)
 Frame = -3

Query  534  RKRKL-AGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQES  358
            +KRK   G F K+  E++EKQE +QK+FLE  E  E ER++REEAW+ QE+ R+ RE E+
Sbjct  228  KKRKYWKGLFTKLTNELMEKQEKVQKRFLETFENQERERISREEAWRVQEVARINREHET  287

Query  357  LakeraiaeakdaaviAFLQKISKQPIL------VPHKPQSEDVQEFAAQTKENGSG--D  202
            L  ER+ A AKDA +I+FL KIS           VP + Q         ++KE      D
Sbjct  288  LVHERSNAVAKDAVIISFLHKISGGQQQQQQKHEVPQRKQYHSEHSITFESKEPRPVLFD  347

Query  201  TTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRC  22
            +  S S SSSRWPK E+EALI+IR NL+  + +NG++GPLWE+IS  M++LGY+R+AKRC
Sbjct  348  SNHSLSPSSSRWPKTEVEALIRIRKNLEANYQENGTRGPLWEEISGGMRRLGYNRSAKRC  407

Query  21   KEKWENI  1
            KEKWENI
Sbjct  408  KEKWENI  414


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR  ++  ++++  +GPLW+E+S  M   GY RSAK+C+EK+ENI KY
Sbjct  358  RWPKTEVEALIRIRKNLEANYQENGTRGPLWEEISGGMRRLGYNRSAKRCKEKWENINKY  417

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F QLE  
Sbjct  418  FKKVKESNKKRPLDSKTCPYFNQLEAL  444


 Score = 73.9 bits (180),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+PE  AL++IR+ +D    D+  K PLWE++S +MK+LGY R+AK+CKEK+EN+
Sbjct  26   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEVSRKMKELGYKRSAKKCKEKFENV  82



>ref|XP_010660501.1| PREDICTED: trihelix transcription factor GTL1 isoform X1 [Vitis 
vinifera]
Length=811

 Score =   152 bits (384),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD+AFRD+TLKGPLW++VSRK+ E GY RSAKKC+EKFEN++KY
Sbjct  102  RWPRQETLALLKIRSEMDVAFRDATLKGPLWEDVSRKLAELGYSRSAKKCKEKFENVHKY  161

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            ++RTKEGR+GRQ GK+YRFF QLE   +  + N
Sbjct  162  YKRTKEGRAGRQDGKSYRFFSQLEALHSTATSN  194


 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI +R+ LD ++ + G KGPLWE+ISA M+++GY R+AKRCKEKWENI
Sbjct  537  RWPKTEVLALINLRSGLDSRYQEAGPKGPLWEEISAGMQQMGYKRSAKRCKEKWENI  593


 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+ +RS +D  ++++  KGPLW+E+S  M++ GY+RSAK+C+EK+ENI KY
Sbjct  537  RWPKTEVLALINLRSGLDSRYQEAGPKGPLWEEISAGMQQMGYKRSAKRCKEKWENINKY  596

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  597  FKKVKESNKKRPEDAKTCPYFHQLDAL  623


 Score = 77.8 bits (190),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE +MK+V+EKQE +Q++FLE IE+ E +RM REEAWK+QE+ RL RE + +A+ERA++
Sbjct  353  FFESLMKQVMEKQEVMQQRFLETIEKREQDRMIREEAWKRQEMARLSREHDLMAQERALS  412

Query  333  eakdaaviAFLQKISKQPILVP  268
             ++DAA+IAFLQKI+ Q I +P
Sbjct  413  ASRDAAIIAFLQKITGQTIQLP  434


 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D   KGPLWED+S ++ +LGY R+AK+CKEK+EN+
Sbjct  102  RWPRQETLALLKIRSEMDVAFRDATLKGPLWEDVSRKLAELGYSRSAKKCKEKFENV  158



>ref|XP_011042851.1| PREDICTED: trihelix transcription factor GT-2-like [Populus euphratica]
Length=593

 Score =   150 bits (378),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 128/194 (66%), Gaps = 27/194 (14%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++ ++V++KQEDLQ+KFLE IE+ E+ERMAREEAW+ QE  R+ RE E+L +ER+ A
Sbjct  275  FFERLTRDVIKKQEDLQEKFLEKIEKYEHERMAREEAWRTQETARINREHETLIQERSTA  334

Query  333  eakdaaviAFLQKISKQPILV-----------------------PHKPQSEDVQEFAAQT  223
             AKDAAV+AFLQKIS Q   V                       P       V +     
Sbjct  335  AAKDAAVVAFLQKISGQQNSVQTQEIPQPTTTPTASPPQPLQLRPAPASLAPVTKSEVPK  394

Query  222  KENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGY  43
            ++NG   T     SSSSRWPK E++ALI +R NLD+++ +NG+KGPLWEDISA M++LGY
Sbjct  395  RDNGDNFTV----SSSSRWPKVEVQALINLRANLDIKYQENGAKGPLWEDISAGMQRLGY  450

Query  42   DRNAKRCKEKWENI  1
            +R+AKR  EKWENI
Sbjct  451  NRSAKRGNEKWENI  464


 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD  FRDS LKGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  61   RWPRQETLALLKIRSDMDAVFRDSGLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKY  120

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            H+RTKEGR+G+  GK+Y+FF++LE F    SH+
Sbjct  121  HKRTKEGRTGKSEGKSYKFFDELEAFQNHPSHS  153


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +D+ ++++  KGPLW+++S  M+  GY RSAK+  EK+ENI KY
Sbjct  408  RWPKVEVQALINLRANLDIKYQENGAKGPLWEDISAGMQRLGYNRSAKRGNEKWENINKY  467

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F+QL+  
Sbjct  468  FKKVKESNKKRPEDSKTCPYFDQLDAL  494


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D+G KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  61   RWPRQETLALLKIRSDMDAVFRDSGLKGPLWEEVSRKLAELGYHRSAKKCKEKFENV  117



>ref|XP_003536427.1| PREDICTED: trihelix transcription factor GT-2-like [Glycine max]
Length=667

 Score =   150 bits (380),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 83/93 (89%), Gaps = 3/93 (3%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD+AFRD+++KGPLW+EVSRKM E GY RS+KKC+EKFEN+YKY
Sbjct  74   RWPRQETLALLRIRSDMDVAFRDASVKGPLWEEVSRKMAELGYHRSSKKCKEKFENVYKY  133

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            H+RTKEGRSG+Q GK YRFF+QL+   A+++H+
Sbjct  134  HKRTKEGRSGKQDGKTYRFFDQLQ---ALENHS  163


 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E++ALI++RT++D ++ +NG KGPLWE+ISA MKKLGY+RNAKRCKEKWENI
Sbjct  474  RWPKVEVQALIKLRTSMDEKYQENGPKGPLWEEISASMKKLGYNRNAKRCKEKWENI  530


 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV+EKQE+LQKKFLEAIE+ E++R+AREEAW+ QE++R+ RE+E LA+ER+IA
Sbjct  308  FFERLMKEVIEKQEELQKKFLEAIEKREDDRIAREEAWRVQEMKRINREREILAQERSIA  367

Query  333  eakdaaviAFLQKISKQ  283
             AKDAAV++FLQKI++Q
Sbjct  368  AAKDAAVMSFLQKIAEQ  384


 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ MD  ++++  KGPLW+E+S  M++ GY R+AK+C+EK+ENI KY
Sbjct  474  RWPKVEVQALIKLRTSMDEKYQENGPKGPLWEEISASMKKLGYNRNAKRCKEKWENINKY  533

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  534  FKKVKESNKRRPEDSKTCPYFHQLDAL  560


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLWE++S +M +LGY R++K+CKEK+EN+
Sbjct  74   RWPRQETLALLRIRSDMDVAFRDASVKGPLWEEVSRKMAELGYHRSSKKCKEKFENV  130



>gb|KCW71141.1| hypothetical protein EUGRSUZ_F04239 [Eucalyptus grandis]
Length=570

 Score =   150 bits (378),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 133/214 (62%), Gaps = 36/214 (17%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKR+   +FE+++K+V++KQEDL + FLE I++CE ER AREE+W  QE  RL RE+E L
Sbjct  200  RKRRWRDFFERVIKDVMDKQEDLHRSFLEMIDKCERERAAREESWWMQETARLAREREIL  259

Query  354  akeraiaeakdaaviAFLQKISKQ-------------------PILVPHKPQSEDV----  244
            A+ER  AEAKD AV++FLQKI++Q                    +  P  P+   V    
Sbjct  260  AQERLAAEAKDTAVMSFLQKIAEQQSRRSSPAQNNNPLSQQLVAVPTPATPKPSTVPPPA  319

Query  243  -----------QEFAAQTKENGSGDTTIss--ssssSRWPKPEIEALIQIRTNLDLQHHD  103
                       +       +NG    T     ++SSSRWPK E+EALI++RTNLD ++ +
Sbjct  320  AAAAAALPSQMRSIEVPKADNGVHFATPRGGGAASSSRWPKVEVEALIRLRTNLDGKYQE  379

Query  102  NGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            NG KGPLWEDIS  M++LGY+R++KRCKEKWENI
Sbjct  380  NGPKGPLWEDISVAMRRLGYERSSKRCKEKWENI  413


 Score =   119 bits (299),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  948  MDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKYHRRTKEGRSGRQTGKN  769
            MD+ FRDS+ KGPLW+EVSRK+ E GY RSAKKC+EKFEN++KYH+RTK+GR+G+  GK 
Sbjct  1    MDVTFRDSSAKGPLWEEVSRKLSELGYHRSAKKCKEKFENVFKYHKRTKDGRTGKHEGKA  60

Query  768  YRFFEQLEVFDAMQSHN  718
            YRFF+QLE F+    H+
Sbjct  61   YRFFDQLEAFENHTLHS  77


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+++R+ +D  ++++  KGPLW+++S  M   GY+RS+K+C+EK+ENI KY
Sbjct  357  RWPKVEVEALIRLRTNLDGKYQENGPKGPLWEDISVAMRRLGYERSSKRCKEKWENINKY  416

Query  816  HRRTKEG-RSGRQTGKNYRFFEQLE  745
             ++ KE  +  R+  K   +F+QL+
Sbjct  417  FKKVKESNKKRREDSKTCPYFQQLD  441


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  LDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            +D+   D+ +KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  1    MDVTFRDSSAKGPLWEEVSRKLSELGYHRSAKKCKEKFENV  41



>ref|XP_006390147.1| hypothetical protein EUTSA_v10018336mg [Eutrema salsugineum]
 gb|ESQ27433.1| hypothetical protein EUTSA_v10018336mg [Eutrema salsugineum]
Length=580

 Score =   149 bits (377),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL+IRSEMD AFRDSTLK PLW+++SRKM E GY+RSAKKC+EKFEN+YKY
Sbjct  43   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEKISRKMMELGYKRSAKKCKEKFENVYKY  102

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTKEGR+G+  GK YRFFE+LE F+ + S+
Sbjct  103  HKRTKEGRTGKSEGKTYRFFEELEAFETLNSY  134


 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 132/199 (66%), Gaps = 21/199 (11%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            R++   G F K+ KE++EKQE +Q++FLE +E  E ER++REEAW+ QE+ R+ REQE+L
Sbjct  259  RRKYWKGLFTKLTKELMEKQEKMQRRFLETLENRERERISREEAWRVQEVARINREQETL  318

Query  354  akeraiaeakdaaviAFLQKIS----------KQPILVPHKPQSEDVQEFAAQTKEN---  214
              ER+ A AKDAA+I+FL KIS           Q   V  + Q +       ++KE    
Sbjct  319  VHERSSAAAKDAAIISFLHKISGGQQQPQQHAHQNHKVSQRKQYQSDHSITFESKEPRPV  378

Query  213  --------GSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEM  58
                    G+ DT  S S SSSRWPK E+EALI+IR NL+  + +NG+KGPLWE+ISA M
Sbjct  379  LLDTTMKMGNYDTNHSVSPSSSRWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGM  438

Query  57   KKLGYDRNAKRCKEKWENI  1
            ++LGY+R+AKRCKEKWENI
Sbjct  439  RRLGYNRSAKRCKEKWENI  457


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR  ++  ++++  KGPLW+E+S  M   GY RSAK+C+EK+ENI KY
Sbjct  401  RWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRRLGYNRSAKRCKEKWENINKY  460

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F QLE  
Sbjct  461  FKKVKESNKKRPLDSKTCPYFHQLEAL  487


 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+PE  AL++IR+ +D    D+  K PLWE IS +M +LGY R+AK+CKEK+EN+
Sbjct  43   RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEKISRKMMELGYKRSAKKCKEKFENV  99



>ref|XP_007143536.1| hypothetical protein PHAVU_007G079700g [Phaseolus vulgaris]
 gb|ESW15530.1| hypothetical protein PHAVU_007G079700g [Phaseolus vulgaris]
Length=649

 Score =   150 bits (378),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 137/219 (63%), Gaps = 49/219 (22%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV+EKQEDLQKKFLEAIE+ E++R+AREEAW+ QE++R+ RE+E LA+ER+IA
Sbjct  304  FFERLMKEVIEKQEDLQKKFLEAIEKREHDRIAREEAWRVQEMQRINREREILAQERSIA  363

Query  333  eakdaaviAFLQK-----------------------------------------------  295
             AKDAAV++FLQK                                               
Sbjct  364  AAKDAAVMSFLQKIAEQQNLGQALSNINLVQQPPHQQPQPPLQQLPPSSVAPPPAQQPLP  423

Query  294  -ISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLD  118
             +  QP+++P   Q  ++ E       N +      + SSSSRWPK E++ALI++RTNLD
Sbjct  424  AVVTQPVVLPVFSQVTNM-EIVKVDNNNNNNSCENFTPSSSSRWPKVEVQALIKLRTNLD  482

Query  117  LQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             ++ +NG KGPLWE+IS+ M+KLGY RNAKRCKEKWENI
Sbjct  483  SKYQENGPKGPLWEEISSSMRKLGYIRNAKRCKEKWENI  521


 Score =   146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 81/93 (87%), Gaps = 3/93 (3%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IR +MD+AFRD+++KGPLW+EVSRKM E GY RS+KKC+EKFEN+YKY
Sbjct  67   RWPRQETLALLRIRKDMDVAFRDASVKGPLWEEVSRKMAELGYHRSSKKCKEKFENVYKY  126

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            H+RTKEGRSG+Q GK YRFF++L+   A+++H 
Sbjct  127  HKRTKEGRSGKQDGKTYRFFDELQ---ALENHT  156


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  465  RWPKVEVQALIKLRTNLDSKYQENGPKGPLWEEISSSMRKLGYIRNAKRCKEKWENINKY  524

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  525  FKKVKESNKRRPEDSKTCPYFHQLDAL  551


 Score = 71.2 bits (173),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR ++D+   D   KGPLWE++S +M +LGY R++K+CKEK+EN+
Sbjct  67   RWPRQETLALLRIRKDMDVAFRDASVKGPLWEEVSRKMAELGYHRSSKKCKEKFENV  123



>ref|XP_009382324.1| PREDICTED: trihelix transcription factor GTL1-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=612

 Score =   149 bits (377),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 135/210 (64%), Gaps = 34/210 (16%)
 Frame = -3

Query  531  KRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLa  352
            +R++  +FE +MK+V+E+QE +Q++FL+AI++ E +RM REEAW+ QE+ RL REQE L 
Sbjct  286  RRQMMAFFEGLMKQVMERQEAMQQRFLDAIDKREQDRMKREEAWRLQEMSRLSREQELLV  345

Query  351  keraiaeakdaaviAFLQKISKQPI-------LVPHKPQSE-------------------  250
            +ER++A ++D+AV+++LQKIS Q I       + P  PQ                     
Sbjct  346  QERSMAASRDSAVVSYLQKISGQSIPLAAAASIAPRPPQPSHTLPPPTLPQQAQPPQQQR  405

Query  249  DVQEFAA-------QTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSK  91
            D Q+ +A          + G G  +   +SSS RWPK E+ ALI +R++L+  + D+G K
Sbjct  406  DAQQSSATQMAPISSEAQEGQGSGSFEPTSSS-RWPKAEVHALIDLRSSLESSYQDSGPK  464

Query  90   GPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            GPLWE+IS  M++LGY+R+AKRCKEKWENI
Sbjct  465  GPLWEEISTGMQRLGYNRSAKRCKEKWENI  494


 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD AFRD+T+KGPLW+EVSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  80   RWPRQETLALLKIRSEMDAAFRDATIKGPLWEEVSRKLAELGYERSAKKCKEKFENVHKY  139

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++R K+GR+GRQ GK YRF+ +LE  
Sbjct  140  YKRKKDGRAGRQDGKTYRFYSELEAL  165


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +RS ++ +++DS  KGPLW+E+S  M+  GY RSAK+C+EK+ENI KY
Sbjct  438  RWPKAEVHALIDLRSSLESSYQDSGPKGPLWEEISTGMQRLGYNRSAKRCKEKWENINKY  497

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KEG   R +  K   +F QL+  
Sbjct  498  FKKVKEGNRKRPEDSKTCPYFHQLDAL  524


 Score = 71.2 bits (173),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D   KGPLWE++S ++ +LGY+R+AK+CKEK+EN+
Sbjct  80   RWPRQETLALLKIRSEMDAAFRDATIKGPLWEEVSRKLAELGYERSAKKCKEKFENV  136



>ref|XP_010063871.1| PREDICTED: trihelix transcription factor GT-2-like [Eucalyptus 
grandis]
Length=639

 Score =   149 bits (377),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 133/214 (62%), Gaps = 36/214 (17%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKR+   +FE+++K+V++KQEDL + FLE I++CE ER AREE+W  QE  RL RE+E L
Sbjct  269  RKRRWRDFFERVIKDVMDKQEDLHRSFLEMIDKCERERAAREESWWMQETARLAREREIL  328

Query  354  akeraiaeakdaaviAFLQKISKQ-------------------PILVPHKPQSEDV----  244
            A+ER  AEAKD AV++FLQKI++Q                    +  P  P+   V    
Sbjct  329  AQERLAAEAKDTAVMSFLQKIAEQQSRRSSPAQNNNPLSQQLVAVPTPATPKPSTVPPPA  388

Query  243  -----------QEFAAQTKENGSGDTTIss--ssssSRWPKPEIEALIQIRTNLDLQHHD  103
                       +       +NG    T     ++SSSRWPK E+EALI++RTNLD ++ +
Sbjct  389  AAAAAALPSQMRSIEVPKADNGVHFATPRGGGAASSSRWPKVEVEALIRLRTNLDGKYQE  448

Query  102  NGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            NG KGPLWEDIS  M++LGY+R++KRCKEKWENI
Sbjct  449  NGPKGPLWEDISVAMRRLGYERSSKRCKEKWENI  482


 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+ FRDS+ KGPLW+EVSRK+ E GY RSAKKC+EKFEN++KY
Sbjct  54   RWPRQETLALLKIRSDMDVTFRDSSAKGPLWEEVSRKLSELGYHRSAKKCKEKFENVFKY  113

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            H+RTK+GR+G+  GK YRFF+QLE F+    H+
Sbjct  114  HKRTKDGRTGKHEGKAYRFFDQLEAFENHTLHS  146


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+++R+ +D  ++++  KGPLW+++S  M   GY+RS+K+C+EK+ENI KY
Sbjct  426  RWPKVEVEALIRLRTNLDGKYQENGPKGPLWEDISVAMRRLGYERSSKRCKEKWENINKY  485

Query  816  HRRTKEG-RSGRQTGKNYRFFEQLE  745
             ++ KE  +  R+  K   +F+QL+
Sbjct  486  FKKVKESNKKRREDSKTCPYFQQLD  510


 Score = 74.3 bits (181),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D+ +KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  54   RWPRQETLALLKIRSDMDVTFRDSSAKGPLWEEVSRKLSELGYHRSAKKCKEKFENV  110



>ref|XP_011042850.1| PREDICTED: trihelix transcription factor GT-2-like [Populus euphratica]
Length=612

 Score =   149 bits (377),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET+ LLKIRS+MD+AFRD++ KGPLW++VSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  63   RWPRQETMALLKIRSDMDVAFRDASAKGPLWEDVSRKLAELGYNRSAKKCKEKFENVYKY  122

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA  733
            H+RTK+GRSG+Q GK YRFF+QLE F++
Sbjct  123  HKRTKDGRSGKQEGKTYRFFDQLEAFES  150


 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 130/207 (63%), Gaps = 39/207 (19%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++M EV++KQE+ Q KFLEAIE+ E+ERM REE+W+ QE+ R+ RE+E+ A+ER+ A
Sbjct  287  FFERLMTEVIQKQEETQNKFLEAIEKREHERMVREESWRMQEMARINRERETSAQERSTA  346

Query  333  eakdaaviAFLQKISKQ--PILVPHK----------------------------------  262
              K AAV+AFLQK+S+Q  P  V +                                   
Sbjct  347  AIKGAAVMAFLQKLSEQQNPGQVQNNPPPTQPPPPPPALPPISQQTPTPTTPPPLPEAQV  406

Query  261  PQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPL  82
            P  + V        +NG  +     S+SSSRWPK E+EALI +RTNLD ++ +NG KGPL
Sbjct  407  PPPQPVANLDIMKSDNGDQN---FMSASSSRWPKVEVEALIGLRTNLDCKYQENGPKGPL  463

Query  81   WEDISAEMKKLGYDRNAKRCKEKWENI  1
            WE+ISA M+KLGY+RNAKRCKEKWENI
Sbjct  464  WEEISAGMRKLGYNRNAKRCKEKWENI  490


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 60/98 (61%), Gaps = 3/98 (3%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +D  ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  434  RWPKVEVEALIGLRTNLDCKYQENGPKGPLWEEISAGMRKLGYNRNAKRCKEKWENINKY  493

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKIGG  706
             ++ KE    R +  K   +F QL+     +  NKI G
Sbjct  494  FKKVKESNKKRPEDSKTCPYFHQLDAL--YKEKNKIDG  529


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D  +KGPLWED+S ++ +LGY+R+AK+CKEK+EN+
Sbjct  63   RWPRQETMALLKIRSDMDVAFRDASAKGPLWEDVSRKLAELGYNRSAKKCKEKFENV  119



>gb|KFK42101.1| hypothetical protein AALP_AA2G210800 [Arabis alpina]
Length=591

 Score =   149 bits (376),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 142/211 (67%), Gaps = 33/211 (16%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK  G+FE++MK+V++KQE+LQ KFLEA+E+ E+ER+ REE+W+ QEI R+ RE E L
Sbjct  244  RKRKWKGFFERLMKQVVDKQEELQNKFLEAVEKREHERLLREESWRVQEIARINREHEIL  303

Query  354  akeraiaeakdaaviAFLQKISKQPILVPHKPQSEDVQE---------------------  238
            A+ER+++ AKDAAV+AFLQK+S++P   P     + +Q                      
Sbjct  304  AQERSMSAAKDAAVMAFLQKLSEKPSQTPQPQPQQQMQLNNLQQTPQPPQPPPQTPQPPV  363

Query  237  -FAAQTKENGSGDTTI-----------ssssssSRWPKPEIEALIQIRTNLDLQHHDNGS  94
               ++T +  +GD  +           +++ SSSRWPK EIEALI++RTNLD ++ +NG 
Sbjct  364  ITPSETTKTDNGDQYLPPMSAEASVAVAAAGSSSRWPKVEIEALIKLRTNLDAKYQENGP  423

Query  93   KGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            KGPLWE IS  MK+LG++RN+KRCKEKWENI
Sbjct  424  KGPLWEQISGGMKRLGFNRNSKRCKEKWENI  454


 Score =   140 bits (354),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 80/92 (87%), Gaps = 3/92 (3%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+M +AFRD+++KGPLW+EVSRKM E G+ R+AKKC+EKFEN+YKY
Sbjct  65   RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMAELGFIRNAKKCKEKFENVYKY  124

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTKEGR+G+  GK YRFF+QL+   A+++H
Sbjct  125  HKRTKEGRTGKSEGKTYRFFDQLQ---ALETH  153


 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+++S  M+  G+ R++K+C+EK+ENI KY
Sbjct  398  RWPKVEIEALIKLRTNLDAKYQENGPKGPLWEQISGGMKRLGFNRNSKRCKEKWENINKY  457

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  458  FKKVKESNKKRPEDSKTCPYFHQLDAL  484


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++ +   D   KGPLWE++S +M +LG+ RNAK+CKEK+EN+
Sbjct  65   RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMAELGFIRNAKKCKEKFENV  121



>ref|XP_002302180.1| trihelix DNA-binding family protein [Populus trichocarpa]
 gb|EEE81453.1| trihelix DNA-binding family protein [Populus trichocarpa]
Length=605

 Score =   149 bits (376),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET+ LLKIRS+MD+AFRD+++KGPLW++VSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  63   RWPRQETMALLKIRSDMDVAFRDASVKGPLWEDVSRKLAELGYNRSAKKCKEKFENVYKY  122

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            H+RTK+GRSG+Q GK YRFF+QLE F
Sbjct  123  HKRTKDGRSGKQEGKTYRFFDQLEAF  148


 Score =   140 bits (352),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 127/203 (63%), Gaps = 33/203 (16%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++M EV++KQE+ Q KFLEAI + ENERM REE+W+ QE+ R+ RE+E  A+ER+IA
Sbjct  284  FFERLMTEVIQKQEETQNKFLEAIAKRENERMVREESWRMQEMARINREREISAQERSIA  343

Query  333  eakdaaviAFLQK--------------------------ISKQPILVPHKPQSEDVQEFA  232
              KDAAV+AFLQK                          IS+Q       P     Q   
Sbjct  344  ATKDAAVMAFLQKLSEQQNPGQVQNNPPPTQPPPPALPPISQQTPTPTPPPPLPVAQVPP  403

Query  231  AQTKEN------GSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDI  70
             Q   N       +GD    S+SSS RWPK E+EALI +RTNLD ++ +NG KGPLWE+I
Sbjct  404  PQPVANLDIMKSDNGDQNFMSASSS-RWPKVEVEALIGLRTNLDCKYQENGPKGPLWEEI  462

Query  69   SAEMKKLGYDRNAKRCKEKWENI  1
            SA M+KLGY+RNAKRCKEKWENI
Sbjct  463  SAGMRKLGYNRNAKRCKEKWENI  485


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 60/98 (61%), Gaps = 3/98 (3%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +D  ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  429  RWPKVEVEALIGLRTNLDCKYQENGPKGPLWEEISAGMRKLGYNRNAKRCKEKWENINKY  488

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKIGG  706
             ++ KE    R +  K   +F QL+     +  NKI G
Sbjct  489  FKKVKESSKKRPEDSKTCPYFHQLDAL--YKEKNKIDG  524


 Score = 74.7 bits (182),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLWED+S ++ +LGY+R+AK+CKEK+EN+
Sbjct  63   RWPRQETMALLKIRSDMDVAFRDASVKGPLWEDVSRKLAELGYNRSAKKCKEKFENV  119



>ref|XP_004516630.1| PREDICTED: trihelix transcription factor GT-2-like [Cicer arietinum]
Length=655

 Score =   149 bits (377),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LLKIRSEMD+AFRD+++KGPLW+EVSR+M EFGYQR++KKC+EKFEN+YKY
Sbjct  61   RWPRNETLALLKIRSEMDVAFRDASVKGPLWEEVSRRMAEFGYQRNSKKCKEKFENVYKY  120

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTKEGR G+  GK YRFF+QL+  +
Sbjct  121  HKRTKEGRGGKSDGKTYRFFDQLQALE  147


 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+EALI++RT+LD ++ +NG KGPLWE+IS  MKKLGY+RNAKRCKEKWENI
Sbjct  480  RWPKTEVEALIKMRTSLDTKYQENGPKGPLWEEISGLMKKLGYNRNAKRCKEKWENI  536


 Score = 80.9 bits (198),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M++ GY R+AK+C+EK+ENI KY
Sbjct  480  RWPKTEVEALIKMRTSLDTKYQENGPKGPLWEEISGLMKKLGYNRNAKRCKEKWENINKY  539

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  540  FKKVKESNKKRPEDSKTCPYFHQLDAL  566


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D   KGPLWE++S  M + GY RN+K+CKEK+EN+
Sbjct  61   RWPRNETLALLKIRSEMDVAFRDASVKGPLWEEVSRRMAEFGYQRNSKKCKEKFENV  117


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++ KEV+EKQE+L K+FLEAIE+ +NER+ RE  W+ QE++R+KRE+E LA+ER+IA
Sbjct  299  FFERLKKEVVEKQEELHKRFLEAIEKRDNERVKREITWRLQEMQRIKREREVLAQERSIA  358

Query  333  eakdaaviAFLQKIS  289
             AKD+AV+AFLQK +
Sbjct  359  AAKDSAVMAFLQKFA  373



>ref|XP_009106348.1| PREDICTED: trihelix transcription factor GT-2-like [Brassica 
rapa]
Length=574

 Score =   149 bits (375),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LLKIRSEMD +FRDSTLK PLW+E+SRKM E GY+RSAKKC+EKFEN+YKY
Sbjct  43   RWPRPETLALLKIRSEMDKSFRDSTLKAPLWEEISRKMMELGYKRSAKKCKEKFENVYKY  102

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA  733
            H+RTKEGR+G+  GK YRFFE+LE F++
Sbjct  103  HKRTKEGRTGKSEGKTYRFFEELEAFES  130


 Score =   128 bits (321),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 131/203 (65%), Gaps = 25/203 (12%)
 Frame = -3

Query  534  RKRKL-AGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQES  358
            +KRK   G F K+ KE++EKQE +QKKFLE +E  E ER++REEAWK QE+ R+ +E E+
Sbjct  250  KKRKYWKGLFTKLTKELMEKQEKMQKKFLETLENRERERISREEAWKVQEVARINKEHET  309

Query  357  LakeraiaeakdaaviAFLQKISKQPIL----------------VPHKPQSEDVQE---F  235
            L  ER+ A AKDAA+I+FL KIS                     +P + Q +  Q    F
Sbjct  310  LVHERSNAAAKDAAIISFLHKISGGGGQQQQQQQPQQQPQQNQKLPQRKQYQSEQHSITF  369

Query  234  AAQTKENGSGDTTI-----ssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDI  70
             ++       D T+     S S SSSRWPK E+EALI+IR NL+  + +NG+KGPLWE+I
Sbjct  370  ESKEPMPVPLDATMKMGNHSLSPSSSRWPKTEVEALIRIRKNLEANYQENGTKGPLWEEI  429

Query  69   SAEMKKLGYDRNAKRCKEKWENI  1
            SA M++LGY+R+AKRCKEKWENI
Sbjct  430  SAGMRRLGYNRSAKRCKEKWENI  452


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR  ++  ++++  KGPLW+E+S  M   GY RSAK+C+EK+ENI KY
Sbjct  396  RWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRRLGYNRSAKRCKEKWENINKY  455

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVF  739
             ++ KE    R    K   +F QLE  
Sbjct  456  FKKVKESNKKRPLDSKTCPYFHQLEAL  482


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+PE  AL++IR+ +D    D+  K PLWE+IS +M +LGY R+AK+CKEK+EN+
Sbjct  43   RWPRPETLALLKIRSEMDKSFRDSTLKAPLWEEISRKMMELGYKRSAKKCKEKFENV  99



>ref|XP_010062115.1| PREDICTED: trihelix transcription factor GT-2-like isoform X2 
[Eucalyptus grandis]
Length=516

 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 134/218 (61%), Gaps = 43/218 (20%)
 Frame = -3

Query  531  KRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLa  352
            KRK  G+FE++ KEV++KQE + +KFLE IE+ E ERMAREEAW+ QEI R+ RE+E LA
Sbjct  178  KRKWRGFFERLTKEVMDKQEAMHRKFLEMIEKREQERMAREEAWRVQEITRISREREILA  237

Query  351  keraiaeakdaaviAFLQKISKQPI-------------------LVPHKPQSEDVQEFAA  229
            +ER++  AKDAAV++FLQKI++Q                      V H P     Q  +A
Sbjct  238  QERSVVAAKDAAVLSFLQKIAEQQFPGQAQADPSPPPLQPQPQPPVRHVPNLSSPQPISA  297

Query  228  QTKENG----------------------SGDTTIssssssSRWPKPEIEALIQIRTNLDL  115
                 G                      +GD    +  SSSRWPK E+EALI++RT+L+ 
Sbjct  298  LATTPGEIIRYSQAQSQVVNMEIHRSANNGDK--QAPRSSSRWPKLEVEALIKLRTDLES  355

Query  114  QHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ++ +NG KGPLWE+ISA M+K GY+R+AKRCKEKWENI
Sbjct  356  KYQENGPKGPLWEEISAAMRKAGYNRSAKRCKEKWENI  393


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R++++  ++++  KGPLW+E+S  M + GY RSAK+C+EK+ENI KY
Sbjct  337  RWPKLEVEALIKLRTDLESKYQENGPKGPLWEEISAAMRKAGYNRSAKRCKEKWENINKY  396

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSH  721
             ++ KE    R +  K   +F QL+     +SH
Sbjct  397  FKKVKESNKQRPEDSKTCPYFHQLDAIYKEKSH  429


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  888  KMEEFGYQRSAKKCREKFENIYKYHRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            ++ E GY RSAKKC+EKFEN+YKYH+RTK+GR+G+   K YRFF+QLE  +
Sbjct  6    QLGELGYNRSAKKCKEKFENVYKYHKRTKDGRTGKHEKKTYRFFDQLEALE  56



>gb|EYU35138.1| hypothetical protein MIMGU_mgv1a024778mg [Erythranthe guttata]
Length=532

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 129/352 (37%), Positives = 198/352 (56%), Gaps = 44/352 (13%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  94   RWPRQETLTLLEIRSRLDPKFKEANQKGPLWDEVSRIMCEEHGYQRSGKKCREKFENLYK  153

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVF----DAMQSHNKIGGaaaaeppelaspspvAMI  652
            Y+++TKEG++GRQ GK+YRFF QLE      + + S +          P     +    +
Sbjct  154  YYKKTKEGKAGRQDGKHYRFFRQLEALYGSNNTVLSDHPPHHLTTTTLPYSFPTTTTTQL  213

Query  651  KP-------NTNIVQDFRMRPHGFGADADVLsaststtyssggssGR---KRKLAGYFEK  502
            +P       N N   D  +    + +DA+  S+S       G   G    K K+  + + 
Sbjct  214  EPPLFQYPNNNNKQSDTSLSLSNY-SDAETSSSSGDGKTGGGDGGGGNNWKLKIRDFIDV  272

Query  501  MMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraiaeakd  322
             MK++++KQE   +K + AIE  E ER++REE W+K + ER+ RE++  A ERA  EA+D
Sbjct  273  QMKKLMDKQEAWMEKMMRAIEHKERERISREEEWRKMDAERIDRERKFWAGERAWIEARD  332

Query  321  aaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEAL  142
            AA++  L K++ +       P+   +         N  G+           WP+ E+  L
Sbjct  333  AALMEALSKLTGRA-----SPEERIIN--------NNDGEI----------WPEGEMGRL  369

Query  141  IQIRTNLDLQHHD-NGSKGP----LWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ++IR +++++     G++      LW++I+ +M  LGYDR+   CK+KW+++
Sbjct  370  VEIRRSMEVKFEQIRGARLSEEVVLWDEIATKMACLGYDRSPMMCKDKWDSV  421



>gb|KCW69185.1| hypothetical protein EUGRSUZ_F02707 [Eucalyptus grandis]
Length=531

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 133/216 (62%), Gaps = 39/216 (18%)
 Frame = -3

Query  531  KRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLa  352
            KRK  G+FE++ KEV++KQE + +KFLE IE+ E ERMAREEAW+ QEI R+ RE+E LA
Sbjct  193  KRKWRGFFERLTKEVMDKQEAMHRKFLEMIEKREQERMAREEAWRVQEITRISREREILA  252

Query  351  keraiaeakdaaviAFLQKISKQPI-------------------LVPHKPQSEDVQEFAA  229
            +ER++  AKDAAV++FLQKI++Q                      V H P     Q  +A
Sbjct  253  QERSVVAAKDAAVLSFLQKIAEQQFPGQAQADPSPPPLQPQPQPPVRHVPNLSSPQPISA  312

Query  228  QTKENG--------------------SGDTTIssssssSRWPKPEIEALIQIRTNLDLQH  109
                 G                    + +    +  SSSRWPK E+EALI++RT+L+ ++
Sbjct  313  LATTPGEIIRYSQAQSQVVNMEIHRSANNGDKQAPRSSSRWPKLEVEALIKLRTDLESKY  372

Query  108  HDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             +NG KGPLWE+ISA M+K GY+R+AKRCKEKWENI
Sbjct  373  QENGPKGPLWEEISAAMRKAGYNRSAKRCKEKWENI  408


 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  948  MDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKYHRRTKEGRSGRQTGKN  769
            MD  FRD+++KGPLWD+VSRK+ E GY RSAKKC+EKFEN+YKYH+RTK+GR+G+   K 
Sbjct  1    MDGEFRDASVKGPLWDDVSRKLGELGYNRSAKKCKEKFENVYKYHKRTKDGRTGKHEKKT  60

Query  768  YRFFEQLEVFD  736
            YRFF+QLE  +
Sbjct  61   YRFFDQLEALE  71


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R++++  ++++  KGPLW+E+S  M + GY RSAK+C+EK+ENI KY
Sbjct  352  RWPKLEVEALIKLRTDLESKYQENGPKGPLWEEISAAMRKAGYNRSAKRCKEKWENINKY  411

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSH  721
             ++ KE    R +  K   +F QL+     +SH
Sbjct  412  FKKVKESNKQRPEDSKTCPYFHQLDAIYKEKSH  444


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  LDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            +D +  D   KGPLW+D+S ++ +LGY+R+AK+CKEK+EN+
Sbjct  1    MDGEFRDASVKGPLWDDVSRKLGELGYNRSAKKCKEKFENV  41



>ref|XP_003556152.2| PREDICTED: trihelix transcription factor GT-2-like [Glycine max]
Length=705

 Score =   150 bits (378),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 141/222 (64%), Gaps = 51/222 (23%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV+EKQE+LQKKFLEAIE+ E++R+AREEAW+ QE++R+ RE+E LA+ER+IA
Sbjct  355  FFERLMKEVIEKQEELQKKFLEAIEKREHDRIAREEAWRVQEMQRINREREILAQERSIA  414

Query  333  eakdaaviAFLQKISK--------------------------------------------  286
             AKDAAV++FLQKI++                                            
Sbjct  415  AAKDAAVMSFLQKIAEQQNLGQALTNINLVQPQPQLQPQPPVQQQVTPPNIVPAPMQQPL  474

Query  285  -----QPILVPHKPQSEDVQEFAAQTKENGSGDTTIss--ssssSRWPKPEIEALIQIRT  127
                 QP+++P   Q  +++   A    N + +    +    SSSRWPK E++ALI++RT
Sbjct  475  PVIVTQPVVLPVVSQVTNMEIMKADNNNNNNNNNNCENFLPPSSSRWPKVEVQALIKLRT  534

Query  126  NLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ++D ++ +NG KGPLWE+ISA MKKLGY+RNAKRCKEKWENI
Sbjct  535  SMDEKYQENGPKGPLWEEISASMKKLGYNRNAKRCKEKWENI  576


 Score =   149 bits (376),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 83/93 (89%), Gaps = 3/93 (3%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD+AFRD+++KGPLW+EVSRKM E GY RS+KKC+EKFEN+YKY
Sbjct  126  RWPRQETLALLRIRSDMDVAFRDASVKGPLWEEVSRKMAELGYHRSSKKCKEKFENVYKY  185

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            H+RTKEGRSG+Q GK YRFF+QL+   A+++H+
Sbjct  186  HKRTKEGRSGKQDGKTYRFFDQLQ---ALENHS  215


 Score = 81.6 bits (200),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ MD  ++++  KGPLW+E+S  M++ GY R+AK+C+EK+ENI KY
Sbjct  520  RWPKVEVQALIKLRTSMDEKYQENGPKGPLWEEISASMKKLGYNRNAKRCKEKWENINKY  579

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  580  FKKVKESNKRRPEDSKTCPYFHQLDAL  606


 Score = 72.4 bits (176),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLWE++S +M +LGY R++K+CKEK+EN+
Sbjct  126  RWPRQETLALLRIRSDMDVAFRDASVKGPLWEEVSRKMAELGYHRSSKKCKEKFENV  182



>ref|XP_010531649.1| PREDICTED: trihelix transcription factor GT-2-like, partial [Tarenaya 
hassleriana]
Length=549

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+AFRD+++KGPLW EVSRKM E GY RSAKKC+EKFEN+YKY
Sbjct  36   RWPRQETLALLKIRSDMDIAFRDASVKGPLWGEVSRKMAELGYNRSAKKCKEKFENVYKY  95

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTKEGR+G+  GK YRFF+QL+  ++   H
Sbjct  96   HKRTKEGRNGKSEGKTYRFFDQLQALESQSHH  127


 Score =   147 bits (371),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 130/189 (69%), Gaps = 21/189 (11%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE +MK+V+EKQE+LQ +FLEA+E+ E+ERM REEAW  QE+ R+ RE+E LA+ER++A
Sbjct  238  FFEGLMKQVVEKQEELQCRFLEAVEKREHERMVREEAWTMQEMARINREREILAQERSMA  297

Query  333  eakdaaviAFLQKISKQPILVPHK------------------PQSEDVQEFAAQTKENGS  208
             AKDAAV+AFLQK+S+ P L   K                   Q    Q       +NG 
Sbjct  298  AAKDAAVMAFLQKLSENPNLSQSKQFPSPQTQTPQQQQQPPPQQQPQPQPPVVTKTDNGE  357

Query  207  GDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAK  28
             +       SSSRWPK EIEALI++RTNLD ++ +NG KGPLWE+ISA M++LG++R++K
Sbjct  358  RNLV---GPSSSRWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMRRLGFNRSSK  414

Query  27   RCKEKWENI  1
            RCKEKWENI
Sbjct  415  RCKEKWENI  423


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M   G+ RS+K+C+EK+ENI KY
Sbjct  367  RWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMRRLGFNRSSKRCKEKWENINKY  426

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  427  FKKVKESNKKRPEDSKTCPYFHQLDAL  453


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 58/94 (62%), Gaps = 4/94 (4%)
 Frame = -3

Query  282  PILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHD  103
            P +    PQ+ D    AA     GS + +       +RWP+ E  AL++IR+++D+   D
Sbjct  3    PAVTAATPQTNDA---AAGPNLEGSEEMS-DRGFGGNRWPRQETLALLKIRSDMDIAFRD  58

Query  102  NGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
               KGPLW ++S +M +LGY+R+AK+CKEK+EN+
Sbjct  59   ASVKGPLWGEVSRKMAELGYNRSAKKCKEKFENV  92



>ref|XP_006390148.1| hypothetical protein EUTSA_v10018297mg [Eutrema salsugineum]
 gb|ESQ27434.1| hypothetical protein EUTSA_v10018297mg [Eutrema salsugineum]
Length=612

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 139/216 (64%), Gaps = 50/216 (23%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MK+V++KQE+LQ+KFLEA+E+ E+ER+ REE W+ QEI R+ RE E LA+ER+++
Sbjct  257  FFERLMKQVVDKQEELQRKFLEAVEKREHERLVREETWRVQEIARINREHEILAQERSMS  316

Query  333  eakdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTK----------------------  220
             AKDAAV+AFLQK+S++P      PQ + +     QT+                      
Sbjct  317  AAKDAAVMAFLQKLSEKP-----NPQGQPIAPQPQQTRSQMQVNNHQQQTPQRPPPPPPL  371

Query  219  ----------------ENGSGDTT-------IssssssSRWPKPEIEALIQIRTNLDLQH  109
                            +NG  + T         +++SSSRWPK EIEALI++RTNLD ++
Sbjct  372  PQPTQPVTPTLDATKTDNGDQNMTPASASAAGGAAASSSRWPKVEIEALIKLRTNLDSKY  431

Query  108  HDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             +NG KGPLWE+ISA M++LG++RN+KRCKEKWENI
Sbjct  432  QENGPKGPLWEEISAGMRRLGFNRNSKRCKEKWENI  467


 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+M +AFRD+++KGPLW+EVSRKM E GY R+AKKC+EKFEN+YKY
Sbjct  57   RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMAELGYIRNAKKCKEKFENVYKY  116

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS  724
            H+RTKEGR+G+  GK YRFF+QLE  +   +
Sbjct  117  HKRTKEGRTGKSEGKTYRFFDQLEALETQST  147


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M   G+ R++K+C+EK+ENI KY
Sbjct  411  RWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMRRLGFNRNSKRCKEKWENINKY  470

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  471  FKKVKESNKKRPEDSKTCPYFHQLDAL  497


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++ +   D   KGPLWE++S +M +LGY RNAK+CKEK+EN+
Sbjct  57   RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMAELGYIRNAKKCKEKFENV  113



>ref|XP_007143535.1| hypothetical protein PHAVU_007G079700g [Phaseolus vulgaris]
 gb|ESW15529.1| hypothetical protein PHAVU_007G079700g [Phaseolus vulgaris]
Length=718

 Score =   149 bits (377),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 137/219 (63%), Gaps = 49/219 (22%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV+EKQEDLQKKFLEAIE+ E++R+AREEAW+ QE++R+ RE+E LA+ER+IA
Sbjct  373  FFERLMKEVIEKQEDLQKKFLEAIEKREHDRIAREEAWRVQEMQRINREREILAQERSIA  432

Query  333  eakdaaviAFLQK-----------------------------------------------  295
             AKDAAV++FLQK                                               
Sbjct  433  AAKDAAVMSFLQKIAEQQNLGQALSNINLVQQPPHQQPQPPLQQLPPSSVAPPPAQQPLP  492

Query  294  -ISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLD  118
             +  QP+++P   Q  ++ E       N +      + SSSSRWPK E++ALI++RTNLD
Sbjct  493  AVVTQPVVLPVFSQVTNM-EIVKVDNNNNNNSCENFTPSSSSRWPKVEVQALIKLRTNLD  551

Query  117  LQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             ++ +NG KGPLWE+IS+ M+KLGY RNAKRCKEKWENI
Sbjct  552  SKYQENGPKGPLWEEISSSMRKLGYIRNAKRCKEKWENI  590


 Score =   145 bits (367),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 81/93 (87%), Gaps = 3/93 (3%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IR +MD+AFRD+++KGPLW+EVSRKM E GY RS+KKC+EKFEN+YKY
Sbjct  136  RWPRQETLALLRIRKDMDVAFRDASVKGPLWEEVSRKMAELGYHRSSKKCKEKFENVYKY  195

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            H+RTKEGRSG+Q GK YRFF++L+   A+++H 
Sbjct  196  HKRTKEGRSGKQDGKTYRFFDELQ---ALENHT  225


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  534  RWPKVEVQALIKLRTNLDSKYQENGPKGPLWEEISSSMRKLGYIRNAKRCKEKWENINKY  593

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  594  FKKVKESNKRRPEDSKTCPYFHQLDAL  620


 Score = 71.2 bits (173),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR ++D+   D   KGPLWE++S +M +LGY R++K+CKEK+EN+
Sbjct  136  RWPRQETLALLRIRKDMDVAFRDASVKGPLWEEVSRKMAELGYHRSSKKCKEKFENV  192



>ref|XP_009382323.1| PREDICTED: trihelix transcription factor GTL1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=699

 Score =   149 bits (376),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 135/210 (64%), Gaps = 34/210 (16%)
 Frame = -3

Query  531  KRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLa  352
            +R++  +FE +MK+V+E+QE +Q++FL+AI++ E +RM REEAW+ QE+ RL REQE L 
Sbjct  286  RRQMMAFFEGLMKQVMERQEAMQQRFLDAIDKREQDRMKREEAWRLQEMSRLSREQELLV  345

Query  351  keraiaeakdaaviAFLQKISKQPI-------LVPHKPQSE-------------------  250
            +ER++A ++D+AV+++LQKIS Q I       + P  PQ                     
Sbjct  346  QERSMAASRDSAVVSYLQKISGQSIPLAAAASIAPRPPQPSHTLPPPTLPQQAQPPQQQR  405

Query  249  DVQEFAA-------QTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSK  91
            D Q+ +A          + G G  +   +SSS RWPK E+ ALI +R++L+  + D+G K
Sbjct  406  DAQQSSATQMAPISSEAQEGQGSGSFEPTSSS-RWPKAEVHALIDLRSSLESSYQDSGPK  464

Query  90   GPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            GPLWE+IS  M++LGY+R+AKRCKEKWENI
Sbjct  465  GPLWEEISTGMQRLGYNRSAKRCKEKWENI  494


 Score =   141 bits (356),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD AFRD+T+KGPLW+EVSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  80   RWPRQETLALLKIRSEMDAAFRDATIKGPLWEEVSRKLAELGYERSAKKCKEKFENVHKY  139

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++R K+GR+GRQ GK YRF+ +LE  
Sbjct  140  YKRKKDGRAGRQDGKTYRFYSELEAL  165


 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +RS ++ +++DS  KGPLW+E+S  M+  GY RSAK+C+EK+ENI KY
Sbjct  438  RWPKAEVHALIDLRSSLESSYQDSGPKGPLWEEISTGMQRLGYNRSAKRCKEKWENINKY  497

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KEG   R +  K   +F QL+  
Sbjct  498  FKKVKEGNRKRPEDSKTCPYFHQLDAL  524


 Score = 71.2 bits (173),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D   KGPLWE++S ++ +LGY+R+AK+CKEK+EN+
Sbjct  80   RWPRQETLALLKIRSEMDAAFRDATIKGPLWEEVSRKLAELGYERSAKKCKEKFENV  136



>ref|XP_010062114.1| PREDICTED: trihelix transcription factor GT-2-like isoform X1 
[Eucalyptus grandis]
Length=604

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 133/216 (62%), Gaps = 39/216 (18%)
 Frame = -3

Query  531  KRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLa  352
            KRK  G+FE++ KEV++KQE + +KFLE IE+ E ERMAREEAW+ QEI R+ RE+E LA
Sbjct  266  KRKWRGFFERLTKEVMDKQEAMHRKFLEMIEKREQERMAREEAWRVQEITRISREREILA  325

Query  351  keraiaeakdaaviAFLQKISKQPI-------------------LVPHKPQSEDVQEFAA  229
            +ER++  AKDAAV++FLQKI++Q                      V H P     Q  +A
Sbjct  326  QERSVVAAKDAAVLSFLQKIAEQQFPGQAQADPSPPPLQPQPQPPVRHVPNLSSPQPISA  385

Query  228  QTKENG--------------------SGDTTIssssssSRWPKPEIEALIQIRTNLDLQH  109
                 G                    + +    +  SSSRWPK E+EALI++RT+L+ ++
Sbjct  386  LATTPGEIIRYSQAQSQVVNMEIHRSANNGDKQAPRSSSRWPKLEVEALIKLRTDLESKY  445

Query  108  HDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             +NG KGPLWE+ISA M+K GY+R+AKRCKEKWENI
Sbjct  446  QENGPKGPLWEEISAAMRKAGYNRSAKRCKEKWENI  481


 Score =   139 bits (349),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD  FRD+++KGPLWD+VSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  58   RWPRQETLALLKIRSDMDGEFRDASVKGPLWDDVSRKLGELGYNRSAKKCKEKFENVYKY  117

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTK+GR+G+   K YRFF+QLE  +
Sbjct  118  HKRTKDGRTGKHEKKTYRFFDQLEALE  144


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R++++  ++++  KGPLW+E+S  M + GY RSAK+C+EK+ENI KY
Sbjct  425  RWPKLEVEALIKLRTDLESKYQENGPKGPLWEEISAAMRKAGYNRSAKRCKEKWENINKY  484

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSH  721
             ++ KE    R +  K   +F QL+     +SH
Sbjct  485  FKKVKESNKQRPEDSKTCPYFHQLDAIYKEKSH  517


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D +  D   KGPLW+D+S ++ +LGY+R+AK+CKEK+EN+
Sbjct  58   RWPRQETLALLKIRSDMDGEFRDASVKGPLWDDVSRKLGELGYNRSAKKCKEKFENV  114



>ref|XP_008381818.1| PREDICTED: trihelix transcription factor GT-2-like [Malus domestica]
Length=563

 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET+ LLKIRS+MD AFRDS+LK PLW++VSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  65   RWPRQETVALLKIRSQMDAAFRDSSLKAPLWEDVSRKLGELGYYRSAKKCKEKFENVYKY  124

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            HRRTKEGRS +Q GK YRFF++LE FD    H+
Sbjct  125  HRRTKEGRSKKQEGKTYRFFDELEAFDHQNHHH  157


 Score =   137 bits (344),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 125/197 (63%), Gaps = 19/197 (10%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RK K   +F++  K+VLEKQE LQ+KFLEAI +CE++RM RE AW+K+E+ R+ +E E L
Sbjct  268  RKMKWRYFFKRXTKDVLEKQEKLQEKFLEAIAKCEHQRMVREAAWRKEEMARMSKEHEIL  327

Query  354  akeraiaeakdaaviAFLQKISKQ----PILVPHKPQSEDVQEFAAQTKENGSGDTTIss  187
            A+ER++A A+DAAVI FLQK S Q     I     P S              +    ++S
Sbjct  328  AQERSLAAAQDAAVIEFLQKFSGQQNSTSIQALEAPSSRPHPLPVLMPPPLQAPVAVVTS  387

Query  186  ss---------------ssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKK  52
            S+                S+RWP+ E+EALI +RT LD+++ + G KG LWE+ISA M++
Sbjct  388  STFDVPKLDNSESPLPAGSTRWPRVEVEALINLRTYLDVKYQEAGPKGSLWEEISAGMRR  447

Query  51   LGYDRNAKRCKEKWENI  1
            LGY+R+AKRCK KWENI
Sbjct  448  LGYNRSAKRCKXKWENI  464


 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +D+ ++++  KG LW+E+S  M   GY RSAK+C+ K+ENI KY
Sbjct  408  RWPRVEVEALINLRTYLDVKYQEAGPKGSLWEEISAGMRRLGYNRSAKRCKXKWENINKY  467

Query  816  HRRTKEGRSGRQTG-KNYRFFEQLEVFDAMQSHNKIGG  706
            +++ K     R  G K   +F QL++  + +++    G
Sbjct  468  YKKVKVSSKTRSEGSKTCPYFHQLDILHSKKNNKNNAG  505


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D+  K PLWED+S ++ +LGY R+AK+CKEK+EN+
Sbjct  65   RWPRQETVALLKIRSQMDAAFRDSSLKAPLWEDVSRKLGELGYYRSAKKCKEKFENV  121



>gb|KDP42684.1| hypothetical protein JCGZ_23624 [Jatropha curcas]
Length=561

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 128/364 (35%), Positives = 194/364 (53%), Gaps = 53/364 (15%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE GYQRS KKCREKFEN+YK
Sbjct  133  RWPRQETLTLLEIRSRLDSKFKEANQKGPLWDEVSRIMCEEHGYQRSGKKCREKFENLYK  192

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGGaaaaeppelaspspvAMIKPNT  640
            Y+++TKEG++GRQ GK+YRFF QLE      S++               P        + 
Sbjct  193  YYKKTKEGKAGRQDGKHYRFFRQLEALYGETSNSASIPETHFVNNNTNLPFHTTCTTQSN  252

Query  639  NIVQDFRMRP--------------HGFGADADVLsaststtyssggssGRKR--------  526
            N   +F  +                   +D D   ++ +   +      RKR        
Sbjct  253  NQETNFHSQNKLCDSLSLSNSSEFDTCSSDEDNNLSTATLMENDSIEKRRKRRDGKSWKA  312

Query  525  KLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLake  346
            K+  + +  M++++ +QE   +K  + +E+ E ER+AREE W++QE  R+ RE +  AKE
Sbjct  313  KIKEFIDSQMRKLIHRQEAWLEKLTQTLEQKEQERIAREEEWRQQEAARIDREHKFWAKE  372

Query  345  raiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRW  166
            RA  EA+DAA++  L+K++ + I    + QSE  Q          SG+           W
Sbjct  373  RAWIEARDAALMDTLRKLTGKEI----QNQSEKCQ----------SGNEKC------GNW  412

Query  165  PKPEIEALIQIRTNLD----------LQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKE  16
               E+  L+Q++++++           +  +N  +  LWE+I+A+M  +GY R+A  CKE
Sbjct  413  TDEEVTRLMQLKSSIESRFAQNEEEEEEEKENEEEEALWEEIAAKMVCMGYHRSAIMCKE  472

Query  15   KWEN  4
            KWE+
Sbjct  473  KWES  476


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEM-KKLGYDRNAKRCKEKWENI  1
            RWP+ E   L++IR+ LD +  +   KGPLW+++S  M ++ GY R+ K+C+EK+EN+
Sbjct  133  RWPRQETLTLLEIRSRLDSKFKEANQKGPLWDEVSRIMCEEHGYQRSGKKCREKFENL  190



>ref|XP_010680658.1| PREDICTED: trihelix transcription factor GT-2-like [Beta vulgaris 
subsp. vulgaris]
Length=741

 Score =   149 bits (376),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+ FRDS+LKGPLW+EVSRKM E GY RSAKKC+EKFEN+YKY
Sbjct  77   RWPRQETLALLKIRSDMDVVFRDSSLKGPLWEEVSRKMAELGYHRSAKKCKEKFENVYKY  136

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTK+GR G+  GK YRFF+QLE  +
Sbjct  137  HKRTKDGRVGKSDGKTYRFFDQLEALE  163


 Score = 97.4 bits (241),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E++ALI +RTNLD ++ +NG KGPLWE+ISA M+K GY+RNAKRCKEKWENI
Sbjct  545  RWPKAEVQALINLRTNLDQKYQENGPKGPLWEEISAAMRKHGYNRNAKRCKEKWENI  601


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV++KQE+LQK+FLEA+E+ E++R+ REEAWK QE+ RL RE E L +ER++A
Sbjct  328  FFERLMKEVIDKQEELQKRFLEAVEKREHDRVVREEAWKMQEMNRLNREHEILVQERSMA  387

Query  333  eakdaaviAFLQKISKQ  283
             AKDAA+IAFLQK+S Q
Sbjct  388  AAKDAALIAFLQKLSDQ  404


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +D  ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  545  RWPKAEVQALINLRTNLDQKYQENGPKGPLWEEISAAMRKHGYNRNAKRCKEKWENINKY  604

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  605  FKKVKESNKKRPEDSKTCPYFHQLDAL  631


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D+  KGPLWE++S +M +LGY R+AK+CKEK+EN+
Sbjct  77   RWPRQETLALLKIRSDMDVVFRDSSLKGPLWEEVSRKMAELGYHRSAKKCKEKFENV  133



>ref|XP_002887660.1| hypothetical protein ARALYDRAFT_895569 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63919.1| hypothetical protein ARALYDRAFT_895569 [Arabidopsis lyrata subsp. 
lyrata]
Length=598

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 137/210 (65%), Gaps = 42/210 (20%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MK+V++KQE+LQ+KFLEA+E+ E+ER+ REE+W+ QEI R+ RE E LA+ER+++
Sbjct  249  FFERLMKQVVDKQEELQRKFLEAVEKREHERLVREESWRVQEIARINREHEILAQERSMS  308

Query  333  eakdaaviAFLQKISKQPILVPHKPQS---------------------------------  253
             AKDAAV+AFLQK+S++    P++P +                                 
Sbjct  309  AAKDAAVMAFLQKLSEK---QPNQPTAAQPQPQQVRPQMQLNNNNNQQQTPQPSPPPPPP  365

Query  252  ------EDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSK  91
                  + V      TK +        +S+SSSRWPK EIEALI++RTNLD ++ +NG K
Sbjct  366  PLPQAIQAVVPTLDTTKTDNGDQNMTPASASSSRWPKVEIEALIKLRTNLDSKYQENGPK  425

Query  90   GPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            GPLWE+ISA M++LG++RN+KRCKEKWENI
Sbjct  426  GPLWEEISAGMRRLGFNRNSKRCKEKWENI  455


 Score =   144 bits (362),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+M +AFRD+++KGPLW+EVSRKM E GY R+AKKC+EKFEN+YKY
Sbjct  56   RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMAELGYIRNAKKCKEKFENVYKY  115

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS  724
            H+RTKEGR+G+  GK YRFF+QLE  ++  +
Sbjct  116  HKRTKEGRTGKSEGKTYRFFDQLEALESQST  146


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M   G+ R++K+C+EK+ENI KY
Sbjct  399  RWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMRRLGFNRNSKRCKEKWENINKY  458

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  459  FKKVKESNKKRPEDSKTCPYFHQLDAL  485


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++ +   D   KGPLWE++S +M +LGY RNAK+CKEK+EN+
Sbjct  56   RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMAELGYIRNAKKCKEKFENV  112



>ref|XP_011101538.1| PREDICTED: trihelix transcription factor GT-2-like [Sesamum indicum]
Length=620

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+AFRDS LKGPLW+EVSRKM E G+QRSAKKC+EKFEN+YKY
Sbjct  61   RWPRQETLALLKIRSDMDVAFRDSNLKGPLWEEVSRKMAELGFQRSAKKCKEKFENVYKY  120

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTK+GRS +  GK YRFF+QLE  +
Sbjct  121  HKRTKDGRSSKPDGKTYRFFDQLEALE  147


 Score =   100 bits (248),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 61/75 (81%), Gaps = 2/75 (3%)
 Frame = -3

Query  225  TKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLG  46
            +K +  GD  + +SSS  RWPK E++ALI +RT+LDL++ DNG KGPLWE+ISA M KLG
Sbjct  426  SKTDNGGDNLMPASSS--RWPKAEVQALINLRTSLDLKYQDNGPKGPLWEEISAAMGKLG  483

Query  45   YDRNAKRCKEKWENI  1
            Y+R+AKRCKEKWENI
Sbjct  484  YNRSAKRCKEKWENI  498


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +DL ++D+  KGPLW+E+S  M + GY RSAK+C+EK+ENI KY
Sbjct  442  RWPKAEVQALINLRTSLDLKYQDNGPKGPLWEEISAAMGKLGYNRSAKRCKEKWENINKY  501

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKI  712
             ++ KE    R +  K   +F QL+     ++ N +
Sbjct  502  FKKVKESNKKRPEDSKTCPYFHQLDAIYKERARNDV  537


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            YFE++MK+V++KQE+LQ+KFL+ +E+ E +RMAREEAW+ QE+ R+ RE E L +ER++A
Sbjct  272  YFERLMKDVIQKQEELQRKFLDTLEKRERDRMAREEAWRVQEMARMNREHELLVQERSMA  331

Query  333  eakdaaviAFLQKISKQ  283
             AKDAAVIAFLQK++ Q
Sbjct  332  AAKDAAVIAFLQKVTDQ  348


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D+  KGPLWE++S +M +LG+ R+AK+CKEK+EN+
Sbjct  61   RWPRQETLALLKIRSDMDVAFRDSNLKGPLWEEVSRKMAELGFQRSAKKCKEKFENV  117



>ref|XP_004173228.1| PREDICTED: trihelix transcription factor GT-2-like [Cucumis sativus]
Length=200

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD  FRD+TLKGPLWDEVSRK+ E GY+R+AKKC+EKFEN+ KY
Sbjct  23   RWPRQETLALLKIRSEMDSVFRDATLKGPLWDEVSRKLGEMGYKRNAKKCKEKFENVQKY  82

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTKEGR GRQ GK Y+FF QLE  
Sbjct  83   YKRTKEGRGGRQDGKTYKFFTQLEAL  108


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D   KGPLW+++S ++ ++GY RNAK+CKEK+EN+
Sbjct  23   RWPRQETLALLKIRSEMDSVFRDATLKGPLWDEVSRKLGEMGYKRNAKKCKEKFENV  79



>ref|XP_011074760.1| PREDICTED: trihelix transcription factor GT-2-like isoform X1 
[Sesamum indicum]
Length=616

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+AFRD++LKGPLW+EVSRKM E G+QRSAKKC+EKFEN+YKY
Sbjct  58   RWPRQETLALLKIRSDMDVAFRDASLKGPLWEEVSRKMAELGFQRSAKKCKEKFENVYKY  117

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTK+GR+ +  GK YRFF+QLE  +
Sbjct  118  HKRTKDGRASKSDGKTYRFFDQLEALE  144


 Score =   100 bits (249),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 63/75 (84%), Gaps = 2/75 (3%)
 Frame = -3

Query  225  TKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLG  46
            +K +  GDT +S+SSS  RWPK E++ALI +RT+LDL++ +NG KGPLWE+ISA M KLG
Sbjct  418  SKTDNGGDTCVSASSS--RWPKAEVQALINLRTSLDLKYQENGPKGPLWEEISAGMAKLG  475

Query  45   YDRNAKRCKEKWENI  1
            Y+R++KRCKEKWENI
Sbjct  476  YNRSSKRCKEKWENI  490


 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +DL ++++  KGPLW+E+S  M + GY RS+K+C+EK+ENI KY
Sbjct  434  RWPKAEVQALINLRTSLDLKYQENGPKGPLWEEISAGMAKLGYNRSSKRCKEKWENINKY  493

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKIGG  706
             ++ KE    R +  K   +F QL+     ++ N + G
Sbjct  494  FKKVKESNKKRAEDSKTCPYFHQLDAIYKEKAKNDVVG  531


 Score = 71.2 bits (173),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLWE++S +M +LG+ R+AK+CKEK+EN+
Sbjct  58   RWPRQETLALLKIRSDMDVAFRDASLKGPLWEEVSRKMAELGFQRSAKKCKEKFENV  114


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +F+++MK+V+ KQE+LQKKFL+ +E+ E ERMAREEAW+ QE+ R+ RE E L +ER+IA
Sbjct  276  FFQRLMKDVIHKQEELQKKFLDTLEKRERERMAREEAWRVQEMSRMNREHELLVQERSIA  335

Query  333  eakdaaviAFLQKISKQ  283
             AKDAAVIAFLQK+++Q
Sbjct  336  AAKDAAVIAFLQKVTEQ  352



>gb|AFK41859.1| unknown [Medicago truncatula]
Length=248

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD AF+D+++KGPLWDEVSRKM + GYQR++KKC+EKFEN+YKY
Sbjct  55   RWPRQETLALLKIRSDMDGAFKDASVKGPLWDEVSRKMADLGYQRNSKKCKEKFENVYKY  114

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTKEGR G+  GK YRFF+QL+  +
Sbjct  115  HKRTKEGRGGKSDGKTYRFFDQLQALE  141


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D   KGPLW+++S +M  LGY RN+K+CKEK+EN+
Sbjct  55   RWPRQETLALLKIRSDMDGAFKDASVKGPLWDEVSRKMADLGYQRNSKKCKEKFENV  111



>gb|KDP42994.1| hypothetical protein JCGZ_25180 [Jatropha curcas]
Length=619

 Score =   147 bits (372),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD  FRDS+LKGPLW+EVSRK+ + GY RSAKKC+EKFEN+YKY
Sbjct  56   RWPRQETLALLKIRSDMDSVFRDSSLKGPLWEEVSRKLADLGYNRSAKKCKEKFENVYKY  115

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTKEGR+G+  GK YRFF+QL+  ++   H
Sbjct  116  HKRTKEGRTGKSDGKTYRFFDQLQALESHHHH  147


 Score =   147 bits (371),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 133/225 (59%), Gaps = 49/225 (22%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +FEK+ K+V++KQ  LQ KFLE IER E ER+AREEAW+ QE+ R+ RE E L
Sbjct  272  RKRKWKDFFEKLTKDVIKKQVVLQNKFLETIERLEQERIAREEAWRLQEMTRINREHEIL  331

Query  354  akeraiaeakdaaviAFLQKISKQ-------PILVPHK----------------------  262
             +ER  A AKDAAVIAFLQKIS Q        I +PH                       
Sbjct  332  IQERTTAAAKDAAVIAFLQKISGQQNSLQLHSIDIPHSSIFTPAMAPAPAPAPAPALVPV  391

Query  261  --------------PQSEDVQEFAAQTKENGS----GDTTIssssssSRWPKPEIEALIQ  136
                          P S  V      T  + S    G+  I  +SSS RWPK E++ALI+
Sbjct  392  PVPVPVPAPAPQSTPPSA-VASVPVLTSPDVSRKDDGERAIVMTSSS-RWPKVEVQALIK  449

Query  135  IRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            +RTNLD ++ +NG KGPLWE+IS+ M+KLGY+R+AKRCKEKWENI
Sbjct  450  LRTNLDTKYQENGPKGPLWEEISSRMQKLGYNRSAKRCKEKWENI  494


 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S +M++ GY RSAK+C+EK+ENI KY
Sbjct  438  RWPKVEVQALIKLRTNLDTKYQENGPKGPLWEEISSRMQKLGYNRSAKRCKEKWENINKY  497

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  498  FKKVKESSKRRPEDSKTCPYFHQLDAL  524


 Score = 70.9 bits (172),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D+  KGPLWE++S ++  LGY+R+AK+CKEK+EN+
Sbjct  56   RWPRQETLALLKIRSDMDSVFRDSSLKGPLWEEVSRKLADLGYNRSAKKCKEKFENV  112



>gb|KDP42995.1| hypothetical protein JCGZ_25181 [Jatropha curcas]
Length=684

 Score =   148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 138/219 (63%), Gaps = 49/219 (22%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV+ KQED+Q+KFLEAIE+ E++R+ REE+W+ QE+ R+ RE+E LA+ER+IA
Sbjct  342  FFERLMKEVVHKQEDMQRKFLEAIEKREHDRIVREESWRMQEMARINREREILAQERSIA  401

Query  333  eakdaaviAFLQKISKQ-------------------------------------------  283
             AKDAAV+AFLQK+S+Q                                           
Sbjct  402  AAKDAAVMAFLQKLSEQQNPGQVLNIPPPVQPPQPPPSHPQPQPPPQPVIPTPTPASAPA  461

Query  282  -----PILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLD  118
                   + P    S  VQ       ++ +GD T++ +SSS RWP+ E++ALI++RTNLD
Sbjct  462  PAPQPLPITPVASTSPLVQTVTTLDTKSDNGDQTLAQASSS-RWPRVEVQALIKLRTNLD  520

Query  117  LQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             ++ +NG KGPLWE+ISA M+KLGY+R+AKRCKEKWENI
Sbjct  521  SKYQENGPKGPLWEEISAGMRKLGYNRSAKRCKEKWENI  559


 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 78/103 (76%), Gaps = 16/103 (16%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSR----------------KMEEFGYQ  865
            RWP +ETL LLKIRS+MD++FRD+++KGPLW+EVSR                K+ E GY 
Sbjct  96   RWPRQETLALLKIRSDMDVSFRDASVKGPLWEEVSRWDTKSFFLLLETGDCRKLAELGYN  155

Query  864  RSAKKCREKFENIYKYHRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            RSAKKC+EKFEN+YKYH+RTKE R+G+Q GK YRFF+QLE F+
Sbjct  156  RSAKKCKEKFENVYKYHKRTKESRTGKQEGKTYRFFDQLEAFE  198


 Score = 80.5 bits (197),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M + GY RSAK+C+EK+ENI KY
Sbjct  503  RWPRVEVQALIKLRTNLDSKYQENGPKGPLWEEISAGMRKLGYNRSAKRCKEKWENINKY  562

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  563  FKKVKESNKRRPEDSKTCPYFHQLDAL  589


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 16/73 (22%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDIS----------------AEMKKLGYD  40
            RWP+ E  AL++IR+++D+   D   KGPLWE++S                 ++ +LGY+
Sbjct  96   RWPRQETLALLKIRSDMDVSFRDASVKGPLWEEVSRWDTKSFFLLLETGDCRKLAELGYN  155

Query  39   RNAKRCKEKWENI  1
            R+AK+CKEK+EN+
Sbjct  156  RSAKKCKEKFENV  168



>ref|XP_009368514.1| PREDICTED: trihelix transcription factor GT-2-like [Pyrus x bretschneideri]
Length=572

 Score =   147 bits (371),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET+ LLKIRS+MD AFRDS+LK PLW++VSRK+ E GY R+AKKC+EKFEN+YKY
Sbjct  65   RWPRQETVALLKIRSQMDDAFRDSSLKAPLWEDVSRKLGELGYYRTAKKCKEKFENVYKY  124

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            HRRTKEGRSG+Q GK YRFF++LE F A Q+H+
Sbjct  125  HRRTKEGRSGKQEGKTYRFFDELEAF-AHQNHH  156


 Score =   142 bits (359),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 126/197 (64%), Gaps = 19/197 (10%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +F ++ K+VLEKQE LQ+KFLEAI +CE++RMAREEAW+ +E+ R+ +E E L
Sbjct  266  RKRKWKYFFRRLTKDVLEKQEKLQEKFLEAIAKCEHQRMAREEAWRMEEMARMSKEHEIL  325

Query  354  akeraiaeakdaaviAFLQKISKQ-----------PILVPHKPQSEDVQEFAAQTKENGS  208
            A+ER++A AKDAAVI FL K+S Q           P   P            A      S
Sbjct  326  AQERSLAAAKDAAVIEFLHKVSGQQNLTNMQAIEAPSSQPQPMSVLMPPPLPAPVAVTRS  385

Query  207  GDTTIss--------ssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKK  52
             +  +           + S+RWP+ E+EALI +RT LD+++ ++G KG LWE+IS  MK+
Sbjct  386  SNFEVPKLNKGESPFPAGSTRWPRVEVEALINLRTCLDVKYQESGPKGSLWEEISVGMKR  445

Query  51   LGYDRNAKRCKEKWENI  1
            LGY+R+AKRCKEKWENI
Sbjct  446  LGYNRSAKRCKEKWENI  462


 Score = 77.4 bits (189),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +D+ +++S  KG LW+E+S  M+  GY RSAK+C+EK+ENI KY
Sbjct  406  RWPRVEVEALINLRTCLDVKYQESGPKGSLWEEISVGMKRLGYNRSAKRCKEKWENINKY  465

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDA  733
            +++ KE    R +  K   +F  L++  +
Sbjct  466  YKKVKESSKTRSEDSKTCPYFHLLDILHS  494


 Score = 69.7 bits (169),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = -3

Query  258  QSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLW  79
            +SE     +   +E   GD  +S  +   RWP+ E  AL++IR+ +D    D+  K PLW
Sbjct  39   ESETTNVLSNSVQEENKGDRNLSGGN---RWPRQETVALLKIRSQMDDAFRDSSLKAPLW  95

Query  78   EDISAEMKKLGYDRNAKRCKEKWENI  1
            ED+S ++ +LGY R AK+CKEK+EN+
Sbjct  96   EDVSRKLGELGYYRTAKKCKEKFENV  121



>ref|XP_010108641.1| Trihelix transcription factor GT-2 [Morus notabilis]
 gb|EXC19897.1| Trihelix transcription factor GT-2 [Morus notabilis]
Length=611

 Score =   147 bits (371),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD  FRDS+LK PLW+EVSRK+ E GY+RS KKC+EKFEN+YKY
Sbjct  82   RWPRQETLALLKIRSDMDATFRDSSLKAPLWEEVSRKLAELGYKRSGKKCKEKFENVYKY  141

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            HRRTK+GR+G+  GK YRFF+QLE FD
Sbjct  142  HRRTKDGRTGKSDGKTYRFFDQLEAFD  168


 Score = 93.2 bits (230),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  PKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            PK E+EALI +RTNLDL++ +N  KGPLWEDISA M++LGYDR++KRCKEKWENI
Sbjct  430  PKAEVEALINLRTNLDLKYEENVPKGPLWEDISAGMRRLGYDRSSKRCKEKWENI  484


 Score = 75.5 bits (184),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +F ++ +EV+ KQE++ K+FLE + +CE+ER AREEAW+ QE+ R+ RE E L
Sbjct  276  RKRKWRDFFRRLTREVVRKQEEMHKRFLETVAKCEHERTAREEAWRLQEMARINREHEIL  335

Query  354  akeraiaeakdaaviAFLQKIS  289
             +ER+ A AKDAA+IAFLQK+S
Sbjct  336  LQERSAATAKDAALIAFLQKVS  357


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = -3

Query  990  PHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKYHR  811
            P  E   L+ +R+ +DL + ++  KGPLW+++S  M   GY RS+K+C+EK+ENI KY +
Sbjct  430  PKAEVEALINLRTNLDLKYEENVPKGPLWEDISAGMRRLGYDRSSKRCKEKWENINKYFK  489

Query  810  RTKEGRSGRQ-TGKNYRFFEQLEVF  739
            + K+    R    K   +F QL+  
Sbjct  490  KVKDSDKKRSDDSKTCPYFHQLDAI  514


 Score = 67.8 bits (164),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D+  K PLWE++S ++ +LGY R+ K+CKEK+EN+
Sbjct  82   RWPRQETLALLKIRSDMDATFRDSSLKAPLWEEVSRKLAELGYKRSGKKCKEKFENV  138



>ref|XP_007019487.1| Duplicated homeodomain-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY16712.1| Duplicated homeodomain-like superfamily protein, putative [Theobroma 
cacao]
Length=569

 Score =   147 bits (370),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 128/206 (62%), Gaps = 31/206 (15%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   +F ++ KEV+EKQE+LQ KFL  IE+CE ER AREEAW+ QE+ R+ RE E L
Sbjct  241  KKRKWKEFFWRLTKEVIEKQEELQNKFLRTIEKCEQERTAREEAWRIQEMARINREHEIL  300

Query  354  akeraiaeakdaaviAFLQKI-SKQPILV---------------------------PHKP  259
             +ER+ A AKDAAVIAFLQKI  +QP  V                           P   
Sbjct  301  VQERSTAAAKDAAVIAFLQKILGQQPNTVQVQPQENPQPTPPPPTAPLSLPPPLHQPQPQ  360

Query  258  QSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLW  79
                   F      NG+ +  +SS S   RWPK E++ALI++RTNL++++ +NG K PLW
Sbjct  361  PPTPALNFDTSKMTNGAYNVVLSSPS---RWPKAEVQALIRLRTNLNVKYQENGPKAPLW  417

Query  78   EDISAEMKKLGYDRNAKRCKEKWENI  1
            E+ISA M+KLGY R+AKRCKEKWENI
Sbjct  418  EEISAGMRKLGYSRSAKRCKEKWENI  443


 Score =   144 bits (362),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +E+L LLKIRS+MD  FRDS+LKGPLW+EVSRK+ E GY RSAKKC+EKFEN++KY
Sbjct  46   RWPRQESLALLKIRSDMDAVFRDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVFKY  105

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS  724
            H+RTK+GR+G+  GK YRFF+QLE  + + S
Sbjct  106  HKRTKDGRTGKADGKTYRFFDQLEALENLHS  136


 Score = 77.4 bits (189),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+++R+ +++ ++++  K PLW+E+S  M + GY RSAK+C+EK+ENI KY
Sbjct  387  RWPKAEVQALIRLRTNLNVKYQENGPKAPLWEEISAGMRKLGYSRSAKRCKEKWENINKY  446

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  447  FKKVKESSKKRSEDSKTCPYFHQLDAI  473


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D+  KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  46   RWPRQESLALLKIRSDMDAVFRDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENV  102



>ref|NP_177814.1| Duplicated homeodomain-like superfamily protein [Arabidopsis 
thaliana]
 gb|AAG51144.1|AC079283_1 GT-like trihelix DNA-binding protein, putative [Arabidopsis thaliana]
 gb|AEE35898.1| Duplicated homeodomain-like superfamily protein [Arabidopsis 
thaliana]
Length=603

 Score =   147 bits (371),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 139/208 (67%), Gaps = 37/208 (18%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MK+V++KQE+LQ+KFLEA+E+ E+ER+ REE+W+ QEI R+ RE E LA+ER+++
Sbjct  257  FFERLMKQVVDKQEELQRKFLEAVEKREHERLVREESWRVQEIARINREHEILAQERSMS  316

Query  333  eakdaaviAFLQKISKQ---------------PIL--------------------VPHKP  259
             AKDAAV+AFLQK+S++               P +                     P   
Sbjct  317  AAKDAAVMAFLQKLSEKQPNQPQPQPQPQQVRPSMQLNNNNQQQPPQRSPPPQPPAPLPQ  376

Query  258  QSEDVQEFAAQTKENGSGD--TTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGP  85
              + V      TK +  GD   T ++S+SSSRWPK EIEALI++RTNLD ++ +NG KGP
Sbjct  377  PIQAVVSTLDTTKTDNGGDQNMTPAASASSSRWPKVEIEALIKLRTNLDSKYQENGPKGP  436

Query  84   LWEDISAEMKKLGYDRNAKRCKEKWENI  1
            LWE+ISA M++LG++RN+KRCKEKWENI
Sbjct  437  LWEEISAGMRRLGFNRNSKRCKEKWENI  464


 Score =   142 bits (359),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+M +AFRD+++KGPLW+EVSRKM E GY R+AKKC+EKFEN+YKY
Sbjct  61   RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMAEHGYIRNAKKCKEKFENVYKY  120

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS  724
            H+RTKEGR+G+  GK YRFF+QLE  ++  +
Sbjct  121  HKRTKEGRTGKSEGKTYRFFDQLEALESQST  151


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M   G+ R++K+C+EK+ENI KY
Sbjct  408  RWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMRRLGFNRNSKRCKEKWENINKY  467

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  468  FKKVKESNKKRPEDSKTCPYFHQLDAL  494


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++ +   D   KGPLWE++S +M + GY RNAK+CKEK+EN+
Sbjct  61   RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVSRKMAEHGYIRNAKKCKEKFENV  117



>ref|XP_002300534.2| hypothetical protein POPTR_0001s45870g [Populus trichocarpa]
 gb|EEE85339.2| hypothetical protein POPTR_0001s45870g [Populus trichocarpa]
Length=704

 Score =   148 bits (373),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRSEMD AFRD+TLKGPLW++VSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  106  RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENVHKY  165

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTKEGR+GRQ GK+YRFF QLE  
Sbjct  166  YKRTKEGRAGRQDGKSYRFFSQLEAL  191


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 4/73 (5%)
 Frame = -3

Query  219  ENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYD  40
            E GSG +      +SSRWPKPE+ ALI++R+ L+ ++ + G KGPLWE+ISA M +LGY 
Sbjct  510  ELGSGGS----EPASSRWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYK  565

Query  39   RNAKRCKEKWENI  1
            R++KRCKEKWENI
Sbjct  566  RSSKRCKEKWENI  578


 Score = 80.5 bits (197),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+K+RS ++  ++++  KGPLW+E+S  M   GY+RS+K+C+EK+ENI KY
Sbjct  522  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENINKY  581

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F +L+  
Sbjct  582  FKKVKESNKKRTEDAKTCPYFHELDAL  608


 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE +MK+V++KQE +Q++FLEAIE+ E +RM R+EAWK+QE+ RL RE E +A+ER+I+
Sbjct  334  FFEGLMKQVMQKQEAMQQRFLEAIEKREQDRMIRDEAWKRQEMARLSREHEIMAQERSIS  393

Query  333  eakdaaviAFLQKISKQPILVP  268
             ++DAA++AFLQKI+ Q I +P
Sbjct  394  ASRDAAIVAFLQKITGQTIHLP  415


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+ +D    D   KGPLWED+S ++ ++GY R+AK+CKEK+EN+
Sbjct  106  RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENV  162



>ref|XP_009787560.1| PREDICTED: trihelix transcription factor GTL1-like [Nicotiana 
sylvestris]
Length=637

 Score =   147 bits (371),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRSEMD+ FRDS+LKGPLW+EVSRK+ + GY RS KKC+EKFEN+YKY
Sbjct  64   RWPRQETLALLRIRSEMDVVFRDSSLKGPLWEEVSRKLADLGYHRSGKKCKEKFENVYKY  123

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            HRRTK+GR+ +  GK YRFF+QL  F+   SH
Sbjct  124  HRRTKDGRASKADGKTYRFFDQLAAFENTPSH  155


 Score =   129 bits (324),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 135/241 (56%), Gaps = 66/241 (27%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   +FE++ K+V+EKQE+LQ  FLE +E+ E ERM REE W+ QE+ R+ RE + L
Sbjct  262  KKRKWKDFFERLTKDVIEKQEELQNNFLETLEKRERERMVREETWRVQEMTRMNREHDLL  321

Query  354  akeraiaeakdaaviAFLQKIS------------------------KQPILVPHK-----  262
             +ER++A AKDA +IAFLQKI+                        K P + PH      
Sbjct  322  VQERSMAAAKDATIIAFLQKITEQKNTPIPNITNASLAQIQFQLSEKSPSVPPHSQPQKQ  381

Query  261  --------------------------PQSEDVQ--------EFAAQTKENGSGDTTIsss  184
                                      P +   Q         F A   +NG  + +    
Sbjct  382  TQQPPAPPTTIPAPATTPAPATAVSLPMAIHAQVQTQAPSLPFEAPKTDNGGENLS---P  438

Query  183  sssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWEN  4
            +SSSRWPK EIEALI++RT+LDL++ DNG KGPLWE+ISA M+KLGY+RNAKRCKEKWEN
Sbjct  439  ASSSRWPKEEIEALIRLRTSLDLKYQDNGPKGPLWEEISAGMRKLGYNRNAKRCKEKWEN  498

Query  3    I  1
            I
Sbjct  499  I  499


 Score = 87.4 bits (215),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++R+ +DL ++D+  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  443  RWPKEEIEALIRLRTSLDLKYQDNGPKGPLWEEISAGMRKLGYNRNAKRCKEKWENINKY  502

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKI  712
             ++ KE    R +  K   +F QLE     ++ N++
Sbjct  503  FKKVKESNKKRPEDSKTCPYFHQLEALYKEKAKNEV  538


 Score = 68.6 bits (166),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D+  KGPLWE++S ++  LGY R+ K+CKEK+EN+
Sbjct  64   RWPRQETLALLRIRSEMDVVFRDSSLKGPLWEEVSRKLADLGYHRSGKKCKEKFENV  120



>ref|XP_002532428.1| hypothetical protein RCOM_0453340 [Ricinus communis]
 gb|EEF29943.1| hypothetical protein RCOM_0453340 [Ricinus communis]
Length=649

 Score =   147 bits (371),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD  FRDS+LKGPLW+EVSRK+ E G+ RSAKKC+EKFEN+YKY
Sbjct  71   RWPRQETLALLKIRSDMDAVFRDSSLKGPLWEEVSRKLAELGFHRSAKKCKEKFENVYKY  130

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA  733
            H+RTK+GR+G+  GK YRFF+QLE F++
Sbjct  131  HKRTKDGRTGKSEGKTYRFFDQLEAFES  158


 Score = 97.4 bits (241),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  KENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGY  43
            K+NG  ++  +   S SRWPK E+EALI++RT+LD ++  NG KGPLWE+ISA M++LGY
Sbjct  434  KDNGQSNSNAAIVLSPSRWPKVEVEALIRLRTSLDSKYLQNGPKGPLWEEISAGMQRLGY  493

Query  42   DRNAKRCKEKWENI  1
             R+AKRCKEKWENI
Sbjct  494  SRSAKRCKEKWENI  507


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+++R+ +D  +  +  KGPLW+E+S  M+  GY RSAK+C+EK+ENI KY
Sbjct  451  RWPKVEVEALIRLRTSLDSKYLQNGPKGPLWEEISAGMQRLGYSRSAKRCKEKWENINKY  510

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  511  FKKVKESNKKRSEDSKTCPYFHQLDAI  537


 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKR+   +FE++ K+V++KQE+LQ+KFLE +E+ E+ER+AREE W+ QE+ R+ RE E L
Sbjct  281  RKRRWKDFFERLTKDVIKKQEELQRKFLETVEKREHERIAREETWRMQEMARINREHEIL  340

Query  354  akeraiaeakdaaviAFLQKISKQ  283
             +ER  A AKDA+VIAFLQKIS Q
Sbjct  341  IQERTTAAAKDASVIAFLQKISGQ  364


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D+  KGPLWE++S ++ +LG+ R+AK+CKEK+EN+
Sbjct  71   RWPRQETLALLKIRSDMDAVFRDSSLKGPLWEEVSRKLAELGFHRSAKKCKEKFENV  127



>gb|KEH42088.1| trihelix transcription factor [Medicago truncatula]
Length=511

 Score =   146 bits (369),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 119/215 (55%), Gaps = 4/215 (2%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETLTLL+IRS +D  F+++  KGPLWDEVSR M EE  YQRS KKCREKFEN+YK
Sbjct  131  RWPRQETLTLLEIRSRLDPKFKEANQKGPLWDEVSRIMSEEHAYQRSGKKCREKFENLYK  190

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH-NKIGGaaaaeppelaspspvAMIKPN  643
            Y+++TKEG++GR  GK+YRFF QLE      S+   +                     P+
Sbjct  191  YYKKTKEGKAGRHDGKHYRFFRQLEALYGENSNQTSLPETNFVNNNNFHFQQTSNSQNPH  250

Query  642  TNIVQDFRMRPHGFGADADVLsaststtyssggssGR--KRKLAGYFEKMMKEVLEKQED  469
             +           F  D                S  R  K K+  + +  MK+++EKQE+
Sbjct  251  NDHSLSLTTNSTDFEIDTSSSDDGNDVKGKRKSSGRRSWKVKIKDFIDAQMKKLVEKQEE  310

Query  468  LQKKFLEAIERCENERMAREEAWKKQEIERLKREQ  364
               K ++ +E  E ER  REE W+KQE +R+++EQ
Sbjct  311  WLSKLVKTLEDKEKERALREEEWRKQEAKRVEKEQ  345


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEM-KKLGYDRNAKRCKEKWENI  1
            RWP+ E   L++IR+ LD +  +   KGPLW+++S  M ++  Y R+ K+C+EK+EN+
Sbjct  131  RWPRQETLTLLEIRSRLDPKFKEANQKGPLWDEVSRIMSEEHAYQRSGKKCREKFENL  188



>ref|XP_010108642.1| Trihelix transcription factor GT-2 [Morus notabilis]
 gb|EXC19898.1| Trihelix transcription factor GT-2 [Morus notabilis]
Length=690

 Score =   147 bits (372),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET++LLKIRS+MD+AFRD+++KGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  59   RWPRQETISLLKIRSDMDVAFRDASVKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKY  118

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTKEGRSG+  GK YRFF+QL+  +
Sbjct  119  HKRTKEGRSGKADGKTYRFFDQLQALE  145


 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI++RT+LD ++ DNG KGPLWE+IS  MK++GY+R+AKRCKEKWENI
Sbjct  484  RWPKVEVHALIKLRTDLDAKYQDNGPKGPLWEEISEAMKRVGYNRSAKRCKEKWENI  540


 Score = 84.3 bits (207),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+++D  ++D+  KGPLW+E+S  M+  GY RSAK+C+EK+ENI KY
Sbjct  484  RWPKVEVHALIKLRTDLDAKYQDNGPKGPLWEEISEAMKRVGYNRSAKRCKEKWENINKY  543

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  544  FKKVKESNKRRPEDSKTCPYFHQLDAL  570


 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV+ +QE+LQK+FLEAIE+ E++RM REEAW+ QE+ R+ RE+E LA+ER++A
Sbjct  301  FFERLMKEVIHRQEELQKRFLEAIEKREHDRMVREEAWRMQEMTRINREREILAQERSMA  360

Query  333  eakdaaviAFLQKISKQ  283
             AKDAAV+AFLQKIS Q
Sbjct  361  AAKDAAVMAFLQKISDQ  377


 Score = 71.2 bits (173),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  +L++IR+++D+   D   KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  59   RWPRQETISLLKIRSDMDVAFRDASVKGPLWEEVSRKLAELGYHRSAKKCKEKFENV  115



>ref|XP_006364133.1| PREDICTED: trihelix transcription factor GTL1-like [Solanum tuberosum]
Length=652

 Score =   147 bits (371),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD+ F+DS+LKGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  69   RWPRQETLALLKIRSEMDVVFKDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKY  128

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            HRRTKEGR+ +  GK YRFF+QL+  +
Sbjct  129  HRRTKEGRASKADGKTYRFFDQLQALE  155


 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 137/237 (58%), Gaps = 61/237 (26%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   +FE +MK+V+EKQE+LQKKFLE +E+ E +R+ REE W+ QE+ RL RE + L
Sbjct  280  KKRKWKVFFESLMKDVIEKQEELQKKFLEMLEKRERDRLMREETWRVQEMARLNREHDLL  339

Query  354  akeraiaeakdaaviAFLQ-----------------------------KISKQPILVPHK  262
             +ER++A AKDA +IAFLQ                             K+S++P   P  
Sbjct  340  VQERSMAAAKDATIIAFLQKITEQQNTPIPNSTNNSSPSPFPLAQIQLKLSEKPFSAPQP  399

Query  261  --------------------------PQSEDVQEFAAQT----KENGSGDTTIssssssS  172
                                      PQ+  +   +A++    K +  G+    S +SSS
Sbjct  400  QPPAIAVSLPMTIHTPAPAPASTPALPQALTLPVVSAKSFDPPKSDNGGEN--FSPASSS  457

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK EIEALI +RT LDL++ +NG KGPLWE+IS+ M+K+GY+RNAKRCKEKWENI
Sbjct  458  RWPKEEIEALISLRTCLDLKYQENGPKGPLWEEISSGMRKIGYNRNAKRCKEKWENI  514


 Score = 84.0 bits (206),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+ +R+ +DL ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  458  RWPKEEIEALISLRTCLDLKYQENGPKGPLWEEISSGMRKIGYNRNAKRCKEKWENINKY  517

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QLE  
Sbjct  518  FKKVKESNKKRPEDSKTCPYFHQLEAL  544


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D+  KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  69   RWPRQETLALLKIRSEMDVVFKDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENV  125



>ref|XP_010250890.1| PREDICTED: trihelix transcription factor GTL1 isoform X2 [Nelumbo 
nucifera]
Length=695

 Score =   147 bits (371),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD AFRD+TLKGPLW++VSRK+ E GY RSAKKC+EKFEN++KY
Sbjct  113  RWPRQETLALLKIRSEMDSAFRDATLKGPLWEDVSRKLAELGYVRSAKKCKEKFENVHKY  172

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTKEGR+GRQ GK+YRFF QLE  
Sbjct  173  YKRTKEGRAGRQDGKSYRFFSQLEAL  198


 Score = 90.5 bits (223),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 66/98 (67%), Gaps = 9/98 (9%)
 Frame = -3

Query  276  LVPHKPQSEDV------QEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDL  115
            +V H+P S +V      Q+   +    G G +      +SSRWPK E+ ALI++R+ L+ 
Sbjct  473  IVRHQPASSEVIIAIPEQQVPQEMSSGGRGGS---FDPTSSRWPKAEVHALIKMRSGLES  529

Query  114  QHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ++ + G KGPLWE+ISA M+++GY+R+AKRCKEKWENI
Sbjct  530  RYQEAGPKGPLWEEISAGMQRMGYNRSAKRCKEKWENI  567


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+RS ++  ++++  KGPLW+E+S  M+  GY RSAK+C+EK+ENI KY
Sbjct  511  RWPKAEVHALIKMRSGLESRYQEAGPKGPLWEEISAGMQRMGYNRSAKRCKEKWENINKY  570

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  571  FKKVKESNKKRPEDAKTCPYFHQLDAL  597


 Score = 74.7 bits (182),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  525  KLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLake  346
            ++  +FE +MK+V+E+QE +Q++FLE IE+ E +R+ REEAW++QE+ RL RE E +A+E
Sbjct  329  RMMSFFEGLMKQVMERQEAMQQRFLETIEKREQDRIIREEAWRRQEMARLTREHEIMAQE  388

Query  345  raiaeakdaaviAFLQKISKQPI  277
            RAI+ ++DAA+I+FLQKI+ Q I
Sbjct  389  RAISSSRDAAIISFLQKITGQTI  411


 Score = 71.2 bits (173),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D   KGPLWED+S ++ +LGY R+AK+CKEK+EN+
Sbjct  113  RWPRQETLALLKIRSEMDSAFRDATLKGPLWEDVSRKLAELGYVRSAKKCKEKFENV  169



>ref|XP_009411483.1| PREDICTED: trihelix transcription factor GTL1-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=637

 Score =   147 bits (370),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 128/212 (60%), Gaps = 39/212 (18%)
 Frame = -3

Query  522  LAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLaker  343
            +  +FE +M++V+E+QE +Q++FLEAIE+ E +RM REEAW+ QE+ RL REQE L +ER
Sbjct  301  MMAFFEGLMQQVMERQEAMQQRFLEAIEKREQDRMKREEAWRLQEMSRLSREQELLVQER  360

Query  342  aiaeakdaaviAFLQKISKQPILVPHKP--------------------------------  259
            A+A ++D AVI++LQKIS Q I +P  P                                
Sbjct  361  AVAASRDTAVISYLQKISGQTIPLPAMPATSIAPLPQSSYTPPQQQQPPSKPQHHTQVTD  420

Query  258  ----QSEDVQEFAAQTKE--NGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNG  97
                QS    +    + E   G G       SSS RWPK E+ ALI++R+ LD ++ + G
Sbjct  421  VARHQSSSATQLVPISSEPQEGVGGGGFEPPSSS-RWPKAEVHALIKLRSGLDSRYQEAG  479

Query  96   SKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             KGPLWE+ISA M++LGY+RNAKRCKEKWENI
Sbjct  480  PKGPLWEEISAGMRRLGYNRNAKRCKEKWENI  511


 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 78/97 (80%), Gaps = 5/97 (5%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD AFRD+T KGPLW+EVSRK+ E GY+R+AKKC+EKFEN++KY
Sbjct  94   RWPRQETLALLKIRSDMDAAFRDATFKGPLWEEVSRKLAELGYKRTAKKCKEKFENVHKY  153

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGG  706
            ++RTKEGR+GRQ GK YRFF QLE       H   GG
Sbjct  154  YKRTKEGRAGRQDGKAYRFFSQLEAL-----HGSGGG  185


 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+RS +D  ++++  KGPLW+E+S  M   GY R+AK+C+EK+ENI KY
Sbjct  455  RWPKAEVHALIKLRSGLDSRYQEAGPKGPLWEEISAGMRRLGYNRNAKRCKEKWENINKY  514

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  515  FKKVKESSKNRPEDSKTCPYFHQLDAL  541


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  GSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRN  34
            G+G+      +  +RWP+ E  AL++IR+++D    D   KGPLWE++S ++ +LGY R 
Sbjct  80   GAGEEAERGGAPGNRWPRQETLALLKIRSDMDAAFRDATFKGPLWEEVSRKLAELGYKRT  139

Query  33   AKRCKEKWENI  1
            AK+CKEK+EN+
Sbjct  140  AKKCKEKFENV  150



>ref|XP_004309494.1| PREDICTED: uncharacterized protein LOC101290918 [Fragaria vesca 
subsp. vesca]
Length=769

 Score =   148 bits (373),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD+AFRD+TLKGPLW++VSRK+ E GY+R+AKKC+EKFEN++KY
Sbjct  91   RWPRQETLALLKIRSEMDVAFRDATLKGPLWEDVSRKLAELGYKRNAKKCKEKFENVHKY  150

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHN  718
            ++RTKEGR+GRQ GK+Y+FF +LE      S N
Sbjct  151  YKRTKEGRAGRQDGKSYKFFSELEALHGSPSPN  183


 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI++R+ L+ ++ + G KGPLWE+ISA M+++GY RN KRCKEKWENI
Sbjct  497  RWPKAEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMQRMGYKRNPKRCKEKWENI  553


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+K+RS ++  ++++  KGPLW+E+S  M+  GY+R+ K+C+EK+ENI KY
Sbjct  497  RWPKAEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMQRMGYKRNPKRCKEKWENINKY  556

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F +L+  
Sbjct  557  FKKVKESNKVRPEDAKTCPYFHELDAL  583


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            R++  +FE +MK+V++KQE +Q++FLE IE+ E +R  REEAWK+QE+ RL RE E + +
Sbjct  306  RRMMEFFEILMKQVMQKQETMQQRFLEVIEKREQDRNIREEAWKRQEMARLTREHELMTQ  365

Query  348  eraiaeakdaaviAFLQKISKQPILVP  268
            ERAI+ ++DAA+IAFLQKI+ Q I +P
Sbjct  366  ERAISASRDAAIIAFLQKITGQTIQLP  392


 Score = 75.5 bits (184),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D   KGPLWED+S ++ +LGY RNAK+CKEK+EN+
Sbjct  91   RWPRQETLALLKIRSEMDVAFRDATLKGPLWEDVSRKLAELGYKRNAKKCKEKFENV  147



>ref|XP_003548114.1| PREDICTED: trihelix transcription factor GT-2-like [Glycine max]
Length=655

 Score =   147 bits (370),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 83/97 (86%), Gaps = 3/97 (3%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+AFRD+++KGPLW+EVSRK+ E GY R+AKKC+EKFEN+YKY
Sbjct  63   RWPKQETLALLKIRSDMDVAFRDASVKGPLWEEVSRKLAELGYNRNAKKCKEKFENVYKY  122

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGG  706
            H+RTKEGRSG+  GK YRFF+QL+   A++++  I G
Sbjct  123  HKRTKEGRSGKSEGKTYRFFDQLQ---ALENNPAIHG  156


 Score =   144 bits (363),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 140/222 (63%), Gaps = 52/222 (23%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV+EKQE+LQ++FLEAIE+ E ER+ REEAW+ QE++R+ RE+E LA+ER+IA
Sbjct  308  FFERLMKEVIEKQEELQRRFLEAIEKREQERVVREEAWRMQEMQRINREREILAQERSIA  367

Query  333  eakdaaviAFLQKISK---------QPIL-------VPHKP---------------QSED  247
             AKDAAV+ FLQKI++         +P L       VP +P               Q+  
Sbjct  368  AAKDAAVMTFLQKIAEHQQQETINLEPALNNNSITVVPQQPVPQATPTSTPTPQQAQTTT  427

Query  246  VQEFAAQ--------------------TKENGSGDTTIssssssSRWPKPEIEALIQIRT  127
            V E                         K + +G+  +   +SSSRWPK E++ALI +RT
Sbjct  428  VPEAPQVQPLVPQLQQQQQIVVSNVEINKADNNGEN-LMMEASSSRWPKVEVQALINLRT  486

Query  126  NLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            +L+ ++ ++G KGPLWE+ISA M+K+GY+RNAKRCKEKWENI
Sbjct  487  SLETKYQESGPKGPLWEEISALMRKMGYNRNAKRCKEKWENI  528


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ ++  +++S  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  472  RWPKVEVQALINLRTSLETKYQESGPKGPLWEEISALMRKMGYNRNAKRCKEKWENINKY  531

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QLE  
Sbjct  532  FKKVKESNKKRPEDSKTCPYFHQLEAL  558


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E  AL++IR+++D+   D   KGPLWE++S ++ +LGY+RNAK+CKEK+EN+
Sbjct  63   RWPKQETLALLKIRSDMDVAFRDASVKGPLWEEVSRKLAELGYNRNAKKCKEKFENV  119



>ref|XP_010314480.1| PREDICTED: trihelix transcription factor GTL1-like [Solanum lycopersicum]
Length=651

 Score =   147 bits (370),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 137/232 (59%), Gaps = 54/232 (23%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   +FE +MK+V+EKQE+LQKKFLE +E+ E +R+ REEAW+ QE+ RL RE + L
Sbjct  282  KKRKWKEFFESLMKDVIEKQEELQKKFLETLEKRERDRLMREEAWRVQEMARLNREHDLL  341

Query  354  akeraiaeakdaaviAFLQKISKQ-----------------PIL----------------  274
             +ER++A AKDA +IAFLQKI++Q                 PI                 
Sbjct  342  VQERSMAAAKDATIIAFLQKITEQQNTQTPNSTNNTSPSPFPIAQIQLKLSEKPFSTPPQ  401

Query  273  -------------------VPHKPQSEDVQEFAAQTKENGSGDTTIs--sssssSRWPKP  157
                                P  PQ+  +   ++++ E    D      S +SSSRWPK 
Sbjct  402  PQPQPSATAVSLPMTIHTPTPAPPQTLTLPVVSSKSLEPPKSDNGGENFSPASSSRWPKE  461

Query  156  EIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            EIEALI +RT LDL++ +NG KGPLWE+IS+ M+K+GY+RNAKRCKEKWENI
Sbjct  462  EIEALISLRTCLDLKYQENGPKGPLWEEISSGMRKIGYNRNAKRCKEKWENI  513


 Score =   146 bits (369),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 1/96 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD+ F+DS+LKGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  72   RWPRQETLALLKIRSEMDVVFKDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKY  131

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF-DAMQSHNKI  712
            HRRTK+GR+ +  GK YRFF+QL+   +   SH+ I
Sbjct  132  HRRTKDGRASKADGKTYRFFDQLQALENNPSSHSNI  167


 Score = 83.6 bits (205),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+ +R+ +DL ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  457  RWPKEEIEALISLRTCLDLKYQENGPKGPLWEEISSGMRKIGYNRNAKRCKEKWENINKY  516

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QLE  
Sbjct  517  FKKVKESNKKRPEDSKTCPYFHQLEAL  543


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D+  KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  72   RWPRQETLALLKIRSEMDVVFKDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENV  128



>ref|XP_006434456.1| hypothetical protein CICLE_v10000627mg [Citrus clementina]
 gb|ESR47696.1| hypothetical protein CICLE_v10000627mg [Citrus clementina]
Length=610

 Score =   146 bits (369),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD  FRDS+LKGPLW+E+SRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  70   RWPRQETLALLKIRSDMDQVFRDSSLKGPLWEEISRKLAELGYNRSAKKCKEKFENVYKY  129

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            HRRTK+GR+G+  GK+Y+FF+QLE  D
Sbjct  130  HRRTKDGRTGKPEGKHYKFFDQLEALD  156


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 125/199 (63%), Gaps = 21/199 (11%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +F+++ K+V++KQE+LQ +FLE +ER E ER+ R+EAW+ QE+ R+ RE E L
Sbjct  273  RKRKWKMFFKRLTKQVIKKQEELQYRFLEEMERRERERIVRDEAWRVQEMARIDREHEIL  332

Query  354  akeraiaeakdaaviAFLQKISKQ---PI------------------LVPHKPQSEDVQE  238
             +ERA A AKDAAVIAFLQ IS Q   P+                  + P          
Sbjct  333  IQERATAAAKDAAVIAFLQNISGQQQIPVKENPQPPPPTVVVQPVPAVPPQPQPPATTTP  392

Query  237  FAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEM  58
                   N +    +  S+SSSRWPK E++ALI+ RT L  ++ +NG KGPLWE+I+A M
Sbjct  393  NNKPAANNNNYGGNVVMSTSSSRWPKAEVQALIKFRTELANKYQENGPKGPLWEEIAAAM  452

Query  57   KKLGYDRNAKRCKEKWENI  1
            + +GY+RNAKRCKEKWENI
Sbjct  453  RSVGYNRNAKRCKEKWENI  471


 Score = 77.4 bits (189),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K R+E+   ++++  KGPLW+E++  M   GY R+AK+C+EK+ENI KY
Sbjct  415  RWPKAEVQALIKFRTELANKYQENGPKGPLWEEIAAAMRSVGYNRNAKRCKEKWENINKY  474

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R    K   +F+QL+  
Sbjct  475  FKKVKESNKKRPDDSKTCPYFDQLDAL  501


 Score = 71.2 bits (173),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D+  KGPLWE+IS ++ +LGY+R+AK+CKEK+EN+
Sbjct  70   RWPRQETLALLKIRSDMDQVFRDSSLKGPLWEEISRKLAELGYNRSAKKCKEKFENV  126



>ref|XP_003592114.1| GT-2 factor [Medicago truncatula]
 gb|AES62365.1| trihelix transcription factor GT-like protein [Medicago truncatula]
Length=637

 Score =   146 bits (369),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRS+MD  FRD+++KGPLWDEVSRK+ E GY RS+KKC+EKFEN+YKY
Sbjct  57   RWPRQETLALLRIRSDMDTVFRDASVKGPLWDEVSRKLAELGYHRSSKKCKEKFENVYKY  116

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTK+GR G+  GK YRFF+QLE  D   ++
Sbjct  117  HKRTKDGRGGKSDGKTYRFFDQLEALDHFHTN  148


 Score = 94.0 bits (232),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E++ALI +RT++D ++ +NG KGPLWE+IS  MK LGY+RNAKRCKEKWENI
Sbjct  454  RWPKVEVQALINLRTSMDNKYQENGPKGPLWEEISLAMKNLGYNRNAKRCKEKWENI  510


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +FE++MK+V EKQEDLQK+FLE IE+ E ER+ REEAW+ QE++R+ RE+E L
Sbjct  276  RKRKWKNFFERIMKKVTEKQEDLQKRFLEVIEKREQERVVREEAWRAQEMQRINREREML  335

Query  354  akeraiaeakdaaviAFLQKISKQ  283
            A ER+I  AKDAAV++FLQKI++Q
Sbjct  336  AHERSITAAKDAAVMSFLQKIAEQ  359


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ MD  ++++  KGPLW+E+S  M+  GY R+AK+C+EK+ENI KY
Sbjct  454  RWPKVEVQALINLRTSMDNKYQENGPKGPLWEEISLAMKNLGYNRNAKRCKEKWENINKY  513

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  514  FKKVKESNKKRPEDSKTCPYFHQLDAL  540


 Score = 68.6 bits (166),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D   KGPLW+++S ++ +LGY R++K+CKEK+EN+
Sbjct  57   RWPRQETLALLRIRSDMDTVFRDASVKGPLWDEVSRKLAELGYHRSSKKCKEKFENV  113



>gb|KDO83728.1| hypothetical protein CISIN_1g007316mg [Citrus sinensis]
Length=608

 Score =   146 bits (368),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD  FRDS+LKGPLW+E+SRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  70   RWPRQETLALLKIRSDMDQVFRDSSLKGPLWEEISRKLAELGYNRSAKKCKEKFENVYKY  129

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            HRRTK+GR+G+  GK+Y+FF+QLE  D
Sbjct  130  HRRTKDGRTGKPEGKHYKFFDQLEALD  156


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 125/199 (63%), Gaps = 21/199 (11%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +F+++ K+V++KQE+LQ +FLE +ER E ER+ R+EAW+ QE+ R+ RE E L
Sbjct  271  RKRKWKMFFKRLTKQVIKKQEELQYRFLEEMERRERERIVRDEAWRVQEMARIDREHEIL  330

Query  354  akeraiaeakdaaviAFLQKISKQ---PI------------------LVPHKPQSEDVQE  238
             +ERA A AKDAAVIAFLQ IS Q   P+                  + P          
Sbjct  331  IQERATAAAKDAAVIAFLQNISGQQQIPVKENPQPPPPTVVVQPVPAVPPQPQPPATTTP  390

Query  237  FAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEM  58
                   N +    +  S+SSSRWPK E++ALI+ RT L  ++ +NG KGPLWE+I+A M
Sbjct  391  NNKPAANNNNYGGNVVMSTSSSRWPKAEVQALIKFRTELANKYQENGPKGPLWEEIAAAM  450

Query  57   KKLGYDRNAKRCKEKWENI  1
            + +GY+RNAKRCKEKWENI
Sbjct  451  RSVGYNRNAKRCKEKWENI  469


 Score = 77.4 bits (189),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K R+E+   ++++  KGPLW+E++  M   GY R+AK+C+EK+ENI KY
Sbjct  413  RWPKAEVQALIKFRTELANKYQENGPKGPLWEEIAAAMRSVGYNRNAKRCKEKWENINKY  472

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R    K   +F+QL+  
Sbjct  473  FKKVKESNKKRPDDSKTCPYFDQLDAL  499


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D+  KGPLWE+IS ++ +LGY+R+AK+CKEK+EN+
Sbjct  70   RWPRQETLALLKIRSDMDQVFRDSSLKGPLWEEISRKLAELGYNRSAKKCKEKFENV  126



>gb|KDO83726.1| hypothetical protein CISIN_1g006925mg [Citrus sinensis]
 gb|KDO83727.1| hypothetical protein CISIN_1g006925mg [Citrus sinensis]
Length=625

 Score =   146 bits (368),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 136/225 (60%), Gaps = 47/225 (21%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   +FE++MK+V++KQE+LQ KFLEAIE+ E+ERM REEAW+ QE+ R+ RE+E L
Sbjct  279  KKRKWRDFFERLMKQVVDKQEELQMKFLEAIEKREHERMVREEAWRMQEMTRINREREIL  338

Query  354  akeraiaeakdaaviAFLQKISKQ------------------------------------  283
             +ER+IA AKDAAV+AFLQK+++Q                                    
Sbjct  339  GQERSIASAKDAAVMAFLQKLAEQQNPGSQVVISTSNNSIPAPPIILPPVPAPAPVQSQP  398

Query  282  ----PILVPHKPQSED-------VQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQ  136
                PI  P              V        +NG      +  +SSSRWPK E+EALI+
Sbjct  399  PPLQPISTPASAPPPPPPHQQQPVFSIERTKTDNGGERNNYTGGTSSSRWPKVEVEALIK  458

Query  135  IRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            +RT+LD ++ +NG KGPLWE+ISA M++LGY+R++KRCKEKWENI
Sbjct  459  MRTSLDSKYQENGPKGPLWEEISAGMRRLGYNRSSKRCKEKWENI  503


 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+AFRD+++KGPLW+E+SRK+ E GY RSAKKC+EKFEN++KY
Sbjct  69   RWPRQETLALLKIRSDMDVAFRDASVKGPLWEEISRKLGELGYHRSAKKCKEKFENVFKY  128

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTK+ RS +  GK YRFF+QLE F+
Sbjct  129  HKRTKDSRSSKGQGKTYRFFDQLEAFE  155


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M   GY RS+K+C+EK+ENI KY
Sbjct  447  RWPKVEVEALIKMRTSLDSKYQENGPKGPLWEEISAGMRRLGYNRSSKRCKEKWENINKY  506

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  507  FKKVKESNKKRPEDSKTCPYFHQLDAL  533


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLWE+IS ++ +LGY R+AK+CKEK+EN+
Sbjct  69   RWPRQETLALLKIRSDMDVAFRDASVKGPLWEEISRKLGELGYHRSAKKCKEKFENV  125



>ref|XP_009769494.1| PREDICTED: trihelix transcription factor GT-2-like [Nicotiana 
sylvestris]
Length=684

 Score =   147 bits (370),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET+ LLKIRSEMDL FRDS+LKGPLW+EVSRKM + G+ RSAKKC+EKFEN+YKY
Sbjct  70   RWPRQETIALLKIRSEMDLVFRDSSLKGPLWEEVSRKMADLGFHRSAKKCKEKFENVYKY  129

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTK+GR+ +  GK YRFFEQLE  +
Sbjct  130  HKRTKDGRASKADGKTYRFFEQLEALE  156


 Score =   100 bits (250),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = -3

Query  240  EFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAE  61
            E   ++   G G T     +SSSRWPK E+EALI++RT LD+++ +NG KGPLWE+ISA 
Sbjct  464  ELTPKSDNGGEGYTP----ASSSRWPKAEVEALIKLRTQLDVKYQENGPKGPLWEEISAG  519

Query  60   MKKLGYDRNAKRCKEKWENI  1
            MKK+GY+RNAKRCKEKWENI
Sbjct  520  MKKIGYNRNAKRCKEKWENI  539


 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+++D+ ++++  KGPLW+E+S  M++ GY R+AK+C+EK+ENI KY
Sbjct  483  RWPKAEVEALIKLRTQLDVKYQENGPKGPLWEEISAGMKKIGYNRNAKRCKEKWENINKY  542

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  543  FKKVKESNKKRPEDSKTCPYFHQLDAL  569


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 73/96 (76%), Gaps = 5/96 (5%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MK+V++KQEDLQ++FLE +E+ E +RM REEAW+ QE+ R+ RE + L +ER++A
Sbjct  299  FFERLMKDVIDKQEDLQRRFLETLEKRERDRMVREEAWRVQEVARMNREHDLLVQERSMA  358

Query  333  eakdaaviAFLQKISKQ-----PILVPHKPQSEDVQ  241
            EAKDAAV++FLQKI++Q     P  +   P S  VQ
Sbjct  359  EAKDAAVVSFLQKITEQQNIQIPSNINVAPPSAQVQ  394


 Score = 71.2 bits (173),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +DL   D+  KGPLWE++S +M  LG+ R+AK+CKEK+EN+
Sbjct  70   RWPRQETIALLKIRSEMDLVFRDSSLKGPLWEEVSRKMADLGFHRSAKKCKEKFENV  126



>ref|XP_006473055.1| PREDICTED: trihelix transcription factor GT-2-like [Citrus sinensis]
Length=609

 Score =   146 bits (368),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD  FRDS+LKGPLW+E+SRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  72   RWPRQETLALLKIRSDMDQVFRDSSLKGPLWEEISRKLAELGYNRSAKKCKEKFENVYKY  131

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            HRRTK+GR+G+  GK+Y+FF+QLE  D
Sbjct  132  HRRTKDGRTGKPEGKHYKFFDQLEALD  158


 Score =   103 bits (256),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 125/199 (63%), Gaps = 21/199 (11%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            RKRK   +F+++ K+V++KQE+LQ +FLE +ER E ER+ R+EAW+ QE+ R+ RE E L
Sbjct  274  RKRKWKMFFKRLTKQVIKKQEELQYRFLEEMERRERERIVRDEAWRVQEMARIDREHEIL  333

Query  354  akeraiaeakdaaviAFLQKISKQ---PI------------------LVPHKPQSEDVQE  238
             +ERA A AKDAAVIAFLQ IS Q   P+                  + P          
Sbjct  334  IQERATAAAKDAAVIAFLQNISGQQQIPVKENPQPPPPTVVVQPVPAVPPQPQPPATTTP  393

Query  237  FAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEM  58
                   N +    +  S+SSSRWPK E++ALI+ RT L  ++ +NG KGPLWE+I+A M
Sbjct  394  NNKPAANNNNYGGNVVMSTSSSRWPKAEVQALIKFRTELANKYQENGPKGPLWEEIAAAM  453

Query  57   KKLGYDRNAKRCKEKWENI  1
            + +GY+RNAKRCKEKWENI
Sbjct  454  RSVGYNRNAKRCKEKWENI  472


 Score = 77.4 bits (189),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K R+E+   ++++  KGPLW+E++  M   GY R+AK+C+EK+ENI KY
Sbjct  416  RWPKAEVQALIKFRTELANKYQENGPKGPLWEEIAAAMRSVGYNRNAKRCKEKWENINKY  475

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R    K   +F+QL+  
Sbjct  476  FKKVKESNKKRPDDSKTCPYFDQLDAL  502


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D+  KGPLWE+IS ++ +LGY+R+AK+CKEK+EN+
Sbjct  72   RWPRQETLALLKIRSDMDQVFRDSSLKGPLWEEISRKLAELGYNRSAKKCKEKFENV  128



>ref|XP_009401789.1| PREDICTED: trihelix transcription factor GTL1-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=735

 Score =   147 bits (371),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 5/97 (5%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD AFRD+T KGPLW+EVSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  113  RWPRQETLALLKIRSEMDAAFRDATFKGPLWEEVSRKLAELGYKRSAKKCKEKFENVHKY  172

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGG  706
            ++RTK+GR+GRQ GK YRFF QLE       H+  GG
Sbjct  173  YKRTKDGRAGRQDGKTYRFFNQLEAL-----HSSGGG  204


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI++R+ L  ++ + G KGPLWEDISA M +LGY+R+AKRCKEKWENI
Sbjct  478  RWPKEEVHALIKLRSGLGSRYQEAGPKGPLWEDISAGMHRLGYNRSAKRCKEKWENI  534


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+K+RS +   ++++  KGPLW+++S  M   GY RSAK+C+EK+ENI KY
Sbjct  478  RWPKEEVHALIKLRSGLGSRYQEAGPKGPLWEDISAGMHRLGYNRSAKRCKEKWENINKY  537

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ K+    R +  K+  +F +LE  
Sbjct  538  FKKVKDSNKKRPEDSKSCPYFHELEAL  564


 Score = 77.4 bits (189),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 73/96 (76%), Gaps = 10/96 (10%)
 Frame = -3

Query  534  RKRKLAG----------YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEI  385
            RKRK +G          +F+ +M++V+E+QE +Q++FLEAIE+ E +R+ RE+AW+ QE+
Sbjct  304  RKRKRSGGSRARQQMMTFFQGLMRQVMERQEAMQQRFLEAIEKREQDRLIREDAWRLQEM  363

Query  384  ERLKREQESLakeraiaeakdaaviAFLQKISKQPI  277
             RL REQE L++ERA+A ++D AVI++LQKIS QP+
Sbjct  364  ARLSREQELLSQERAMAASRDTAVISYLQKISGQPV  399


 Score = 69.7 bits (169),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D   KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  113  RWPRQETLALLKIRSEMDAAFRDATFKGPLWEEVSRKLAELGYKRSAKKCKEKFENV  169



>ref|XP_009401788.1| PREDICTED: trihelix transcription factor GTL1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=741

 Score =   147 bits (371),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 5/97 (5%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD AFRD+T KGPLW+EVSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  113  RWPRQETLALLKIRSEMDAAFRDATFKGPLWEEVSRKLAELGYKRSAKKCKEKFENVHKY  172

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGG  706
            ++RTK+GR+GRQ GK YRFF QLE       H+  GG
Sbjct  173  YKRTKDGRAGRQDGKTYRFFNQLEAL-----HSSGGG  204


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI++R+ L  ++ + G KGPLWEDISA M +LGY+R+AKRCKEKWENI
Sbjct  478  RWPKEEVHALIKLRSGLGSRYQEAGPKGPLWEDISAGMHRLGYNRSAKRCKEKWENI  534


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+K+RS +   ++++  KGPLW+++S  M   GY RSAK+C+EK+ENI KY
Sbjct  478  RWPKEEVHALIKLRSGLGSRYQEAGPKGPLWEDISAGMHRLGYNRSAKRCKEKWENINKY  537

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ K+    R +  K+  +F +LE  
Sbjct  538  FKKVKDSNKKRPEDSKSCPYFHELEAL  564


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 73/96 (76%), Gaps = 10/96 (10%)
 Frame = -3

Query  534  RKRKLAG----------YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEI  385
            RKRK +G          +F+ +M++V+E+QE +Q++FLEAIE+ E +R+ RE+AW+ QE+
Sbjct  304  RKRKRSGGSRARQQMMTFFQGLMRQVMERQEAMQQRFLEAIEKREQDRLIREDAWRLQEM  363

Query  384  ERLKREQESLakeraiaeakdaaviAFLQKISKQPI  277
             RL REQE L++ERA+A ++D AVI++LQKIS QP+
Sbjct  364  ARLSREQELLSQERAMAASRDTAVISYLQKISGQPV  399


 Score = 69.7 bits (169),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D   KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  113  RWPRQETLALLKIRSEMDAAFRDATFKGPLWEEVSRKLAELGYKRSAKKCKEKFENV  169



>ref|XP_010533325.1| PREDICTED: trihelix transcription factor GT-2-like, partial [Tarenaya 
hassleriana]
Length=210

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL LL+IRSEM+LAFRDS LK PLW+++SRKM E G++RSAKKC+EKFEN+YKY
Sbjct  42   RWPRSETLALLRIRSEMELAFRDSNLKAPLWEQISRKMRELGFRRSAKKCKEKFENVYKY  101

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTKEGRSG++ GK Y+F ++LE F+ +  +
Sbjct  102  HKRTKEGRSGKREGKTYQFSDELEAFENIHHY  133


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ ++L   D+  K PLWE IS +M++LG+ R+AK+CKEK+EN+
Sbjct  42   RWPRSETLALLRIRSEMELAFRDSNLKAPLWEQISRKMRELGFRRSAKKCKEKFENV  98



>gb|KEH43422.1| trihelix transcription factor [Medicago truncatula]
Length=501

 Score =   145 bits (366),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 117/369 (32%), Positives = 179/369 (49%), Gaps = 48/369 (13%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKM-EEFGYQRSAKKCREKFENIYK  820
            RWP +ETL+LL+IRS +D  FR++  K PLW+E+SR M EEFGYQRS KKC+EKFEN+YK
Sbjct  114  RWPRQETLSLLEIRSRLDSKFRENNQKAPLWNEISRIMAEEFGYQRSGKKCKEKFENLYK  173

Query  819  YHRRTKEGRSGRQTGKNYRFFEQLEVFDA---MQSHNKIGGaaaaeppelaspspvAMI-  652
            Y+++TKEG++ RQ GK+YRFF QLE         SH             +A+ +P   I 
Sbjct  174  YYKKTKEGKASRQDGKHYRFFRQLEAICGEPNTNSHASTLDKITPNASFVATQTPTFTIN  233

Query  651  KPNTNIVQDFRMRPHGFGA--------------------DADVLsaststtyssggssGR  532
            + NTN V    +  H +                      D   ++ +  ++   G S  R
Sbjct  234  QENTNGVDHNLIHNHKYSQSLSFSNSSEFETSSSENNDEDLSTIAHTMKSSKEKGQSGHR  293

Query  531  KR------KLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKR  370
            +       K+    +  MK ++E Q+   ++ L  +E+ E E  ++EE  K++E  R  +
Sbjct  294  RARKSWRGKVEEIVDSHMKNIIETQDAWMERMLSVVEQREQEMASKEEERKRKESMRFDQ  353

Query  369  EQESLakeraiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGSGDTT--  196
            E   L          +A   A L+ + K   +    P     QE         + DTT  
Sbjct  354  EIHEL--WAKEKAWVEARDSALLEVVRKHIGIQLEAPNKSKSQE---------ANDTTNY  402

Query  195  ---IssssssSRWPKPEIEALIQIRTNLDLQHHDNGS-KGPLWEDISAEMKKLGYDRNAK  28
                 S  +  RW + EI  LIQ+R+  + Q  + G     +W++I   M  +G++RN  
Sbjct  403  EYPFESVDNIHRWTEMEISNLIQLRSGFEHQVREKGYLDDGVWDEIGERMVYMGFNRNGA  462

Query  27   RCKEKWENI  1
             CK+ W++I
Sbjct  463  ECKKIWDDI  471



>ref|XP_007019483.1| Duplicated homeodomain-like superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY16708.1| Duplicated homeodomain-like superfamily protein isoform 2 [Theobroma 
cacao]
Length=559

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+ FRD+++KGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  86   RWPRQETLALLKIRSDMDVTFRDASVKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKY  145

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS  724
            H+RTK+GR+G+  GK YRFF+QLE  + + S
Sbjct  146  HKRTKDGRTGKSDGKAYRFFDQLEALENISS  176


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV++KQED+QKKFLEAIE+ E+ER+ RE+AW+ QE+ R+ RE+E LA+ER+IA
Sbjct  291  FFERLMKEVIQKQEDMQKKFLEAIEKREHERLVREDAWRMQEMARINREREILAQERSIA  350

Query  333  eakdaaviAFLQKISKQ  283
             AKDAAV+AFLQK+S+Q
Sbjct  351  AAKDAAVMAFLQKLSEQ  367


 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  86   RWPRQETLALLKIRSDMDVTFRDASVKGPLWEEVSRKLAELGYHRSAKKCKEKFENV  142


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAE  61
            RWPK E+EALI++RT+LD ++ +NG KGPLWE+IS +
Sbjct  444  RWPKVEVEALIKLRTSLDAKYQENGPKGPLWEEISVD  480



>ref|XP_010919360.1| PREDICTED: trihelix transcription factor GTL1-like isoform X2 
[Elaeis guineensis]
Length=693

 Score =   147 bits (370),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD AFRD+TLKGPLW++VSR++ E GY+RSAKKC+EKFEN++KY
Sbjct  106  RWPRQETLALLKIRSEMDAAFRDATLKGPLWEDVSRRLAELGYKRSAKKCKEKFENVHKY  165

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA  733
            ++RTKEGR+GRQ GK+YRFF QLE   +
Sbjct  166  YKRTKEGRAGRQDGKSYRFFSQLEALHS  193


 Score = 88.6 bits (218),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI++R+ L+ ++ + G KGPLWE+ISA M++LGY+R+AKRCKEKWENI
Sbjct  497  RWPKAEVHALIKMRSGLESRYQEAGPKGPLWEEISAGMQRLGYNRSAKRCKEKWENI  553


 Score = 80.5 bits (197),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            RK+  +FE +MK+V+E+QE +Q++FLE IE+ E +RM REEAW++QE+ RL RE E LA+
Sbjct  324  RKMMVFFEGLMKQVMERQESMQQRFLETIEKREQDRMIREEAWRRQEVARLNREHELLAQ  383

Query  348  eraiaeakdaaviAFLQKISKQPILVPHKPQS  253
            ERA+A ++DAA+I+ +QKIS Q I +P  P +
Sbjct  384  ERAMAASRDAAIISCIQKISGQTIQLPTVPAT  415


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+RS ++  ++++  KGPLW+E+S  M+  GY RSAK+C+EK+ENI KY
Sbjct  497  RWPKAEVHALIKMRSGLESRYQEAGPKGPLWEEISAGMQRLGYNRSAKRCKEKWENINKY  556

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  557  FKKVKESNKKRPEDSKTCPYFHQLDAL  583


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 56/93 (60%), Gaps = 7/93 (8%)
 Frame = -3

Query  276  LVPHKPQS-EDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDN  100
            LVP  P +  D +  AA  ++   G  T       +RWP+ E  AL++IR+ +D    D 
Sbjct  76   LVPSVPGNFPDEEALAAAGEDIERGGAT------GNRWPRQETLALLKIRSEMDAAFRDA  129

Query  99   GSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
              KGPLWED+S  + +LGY R+AK+CKEK+EN+
Sbjct  130  TLKGPLWEDVSRRLAELGYKRSAKKCKEKFENV  162



>ref|XP_010250883.1| PREDICTED: trihelix transcription factor GTL1 isoform X1 [Nelumbo 
nucifera]
Length=777

 Score =   147 bits (372),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD AFRD+TLKGPLW++VSRK+ E GY RSAKKC+EKFEN++KY
Sbjct  113  RWPRQETLALLKIRSEMDSAFRDATLKGPLWEDVSRKLAELGYVRSAKKCKEKFENVHKY  172

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTKEGR+GRQ GK+YRFF QLE  
Sbjct  173  YKRTKEGRAGRQDGKSYRFFSQLEAL  198


 Score = 90.1 bits (222),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 66/98 (67%), Gaps = 9/98 (9%)
 Frame = -3

Query  276  LVPHKPQSEDV------QEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDL  115
            +V H+P S +V      Q+   +    G G +      +SSRWPK E+ ALI++R+ L+ 
Sbjct  473  IVRHQPASSEVIIAIPEQQVPQEMSSGGRGGS---FDPTSSRWPKAEVHALIKMRSGLES  529

Query  114  QHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ++ + G KGPLWE+ISA M+++GY+R+AKRCKEKWENI
Sbjct  530  RYQEAGPKGPLWEEISAGMQRMGYNRSAKRCKEKWENI  567


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+RS ++  ++++  KGPLW+E+S  M+  GY RSAK+C+EK+ENI KY
Sbjct  511  RWPKAEVHALIKMRSGLESRYQEAGPKGPLWEEISAGMQRMGYNRSAKRCKEKWENINKY  570

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  571  FKKVKESNKKRPEDAKTCPYFHQLDAL  597


 Score = 74.7 bits (182),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  525  KLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLake  346
            ++  +FE +MK+V+E+QE +Q++FLE IE+ E +R+ REEAW++QE+ RL RE E +A+E
Sbjct  329  RMMSFFEGLMKQVMERQEAMQQRFLETIEKREQDRIIREEAWRRQEMARLTREHEIMAQE  388

Query  345  raiaeakdaaviAFLQKISKQPI  277
            RAI+ ++DAA+I+FLQKI+ Q I
Sbjct  389  RAISSSRDAAIISFLQKITGQTI  411


 Score = 71.2 bits (173),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D   KGPLWED+S ++ +LGY R+AK+CKEK+EN+
Sbjct  113  RWPRQETLALLKIRSEMDSAFRDATLKGPLWEDVSRKLAELGYVRSAKKCKEKFENV  169



>gb|AER42647.1| GTL1 [Populus tremula x Populus alba]
Length=795

 Score =   147 bits (372),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRSEMD AFRD+TLKGPLW++VSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  108  RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENVHKY  167

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTK+GR+GRQ GK+YRFF QLE  
Sbjct  168  YKRTKDGRAGRQDGKSYRFFSQLEAL  193


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPKPE+ ALI++R+ L+ ++ + G KGPLWE+ISA M +LGY R++KRCKEKWENI
Sbjct  523  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENI  579


 Score = 80.9 bits (198),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+K+RS ++  ++++  KGPLW+E+S  M   GY+RS+K+C+EK+ENI KY
Sbjct  523  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENINKY  582

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F +L+  
Sbjct  583  FKKVKESNKKRPEDAKTCPYFHELDAL  609


 Score = 77.8 bits (190),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE +MK+V++KQE +Q++FLEAIE+ E +RM R+EAWK+QE+ R  RE E +A+ER+I+
Sbjct  337  FFEGLMKQVMQKQEAMQQRFLEAIEKREQDRMIRDEAWKRQEMARSSREHEIMAQERSIS  396

Query  333  eakdaaviAFLQKISKQPILVP  268
             ++DAA++AFLQKI+ Q I VP
Sbjct  397  ASRDAAIVAFLQKITGQTIHVP  418


 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+ +D    D   KGPLWED+S ++ ++GY R+AK+CKEK+EN+
Sbjct  108  RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENV  164



>ref|XP_007039269.1| Duplicated homeodomain-like superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY23770.1| Duplicated homeodomain-like superfamily protein, putative isoform 
2 [Theobroma cacao]
Length=705

 Score =   147 bits (370),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD AFRD+T+KGPLW++VSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  98   RWPRQETLALLKIRSDMDAAFRDATVKGPLWEDVSRKLAELGYKRSAKKCKEKFENVHKY  157

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS  724
            ++RTKEGR+GRQ GK+Y+FF QLE      S
Sbjct  158  YKRTKEGRAGRQDGKSYKFFSQLEALHTTSS  188


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI +R+ L+ ++ + G KGPLWE+ISA M ++GY R+AKRCKEKWENI
Sbjct  531  RWPKAEVLALINLRSGLESRYQEAGPKGPLWEEISAGMSRMGYKRSAKRCKEKWENI  587


 Score = 82.4 bits (202),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+ +RS ++  ++++  KGPLW+E+S  M   GY+RSAK+C+EK+ENI KY
Sbjct  531  RWPKAEVLALINLRSGLESRYQEAGPKGPLWEEISAGMSRMGYKRSAKRCKEKWENINKY  590

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  591  FKKVKESNKKRPEDAKTCPYFHQLDAL  617


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            R++  +FE +MK+V++KQE +Q++FLEAIE+ E +RM REEAWK+QE+ RL R+ E +A 
Sbjct  327  RRMMEFFEGLMKQVMQKQESMQQRFLEAIEKREQDRMIREEAWKRQEMARLTRDHELMAH  386

Query  348  eraiaeakdaaviAFLQKISKQPILVP  268
            ERAIA ++DAA+I+FLQKI+ Q + +P
Sbjct  387  ERAIAASRDAAIISFLQKITGQTVQLP  413


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D   KGPLWED+S ++ +LGY R+AK+CKEK+EN+
Sbjct  98   RWPRQETLALLKIRSDMDAAFRDATVKGPLWEDVSRKLAELGYKRSAKKCKEKFENV  154



>ref|XP_009618661.1| PREDICTED: trihelix transcription factor GTL1-like [Nicotiana 
tomentosiformis]
Length=689

 Score =   146 bits (369),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET+ LLKIRSEMD+ FRDS+LKGPLW+EVSRKM + G+ RSAKKC+EKFEN+YKY
Sbjct  73   RWPRQETIALLKIRSEMDVVFRDSSLKGPLWEEVSRKMADLGFHRSAKKCKEKFENVYKY  132

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTK+GR+ +  GK YRFFEQLE  +
Sbjct  133  HKRTKDGRASKADGKTYRFFEQLEALE  159


 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = -3

Query  240  EFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAE  61
            E   ++   G G T     +SSSRWPK E+EALI++RT LD+++ +NG KGPLWE+ISA 
Sbjct  472  ELTPKSDNGGEGYTP----ASSSRWPKAEVEALIKLRTQLDVKYQENGPKGPLWEEISAG  527

Query  60   MKKLGYDRNAKRCKEKWENI  1
            MKKLGY+RNAKRCKEKWENI
Sbjct  528  MKKLGYNRNAKRCKEKWENI  547


 Score = 84.0 bits (206),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+++D+ ++++  KGPLW+E+S  M++ GY R+AK+C+EK+ENI KY
Sbjct  491  RWPKAEVEALIKLRTQLDVKYQENGPKGPLWEEISAGMKKLGYNRNAKRCKEKWENINKY  550

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  551  FKKVKESNKKRPEDSKTCPYFHQLDAL  577


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MK+V++KQEDLQ++FLE +E+ E +R  REEAW+ QE+ R+ RE + L +ER++A
Sbjct  308  FFERLMKDVIDKQEDLQRRFLETLEKRERDRTVREEAWRVQEVARMNREHDLLVQERSMA  367

Query  333  eakdaaviAFLQKISKQ  283
             AKDAAVI+FLQKI++Q
Sbjct  368  AAKDAAVISFLQKITEQ  384


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D+  KGPLWE++S +M  LG+ R+AK+CKEK+EN+
Sbjct  73   RWPRQETIALLKIRSEMDVVFRDSSLKGPLWEEVSRKMADLGFHRSAKKCKEKFENV  129



>ref|XP_009411482.1| PREDICTED: trihelix transcription factor GTL1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=721

 Score =   147 bits (370),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 128/212 (60%), Gaps = 39/212 (18%)
 Frame = -3

Query  522  LAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLaker  343
            +  +FE +M++V+E+QE +Q++FLEAIE+ E +RM REEAW+ QE+ RL REQE L +ER
Sbjct  301  MMAFFEGLMQQVMERQEAMQQRFLEAIEKREQDRMKREEAWRLQEMSRLSREQELLVQER  360

Query  342  aiaeakdaaviAFLQKISKQPILVPHKP--------------------------------  259
            A+A ++D AVI++LQKIS Q I +P  P                                
Sbjct  361  AVAASRDTAVISYLQKISGQTIPLPAMPATSIAPLPQSSYTPPQQQQPPSKPQHHTQVTD  420

Query  258  ----QSEDVQEFAAQTKE--NGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNG  97
                QS    +    + E   G G       SSS RWPK E+ ALI++R+ LD ++ + G
Sbjct  421  VARHQSSSATQLVPISSEPQEGVGGGGFEPPSSS-RWPKAEVHALIKLRSGLDSRYQEAG  479

Query  96   SKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
             KGPLWE+ISA M++LGY+RNAKRCKEKWENI
Sbjct  480  PKGPLWEEISAGMRRLGYNRNAKRCKEKWENI  511


 Score =   145 bits (366),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 78/97 (80%), Gaps = 5/97 (5%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD AFRD+T KGPLW+EVSRK+ E GY+R+AKKC+EKFEN++KY
Sbjct  94   RWPRQETLALLKIRSDMDAAFRDATFKGPLWEEVSRKLAELGYKRTAKKCKEKFENVHKY  153

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSHNKIGG  706
            ++RTKEGR+GRQ GK YRFF QLE       H   GG
Sbjct  154  YKRTKEGRAGRQDGKAYRFFSQLEAL-----HGSGGG  185


 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+RS +D  ++++  KGPLW+E+S  M   GY R+AK+C+EK+ENI KY
Sbjct  455  RWPKAEVHALIKLRSGLDSRYQEAGPKGPLWEEISAGMRRLGYNRNAKRCKEKWENINKY  514

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  515  FKKVKESSKNRPEDSKTCPYFHQLDAL  541


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  GSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRN  34
            G+G+      +  +RWP+ E  AL++IR+++D    D   KGPLWE++S ++ +LGY R 
Sbjct  80   GAGEEAERGGAPGNRWPRQETLALLKIRSDMDAAFRDATFKGPLWEEVSRKLAELGYKRT  139

Query  33   AKRCKEKWENI  1
            AK+CKEK+EN+
Sbjct  140  AKKCKEKFENV  150



>gb|AFW63214.1| putative homeodomain-like transcription factor superfamily protein 
[Zea mays]
Length=589

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 124/210 (59%), Gaps = 41/210 (20%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            R++   FE+MMK+  EKQ+ +Q+ FLE +ERCE ER AREEAW++QE+ R+ RE+E LA+
Sbjct  262  REMMATFERMMKQFTEKQDAMQRVFLETLERCEAERTAREEAWRRQEVARMNREREQLAR  321

Query  348  eraiaeakdaaviAFLQKISK---QPI-LVPHK---------------------------  262
            ERA A ++DAA+IAFLQ++     +P  L PH                            
Sbjct  322  ERAAAASRDAALIAFLQRVGGGQGEPARLPPHGAGVVPPPPMPDCAPPSPRRHAAAASLQ  381

Query  261  ---PQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSK  91
               P      E  A+    G G T        SRWPK E+EALIQ+R     ++HD G+K
Sbjct  382  QLVPVPPKAVEALARAGGEGGGSTP-------SRWPKEEVEALIQMRNEKGEKYHDAGAK  434

Query  90   GPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            GPLWEDI+A M+ +GY R+AKRCKEKWENI
Sbjct  435  GPLWEDIAAAMRGIGYSRSAKRCKEKWENI  464


 Score =   130 bits (326),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EETL L++IR+EMD  FR S LK PLW+ V+RK+   GY RSAKKC+EKFEN+ KY
Sbjct  95   RWPREETLALIRIRTEMDADFRSSPLKAPLWENVARKLAGLGYHRSAKKCKEKFENVDKY  154

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA  733
            +RRTK+ R+GRQ GK+YRFF QLE   A
Sbjct  155  YRRTKDARAGRQDGKSYRFFSQLEALHA  182


 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++R+E    + D+  KGPLW++++  M   GY RSAK+C+EK+ENI KY
Sbjct  408  RWPKEEVEALIQMRNEKGEKYHDAGAKGPLWEDIAAAMRGIGYSRSAKRCKEKWENINKY  467

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKIGG  706
            +++ KE    R +  K   +F QL+     +  +  GG
Sbjct  468  YKKVKESNKRRPEDSKTCPYFHQLDAMYRNKHRSGTGG  505


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 10/86 (12%)
 Frame = -3

Query  258  QSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLW  79
            Q ED+Q     +    SG+          RWP+ E  ALI+IRT +D     +  K PLW
Sbjct  76   QDEDMQADLGASGAGASGN----------RWPREETLALIRIRTEMDADFRSSPLKAPLW  125

Query  78   EDISAEMKKLGYDRNAKRCKEKWENI  1
            E+++ ++  LGY R+AK+CKEK+EN+
Sbjct  126  ENVARKLAGLGYHRSAKKCKEKFENV  151



>ref|XP_006473053.1| PREDICTED: trihelix transcription factor GT-2-like [Citrus sinensis]
Length=624

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 141/224 (63%), Gaps = 46/224 (21%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   +FE++MK+V++KQE+LQ KFLEAIE+ E+ERM REEAW+ QEI R+ RE+E L
Sbjct  279  KKRKWRDFFERLMKQVVDKQEELQMKFLEAIEKREHERMVREEAWRMQEITRINREREIL  338

Query  354  akeraiaeakdaaviAFLQKI------------------------------------SKQ  283
            A+ER+IA AKDAAV+AFLQK+                                    S+ 
Sbjct  339  AQERSIASAKDAAVMAFLQKLAEQQNPGSQVVISTSNNSIPAPPIILPPVPAPAPVQSQP  398

Query  282  PILVPHKPQSEDVQE--------FAAQ-TK-ENGSGDTTIssssssSRWPKPEIEALIQI  133
            P L P    +             F+ + TK +NG      +  +SSSRWPK E+EALI++
Sbjct  399  PPLQPTSTPAPAPPPPPHQQQPLFSTERTKTDNGGERNNYTVGTSSSRWPKVEVEALIKM  458

Query  132  RTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RT+LD ++ +NG KGPLWE+ISA M++LGY+R++KRCKEKWENI
Sbjct  459  RTSLDSKYQENGPKGPLWEEISAGMRRLGYNRSSKRCKEKWENI  502


 Score =   141 bits (356),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+AFRD+++KGPLW+E+SRK+ E GY RSAKKC+EKFEN++KY
Sbjct  69   RWPRQETLALLKIRSDMDVAFRDASVKGPLWEEISRKLGELGYHRSAKKCKEKFENVFKY  128

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTK+ RS +  GK YRFF+QLE F+
Sbjct  129  HKRTKDSRSSKGQGKTYRFFDQLEAFE  155


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M   GY RS+K+C+EK+ENI KY
Sbjct  446  RWPKVEVEALIKMRTSLDSKYQENGPKGPLWEEISAGMRRLGYNRSSKRCKEKWENINKY  505

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  506  FKKVKESNKKRPEDSKTCPYFHQLDAL  532


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLWE+IS ++ +LGY R+AK+CKEK+EN+
Sbjct  69   RWPRQETLALLKIRSDMDVAFRDASVKGPLWEEISRKLGELGYHRSAKKCKEKFENV  125



>ref|XP_009389204.1| PREDICTED: trihelix transcription factor GTL1-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=692

 Score =   146 bits (369),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET+ LLKIRSEMD  FRD+TLKGPLW+EVSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  105  RWPRQETVALLKIRSEMDAVFRDATLKGPLWEEVSRKLAELGYKRSAKKCKEKFENVHKY  164

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTK+GR+GRQ GK+YRFF QLE  
Sbjct  165  YKRTKDGRAGRQDGKSYRFFSQLEAL  190


 Score =   140 bits (353),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 141/239 (59%), Gaps = 63/239 (26%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            RK+  +F+++M++V+E+QE +Q++FLEAIE+ E +RM R+EAW++QE+ RL REQE LA+
Sbjct  309  RKMMAFFDRLMRQVMERQEVMQQRFLEAIEKREQDRMIRDEAWRRQEMARLNREQEVLAQ  368

Query  348  eraiaeakdaaviAFLQKISKQ----------PI----LVPHKP----------------  259
            ERA+A ++D A+I++LQKIS Q          PI    L PH+P                
Sbjct  369  ERAMAASRDTAIISYLQKISGQTFRVPAMPATPISIVPLPPHQPSHAPPPQPAAPQQQLH  428

Query  258  -----------------------QSEDV---QEFAAQTKENGS------GDTTIs-ssss  178
                                   QS ++   Q  +A     GS      G  ++  + SS
Sbjct  429  PPPLQQQKPVQPLPQKHEVQRHLQSSEIAHHQPSSATESVPGSEPQDAVGRASLQEAMSS  488

Query  177  sSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            SSRWPK E+ ALI+IR+ L+ +  D G KGPLWE+ISA M++LGY+R AKRCKEKWENI
Sbjct  489  SSRWPKAEVHALIKIRSALESKFQDAGPKGPLWEEISARMQQLGYNRRAKRCKEKWENI  547


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+KIRS ++  F+D+  KGPLW+E+S +M++ GY R AK+C+EK+ENI KY
Sbjct  491  RWPKAEVHALIKIRSALESKFQDAGPKGPLWEEISARMQQLGYNRRAKRCKEKWENINKY  550

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  551  FKKVKESNKLRPEDSKTCPYFHQLDTL  577


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 7/84 (8%)
 Frame = -3

Query  252  EDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWED  73
            +DV   A    E G+G T        +RWP+ E  AL++IR+ +D    D   KGPLWE+
Sbjct  85   DDVVLAAGDDAERGTGATA-------NRWPRQETVALLKIRSEMDAVFRDATLKGPLWEE  137

Query  72   ISAEMKKLGYDRNAKRCKEKWENI  1
            +S ++ +LGY R+AK+CKEK+EN+
Sbjct  138  VSRKLAELGYKRSAKKCKEKFENV  161



>ref|XP_011038062.1| PREDICTED: trihelix transcription factor GTL1-like isoform X6 
[Populus euphratica]
Length=642

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRSEMD AFRD+TLKGPLW++VSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  29   RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENVHKY  88

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTK+GR+GRQ GK+YRFF QLE  
Sbjct  89   YKRTKDGRAGRQDGKSYRFFSQLEAL  114


 Score = 88.2 bits (217),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPKPE+ ALI++R+ L+ ++ + G KGPLWE+ISA M +LGY R++KRCKEKWENI
Sbjct  442  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENI  498


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+K+RS ++  ++++  KGPLW+E+S  M   GY+RS+K+C+EK+ENI KY
Sbjct  442  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENINKY  501

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F +L+  
Sbjct  502  FKKVKESNKKRPEDAKTCPYFHELDAL  528


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE +MK+V++KQE +Q++FLEAIE+ E +RM R+EAWK+QE+ R  RE E +A+ER+ +
Sbjct  256  FFEGLMKQVMQKQEAMQQRFLEAIEKREQDRMIRDEAWKRQEMARWSREHEIMAEERSTS  315

Query  333  eakdaaviAFLQKISKQPILVP  268
             +++AA++ FLQKI+ Q I +P
Sbjct  316  ASRNAAIVVFLQKITGQTIHLP  337


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+ +D    D   KGPLWED+S ++ ++GY R+AK+CKEK+EN+
Sbjct  29   RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENV  85



>ref|XP_010919359.1| PREDICTED: trihelix transcription factor GTL1-like isoform X1 
[Elaeis guineensis]
Length=772

 Score =   147 bits (370),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD AFRD+TLKGPLW++VSR++ E GY+RSAKKC+EKFEN++KY
Sbjct  106  RWPRQETLALLKIRSEMDAAFRDATLKGPLWEDVSRRLAELGYKRSAKKCKEKFENVHKY  165

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTKEGR+GRQ GK+YRFF QLE  
Sbjct  166  YKRTKEGRAGRQDGKSYRFFSQLEAL  191


 Score = 88.6 bits (218),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI++R+ L+ ++ + G KGPLWE+ISA M++LGY+R+AKRCKEKWENI
Sbjct  497  RWPKAEVHALIKMRSGLESRYQEAGPKGPLWEEISAGMQRLGYNRSAKRCKEKWENI  553


 Score = 80.5 bits (197),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            RK+  +FE +MK+V+E+QE +Q++FLE IE+ E +RM REEAW++QE+ RL RE E LA+
Sbjct  324  RKMMVFFEGLMKQVMERQESMQQRFLETIEKREQDRMIREEAWRRQEVARLNREHELLAQ  383

Query  348  eraiaeakdaaviAFLQKISKQPILVPHKPQS  253
            ERA+A ++DAA+I+ +QKIS Q I +P  P +
Sbjct  384  ERAMAASRDAAIISCIQKISGQTIQLPTVPAT  415


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+RS ++  ++++  KGPLW+E+S  M+  GY RSAK+C+EK+ENI KY
Sbjct  497  RWPKAEVHALIKMRSGLESRYQEAGPKGPLWEEISAGMQRLGYNRSAKRCKEKWENINKY  556

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  557  FKKVKESNKKRPEDSKTCPYFHQLDAL  583


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 56/93 (60%), Gaps = 7/93 (8%)
 Frame = -3

Query  276  LVPHKPQS-EDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDN  100
            LVP  P +  D +  AA  ++   G  T       +RWP+ E  AL++IR+ +D    D 
Sbjct  76   LVPSVPGNFPDEEALAAAGEDIERGGAT------GNRWPRQETLALLKIRSEMDAAFRDA  129

Query  99   GSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
              KGPLWED+S  + +LGY R+AK+CKEK+EN+
Sbjct  130  TLKGPLWEDVSRRLAELGYKRSAKKCKEKFENV  162



>ref|XP_011081350.1| PREDICTED: trihelix transcription factor GTL1 isoform X2 [Sesamum 
indicum]
Length=655

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRSEMD AFRD+TLKGPLW++VSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  85   RWPRQETLALLQIRSEMDTAFRDATLKGPLWEQVSRKLAELGYKRSAKKCKEKFENVHKY  144

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTKEGR+GRQ GK+Y+FF QLE  
Sbjct  145  YKRTKEGRAGRQDGKSYKFFSQLEAL  170


 Score = 87.4 bits (215),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI++R++L+ ++ + G KGPLWE+IS+ M+++GY+RNAKRCKEKWENI
Sbjct  477  RWPKAEVLALIKLRSSLESRYQEAGPKGPLWEEISSGMQRMGYNRNAKRCKEKWENI  533


 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+K+RS ++  ++++  KGPLW+E+S  M+  GY R+AK+C+EK+ENI KY
Sbjct  477  RWPKAEVLALIKLRSSLESRYQEAGPKGPLWEEISSGMQRMGYNRNAKRCKEKWENINKY  536

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F +L+  
Sbjct  537  FKKVKESNKKRSEDSKTCPYFNELDAL  563


 Score = 78.2 bits (191),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -3

Query  525  KLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLake  346
            ++  +FE +MK+V++KQE +Q+KFLEAIE+ E +RM REEAWK+Q++ RL RE E  A+E
Sbjct  291  RMMDFFEGLMKQVMQKQEAMQQKFLEAIEKREQDRMIREEAWKRQDMARLAREHELTAQE  350

Query  345  raiaeakdaaviAFLQKISKQPILVP  268
            RAI+ ++DAA+IAFLQKI+ Q I +P
Sbjct  351  RAISASRDAAIIAFLQKITGQTIHLP  376


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 56/98 (57%), Gaps = 8/98 (8%)
 Frame = -3

Query  294  ISKQPILVPHKPQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDL  115
            IS +P   P    + D +E    T E   G +        +RWP+ E  AL+QIR+ +D 
Sbjct  52   ISSRPP-APGAIANNDFEEVIRATAEGAGGAS-------GNRWPRQETLALLQIRSEMDT  103

Query  114  QHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
               D   KGPLWE +S ++ +LGY R+AK+CKEK+EN+
Sbjct  104  AFRDATLKGPLWEQVSRKLAELGYKRSAKKCKEKFENV  141



>ref|XP_008791631.1| PREDICTED: trihelix transcription factor GTL1 isoform X2 [Phoenix 
dactylifera]
Length=709

 Score =   146 bits (369),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD AFRD+TLKGPLW++VSR++ E GY+RSAKKC+EKFEN++KY
Sbjct  107  RWPRQETLALLKIRSEMDAAFRDATLKGPLWEDVSRRLAELGYRRSAKKCKEKFENVHKY  166

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTKEGR+GRQ GK+YRFF QLE  
Sbjct  167  YKRTKEGRAGRQDGKSYRFFSQLEAL  192


 Score = 90.5 bits (223),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI++R+ LD ++ + G KGPLWE+ISA M++LGY+R+AKRCKEKWENI
Sbjct  497  RWPKAEVHALIKLRSGLDSRYQEAGPKGPLWEEISAGMQRLGYNRSAKRCKEKWENI  553


 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+RS +D  ++++  KGPLW+E+S  M+  GY RSAK+C+EK+ENI KY
Sbjct  497  RWPKAEVHALIKLRSGLDSRYQEAGPKGPLWEEISAGMQRLGYNRSAKRCKEKWENINKY  556

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  557  FKKVKESNRKRPEDSKTCPYFHQLDAL  583


 Score = 78.2 bits (191),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            RK+  +FE +MK+V+E+QE +Q++FLE +E+ E +RM REEAW++QE+ RL  E E LA+
Sbjct  320  RKMMAFFEGLMKQVMERQESMQQRFLETVEKREQDRMIREEAWRRQEMARLNHEHELLAQ  379

Query  348  eraiaeakdaaviAFLQKISKQPILVPHKPQS  253
            ERA+A ++DAA+I+ +QKIS Q I +P  P +
Sbjct  380  ERAMAASRDAAIISCIQKISGQTIPLPTVPAT  411


 Score = 71.6 bits (174),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D   KGPLWED+S  + +LGY R+AK+CKEK+EN+
Sbjct  107  RWPRQETLALLKIRSEMDAAFRDATLKGPLWEDVSRRLAELGYRRSAKKCKEKFENV  163



>ref|XP_008239289.1| PREDICTED: trihelix transcription factor GTL1 isoform X2 [Prunus 
mume]
Length=696

 Score =   146 bits (368),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD++FRD+TLKGPLW++VSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  103  RWPRQETLALLKIRSEMDVSFRDATLKGPLWEDVSRKLAELGYKRSAKKCKEKFENVHKY  162

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTKEGR+GRQ GK+Y+FF +LE  
Sbjct  163  YKRTKEGRAGRQDGKSYKFFSELEAL  188


 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI++R+ L+ ++ + G KGPLWE+ISA M ++GY R++KRCKEKWENI
Sbjct  502  RWPKAEVLALIKLRSGLESRYQEAGPKGPLWEEISAGMGRMGYKRSSKRCKEKWENI  558


 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+K+RS ++  ++++  KGPLW+E+S  M   GY+RS+K+C+EK+ENI KY
Sbjct  502  RWPKAEVLALIKLRSGLESRYQEAGPKGPLWEEISAGMGRMGYKRSSKRCKEKWENINKY  561

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F +L+  
Sbjct  562  FKKVKESNKKRPEDAKTCPYFHELDAL  588


 Score = 77.4 bits (189),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            RK+  +FE +MK+V++KQE +Q++FLE IE+ E +R  REEAWK+QE+ RL RE E +++
Sbjct  316  RKMMEFFEVLMKQVMQKQETMQQRFLEVIEKREQDRTIREEAWKRQEMARLTREHELMSQ  375

Query  348  eraiaeakdaaviAFLQKISKQPILVP  268
            ERAI+ ++DAA+I+FLQKI+ Q I +P
Sbjct  376  ERAISASRDAAIISFLQKITGQTIQLP  402


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D   KGPLWED+S ++ +LGY R+AK+CKEK+EN+
Sbjct  103  RWPRQETLALLKIRSEMDVSFRDATLKGPLWEDVSRKLAELGYKRSAKKCKEKFENV  159



>gb|EYU17439.1| hypothetical protein MIMGU_mgv1a026923mg [Erythranthe guttata]
Length=604

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+AFRD++LKGPLWDEVSRKM E G+QR  KKC+EKFEN+YKY
Sbjct  51   RWPRQETLALLKIRSDMDVAFRDASLKGPLWDEVSRKMAELGFQRHPKKCKEKFENVYKY  110

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTK+GRS +  GK+YRFF+QLE  +
Sbjct  111  HKRTKDGRSTKPDGKSYRFFDQLEALE  137


 Score = 95.5 bits (236),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+EALI +RT LDL++ +NG KGPLWE+ISAEM K+GY R++KRCKEKWENI
Sbjct  416  RWPKAEVEALINLRTRLDLKYMENGPKGPLWEEISAEMGKIGYKRSSKRCKEKWENI  472


 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ +DL + ++  KGPLW+E+S +M + GY+RS+K+C+EK+ENI KY
Sbjct  416  RWPKAEVEALINLRTRLDLKYMENGPKGPLWEEISAEMGKIGYKRSSKRCKEKWENINKY  475

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QLE  
Sbjct  476  FKKVKESNKRRPEDSKTCPYFHQLEAI  502


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            YFE++MK+V+ KQE+LQKKFLEA+E+ E +RMAR+EAW+ QE  R+ RE E L  ER+I+
Sbjct  266  YFERLMKDVVHKQEELQKKFLEALEKRERDRMARDEAWRVQETARINREHELLLHERSIS  325

Query  333  eakdaaviAFLQKIS  289
             AKDAAVIAFLQK +
Sbjct  326  AAKDAAVIAFLQKAT  340


 Score = 67.8 bits (164),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLW+++S +M +LG+ R+ K+CKEK+EN+
Sbjct  51   RWPRQETLALLKIRSDMDVAFRDASLKGPLWDEVSRKMAELGFQRHPKKCKEKFENV  107



>ref|XP_009389196.1| PREDICTED: trihelix transcription factor GTL1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=772

 Score =   146 bits (369),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ET+ LLKIRSEMD  FRD+TLKGPLW+EVSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  105  RWPRQETVALLKIRSEMDAVFRDATLKGPLWEEVSRKLAELGYKRSAKKCKEKFENVHKY  164

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTK+GR+GRQ GK+YRFF QLE  
Sbjct  165  YKRTKDGRAGRQDGKSYRFFSQLEAL  190


 Score =   140 bits (353),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 141/239 (59%), Gaps = 63/239 (26%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            RK+  +F+++M++V+E+QE +Q++FLEAIE+ E +RM R+EAW++QE+ RL REQE LA+
Sbjct  309  RKMMAFFDRLMRQVMERQEVMQQRFLEAIEKREQDRMIRDEAWRRQEMARLNREQEVLAQ  368

Query  348  eraiaeakdaaviAFLQKISKQ----------PI----LVPHKP----------------  259
            ERA+A ++D A+I++LQKIS Q          PI    L PH+P                
Sbjct  369  ERAMAASRDTAIISYLQKISGQTFRVPAMPATPISIVPLPPHQPSHAPPPQPAAPQQQLH  428

Query  258  -----------------------QSEDV---QEFAAQTKENGS------GDTTIs-ssss  178
                                   QS ++   Q  +A     GS      G  ++  + SS
Sbjct  429  PPPLQQQKPVQPLPQKHEVQRHLQSSEIAHHQPSSATESVPGSEPQDAVGRASLQEAMSS  488

Query  177  sSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            SSRWPK E+ ALI+IR+ L+ +  D G KGPLWE+ISA M++LGY+R AKRCKEKWENI
Sbjct  489  SSRWPKAEVHALIKIRSALESKFQDAGPKGPLWEEISARMQQLGYNRRAKRCKEKWENI  547


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+KIRS ++  F+D+  KGPLW+E+S +M++ GY R AK+C+EK+ENI KY
Sbjct  491  RWPKAEVHALIKIRSALESKFQDAGPKGPLWEEISARMQQLGYNRRAKRCKEKWENINKY  550

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  551  FKKVKESNKLRPEDSKTCPYFHQLDTL  577


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 7/84 (8%)
 Frame = -3

Query  252  EDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWED  73
            +DV   A    E G+G T        +RWP+ E  AL++IR+ +D    D   KGPLWE+
Sbjct  85   DDVVLAAGDDAERGTGATA-------NRWPRQETVALLKIRSEMDAVFRDATLKGPLWEE  137

Query  72   ISAEMKKLGYDRNAKRCKEKWENI  1
            +S ++ +LGY R+AK+CKEK+EN+
Sbjct  138  VSRKLAELGYKRSAKKCKEKFENV  161



>gb|AIB05523.1| trihelix transcription factor, partial [Zea mays]
Length=656

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 124/210 (59%), Gaps = 41/210 (20%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            R++   FE+MMK+  EKQ+ +Q+ FLE +ERCE ER AREEAW++QE+ R+ RE+E LA+
Sbjct  250  REMMATFERMMKQFTEKQDAMQRVFLETLERCEAERTAREEAWRRQEVARMNREREQLAR  309

Query  348  eraiaeakdaaviAFLQKISK---QPI-LVPHK---------------------------  262
            ERA A ++DAA+IAFLQ++     +P  L PH                            
Sbjct  310  ERAAAASRDAALIAFLQRVGGGQGEPARLPPHGAGVVPPPPMPDCAPPSPRRHAAAASLQ  369

Query  261  ---PQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSK  91
               P      E  A+    G G T        SRWPK E+EALIQ+R     ++HD G+K
Sbjct  370  QLVPVPPKAVEALARAGGEGGGSTP-------SRWPKEEVEALIQMRNEKGEKYHDAGAK  422

Query  90   GPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            GPLWEDI+A M+ +GY R+AKRCKEKWENI
Sbjct  423  GPLWEDIAAAMRGIGYSRSAKRCKEKWENI  452


 Score =   130 bits (327),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EETL L++IR+EMD  FR S LK PLW+ V+RK+   GY RSAKKC+EKFEN+ KY
Sbjct  83   RWPREETLALIRIRTEMDADFRSSPLKAPLWENVARKLAGLGYHRSAKKCKEKFENVDKY  142

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA  733
            +RRTK+ R+GRQ GK+YRFF QLE   A
Sbjct  143  YRRTKDARAGRQDGKSYRFFSQLEALHA  170


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++R+E    + D+  KGPLW++++  M   GY RSAK+C+EK+ENI KY
Sbjct  396  RWPKEEVEALIQMRNEKGEKYHDAGAKGPLWEDIAAAMRGIGYSRSAKRCKEKWENINKY  455

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKIGG  706
            +++ KE    R +  K   +F QL+     +  +  GG
Sbjct  456  YKKVKESNKRRPEDSKTCPYFHQLDAMYRNKHRSGTGG  493


 Score = 68.6 bits (166),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 10/86 (12%)
 Frame = -3

Query  258  QSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLW  79
            Q ED+Q     +    SG+          RWP+ E  ALI+IRT +D     +  K PLW
Sbjct  64   QDEDMQADLGASGAGASGN----------RWPREETLALIRIRTEMDADFRSSPLKAPLW  113

Query  78   EDISAEMKKLGYDRNAKRCKEKWENI  1
            E+++ ++  LGY R+AK+CKEK+EN+
Sbjct  114  ENVARKLAGLGYHRSAKKCKEKFENV  139



>ref|XP_004496472.1| PREDICTED: trihelix transcription factor GT-2-like [Cicer arietinum]
Length=578

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 132/211 (63%), Gaps = 41/211 (19%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            +KRK   YF ++ +EVL KQE++QKKFLEAI++ E E MA+++AW+ QE+ R+ +E E L
Sbjct  243  KKRKWKDYFRRLTREVLIKQEEMQKKFLEAIDKREREHMAQQDAWRVQEMNRINKEHELL  302

Query  354  akeraiaeakdaaviAFLQKISKQ--------------------------PI----LVPH  265
             +ER+   AK+AAVIAFLQK+S Q                          PI    + PH
Sbjct  303  VQERSTTAAKNAAVIAFLQKLSGQQNSTIQDNFIQPPPPPQPTPPESAQTPISQLQIQPH  362

Query  264  KPQSED---VQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGS  94
            +P + +   V+       ++G G ++        RWPK E+ ALI+IRT+L+ ++ +NG 
Sbjct  363  EPVTSNNNIVEIHQNNGHKSGGGASS--------RWPKSEVHALIRIRTSLEPKYQENGP  414

Query  93   KGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            K PLWEDISA M++LGY+RN+KRCKEKWENI
Sbjct  415  KAPLWEDISAGMQRLGYNRNSKRCKEKWENI  445


 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 77/88 (88%), Gaps = 1/88 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD  FRDS+LKGPLW+EVSRK+ E GY R+AKKC+EKFEN+YKY
Sbjct  49   RWPRQETLALLKIRSDMDGVFRDSSLKGPLWEEVSRKLAELGYHRNAKKCKEKFENVYKY  108

Query  816  HRRTKEGRSGRQT-GKNYRFFEQLEVFD  736
            H+RTKEG+SG+++ GK YRFF+QL+  +
Sbjct  109  HKRTKEGKSGKKSEGKTYRFFDQLQALE  136


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L++IR+ ++  ++++  K PLW+++S  M+  GY R++K+C+EK+ENI KY
Sbjct  389  RWPKSEVHALIRIRTSLEPKYQENGPKAPLWEDISAGMQRLGYNRNSKRCKEKWENINKY  448

Query  816  HRRTKEGRSGRQTG-KNYRFFEQLEVF  739
            +++ KE    R+ G K   +F +LE  
Sbjct  449  YKKMKESNKQRRDGSKTCPYFNELEAL  475


 Score = 72.0 bits (175),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D+  KGPLWE++S ++ +LGY RNAK+CKEK+EN+
Sbjct  49   RWPRQETLALLKIRSDMDGVFRDSSLKGPLWEEVSRKLAELGYHRNAKKCKEKFENV  105



>ref|XP_008791630.1| PREDICTED: trihelix transcription factor GTL1 isoform X1 [Phoenix 
dactylifera]
Length=788

 Score =   147 bits (370),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD AFRD+TLKGPLW++VSR++ E GY+RSAKKC+EKFEN++KY
Sbjct  107  RWPRQETLALLKIRSEMDAAFRDATLKGPLWEDVSRRLAELGYRRSAKKCKEKFENVHKY  166

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTKEGR+GRQ GK+YRFF QLE  
Sbjct  167  YKRTKEGRAGRQDGKSYRFFSQLEAL  192


 Score = 90.5 bits (223),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI++R+ LD ++ + G KGPLWE+ISA M++LGY+R+AKRCKEKWENI
Sbjct  497  RWPKAEVHALIKLRSGLDSRYQEAGPKGPLWEEISAGMQRLGYNRSAKRCKEKWENI  553


 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+RS +D  ++++  KGPLW+E+S  M+  GY RSAK+C+EK+ENI KY
Sbjct  497  RWPKAEVHALIKLRSGLDSRYQEAGPKGPLWEEISAGMQRLGYNRSAKRCKEKWENINKY  556

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  557  FKKVKESNRKRPEDSKTCPYFHQLDAL  583


 Score = 77.8 bits (190),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            RK+  +FE +MK+V+E+QE +Q++FLE +E+ E +RM REEAW++QE+ RL  E E LA+
Sbjct  320  RKMMAFFEGLMKQVMERQESMQQRFLETVEKREQDRMIREEAWRRQEMARLNHEHELLAQ  379

Query  348  eraiaeakdaaviAFLQKISKQPILVPHKPQS  253
            ERA+A ++DAA+I+ +QKIS Q I +P  P +
Sbjct  380  ERAMAASRDAAIISCIQKISGQTIPLPTVPAT  411


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    D   KGPLWED+S  + +LGY R+AK+CKEK+EN+
Sbjct  107  RWPRQETLALLKIRSEMDAAFRDATLKGPLWEDVSRRLAELGYRRSAKKCKEKFENV  163



>ref|XP_007210347.1| hypothetical protein PRUPE_ppa001704mg [Prunus persica]
 gb|EMJ11546.1| hypothetical protein PRUPE_ppa001704mg [Prunus persica]
Length=776

 Score =   146 bits (369),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD++FRD+TLKGPLW++VSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  104  RWPRQETLALLKIRSEMDVSFRDATLKGPLWEDVSRKLAELGYKRSAKKCKEKFENVHKY  163

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTKEGR+GRQ GK+Y+FF +LE  
Sbjct  164  YKRTKEGRAGRQDGKSYKFFSELEAL  189


 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI++R+ L+ ++ + G KGPLWE+ISA M ++GY R++KRCKEKWENI
Sbjct  500  RWPKAEVLALIKLRSGLESRYQEAGPKGPLWEEISAGMGRMGYKRSSKRCKEKWENI  556


 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+K+RS ++  ++++  KGPLW+E+S  M   GY+RS+K+C+EK+ENI KY
Sbjct  500  RWPKAEVLALIKLRSGLESRYQEAGPKGPLWEEISAGMGRMGYKRSSKRCKEKWENINKY  559

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F +L+  
Sbjct  560  FKKVKESNKKRPEDAKTCPYFHELDAL  586


 Score = 77.4 bits (189),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            RK+  +FE +MK+V++KQE +Q++FLE IE+ E +R  REEAWK+QE+ RL RE E +++
Sbjct  314  RKMMEFFEVLMKQVMQKQETMQQRFLEVIEKREQDRTIREEAWKRQEMARLTREHELMSQ  373

Query  348  eraiaeakdaaviAFLQKISKQPILVP  268
            ERAI+ ++DAA+I+FLQKI+ Q I +P
Sbjct  374  ERAISASRDAAIISFLQKITGQTIQLP  400


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D+   D   KGPLWED+S ++ +LGY R+AK+CKEK+EN+
Sbjct  104  RWPRQETLALLKIRSEMDVSFRDATLKGPLWEDVSRKLAELGYKRSAKKCKEKFENV  160



>ref|XP_007152027.1| hypothetical protein PHAVU_004G095400g [Phaseolus vulgaris]
 gb|ESW24021.1| hypothetical protein PHAVU_004G095400g [Phaseolus vulgaris]
Length=656

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+AFRD+++KGPLW+EVSRK+ + GY R+AKKC+EKFEN+YKY
Sbjct  69   RWPRQETLALLKIRSDMDVAFRDASVKGPLWEEVSRKLADLGYHRNAKKCKEKFENVYKY  128

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFD  736
            H+RTKEGRSG+  GK YRFF+QL+  +
Sbjct  129  HKRTKEGRSGKTEGKTYRFFDQLQALE  155


 Score =   144 bits (362),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 102/229 (45%), Positives = 142/229 (62%), Gaps = 59/229 (26%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV+EKQE+LQ++FLEAIE+ E ER+ REE+W+ QE++R+ RE+E LA+ER+IA
Sbjct  304  FFERLMKEVIEKQEELQRRFLEAIEKREQERVTREESWRMQEMQRINREREILAQERSIA  363

Query  333  eakdaaviAFLQKISK--------QPIL---------------VPHK-------------  262
             AKDAAV+AFLQK+++        QP L               VP               
Sbjct  364  AAKDAAVMAFLQKMAEHQQEENNLQPALNTNNNNSITIASQQPVPQATPTPTPQQKQTTT  423

Query  261  -PQSEDVQEFAAQ---------------------TKENGSGDTTIssssssSRWPKPEIE  148
             P++  VQ  A Q                      K + +G+  +   +SSSRWPK E++
Sbjct  424  VPETPPVQSLAPQPQQQQHQVQQQQQLVVTNVEINKADNNGEN-LMMGASSSRWPKMEVQ  482

Query  147  ALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            ALI +RTNL+ ++ +NG KGPLWE+IS+ M+K+GY+RNAKRCKEKWENI
Sbjct  483  ALIDLRTNLETKYQENGPKGPLWEEISSLMRKMGYNRNAKRCKEKWENI  531


 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 60/98 (61%), Gaps = 3/98 (3%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+ +R+ ++  ++++  KGPLW+E+S  M + GY R+AK+C+EK+ENI KY
Sbjct  475  RWPKMEVQALIDLRTNLETKYQENGPKGPLWEEISSLMRKMGYNRNAKRCKEKWENINKY  534

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKIGG  706
             ++ KE    R +  K   +F QLE     +  NK+ G
Sbjct  535  FKKVKESNKKRPEDSKTCPYFHQLEAL--YKEKNKVEG  570


 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLWE++S ++  LGY RNAK+CKEK+EN+
Sbjct  69   RWPRQETLALLKIRSDMDVAFRDASVKGPLWEEVSRKLADLGYHRNAKKCKEKFENV  125



>ref|XP_007019482.1| Duplicated homeodomain-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY16707.1| Duplicated homeodomain-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=637

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD+ FRD+++KGPLW+EVSRK+ E GY RSAKKC+EKFEN+YKY
Sbjct  86   RWPRQETLALLKIRSDMDVTFRDASVKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKY  145

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS  724
            H+RTK+GR+G+  GK YRFF+QLE  + + S
Sbjct  146  HKRTKDGRTGKSDGKAYRFFDQLEALENISS  176


 Score = 99.4 bits (246),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+EALI++RT+LD ++ +NG KGPLWE+ISA MKKLGY+RNAKRCKEKWENI
Sbjct  444  RWPKVEVEALIKLRTSLDAKYQENGPKGPLWEEISAAMKKLGYNRNAKRCKEKWENI  500


 Score = 80.9 bits (198),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+R+ +D  ++++  KGPLW+E+S  M++ GY R+AK+C+EK+ENI KY
Sbjct  444  RWPKVEVEALIKLRTSLDAKYQENGPKGPLWEEISAAMKKLGYNRNAKRCKEKWENINKY  503

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  504  FKKVKESNKKRPEDSKTCPYFHQLDAL  530


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE++MKEV++KQED+QKKFLEAIE+ E+ER+ RE+AW+ QE+ R+ RE+E LA+ER+IA
Sbjct  291  FFERLMKEVIQKQEDMQKKFLEAIEKREHERLVREDAWRMQEMARINREREILAQERSIA  350

Query  333  eakdaaviAFLQKISKQ  283
             AKDAAV+AFLQK+S+Q
Sbjct  351  AAKDAAVMAFLQKLSEQ  367


 Score = 71.2 bits (173),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D+   D   KGPLWE++S ++ +LGY R+AK+CKEK+EN+
Sbjct  86   RWPRQETLALLKIRSDMDVTFRDASVKGPLWEEVSRKLAELGYHRSAKKCKEKFENV  142



>ref|XP_010539731.1| PREDICTED: trihelix transcription factor GT-2 isoform X1 [Tarenaya 
hassleriana]
Length=562

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  ETL+LL+IRSEMD +FR S+LK PLW+++SRKM EFGY+RSAKKC+EKFEN+YKY
Sbjct  42   RWPRPETLSLLRIRSEMDSSFRHSSLKAPLWEQISRKMAEFGYRRSAKKCKEKFENVYKY  101

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQSH  721
            H+RTKE RSG+  GK YRFF++LE F+ ++S+
Sbjct  102  HKRTKENRSGKPEGKTYRFFDELEAFETLRSY  133


 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 124/188 (66%), Gaps = 14/188 (7%)
 Frame = -3

Query  534  RKRKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESL  355
            R++   G F+K+ K+++EKQ+++QK+F E +++ E ER+A+EE W+ QE  R+ RE E L
Sbjct  247  RRKYWKGSFKKLAKDLMEKQDEMQKRFFETLDKREEERLAKEEEWRVQETARINREYEIL  306

Query  354  akeraiaeakdaaviAFLQKISKQPILVPHKPQSEDVQEFAAQTKENGS---------GD  202
              ER+ +  KDAA I+FLQK+S+Q     H+ Q         Q  E G+         GD
Sbjct  307  LHERSSSAVKDAAFISFLQKVSEQ----QHQQQKLPFACLNDQKHEKGTVEDTSKMSNGD  362

Query  201  TTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKG-PLWEDISAEMKKLGYDRNAKR  25
            +    S SSSRWPK EIEALI++R ++   + DNG+KG  LW +ISA M+K+GY+R+AKR
Sbjct  363  SNYKLSQSSSRWPKAEIEALIRLRADIGFNYQDNGTKGRSLWGEISAGMRKIGYNRSAKR  422

Query  24   CKEKWENI  1
            CKEKWENI
Sbjct  423  CKEKWENI  430


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKG-PLWDEVSRKMEEFGYQRSAKKCREKFENIYK  820
            RWP  E   L+++R+++   ++D+  KG  LW E+S  M + GY RSAK+C+EK+ENI K
Sbjct  373  RWPKAEIEALIRLRADIGFNYQDNGTKGRSLWGEISAGMRKIGYNRSAKRCKEKWENINK  432

Query  819  YHRRTKEGRSGRQ-TGKNYRFFEQLEVF  739
            Y ++ +E    R  + K   +F QL+  
Sbjct  433  YFKKVRESSKKRPLSSKTCPYFHQLDAI  460


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+PE  +L++IR+ +D     +  K PLWE IS +M + GY R+AK+CKEK+EN+
Sbjct  42   RWPRPETLSLLRIRSEMDSSFRHSSLKAPLWEQISRKMAEFGYRRSAKKCKEKFENV  98



>ref|XP_009398860.1| PREDICTED: trihelix transcription factor GTL1-like [Musa acuminata 
subsp. malaccensis]
Length=676

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETLTLLKIRSEMD AFRD+TLK PLW+EVSRK+ E GY+R+AKKC+EKFEN+ KY
Sbjct  75   RWPLQETLTLLKIRSEMDAAFRDATLKAPLWEEVSRKLAELGYKRTAKKCKEKFENVNKY  134

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS  724
            ++RTKEGR+GRQ GK YRFF QLE   +  S
Sbjct  135  YKRTKEGRAGRQDGKGYRFFSQLEALRSGSS  165


 Score = 87.8 bits (216),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI++R+ L+ ++ + G KGPLWE+ISA M++LGY R+AKRCKEKWENI
Sbjct  452  RWPKAEVHALIKLRSELESKYQETGPKGPLWEEISAGMQRLGYKRSAKRCKEKWENI  508


 Score = 83.6 bits (205),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+K+RSE++  ++++  KGPLW+E+S  M+  GY+RSAK+C+EK+ENI KY
Sbjct  452  RWPKAEVHALIKLRSELESKYQETGPKGPLWEEISAGMQRLGYKRSAKRCKEKWENINKY  511

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  512  FKKVKESNKKRPEDSKTCSYFHQLDAL  538


 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            RK+  +F ++MK+V+E+QE +Q++FL+A+E+ E +RM R+EAW++QE+ RL REQE L +
Sbjct  283  RKMMPFFHRLMKQVMERQEAMQQRFLDAMEKREQDRMIRDEAWRRQEMTRLNREQELLEQ  342

Query  348  eraiaeakdaaviAFLQKISKQPILVP  268
            E A+A ++D A+I++LQK++ + I +P
Sbjct  343  EWAMASSRDTAIISYLQKLTGRTIPMP  369


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP  E   L++IR+ +D    D   K PLWE++S ++ +LGY R AK+CKEK+EN+
Sbjct  75   RWPLQETLTLLKIRSEMDAAFRDATLKAPLWEEVSRKLAELGYKRTAKKCKEKFENV  131



>ref|XP_008678885.1| PREDICTED: trihelix transcription factor GTL1 [Zea mays]
 ref|XP_008678886.1| PREDICTED: trihelix transcription factor GTL1 [Zea mays]
 ref|XP_008678887.1| PREDICTED: trihelix transcription factor GTL1 [Zea mays]
 gb|AFW63212.1| putative homeodomain-like transcription factor superfamily protein 
isoform 1 [Zea mays]
 gb|AFW63213.1| putative homeodomain-like transcription factor superfamily protein 
isoform 2 [Zea mays]
Length=668

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 124/210 (59%), Gaps = 41/210 (20%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            R++   FE+MMK+  EKQ+ +Q+ FLE +ERCE ER AREEAW++QE+ R+ RE+E LA+
Sbjct  262  REMMATFERMMKQFTEKQDAMQRVFLETLERCEAERTAREEAWRRQEVARMNREREQLAR  321

Query  348  eraiaeakdaaviAFLQKISK---QPI-LVPHK---------------------------  262
            ERA A ++DAA+IAFLQ++     +P  L PH                            
Sbjct  322  ERAAAASRDAALIAFLQRVGGGQGEPARLPPHGAGVVPPPPMPDCAPPSPRRHAAAASLQ  381

Query  261  ---PQSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSK  91
               P      E  A+    G G T        SRWPK E+EALIQ+R     ++HD G+K
Sbjct  382  QLVPVPPKAVEALARAGGEGGGSTP-------SRWPKEEVEALIQMRNEKGEKYHDAGAK  434

Query  90   GPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            GPLWEDI+A M+ +GY R+AKRCKEKWENI
Sbjct  435  GPLWEDIAAAMRGIGYSRSAKRCKEKWENI  464


 Score =   130 bits (326),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EETL L++IR+EMD  FR S LK PLW+ V+RK+   GY RSAKKC+EKFEN+ KY
Sbjct  95   RWPREETLALIRIRTEMDADFRSSPLKAPLWENVARKLAGLGYHRSAKKCKEKFENVDKY  154

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDA  733
            +RRTK+ R+GRQ GK+YRFF QLE   A
Sbjct  155  YRRTKDARAGRQDGKSYRFFSQLEALHA  182


 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP EE   L+++R+E    + D+  KGPLW++++  M   GY RSAK+C+EK+ENI KY
Sbjct  408  RWPKEEVEALIQMRNEKGEKYHDAGAKGPLWEDIAAAMRGIGYSRSAKRCKEKWENINKY  467

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVFDAMQSHNKIGG  706
            +++ KE    R +  K   +F QL+     +  +  GG
Sbjct  468  YKKVKESNKRRPEDSKTCPYFHQLDAMYRNKHRSGTGG  505


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 10/86 (12%)
 Frame = -3

Query  258  QSEDVQEFAAQTKENGSGDTTIssssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLW  79
            Q ED+Q     +    SG+          RWP+ E  ALI+IRT +D     +  K PLW
Sbjct  76   QDEDMQADLGASGAGASGN----------RWPREETLALIRIRTEMDADFRSSPLKAPLW  125

Query  78   EDISAEMKKLGYDRNAKRCKEKWENI  1
            E+++ ++  LGY R+AK+CKEK+EN+
Sbjct  126  ENVARKLAGLGYHRSAKKCKEKFENV  151



>ref|XP_011038059.1| PREDICTED: trihelix transcription factor GTL1-like isoform X4 
[Populus euphratica]
 ref|XP_011038061.1| PREDICTED: trihelix transcription factor GTL1-like isoform X5 
[Populus euphratica]
Length=713

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRSEMD AFRD+TLKGPLW++VSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  29   RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENVHKY  88

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTK+GR+GRQ GK+YRFF QLE  
Sbjct  89   YKRTKDGRAGRQDGKSYRFFSQLEAL  114


 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPKPE+ ALI++R+ L+ ++ + G KGPLWE+ISA M +LGY R++KRCKEKWENI
Sbjct  442  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENI  498


 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+K+RS ++  ++++  KGPLW+E+S  M   GY+RS+K+C+EK+ENI KY
Sbjct  442  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENINKY  501

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F +L+  
Sbjct  502  FKKVKESNKKRPEDAKTCPYFHELDAL  528


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE +MK+V++KQE +Q++FLEAIE+ E +RM R+EAWK+QE+ R  RE E +A+ER+ +
Sbjct  256  FFEGLMKQVMQKQEAMQQRFLEAIEKREQDRMIRDEAWKRQEMARWSREHEIMAEERSTS  315

Query  333  eakdaaviAFLQKISKQPILVP  268
             +++AA++ FLQKI+ Q I +P
Sbjct  316  ASRNAAIVVFLQKITGQTIHLP  337


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+ +D    D   KGPLWED+S ++ ++GY R+AK+CKEK+EN+
Sbjct  29   RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENV  85



>ref|XP_011038057.1| PREDICTED: trihelix transcription factor GTL1-like isoform X2 
[Populus euphratica]
Length=715

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRSEMD AFRD+TLKGPLW++VSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  29   RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENVHKY  88

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTK+GR+GRQ GK+YRFF QLE  
Sbjct  89   YKRTKDGRAGRQDGKSYRFFSQLEAL  114


 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPKPE+ ALI++R+ L+ ++ + G KGPLWE+ISA M +LGY R++KRCKEKWENI
Sbjct  442  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENI  498


 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+K+RS ++  ++++  KGPLW+E+S  M   GY+RS+K+C+EK+ENI KY
Sbjct  442  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENINKY  501

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F +L+  
Sbjct  502  FKKVKESNKKRPEDAKTCPYFHELDAL  528


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE +MK+V++KQE +Q++FLEAIE+ E +RM R+EAWK+QE+ R  RE E +A+ER+ +
Sbjct  256  FFEGLMKQVMQKQEAMQQRFLEAIEKREQDRMIRDEAWKRQEMARWSREHEIMAEERSTS  315

Query  333  eakdaaviAFLQKISKQPILVP  268
             +++AA++ FLQKI+ Q I +P
Sbjct  316  ASRNAAIVVFLQKITGQTIHLP  337


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+ +D    D   KGPLWED+S ++ ++GY R+AK+CKEK+EN+
Sbjct  29   RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENV  85



>ref|XP_011038056.1| PREDICTED: trihelix transcription factor GTL1-like isoform X1 
[Populus euphratica]
Length=716

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRSEMD AFRD+TLKGPLW++VSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  29   RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENVHKY  88

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTK+GR+GRQ GK+YRFF QLE  
Sbjct  89   YKRTKDGRAGRQDGKSYRFFSQLEAL  114


 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPKPE+ ALI++R+ L+ ++ + G KGPLWE+ISA M +LGY R++KRCKEKWENI
Sbjct  442  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENI  498


 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+K+RS ++  ++++  KGPLW+E+S  M   GY+RS+K+C+EK+ENI KY
Sbjct  442  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENINKY  501

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F +L+  
Sbjct  502  FKKVKESNKKRPEDAKTCPYFHELDAL  528


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE +MK+V++KQE +Q++FLEAIE+ E +RM R+EAWK+QE+ R  RE E +A+ER+ +
Sbjct  256  FFEGLMKQVMQKQEAMQQRFLEAIEKREQDRMIRDEAWKRQEMARWSREHEIMAEERSTS  315

Query  333  eakdaaviAFLQKISKQPILVP  268
             +++AA++ FLQKI+ Q I +P
Sbjct  316  ASRNAAIVVFLQKITGQTIHLP  337


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+ +D    D   KGPLWED+S ++ ++GY R+AK+CKEK+EN+
Sbjct  29   RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENV  85



>ref|XP_007039268.1| Duplicated homeodomain-like superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY23769.1| Duplicated homeodomain-like superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=792

 Score =   146 bits (369),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRS+MD AFRD+T+KGPLW++VSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  98   RWPRQETLALLKIRSDMDAAFRDATVKGPLWEDVSRKLAELGYKRSAKKCKEKFENVHKY  157

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVFDAMQS  724
            ++RTKEGR+GRQ GK+Y+FF QLE      S
Sbjct  158  YKRTKEGRAGRQDGKSYKFFSQLEALHTTSS  188


 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPK E+ ALI +R+ L+ ++ + G KGPLWE+ISA M ++GY R+AKRCKEKWENI
Sbjct  531  RWPKAEVLALINLRSGLESRYQEAGPKGPLWEEISAGMSRMGYKRSAKRCKEKWENI  587


 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+ +RS ++  ++++  KGPLW+E+S  M   GY+RSAK+C+EK+ENI KY
Sbjct  531  RWPKAEVLALINLRSGLESRYQEAGPKGPLWEEISAGMSRMGYKRSAKRCKEKWENINKY  590

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F QL+  
Sbjct  591  FKKVKESNKKRPEDAKTCPYFHQLDAL  617


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -3

Query  528  RKLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLak  349
            R++  +FE +MK+V++KQE +Q++FLEAIE+ E +RM REEAWK+QE+ RL R+ E +A 
Sbjct  327  RRMMEFFEGLMKQVMQKQESMQQRFLEAIEKREQDRMIREEAWKRQEMARLTRDHELMAH  386

Query  348  eraiaeakdaaviAFLQKISKQPILVP  268
            ERAIA ++DAA+I+FLQKI+ Q + +P
Sbjct  387  ERAIAASRDAAIISFLQKITGQTVQLP  413


 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+++D    D   KGPLWED+S ++ +LGY R+AK+CKEK+EN+
Sbjct  98   RWPRQETLALLKIRSDMDAAFRDATVKGPLWEDVSRKLAELGYKRSAKKCKEKFENV  154



>ref|XP_011038058.1| PREDICTED: trihelix transcription factor GTL1-like isoform X3 
[Populus euphratica]
Length=715

 Score =   145 bits (367),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRSEMD AFRD+TLKGPLW++VSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  29   RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENVHKY  88

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTK+GR+GRQ GK+YRFF QLE  
Sbjct  89   YKRTKDGRAGRQDGKSYRFFSQLEAL  114


 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPKPE+ ALI++R+ L+ ++ + G KGPLWE+ISA M +LGY R++KRCKEKWENI
Sbjct  442  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENI  498


 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+K+RS ++  ++++  KGPLW+E+S  M   GY+RS+K+C+EK+ENI KY
Sbjct  442  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENINKY  501

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F +L+  
Sbjct  502  FKKVKESNKKRPEDAKTCPYFHELDAL  528


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE +MK+V++KQE +Q++FLEAIE+ E +RM R+EAWK+QE+ R  RE E +A+ER+ +
Sbjct  256  FFEGLMKQVMQKQEAMQQRFLEAIEKREQDRMIRDEAWKRQEMARWSREHEIMAEERSTS  315

Query  333  eakdaaviAFLQKISKQPILVP  268
             +++AA++ FLQKI+ Q I +P
Sbjct  316  ASRNAAIVVFLQKITGQTIHLP  337


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+ +D    D   KGPLWED+S ++ ++GY R+AK+CKEK+EN+
Sbjct  29   RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENV  85



>ref|XP_011038063.1| PREDICTED: trihelix transcription factor GTL1-like isoform X7 
[Populus euphratica]
Length=785

 Score =   146 bits (368),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LL+IRSEMD AFRD+TLKGPLW++VSRK+ E GY+RSAKKC+EKFEN++KY
Sbjct  98   RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENVHKY  157

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTK+GR+GRQ GK+YRFF QLE  
Sbjct  158  YKRTKDGRAGRQDGKSYRFFSQLEAL  183


 Score = 88.2 bits (217),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWPKPE+ ALI++R+ L+ ++ + G KGPLWE+ISA M +LGY R++KRCKEKWENI
Sbjct  511  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENI  567


 Score = 80.5 bits (197),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E L L+K+RS ++  ++++  KGPLW+E+S  M   GY+RS+K+C+EK+ENI KY
Sbjct  511  RWPKPEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMLRLGYKRSSKRCKEKWENINKY  570

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   +F +L+  
Sbjct  571  FKKVKESNKKRPEDAKTCPYFHELDAL  597


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -3

Query  513  YFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLakeraia  334
            +FE +MK+V++KQE +Q++FLEAIE+ E +RM R+EAWK+QE+ R  RE E +A+ER+ +
Sbjct  325  FFEGLMKQVMQKQEAMQQRFLEAIEKREQDRMIRDEAWKRQEMARWSREHEIMAEERSTS  384

Query  333  eakdaaviAFLQKISKQPILVP  268
             +++AA++ FLQKI+ Q I +P
Sbjct  385  ASRNAAIVVFLQKITGQTIHLP  406


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL+QIR+ +D    D   KGPLWED+S ++ ++GY R+AK+CKEK+EN+
Sbjct  98   RWPRQETLALLQIRSEMDAAFRDATLKGPLWEDVSRKLAEMGYKRSAKKCKEKFENV  154



>ref|XP_004986012.1| PREDICTED: trihelix transcription factor GTL1-like isoform X1 
[Setaria italica]
Length=753

 Score =   145 bits (367),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 137/242 (57%), Gaps = 74/242 (31%)
 Frame = -3

Query  525  KLAGYFEKMMKEVLEKQEDLQKKFLEAIERCENERMAREEAWKKQEIERLKREQESLake  346
            K+  +FE +M++V+E+QE++Q++F+EAIER E +RM REEAW++QE+ RL REQ++LA+E
Sbjct  282  KMMRFFEGLMRQVMERQEEMQQRFIEAIERREQDRMIREEAWRRQEVARLAREQDALAQE  341

Query  345  raiaeakdaaviAFLQKISKQ---------PILV--------------------------  271
            RA+A ++DAAV++F+Q+++ Q         P+ +                          
Sbjct  342  RAMAASRDAAVVSFIQRVTGQTIPMPSVAPPVFISALTPPPLQPTPVASAAPAAAPAQHQ  401

Query  270  -------------PHKPQSEDVQEFAAQ-------------------TKENGSGDTTIss  187
                         PH PQ    Q   AQ                   T  +G G  +   
Sbjct  402  QPPSIHLSPKPGKPH-PQPHQTQPPLAQLQMSSKEMIVRAPPAESQETPGSGGGAPS---  457

Query  186  ssssSRWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWE  7
                SRWPK E+ ALIQ+RT L+ ++ D+G KGPLWEDISA M++LGY+R+AKRCKEKWE
Sbjct  458  ---PSRWPKAEVHALIQLRTELEARYQDSGPKGPLWEDISAGMRRLGYNRSAKRCKEKWE  514

Query  6    NI  1
            NI
Sbjct  515  NI  516


 Score =   138 bits (348),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP +ETL LLKIRSEMD AFR++ LKGPLW++VSRK+E  GY+RSAKKCREKFEN+ KY
Sbjct  76   RWPRQETLALLKIRSEMDAAFREAALKGPLWEQVSRKLEAMGYKRSAKKCREKFENVDKY  135

Query  816  HRRTKEGRSGRQTGKNYRFFEQLEVF  739
            ++RTK+GR+GR  GK YRFF +LE  
Sbjct  136  YKRTKDGRAGRGDGKAYRFFSELEAL  161


 Score = 82.4 bits (202),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  996  RWPHEETLTLLKIRSEMDLAFRDSTLKGPLWDEVSRKMEEFGYQRSAKKCREKFENIYKY  817
            RWP  E   L+++R+E++  ++DS  KGPLW+++S  M   GY RSAK+C+EK+ENI KY
Sbjct  460  RWPKAEVHALIQLRTELEARYQDSGPKGPLWEDISAGMRRLGYNRSAKRCKEKWENINKY  519

Query  816  HRRTKEGRSGR-QTGKNYRFFEQLEVF  739
             ++ KE    R +  K   ++ QLE  
Sbjct  520  FKKVKESNKKRPEDSKTCPYYHQLEAL  546


 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  RWPKPEIEALIQIRTNLDLQHHDNGSKGPLWEDISAEMKKLGYDRNAKRCKEKWENI  1
            RWP+ E  AL++IR+ +D    +   KGPLWE +S +++ +GY R+AK+C+EK+EN+
Sbjct  76   RWPRQETLALLKIRSEMDAAFREAALKGPLWEQVSRKLEAMGYKRSAKKCREKFENV  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3619834308852