BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25356_g1_i2 len=1536 path=[7958:0-150 8109:151-960 8919:961-988
13942:989-994 8953:995-1033 14696:1034-1052 9011:1053-1109
10156:1110-1112 9071:1113-1535]

Length=1536
                                                                      Score     E

ref|XP_011073382.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    180   5e-46   
emb|CDP16968.1|  unnamed protein product                                177   7e-45   
ref|XP_010532119.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    176   9e-45   
ref|XP_004241688.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    173   1e-43   
ref|XP_010097178.1|  DEAD-box ATP-dependent RNA helicase 35             173   2e-43   
gb|EPS62594.1|  hypothetical protein M569_12195                         172   2e-43   
ref|XP_002271334.2|  PREDICTED: DEAD-box ATP-dependent RNA helica...    172   2e-43   Vitis vinifera
ref|XP_007010761.1|  DEAD-box ATP-dependent RNA helicase 35 isofo...    171   9e-43   
ref|XP_006356229.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    171   1e-42   
ref|XP_009779388.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    170   1e-42   
ref|XP_010244907.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    170   2e-42   
ref|XP_009334632.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    170   2e-42   
ref|XP_006302054.1|  hypothetical protein CARUB_v10020038mg             169   2e-42   
gb|KHG11820.1|  DEAD-box ATP-dependent RNA helicase 35 -like protein    169   3e-42   
ref|XP_006389799.1|  hypothetical protein EUTSA_v10018325mg             169   3e-42   
ref|XP_004135864.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    169   4e-42   
ref|XP_004163548.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    169   4e-42   
ref|XP_008461142.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    169   4e-42   
ref|XP_008380986.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    169   4e-42   
gb|KDP37042.1|  hypothetical protein JCGZ_06098                         168   5e-42   
gb|KFK42468.1|  hypothetical protein AALP_AA2G261000                    168   5e-42   
gb|KGN45245.1|  hypothetical protein Csa_7G432260                       169   5e-42   
ref|XP_009338507.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    168   7e-42   
ref|XP_008372708.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    168   8e-42   
ref|XP_009336329.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    168   8e-42   
ref|XP_002888412.1|  hypothetical protein ARALYDRAFT_315588             167   1e-41   
ref|XP_004235903.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    167   2e-41   
ref|NP_199941.1|  putative DEAD-box ATP-dependent RNA helicase 35       167   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006385035.1|  DEAD-box protein abstrakt                          164   1e-40   
ref|XP_006858127.1|  hypothetical protein AMTR_s00062p00113470          164   2e-40   
gb|EYU21852.1|  hypothetical protein MIMGU_mgv1a003346mg                164   2e-40   
ref|XP_006492096.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    163   2e-40   
ref|XP_006427449.1|  hypothetical protein CICLE_v10025231mg             163   2e-40   
ref|XP_009623241.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    163   3e-40   
ref|XP_011028347.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    162   4e-40   
ref|XP_004303276.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    160   4e-39   
ref|XP_006341396.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    159   5e-39   
ref|XP_003591973.1|  DEAD-box ATP-dependent RNA helicase                159   5e-39   
gb|AFK34615.1|  unknown                                                 159   6e-39   
ref|XP_004496330.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    159   6e-39   
ref|XP_010033981.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    159   7e-39   
dbj|BAE71218.1|  putative DEAD-box protein abstrakt                     158   1e-38   Trifolium pratense [peavine clover]
emb|CDP17841.1|  unnamed protein product                                158   2e-38   
ref|XP_008228671.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    158   2e-38   
ref|XP_007215023.1|  hypothetical protein PRUPE_ppa003295mg             157   2e-38   
ref|XP_010429950.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    157   4e-38   
ref|XP_010417703.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    157   4e-38   
ref|XP_003521701.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    156   5e-38   
ref|XP_003553901.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    156   5e-38   
ref|XP_010472922.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    155   9e-38   
ref|XP_007147038.1|  hypothetical protein PHAVU_006G090900g             154   2e-37   
ref|XP_009389399.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    154   5e-37   
ref|XP_009106742.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    152   1e-36   
gb|KEH40292.1|  DEAD-box ATP-dependent RNA helicase                     152   1e-36   
ref|XP_009402714.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    152   1e-36   
ref|XP_009128421.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    151   3e-36   
ref|XP_009149901.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    149   1e-35   
ref|XP_002517695.1|  dead box ATP-dependent RNA helicase, putative      146   1e-34   Ricinus communis
ref|XP_002864104.1|  hypothetical protein ARALYDRAFT_918160             145   4e-34   
ref|XP_010924578.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    145   4e-34   
ref|XP_010693841.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    143   2e-33   
ref|XP_008793065.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    143   2e-33   
ref|XP_010920596.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    139   7e-32   
ref|XP_008813202.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    137   4e-31   
ref|XP_008231893.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   1e-30   
ref|XP_006281491.1|  hypothetical protein CARUB_v10027584mg             134   2e-30   
ref|XP_002991105.1|  hypothetical protein SELMODRAFT_132834             134   3e-30   
emb|CDX79384.1|  BnaC06g19190D                                          131   3e-30   
ref|XP_002991649.1|  hypothetical protein SELMODRAFT_236355             133   3e-30   
ref|XP_009104465.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   3e-29   
ref|XP_001777066.1|  predicted protein                                  123   1e-26   
gb|EEC72494.1|  hypothetical protein OsI_05864                          120   6e-26   Oryza sativa Indica Group [Indian rice]
sp|Q0E3X4.2|RH35A_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA...    120   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003570939.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    119   2e-25   
ref|XP_006646888.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    118   5e-25   
ref|XP_010442969.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    116   2e-24   
ref|XP_008373987.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    116   2e-24   
ref|XP_006382733.1|  hypothetical protein POPTR_0005s04880g             114   6e-24   
gb|KCW79127.1|  hypothetical protein EUGRSUZ_C00570                     110   2e-23   
gb|ACG29152.1|  ATP-dependent RNA helicase DDX41                        113   2e-23   Zea mays [maize]
gb|ACR35233.1|  unknown                                                 113   3e-23   Zea mays [maize]
ref|NP_001147853.1|  ATP-dependent RNA helicase DDX41                   113   3e-23   Zea mays [maize]
ref|XP_004294217.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   3e-23   
ref|XP_010094212.1|  hypothetical protein L484_016755                   103   4e-23   
ref|XP_002465295.1|  hypothetical protein SORBIDRAFT_01g035760          109   4e-22   Sorghum bicolor [broomcorn]
sp|Q5Z6G5.1|RH35B_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA...    109   4e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02224.1|  hypothetical protein OsI_24319                          108   2e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_008373988.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    106   4e-21   
ref|XP_004951889.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    102   8e-20   
ref|XP_010039676.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  94.7    7e-19   
emb|CDY38671.1|  BnaC02g23080D                                        94.0    5e-17   
emb|CDY39973.1|  BnaC06g40510D                                        92.4    1e-16   
emb|CDY61276.1|  BnaA06g38640D                                        92.0    2e-16   
emb|CDX87315.1|  BnaA07g35580D                                        89.0    2e-15   
gb|EAZ21753.1|  hypothetical protein OsJ_05388                        83.2    2e-13   Oryza sativa Japonica Group [Japonica rice]
emb|CDX67949.1|  BnaA07g19890D                                        83.2    2e-13   
gb|KCW54172.1|  hypothetical protein EUGRSUZ_I00150                   76.6    2e-12   
emb|CDY21912.1|  BnaC09g00180D                                        76.3    1e-11   
ref|XP_010442977.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.0    1e-11   
ref|XP_009796211.1|  PREDICTED: prostatic spermine-binding protei...  72.4    3e-11   
ref|XP_009595108.1|  PREDICTED: nucleolin-like                        72.0    4e-11   
ref|XP_008373989.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  73.9    1e-10   
ref|XP_002966549.1|  hypothetical protein SELMODRAFT_230807           72.4    4e-10   
ref|XP_006350114.1|  PREDICTED: nucleolin-like isoform X1             67.4    2e-09   
ref|XP_004251738.1|  PREDICTED: phosphopantothenoylcysteine decar...  67.0    2e-09   
gb|EMT08209.1|  DEAD-box ATP-dependent RNA helicase 35A               68.9    5e-09   
ref|NP_195063.1|  putative DEAD-box ATP-dependent RNA helicase 43     67.8    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002982390.1|  hypothetical protein SELMODRAFT_116186           66.2    3e-08   
ref|XP_002404560.1|  DEAD box protein abstrakt, putative              61.6    1e-06   Ixodes scapularis [blacklegged tick]
ref|XP_002956712.1|  hypothetical protein VOLCADRAFT_77220            60.5    3e-06   
ref|XP_002528806.1|  dead box ATP-dependent RNA helicase, putative    60.1    3e-06   Ricinus communis
ref|XP_006816434.1|  PREDICTED: probable ATP-dependent RNA helica...  60.1    3e-06   
ref|XP_010091276.1|  DEAD-box ATP-dependent RNA helicase 35           57.0    3e-06   
ref|XP_010656525.1|  PREDICTED: prostatic spermine-binding protein    57.0    4e-06   
ref|XP_003384704.1|  PREDICTED: probable ATP-dependent RNA helica...  59.7    5e-06   
ref|XP_005651280.1|  P-loop containing nucleoside triphosphate hy...  59.3    5e-06   
ref|NP_001071981.1|  zinc finger protein                              58.5    9e-06   Ciona intestinalis [sea vase]
ref|XP_001865238.1|  ATP-dependent RNA helicase abstrakt              58.5    1e-05   Culex quinquefasciatus
gb|ESA13146.1|  hypothetical protein GLOINDRAFT_179791                55.8    1e-05   
ref|XP_004242730.1|  PREDICTED: nucleolin                             55.8    1e-05   
gb|EFA10652.1|  hypothetical protein TcasGA2_TC016289                 58.2    1e-05   
ref|XP_003739731.1|  PREDICTED: ATP-dependent RNA helicase abstra...  58.2    1e-05   
ref|XP_008199686.1|  PREDICTED: ATP-dependent RNA helicase abstrakt   58.2    1e-05   
ref|XP_005190431.1|  PREDICTED: ATP-dependent RNA helicase abstra...  58.2    1e-05   
ref|XP_001661885.1|  DEAD box ATP-dependent RNA helicase              57.8    2e-05   Aedes aegypti
ref|XP_002505158.1|  DEAD/DEAH box helicase                           57.8    2e-05   Micromonas commoda
gb|AAF04040.1|AF187729_1  DEAD-box protein abstrakt                   57.4    2e-05   Drosophila melanogaster
gb|KFM69924.1|  ATP-dependent RNA helicase abstrakt                   57.4    2e-05   
ref|NP_524220.1|  abstrakt                                            57.4    2e-05   Drosophila melanogaster
gb|EKC40522.1|  Putative ATP-dependent RNA helicase DDX41             57.4    3e-05   
gb|KFM26973.1|  DEAD-box ATP-dependent RNA helicase 35                57.0    3e-05   
ref|XP_005850584.1|  hypothetical protein CHLNCDRAFT_140503           56.2    4e-05   
ref|XP_005090184.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    7e-05   
dbj|GAA49588.1|  ATP-dependent RNA helicase DDX41                     56.2    7e-05   
gb|ELU01455.1|  hypothetical protein CAPTEDRAFT_148841                55.8    7e-05   
ref|XP_005971040.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    7e-05   
ref|XP_004008770.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    7e-05   
gb|ETN60487.1|  ATP-dependent RNA helicase abstrakt                   55.1    7e-05   
ref|XP_008211712.1|  PREDICTED: ATP-dependent RNA helicase abstrakt   55.5    9e-05   
ref|XP_003696110.1|  PREDICTED: ATP-dependent RNA helicase abstra...  55.1    1e-04   
ref|XP_006617068.1|  PREDICTED: ATP-dependent RNA helicase abstra...  55.1    1e-04   
ref|XP_002117779.1|  hypothetical protein TRIADDRAFT_51106            55.1    1e-04   Trichoplax adhaerens
ref|XP_009760721.1|  PREDICTED: nucleolin-like                        52.4    1e-04   
ref|XP_004533592.1|  PREDICTED: ATP-dependent RNA helicase abstra...  55.1    1e-04   
ref|XP_318117.4|  AGAP004711-PA                                       54.7    1e-04   Anopheles gambiae str. PEST
gb|KFB44006.1|  DEAD box ATP-dependent RNA helicase                   54.7    2e-04   
ref|XP_003704771.1|  PREDICTED: ATP-dependent RNA helicase abstra...  54.3    2e-04   
ref|XP_008554237.1|  PREDICTED: ATP-dependent RNA helicase abstrakt   54.3    2e-04   
ref|XP_001359629.1|  GA13135                                          54.3    2e-04   
ref|XP_003401085.1|  PREDICTED: ATP-dependent RNA helicase abstra...  54.3    2e-04   
ref|XP_002160326.1|  PREDICTED: ATP-dependent RNA helicase abstrakt   54.3    2e-04   
ref|XP_003490595.1|  PREDICTED: ATP-dependent RNA helicase abstra...  54.3    2e-04   
gb|KDR18857.1|  ATP-dependent RNA helicase abstrakt                   53.9    2e-04   
ref|XP_009630528.1|  PREDICTED: glutamic acid-rich protein-like       51.6    3e-04   
ref|XP_006563505.1|  PREDICTED: ATP-dependent RNA helicase abstrakt   53.9    3e-04   
ref|XP_001700112.1|  predicted protein                                53.5    4e-04   Chlamydomonas reinhardtii
ref|XP_004998067.1|  DEAD box polypeptide 41                          53.1    4e-04   
emb|CDI55090.1|  probable DEAD-box ATP-dependent RNA helicase 35      53.1    5e-04   
gb|EFZ11376.1|  hypothetical protein SINV_10914                       53.1    5e-04   
gb|ERL84963.1|  hypothetical protein D910_02386                       53.1    5e-04   
gb|ENN75170.1|  hypothetical protein YQE_08283                        53.1    5e-04   
ref|NP_491962.1|  Protein SACY-1                                      53.1    5e-04   Caenorhabditis elegans [roundworm]
ref|XP_009163941.1|  hypothetical protein T265_12816                  52.8    6e-04   
emb|CCF48697.1|  probable DEAD-box ATP-dependent RNA helicase 35      52.8    6e-04   
ref|XP_001952119.1|  PREDICTED: ATP-dependent RNA helicase abstrakt   52.8    6e-04   Acyrthosiphon pisum
gb|EFN64767.1|  ATP-dependent RNA helicase abstrakt                   52.8    6e-04   
ref|XP_001748669.1|  hypothetical protein                             52.8    7e-04   Monosiga brevicollis MX1
ref|XP_005992418.1|  PREDICTED: probable ATP-dependent RNA helica...  52.8    7e-04   
gb|EHJ74551.1|  putative ATP-dependent RNA helicase abstrakt          52.4    8e-04   
ref|XP_009058354.1|  hypothetical protein LOTGIDRAFT_163615           52.4    8e-04   
ref|XP_003060455.1|  DEAD/DEAH box helicase                           52.4    8e-04   
ref|XP_796437.3|  PREDICTED: probable ATP-dependent RNA helicase ...  52.4    9e-04   Strongylocentrotus purpuratus [purple urchin]
gb|EFN82776.1|  ATP-dependent RNA helicase abstrakt                   52.4    0.001   



>ref|XP_011073382.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Sesamum indicum]
Length=590

 Score =   180 bits (456),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRALEAQKILQRKGKS+AL+EE EK K VEAKPSLLVKA+QLKKE PE+++TEQ++
Sbjct  15    PVAKRRALEAQKILQRKGKSSALDEEIEKQKLVEAKPSLLVKASQLKKEQPEITQTEQII  74

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             +QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL+IR+  K
Sbjct  75    MQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLSIRRMSK  121



>emb|CDP16968.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   177 bits (448),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 98/108 (91%), Gaps = 1/108 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALE-EEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRALEAQKILQRKGKS+ LE EEAEK+K VEAKPSLLVKA+QLKKE PE+S TEQM
Sbjct  14    PVAKRRALEAQKILQRKGKSSTLEAEEAEKLKLVEAKPSLLVKASQLKKEQPEISPTEQM  73

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             V QEKEMIEHLSDRKTLMSVRELAKGITYTEP+ TGWKPPL IR+  K
Sbjct  74    VQQEKEMIEHLSDRKTLMSVRELAKGITYTEPLFTGWKPPLNIRRLSK  121



>ref|XP_010532119.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Tarenaya hassleriana]
 ref|XP_010532120.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Tarenaya hassleriana]
 ref|XP_010532121.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Tarenaya hassleriana]
 ref|XP_010532122.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Tarenaya hassleriana]
Length=587

 Score =   176 bits (447),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKILQRKGK +ALEEEAEK K  EAKPSLLVKA+QLK+++PEVS TEQ+V
Sbjct  12    PVAKRRAMEAQKILQRKGKVSALEEEAEKAKLAEAKPSLLVKASQLKRDIPEVSPTEQIV  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL IR+
Sbjct  72    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLHIRR  115



>ref|XP_004241688.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Solanum 
lycopersicum]
Length=595

 Score =   173 bits (438),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  1328  MAANINMEIeedddyveyVPVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLV  1149
             MA ++NMEIEE+DDYVEYVPVAKRRA+EAQKILQRKGKS A EEE EKIK VEAKPSLLV
Sbjct  1     MADHLNMEIEEEDDYVEYVPVAKRRAIEAQKILQRKGKSEAFEEEEEKIKLVEAKPSLLV  60

Query  1148  KATQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLA  969
             KA+QLKKE PE+S  EQ+  QEKEMIEHLSD+KTLMSVRELAKGITYTEP+ TGWKPPLA
Sbjct  61    KASQLKKEQPEISHAEQVFQQEKEMIEHLSDKKTLMSVRELAKGITYTEPLRTGWKPPLA  120

Query  968   IRKYDK  951
             IR+  K
Sbjct  121   IRRNSK  126



>ref|XP_010097178.1| DEAD-box ATP-dependent RNA helicase 35 [Morus notabilis]
 gb|EXB67245.1| DEAD-box ATP-dependent RNA helicase 35 [Morus notabilis]
Length=587

 Score =   173 bits (438),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 99/115 (86%), Gaps = 4/115 (3%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKILQRKGKS+ALEEE EK KQ EAKPSLLVKA+QLK+E PE+S TE +V
Sbjct  12    PVAKRRAMEAQKILQRKGKSSALEEELEKSKQAEAKPSLLVKASQLKREAPEISPTELIV  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQCN  927
              QEKEMIEHLSDRKTLMSVRELAKGITYT+P+ TGWKPPL IR+  K     QC+
Sbjct  72    QQEKEMIEHLSDRKTLMSVRELAKGITYTDPLPTGWKPPLPIRRMSKK----QCD  122



>gb|EPS62594.1| hypothetical protein M569_12195, partial [Genlisea aurea]
Length=591

 Score =   172 bits (437),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRALEAQKILQRKGKS+ L+E+ +K K VE KPSLLVKATQLKKE PE++ETEQ+V
Sbjct  16    PVAKRRALEAQKILQRKGKSSGLDEDFDKQKPVETKPSLLVKATQLKKEQPEITETEQIV  75

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
              QEKEMIEHLSDRKTLMSVRELAKGITY+EP+ TGWKPPL IRK  K
Sbjct  76    QQEKEMIEHLSDRKTLMSVRELAKGITYSEPLPTGWKPPLHIRKMSK  122



>ref|XP_002271334.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Vitis vinifera]
 emb|CAN78736.1| hypothetical protein VITISV_003102 [Vitis vinifera]
 emb|CBI36411.3| unnamed protein product [Vitis vinifera]
Length=587

 Score =   172 bits (436),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PV KRRA+EAQ+ILQRKGKS+ALE+EAEK K  EAKPSLLVKA+QLK++LPE+S  EQ+V
Sbjct  12    PVKKRRAMEAQRILQRKGKSSALEDEAEKSKLAEAKPSLLVKASQLKRDLPEISPAEQIV  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL IR+
Sbjct  72    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLPIRR  115



>ref|XP_007010761.1| DEAD-box ATP-dependent RNA helicase 35 isoform 1 [Theobroma cacao]
 ref|XP_007010762.1| DEAD-box ATP-dependent RNA helicase 35 isoform 1 [Theobroma cacao]
 gb|EOY19571.1| DEAD-box ATP-dependent RNA helicase 35 isoform 1 [Theobroma cacao]
 gb|EOY19572.1| DEAD-box ATP-dependent RNA helicase 35 isoform 1 [Theobroma cacao]
Length=653

 Score =   171 bits (433),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKILQRKGKS+ALE+E EK    E KPSLLVKATQLKK+ PE+S+ EQ+V
Sbjct  12    PVAKRRAMEAQKILQRKGKSSALEDENEKSNLAEVKPSLLVKATQLKKDQPEISQMEQIV  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL IR+  K
Sbjct  72    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLHIRRMSK  118



>ref|XP_006356229.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Solanum 
tuberosum]
Length=595

 Score =   171 bits (432),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  1328  MAANINMEIeedddyveyVPVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLV  1149
             MA ++NMEIEE+DDYVEYVPV KRRA+EAQKILQRKGKS A EEE EKIK VE KPSLLV
Sbjct  1     MADHLNMEIEEEDDYVEYVPVTKRRAIEAQKILQRKGKSEAFEEEEEKIKLVEVKPSLLV  60

Query  1148  KATQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLA  969
             KA+QLKKE PE+S  EQ+  QEKEMIEHLSD+KTLMSVRELAKGITYTEP+ TGWKPPLA
Sbjct  61    KASQLKKEQPEISHAEQVFQQEKEMIEHLSDKKTLMSVRELAKGITYTEPLCTGWKPPLA  120

Query  968   IRKYDK  951
             IR+  K
Sbjct  121   IRRNSK  126



>ref|XP_009779388.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Nicotiana 
sylvestris]
Length=595

 Score =   170 bits (431),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  1328  MAANINMEIeedddyveyVPVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLV  1149
             MA ++NME+EE+DDYVEY+PVAKRRA+EAQKILQRKGKS A EEE EK+K VEAKPSLLV
Sbjct  1     MADHLNMEMEEEDDYVEYIPVAKRRAIEAQKILQRKGKSEAFEEEEEKMKLVEAKPSLLV  60

Query  1148  KATQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLA  969
             KA+QLKKE PE+S  EQ+  QEKEMIEHLSD+KTLMSVRELAKGITYTEP+ TGWKPPLA
Sbjct  61    KASQLKKEQPEISHAEQVFQQEKEMIEHLSDKKTLMSVRELAKGITYTEPLRTGWKPPLA  120

Query  968   IRKYDK  951
             IR+  K
Sbjct  121   IRRNSK  126



>ref|XP_010244907.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Nelumbo nucifera]
Length=593

 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PV KRR +EAQKILQRKGKS+ALE+E E+ K  EAKPSLLVKA+QLK++LPE+S TEQ+V
Sbjct  18    PVKKRRLMEAQKILQRKGKSSALEDETERAKLAEAKPSLLVKASQLKRDLPEISPTEQLV  77

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP++TGWKPPL IR+
Sbjct  78    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLVTGWKPPLHIRR  121



>ref|XP_009334632.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Pyrus x bretschneideri]
 ref|XP_009334633.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Pyrus x bretschneideri]
 ref|XP_009334634.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Pyrus x bretschneideri]
Length=587

 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 4/115 (3%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKILQRKGKS+ LEEE EK K  EAKPSLLVKA+QLK++ PE++ TE+++
Sbjct  12    PVAKRRAMEAQKILQRKGKSSGLEEELEKSKLAEAKPSLLVKASQLKRDAPEITPTEEIL  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQCN  927
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL IR+     S  QC+
Sbjct  72    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLNIRRM----SSQQCD  122



>ref|XP_006302054.1| hypothetical protein CARUB_v10020038mg [Capsella rubella]
 gb|EOA34952.1| hypothetical protein CARUB_v10020038mg [Capsella rubella]
Length=587

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+E QKILQRKGK++ LEEEA+K K  EAKPSLLV+ATQLK+++PEVS TEQ++
Sbjct  12    PVAKRRAMEEQKILQRKGKASELEEEADKEKLAEAKPSLLVQATQLKRDVPEVSATEQII  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             LQEKEM+EHLSD+KTLMSVRELAKGITYT+P+LTGWKPPL IR+
Sbjct  72    LQEKEMMEHLSDKKTLMSVRELAKGITYTDPLLTGWKPPLHIRR  115



>gb|KHG11820.1| DEAD-box ATP-dependent RNA helicase 35 -like protein [Gossypium 
arboreum]
Length=587

 Score =   169 bits (428),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKILQRKGK++AL++E EK    E KPSLL+KATQLKK+ PE+S+ EQ+V
Sbjct  12    PVAKRRAMEAQKILQRKGKASALDDETEKANVAEVKPSLLIKATQLKKDQPEISQMEQIV  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL IR+
Sbjct  72    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLHIRR  115



>ref|XP_006389799.1| hypothetical protein EUTSA_v10018325mg [Eutrema salsugineum]
 gb|ESQ27085.1| hypothetical protein EUTSA_v10018325mg [Eutrema salsugineum]
Length=587

 Score =   169 bits (428),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+E QKILQRKGK   LEEEA+K K  EAKPSLLV+ATQLK+++PEVS TEQ++
Sbjct  12    PVAKRRAMEEQKILQRKGKVPELEEEADKDKLAEAKPSLLVQATQLKRDVPEVSATEQII  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             LQEKEM+EHLSD+KTLMSVRELAKGITYTEP+LTGWKPPL IR+
Sbjct  72    LQEKEMMEHLSDKKTLMSVRELAKGITYTEPLLTGWKPPLNIRR  115



>ref|XP_004135864.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Cucumis 
sativus]
Length=597

 Score =   169 bits (427),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKIL RKGK++ALEEE EK +  EAKPSLLVKA+Q+K++ PEVS TEQ+V
Sbjct  22    PVAKRRAMEAQKILMRKGKASALEEELEKSRLAEAKPSLLVKASQMKRDQPEVSPTEQIV  81

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL IR+  K
Sbjct  82    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLPIRRMPK  128



>ref|XP_004163548.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Cucumis 
sativus]
Length=597

 Score =   169 bits (427),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKIL RKGK++ALEEE EK +  EAKPSLLVKA+Q+K++ PEVS TEQ+V
Sbjct  22    PVAKRRAMEAQKILMRKGKASALEEELEKSRLAEAKPSLLVKASQMKRDQPEVSPTEQIV  81

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL IR+  K
Sbjct  82    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLPIRRMPK  128



>ref|XP_008461142.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Cucumis melo]
 ref|XP_008461143.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Cucumis melo]
Length=597

 Score =   169 bits (427),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKIL RKGK++ALEEE EK +  EAKPSLLVKA+Q+K++ PEVS TEQ+V
Sbjct  22    PVAKRRAMEAQKILMRKGKASALEEELEKSRLAEAKPSLLVKASQMKRDQPEVSPTEQIV  81

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL IR+  K
Sbjct  82    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLPIRRMPK  128



>ref|XP_008380986.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Malus domestica]
 ref|XP_008380987.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Malus domestica]
Length=587

 Score =   169 bits (427),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 4/115 (3%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKILQRKGKS+ L+EE EK K  EAKPSLLVKA+QLK++ PE++ TE+++
Sbjct  12    PVAKRRAMEAQKILQRKGKSSGLDEELEKSKLAEAKPSLLVKASQLKRDAPEITPTEEIL  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQCN  927
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL IR+     S  QC+
Sbjct  72    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLNIRQM----SSQQCD  122



>gb|KDP37042.1| hypothetical protein JCGZ_06098 [Jatropha curcas]
Length=587

 Score =   168 bits (426),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 100/115 (87%), Gaps = 5/115 (4%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKILQRKGKSA LE++ EK K  EAKPSLLVKA+QLK++ PE+S+TEQ+V
Sbjct  13    PVAKRRAIEAQKILQRKGKSA-LEDDFEKSKLAEAKPSLLVKASQLKRDQPEISQTEQIV  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQCN  927
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL IR+  +     QC+
Sbjct  72    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLQIRRMSRK----QCD  122



>gb|KFK42468.1| hypothetical protein AALP_AA2G261000 [Arabis alpina]
Length=588

 Score =   168 bits (426),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 1/105 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSA-ALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRA+EAQKILQRKGK+  +LEEEA K    EAKPSLLV+ATQLKK++PEVS T+Q+
Sbjct  12    PVAKRRAMEAQKILQRKGKATESLEEEATKENLAEAKPSLLVQATQLKKDIPEVSATDQI  71

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             +LQEKEM+EHLSD+KTLMSVRELAKGITYTEPMLTGWKPPL IRK
Sbjct  72    ILQEKEMMEHLSDKKTLMSVRELAKGITYTEPMLTGWKPPLHIRK  116



>gb|KGN45245.1| hypothetical protein Csa_7G432260 [Cucumis sativus]
Length=717

 Score =   169 bits (428),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKIL RKGK++ALEEE EK +  EAKPSLLVKA+Q+K++ PEVS TEQ+V
Sbjct  142   PVAKRRAMEAQKILMRKGKASALEEELEKSRLAEAKPSLLVKASQMKRDQPEVSPTEQIV  201

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL IR+  K
Sbjct  202   QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLPIRRMPK  248



>ref|XP_009338507.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Pyrus 
x bretschneideri]
Length=587

 Score =   168 bits (425),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 98/115 (85%), Gaps = 4/115 (3%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKILQRKGKS+ LEEE EK K  EAKPSLLVKA+QLK++ PE++  E+++
Sbjct  12    PVAKRRAMEAQKILQRKGKSSGLEEELEKSKLAEAKPSLLVKASQLKRDAPEITPAEEIL  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQCN  927
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL IR+     S  QC+
Sbjct  72    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLNIRRM----SSQQCD  122



>ref|XP_008372708.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Malus 
domestica]
Length=587

 Score =   168 bits (425),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 98/115 (85%), Gaps = 4/115 (3%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKILQRKGKS+ LEEE EK K  EAKPSLLVKA+QLK++ PE++  E+++
Sbjct  12    PVAKRRAMEAQKILQRKGKSSGLEEELEKSKLAEAKPSLLVKASQLKRDAPEITPAEEIL  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQCN  927
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL IR+     S  QC+
Sbjct  72    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLNIRRM----SSQQCD  122



>ref|XP_009336329.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Pyrus 
x bretschneideri]
 ref|XP_009336336.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Pyrus 
x bretschneideri]
Length=587

 Score =   168 bits (425),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 98/115 (85%), Gaps = 4/115 (3%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKILQRKGKS+ LEEE EK K  EAKPSLLVKA+QLK++ PE++  E+++
Sbjct  12    PVAKRRAMEAQKILQRKGKSSGLEEELEKSKLAEAKPSLLVKASQLKRDAPEITPAEEIL  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQCN  927
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPL IR+     S  QC+
Sbjct  72    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLNIRRM----SSQQCD  122



>ref|XP_002888412.1| hypothetical protein ARALYDRAFT_315588 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64671.1| hypothetical protein ARALYDRAFT_315588 [Arabidopsis lyrata subsp. 
lyrata]
Length=587

 Score =   167 bits (423),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = -2

Query  1268  VAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMVL  1089
             VA+RRA+EAQKILQRKGK++ LEEEA+K K  EAKPSLLV+ATQLK+++P+VS TEQ++L
Sbjct  13    VAERRAMEAQKILQRKGKASELEEEADKEKLAEAKPSLLVQATQLKRDVPQVSATEQIIL  72

Query  1088  QEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             QEKEM+EHLSD+KTLMSVRELAKGITYTEP+LTGWKPPL IR+
Sbjct  73    QEKEMMEHLSDKKTLMSVRELAKGITYTEPLLTGWKPPLHIRR  115



>ref|XP_004235903.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Solanum lycopersicum]
Length=595

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  1328  MAANINMEIeedddyveyVPVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLV  1149
             MA  +NME+E++D+YVEYVPVAKRRA+EAQKILQRKG S+ LEEE EK K VEAKPSLLV
Sbjct  1     MADPVNMEMEDEDNYVEYVPVAKRRAIEAQKILQRKGNSSVLEEEEEKSKLVEAKPSLLV  60

Query  1148  KATQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLA  969
              ATQLKKE PE+S TEQ+VLQEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPLA
Sbjct  61    MATQLKKEQPEISPTEQVVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLA  120

Query  968   IRKYDK  951
             IR+  K
Sbjct  121   IRRMSK  126



>ref|NP_199941.1| putative DEAD-box ATP-dependent RNA helicase 35 [Arabidopsis 
thaliana]
 sp|Q9LU46.1|RH35_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 35 [Arabidopsis 
thaliana]
 dbj|BAA97391.1| DEAD-box protein abstrakt [Arabidopsis thaliana]
 dbj|BAE98527.1| DEAD-box protein abstrakt [Arabidopsis thaliana]
 gb|AED96061.1| putative DEAD-box ATP-dependent RNA helicase 35 [Arabidopsis 
thaliana]
Length=591

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -2

Query  1268  VAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMVL  1089
             VA+RRA+ AQKILQRKGK++ LEEEA+K K  EAKPSLLV+ATQLK+++PEVS TEQ++L
Sbjct  17    VAERRAIAAQKILQRKGKASELEEEADKEKLAEAKPSLLVQATQLKRDVPEVSATEQIIL  76

Query  1088  QEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             QEKEM+EHLSD+KTLMSVRELAKGITYTEP+LTGWKPPL IRK
Sbjct  77    QEKEMMEHLSDKKTLMSVRELAKGITYTEPLLTGWKPPLHIRK  119



>ref|XP_006385035.1| DEAD-box protein abstrakt [Populus trichocarpa]
 gb|ERP62832.1| DEAD-box protein abstrakt [Populus trichocarpa]
Length=587

 Score =   164 bits (415),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRAL AQ ILQR+G  +ALE+E EK K  EAKPSLLVKA+QLK++ PE+S+TEQ+V
Sbjct  12    PVAKRRALTAQMILQRRGNISALEDELEKSKLAEAKPSLLVKASQLKRDQPEISQTEQIV  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
              QEKEMIEHLSD+KTLMSVRELAKGITYTEP+LTGWKPPL IRK  +
Sbjct  72    QQEKEMIEHLSDKKTLMSVRELAKGITYTEPLLTGWKPPLPIRKMSR  118



>ref|XP_006858127.1| hypothetical protein AMTR_s00062p00113470 [Amborella trichopoda]
 gb|ERN19594.1| hypothetical protein AMTR_s00062p00113470 [Amborella trichopoda]
Length=593

 Score =   164 bits (415),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PV KRR +EAQKILQRKGKS+ALE+ AE+ K  EAKPSLLVKA+QLKKELPE+S  EQ+V
Sbjct  19    PVKKRRMMEAQKILQRKGKSSALED-AEQAKLTEAKPSLLVKASQLKKELPEISPMEQLV  77

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
             LQEKEMIEHLSDRKTLMSVRELAKGI YTEPM TGWKPP AIR
Sbjct  78    LQEKEMIEHLSDRKTLMSVRELAKGIQYTEPMNTGWKPPTAIR  120



>gb|EYU21852.1| hypothetical protein MIMGU_mgv1a003346mg [Erythranthe guttata]
Length=591

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRALEAQKILQRKGK+   EEE E  K VEAKP+LLVKA QLKKE PE+++TEQ+V
Sbjct  16    PVAKRRALEAQKILQRKGKTTVAEEETEVQKVVEAKPTLLVKAFQLKKEQPEITQTEQIV  75

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             +QEKEMIE+LSD+K+LMSVRELAKGITYTEP+LTGWKPPL IR+
Sbjct  76    MQEKEMIENLSDKKSLMSVRELAKGITYTEPLLTGWKPPLPIRR  119



>ref|XP_006492096.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like isoform 
X1 [Citrus sinensis]
 ref|XP_006492097.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like isoform 
X2 [Citrus sinensis]
 ref|XP_006492098.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like isoform 
X3 [Citrus sinensis]
 gb|KDO47407.1| hypothetical protein CISIN_1g007831mg [Citrus sinensis]
 gb|KDO47408.1| hypothetical protein CISIN_1g007831mg [Citrus sinensis]
 gb|KDO47409.1| hypothetical protein CISIN_1g007831mg [Citrus sinensis]
Length=588

 Score =   163 bits (413),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             P+AKRRA+EAQKILQRKG+++ LE+E EK K  E KPSLLVKA+QLK++ PE+S TEQ+V
Sbjct  13    PIAKRRAMEAQKILQRKGQASTLEDELEKSKLAEVKPSLLVKASQLKRDQPEISPTEQIV  72

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
              QEKEMIE+LSDRKTLMSVRELAKGITYT+P+LTGWKPPL IR+  K
Sbjct  73    QQEKEMIENLSDRKTLMSVRELAKGITYTDPLLTGWKPPLPIRRMSK  119



>ref|XP_006427449.1| hypothetical protein CICLE_v10025231mg [Citrus clementina]
 gb|ESR40689.1| hypothetical protein CICLE_v10025231mg [Citrus clementina]
Length=588

 Score =   163 bits (413),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             P+AKRRA+EAQKILQRKG+++ LE+E EK K  E KPSLLVKA+QLK++ PE+S TEQ+V
Sbjct  13    PIAKRRAMEAQKILQRKGQASTLEDELEKSKLAEVKPSLLVKASQLKRDQPEISPTEQIV  72

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
              QEKEMIE+LSDRKTLMSVRELAKGITYT+P+LTGWKPPL IR+  K
Sbjct  73    QQEKEMIENLSDRKTLMSVRELAKGITYTDPLLTGWKPPLPIRRMSK  119



>ref|XP_009623241.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Nicotiana 
tomentosiformis]
Length=589

 Score =   163 bits (412),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -2

Query  1310  MEIeedddyveyVPVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLK  1131
             ME+EE+DDYVEY+PVAKRR +EAQKILQRKGKS A EEE EKIK VEAKPSLLVKA+QLK
Sbjct  1     MEMEEEDDYVEYIPVAKRRVIEAQKILQRKGKSEAFEEEEEKIKLVEAKPSLLVKASQLK  60

Query  1130  KELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             KE PE+S  EQ+  QEKEMIEHLSD+KTLMSVRELAKGITYTEP+ TGWKPPLAIR+  K
Sbjct  61    KEQPEISHAEQVFQQEKEMIEHLSDKKTLMSVRELAKGITYTEPLRTGWKPPLAIRRNSK  120



>ref|XP_011028347.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
35-like [Populus euphratica]
Length=587

 Score =   162 bits (411),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PV KRRAL AQ ILQR+G  +ALE+E EK K  EAKPSLLVKA+QLK++ PE+S+TEQ+V
Sbjct  12    PVVKRRALTAQMILQRRGNISALEDELEKSKLAEAKPSLLVKASQLKRDQPEISQTEQIV  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
              QEKEMIEHLSD+KTLMSVRELAKGITYTEP+LTGWKPPL IRK  +
Sbjct  72    QQEKEMIEHLSDKKTLMSVRELAKGITYTEPLLTGWKPPLQIRKMSR  118



>ref|XP_004303276.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Fragaria 
vesca subsp. vesca]
Length=585

 Score =   160 bits (404),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 95/115 (83%), Gaps = 4/115 (3%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+ AQ+IL RKG +A LEE++EK +  E KPSLLVKATQLK++ PE+++ EQ+V
Sbjct  10    PVAKRRAMAAQRILHRKGNAAGLEEDSEKSEAKEVKPSLLVKATQLKRDAPEITQAEQLV  69

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQCN  927
              QEKEMIEHLSDRKTLMSVRELAKGITYTEP+ TGWKPPL IR+  K     QC+
Sbjct  70    QQEKEMIEHLSDRKTLMSVRELAKGITYTEPIPTGWKPPLQIRRMPKK----QCD  120



>ref|XP_006341396.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Solanum 
tuberosum]
Length=589

 Score =   159 bits (403),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  1310  MEIeedddyveyVPVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLK  1131
             ME+E++D+YVEYVPVAKRRA+EAQKILQRKG S+ LEEE EK K VEAKPSLLV ATQLK
Sbjct  1     MEMEDEDNYVEYVPVAKRRAIEAQKILQRKGNSSVLEEEEEKSKLVEAKPSLLVMATQLK  60

Query  1130  KELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             KE PE+S TEQ+VLQEKEMIEHLSDRKTLMSVRELAKGITYTEP+LTGWKPPLA+R+  K
Sbjct  61    KEQPEISPTEQVVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPLLTGWKPPLALRRMSK  120



>ref|XP_003591973.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES62224.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=589

 Score =   159 bits (403),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 96/109 (88%), Gaps = 2/109 (2%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAAL--EEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQ  1098
             PVAKRRA+EAQKILQRKGK+ A   E+++EK+K VE KPSLLVKA+QLKK+ PE+S TEQ
Sbjct  12    PVAKRRAMEAQKILQRKGKATAAIQEDDSEKLKVVETKPSLLVKASQLKKDQPEISVTEQ  71

Query  1097  MVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             +V QEKEMIE+LSD+KTLMSVRELAKGITYTEP+ TGWKPPL IR+  K
Sbjct  72    IVQQEKEMIENLSDKKTLMSVRELAKGITYTEPLPTGWKPPLHIRRMSK  120



>gb|AFK34615.1| unknown [Medicago truncatula]
Length=589

 Score =   159 bits (403),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 96/109 (88%), Gaps = 2/109 (2%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAAL--EEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQ  1098
             PVAKRRA+EAQKILQRKGK+ A   E+++EK+K VE KPSLLVKA+QLKK+ PE+S TEQ
Sbjct  12    PVAKRRAMEAQKILQRKGKATAAIQEDDSEKLKVVETKPSLLVKASQLKKDQPEISVTEQ  71

Query  1097  MVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             +V QEKEMIE+LSD+KTLMSVRELAKGITYTEP+ TGWKPPL IR+  K
Sbjct  72    IVQQEKEMIENLSDKKTLMSVRELAKGITYTEPLPTGWKPPLHIRRMSK  120



>ref|XP_004496330.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Cicer 
arietinum]
Length=588

 Score =   159 bits (402),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 97/108 (90%), Gaps = 1/108 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAAL-EEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRA+EAQKILQRKGK++A+ ++E+EK+  VE KPSLLVKA+QLK+E PE+S TEQ+
Sbjct  12    PVAKRRAIEAQKILQRKGKASAVTDDESEKLPVVETKPSLLVKASQLKREQPEISVTEQI  71

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             V QEKEMIE+LSD+KTLMSVRELAKGITYTEP+ TGWKPPL IR+  K
Sbjct  72    VQQEKEMIENLSDKKTLMSVRELAKGITYTEPLPTGWKPPLHIRRMSK  119



>ref|XP_010033981.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Eucalyptus 
grandis]
 gb|KCW53853.1| hypothetical protein EUGRSUZ_J03085 [Eucalyptus grandis]
Length=597

 Score =   159 bits (402),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 95/115 (83%), Gaps = 4/115 (3%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKILQRKG +++LEE+ EK K  E KPSLLVKATQLK++ PE++ TEQMV
Sbjct  22    PVAKRRAMEAQKILQRKGNASSLEEDHEKAKLAEVKPSLLVKATQLKRDQPEITPTEQMV  81

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQCN  927
               EKEM+E+LSDRKTLMSVRELAKGI YTEP+LTGWKP L IR+  +     QC+
Sbjct  82    QHEKEMLENLSDRKTLMSVRELAKGIIYTEPLLTGWKPSLPIRRMSRK----QCD  132



>dbj|BAE71218.1| putative DEAD-box protein abstrakt [Trifolium pratense]
Length=588

 Score =   158 bits (399),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGK-SAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRA+EAQKILQRKGK SAA+++E+EK+K VE KPSLLVKA+QLKK+ PE+S TEQ+
Sbjct  12    PVAKRRAMEAQKILQRKGKASAAIDDESEKLKVVETKPSLLVKASQLKKDQPEISVTEQI  71

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             V QEKEMIE+L D KTL SVRELAKGITYTEP+ TGWKPPL IR+  K
Sbjct  72    VQQEKEMIENLPDNKTLKSVRELAKGITYTEPLPTGWKPPLHIRRMSK  119



>emb|CDP17841.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   158 bits (399),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQ-VEAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRALEAQKILQRKGKS+ LEEE  +  + VEAKPSLLVKA+QLKKE PE+S TEQM
Sbjct  14    PVAKRRALEAQKILQRKGKSSTLEEEEAEKLKLVEAKPSLLVKASQLKKEQPEISPTEQM  73

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             V QEKEMIEHLSDRKTLMSVRELAKGITY EP+ TGWKPPL IR+  K
Sbjct  74    VQQEKEMIEHLSDRKTLMSVRELAKGITYKEPLFTGWKPPLNIRRLSK  121



>ref|XP_008228671.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Prunus mume]
 ref|XP_008228672.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Prunus mume]
Length=587

 Score =   158 bits (399),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKIL RKGKS+ LEE+ EK K  EAKPSLLVKA+QLK+E PE++  EQMV
Sbjct  12    PVAKRRAMEAQKILLRKGKSSGLEEDLEKSKLAEAKPSLLVKASQLKREAPEITPAEQMV  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
              QEKEMIE+LSDRKTLMSVRELAKGITYT+P+ TGWK PL IR+
Sbjct  72    QQEKEMIENLSDRKTLMSVRELAKGITYTDPIPTGWKSPLHIRR  115



>ref|XP_007215023.1| hypothetical protein PRUPE_ppa003295mg [Prunus persica]
 gb|EMJ16222.1| hypothetical protein PRUPE_ppa003295mg [Prunus persica]
Length=587

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKIL RKGKS+ LEE+ EK K  EAKPSLLVKA+QLK+E PE++  EQMV
Sbjct  12    PVAKRRAMEAQKILLRKGKSSGLEEDLEKSKLAEAKPSLLVKASQLKREAPEITPAEQMV  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
              QEKEMIE+LSDRKTLMSVRELAKGITYT+P+ TGWK PL IR+
Sbjct  72    QQEKEMIENLSDRKTLMSVRELAKGITYTDPIPTGWKSPLHIRR  115



>ref|XP_010429950.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Camelina 
sativa]
Length=588

 Score =   157 bits (396),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 95/105 (90%), Gaps = 1/105 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGK-SAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRA+E QKILQRKGK S   EEEAEK K  EAKPSLLV+ATQLKK++PEVS TEQ+
Sbjct  12    PVAKRRAIEEQKILQRKGKASELEEEEAEKDKLAEAKPSLLVQATQLKKDVPEVSATEQI  71

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             +LQEKEM+EHLSD+KTLMSVRELAKGITYTEP+LTGWKPPL IR+
Sbjct  72    ILQEKEMMEHLSDKKTLMSVRELAKGITYTEPLLTGWKPPLHIRR  116



>ref|XP_010417703.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Camelina 
sativa]
Length=588

 Score =   157 bits (396),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 95/105 (90%), Gaps = 1/105 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGK-SAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRA+E QKILQRKGK S   EEEAEK K  EAKPSLLV+ATQLKK++PEVS TEQ+
Sbjct  12    PVAKRRAMEEQKILQRKGKASELEEEEAEKDKLAEAKPSLLVQATQLKKDVPEVSATEQI  71

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             +LQEKEM+EHLSD+KTLMSVRELAKGITYTEP+LTGWKPPL IR+
Sbjct  72    ILQEKEMMEHLSDKKTLMSVRELAKGITYTEPLLTGWKPPLHIRR  116



>ref|XP_003521701.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like isoform 
X1 [Glycine max]
 ref|XP_006577231.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like isoform 
X2 [Glycine max]
 gb|KHN03983.1| DEAD-box ATP-dependent RNA helicase 35 [Glycine soja]
Length=587

 Score =   156 bits (395),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAAL-EEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRALEAQKILQRKGK++A+ +++ EK +  E KPSLLVKA+QLK+E PE+S TEQ+
Sbjct  11    PVAKRRALEAQKILQRKGKASAVTDDDLEKQRVAETKPSLLVKASQLKREQPEISVTEQI  70

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             V QEKEMIE+LSDRKTLMSVRELAKGITYTEP+ TGWKPPL +R+  K
Sbjct  71    VQQEKEMIENLSDRKTLMSVRELAKGITYTEPLPTGWKPPLHVRRMSK  118



>ref|XP_003553901.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like isoformX2 
[Glycine max]
 ref|XP_006604118.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like isoform 
X3 [Glycine max]
 gb|KHN01905.1| DEAD-box ATP-dependent RNA helicase 35 [Glycine soja]
Length=588

 Score =   156 bits (395),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 93/108 (86%), Gaps = 1/108 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGK-SAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRALEAQ ILQRKGK SAA +++ EK +  E KPSLLVKA+QLK+E PE+S TEQ+
Sbjct  12    PVAKRRALEAQNILQRKGKASAATDDDLEKQRVAETKPSLLVKASQLKREQPEISVTEQI  71

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             V QEKEMIE+LSDRKTLMSVRELAKGITYTEP+ TGWKPPL +R+  K
Sbjct  72    VQQEKEMIENLSDRKTLMSVRELAKGITYTEPLPTGWKPPLHVRRMSK  119



>ref|XP_010472922.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Camelina sativa]
Length=588

 Score =   155 bits (393),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 95/105 (90%), Gaps = 1/105 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGK-SAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRA+E QKILQRKGK S   EEEAEK K  EAKPSLLV+ATQLK+++PEVS TEQ+
Sbjct  12    PVAKRRAIEEQKILQRKGKASELEEEEAEKDKLAEAKPSLLVQATQLKRDVPEVSATEQI  71

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             +LQEKEM+EHLSD+KTLMSVRELAKGITYTEP+LTGWKPPL IR+
Sbjct  72    ILQEKEMMEHLSDKKTLMSVRELAKGITYTEPLLTGWKPPLHIRR  116



>ref|XP_007147038.1| hypothetical protein PHAVU_006G090900g [Phaseolus vulgaris]
 gb|ESW19032.1| hypothetical protein PHAVU_006G090900g [Phaseolus vulgaris]
Length=588

 Score =   154 bits (390),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKS-AALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRA+EAQKILQRKGK+  A ++E EK++  E+KPSLLVKA+Q+K+E PE+S TEQ+
Sbjct  12    PVAKRRAIEAQKILQRKGKALIATDDELEKMRVAESKPSLLVKASQMKREQPEISVTEQI  71

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             V QEKEMIE+LSDRKTLMSVRELAKGITY+EP+ TGWKPPL +R+  K
Sbjct  72    VQQEKEMIENLSDRKTLMSVRELAKGITYSEPLPTGWKPPLHVRRMSK  119



>ref|XP_009389399.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Musa 
acuminata subsp. malaccensis]
Length=607

 Score =   154 bits (388),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 3/107 (3%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGK-SAALEEEAEKIKQV--EAKPSLLVKATQLKKELPEVSETE  1101
             PV KRRA+EAQKILQRKG+ ++A + +A    Q   EAKPSLLVKA+QLK++LPE+S TE
Sbjct  29    PVKKRRAIEAQKILQRKGRPTSAGDSDAANRPQALAEAKPSLLVKASQLKRDLPEISPTE  88

Query  1100  QMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             Q+V QEKEMIEHLSDRKTLMSVRELAKGITYT+P+ TGWKPPLAIR+
Sbjct  89    QLVQQEKEMIEHLSDRKTLMSVRELAKGITYTDPIPTGWKPPLAIRR  135



>ref|XP_009106742.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Brassica 
rapa]
Length=588

 Score =   152 bits (385),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKS-AALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRALE QKILQRKGK     EE +EK K  E+KPSLLV+ATQLK+++PEVS TEQ+
Sbjct  12    PVAKRRALEEQKILQRKGKVLEVEEEASEKEKLAESKPSLLVQATQLKRDVPEVSATEQI  71

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             +LQEKEM+EHLSD+KTLMSVRELAKGITYTEP+LTGWKPPL IRK  +
Sbjct  72    ILQEKEMMEHLSDKKTLMSVRELAKGITYTEPLLTGWKPPLRIRKMSR  119



>gb|KEH40292.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=591

 Score =   152 bits (385),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 1/108 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGK-SAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRA+EAQKILQRKGK SA +++++ K+  VE KPSLLVKA+QLKKE PE+S  EQ+
Sbjct  15    PVAKRRAMEAQKILQRKGKISAPIDDDSGKLSVVETKPSLLVKASQLKKEQPEISVAEQI  74

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             V QEKEMIE+LSD+K LMSVRELAKGITYT+P+ TGWKPPL IR+  K
Sbjct  75    VQQEKEMIENLSDKKNLMSVRELAKGITYTKPLPTGWKPPLHIRRMSK  122



>ref|XP_009402714.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Musa 
acuminata subsp. malaccensis]
Length=609

 Score =   152 bits (385),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 93/108 (86%), Gaps = 5/108 (5%)
 Frame = -2

Query  1268  VAKRRALEAQKILQRKGKSA-ALEEEAEKIKQ----VEAKPSLLVKATQLKKELPEVSET  1104
             V KRR++EAQKILQRKG+SA A + +A++        EAKPSLLVKA+QLK++LPEVS T
Sbjct  30    VNKRRSMEAQKILQRKGRSASAGDADADEANHPPAPTEAKPSLLVKASQLKRDLPEVSPT  89

Query  1103  EQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             EQ+V QEKEMIEHLSDRKTLMSVRELAKGITYT+P+ TGWKPPLAIR+
Sbjct  90    EQLVQQEKEMIEHLSDRKTLMSVRELAKGITYTDPIPTGWKPPLAIRR  137



>ref|XP_009128421.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
35-like [Brassica rapa]
Length=587

 Score =   151 bits (382),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+E QK+LQRKGK   LEEEAEK K  E+KPSLLV+ATQLKK++P+VS TEQ++
Sbjct  12    PVAKRRAMEEQKVLQRKGKVLELEEEAEKEKLAESKPSLLVQATQLKKDIPKVSATEQII  71

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             LQEKEM+EHLSD+KTLMSVRELAKGITYTEP+LTGWKPPL +RK
Sbjct  72    LQEKEMMEHLSDKKTLMSVRELAKGITYTEPLLTGWKPPLHVRK  115



>ref|XP_009149901.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Brassica 
rapa]
Length=588

 Score =   149 bits (376),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 1/105 (1%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKS-AALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRA+E QKILQRKGK     EE +EK K  E+KPSLLV+ATQLK+++PEVS TEQ+
Sbjct  12    PVAKRRAMEEQKILQRKGKVLEVEEEASEKEKLAESKPSLLVQATQLKRDVPEVSATEQI  71

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             +LQEKEM+EHLSD+KTLMSVRELAKGITYTEP+ TGWKPPL IRK
Sbjct  72    ILQEKEMMEHLSDKKTLMSVRELAKGITYTEPLSTGWKPPLRIRK  116



>ref|XP_002517695.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF44859.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=585

 Score =   146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 93/116 (80%), Gaps = 5/116 (4%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQV-EAKPSLLVKATQLKKELPEVSETEQM  1095
             PVAKRRALEAQKIL RK K+ ALE+E +K  +V EAK SLLV+ + LK+E PE+SE EQ+
Sbjct  8     PVAKRRALEAQKILDRKRKACALEDEQKKKPKVFEAKASLLVQVSDLKREHPEISEIEQI  67

Query  1094  VLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQCN  927
             V QEKEM+EHLSD K LMSV+ELAKGITYTEP+LTGWKPPL IRK  +     QC+
Sbjct  68    VQQEKEMLEHLSDMKALMSVQELAKGITYTEPLLTGWKPPLCIRKMSQK----QCD  119



>ref|XP_002864104.1| hypothetical protein ARALYDRAFT_918160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40363.1| hypothetical protein ARALYDRAFT_918160 [Arabidopsis lyrata subsp. 
lyrata]
Length=587

 Score =   145 bits (365),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = -2

Query  1268  VAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMVL  1089
             VA+RRA+EAQKILQRKGK++ LEEEAEK K  EAKPSLLV+ATQLK+++P+VS TEQ++L
Sbjct  13    VAERRAMEAQKILQRKGKASELEEEAEKEKLAEAKPSLLVQATQLKRDVPQVSATEQIIL  72

Query  1088  QEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             QEKEM+EHLSD+KTLMSVRELAKGITYTEP+LTGWKPPL IR+
Sbjct  73    QEKEMMEHLSDKKTLMSVRELAKGITYTEPLLTGWKPPLHIRR  115



>ref|XP_010924578.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Elaeis 
guineensis]
Length=615

 Score =   145 bits (365),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 87/112 (78%), Gaps = 8/112 (7%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGK--------SAALEEEAEKIKQVEAKPSLLVKATQLKKELPE  1116
             PV KRRALEAQKILQRKG+        S      A+    VEAKPSLLVKA+QLK++LPE
Sbjct  32    PVKKRRALEAQKILQRKGRVSSASGGGSGGNPSTADDELAVEAKPSLLVKASQLKRDLPE  91

Query  1115  VSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             +S  EQ V QEKEMIEHLSDR+TLMSVRELAKGITYTEP+ TGWKPP AIR+
Sbjct  92    ISPMEQRVQQEKEMIEHLSDRRTLMSVRELAKGITYTEPIPTGWKPPTAIRR  143



>ref|XP_010693841.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Beta vulgaris 
subsp. vulgaris]
Length=596

 Score =   143 bits (360),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 3/124 (2%)
 Frame = -2

Query  1313  NMEIeedddyveyVPVAKRRALEAQKILQRKGK-SAALEEEAEKIKQV--EAKPSLLVKA  1143
              MEIEEDD+Y EY+ V KRR   A++ILQRK K S+ +E+E+ + +    EAKPSLLVKA
Sbjct  4     TMEIEEDDNYQEYISVEKRRERAAKEILQRKNKDSSKVEDESAQTQTQPEEAKPSLLVKA  63

Query  1142  TQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
             TQLKK++PEVS T+++VLQEKEMIEHLSDRKTLMSVRELAKGITYTEP+ TGWKPPL IR
Sbjct  64    TQLKKDIPEVSPTQKIVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPLWTGWKPPLTIR  123

Query  962   KYDK  951
             +  K
Sbjct  124   RMSK  127



>ref|XP_008793065.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35 [Phoenix dactylifera]
Length=619

 Score =   143 bits (360),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 90/116 (78%), Gaps = 12/116 (10%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGK-----------SAALEEEAEKIKQV-EAKPSLLVKATQLKK  1128
             PV KRRALEAQKILQRKG+           + + +++ ++     EAKPSLLVKA+QLK+
Sbjct  32    PVKKRRALEAQKILQRKGRLSSASGGGSGDNPSADDDPDRPSLAPEAKPSLLVKASQLKR  91

Query  1127  ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             ELPE+S  EQ V QEKEMIEHLSDR+TLMSVRELAKGITYTEP+ TGWKPP AIR+
Sbjct  92    ELPEISPMEQRVQQEKEMIEHLSDRRTLMSVRELAKGITYTEPIPTGWKPPTAIRR  147



>ref|XP_010920596.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Elaeis 
guineensis]
Length=624

 Score =   139 bits (349),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 90/121 (74%), Gaps = 17/121 (14%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGK----------------SAALEEEAEKIKQV-EAKPSLLVKA  1143
             P+ KRRA+EAQKILQRKG+                 +  +++ ++ +   EAKPSLLVKA
Sbjct  32    PIKKRRAMEAQKILQRKGRLASSSSADAGGGSGGHPSTTDDDPDRPRLAPEAKPSLLVKA  91

Query  1142  TQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
             +Q+K++LPE+S  EQ V QEKEMIEHLSDR+TLMSVRELAKGITYTEP+ TGWKPP AIR
Sbjct  92    SQMKRDLPEISPMEQRVQQEKEMIEHLSDRRTLMSVRELAKGITYTEPIPTGWKPPTAIR  151

Query  962   K  960
             +
Sbjct  152   R  152



>ref|XP_008813202.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Phoenix 
dactylifera]
Length=801

 Score =   137 bits (346),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 90/121 (74%), Gaps = 17/121 (14%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAA----------------LEEEAEKIKQV-EAKPSLLVKA  1143
             PV KRRALEAQ+ILQRKG+ A+                 +++ ++ +   EAKPSLLVKA
Sbjct  209   PVKKRRALEAQRILQRKGRLASSSSADFGGGSGGPPSTADDDPDRPRLAPEAKPSLLVKA  268

Query  1142  TQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
             +Q+K+ELPE+S  EQ V QEKEMIEHLSDR+TLMSVRELAKGITY +P+ TGWKPP AIR
Sbjct  269   SQMKRELPEISPVEQRVQQEKEMIEHLSDRRTLMSVRELAKGITYPDPIPTGWKPPTAIR  328

Query  962   K  960
             +
Sbjct  329   R  329



>ref|XP_008231893.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Prunus 
mume]
Length=595

 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 7/111 (6%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVE-------AKPSLLVKATQLKKELPEV  1113
             PVAKRRA+EA KILQRK KS  LEE+++K+K          +KPSLLVK+ ++K E P++
Sbjct  12    PVAKRRAMEAHKILQRKVKSLGLEEKSDKLKLAAQANPNKPSKPSLLVKSLEMKHEAPKI  71

Query  1112  SETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             +  +QMV QEKE+I++LSDRKTLMSV ELAKGITYT+P+ TGWKPPL IR+
Sbjct  72    TPIQQMVQQEKEIIDNLSDRKTLMSVGELAKGITYTDPIPTGWKPPLHIRR  122



>ref|XP_006281491.1| hypothetical protein CARUB_v10027584mg [Capsella rubella]
 gb|AFJ66207.1| hypothetical protein 34G24.5 [Capsella rubella]
 gb|EOA14389.1| hypothetical protein CARUB_v10027584mg [Capsella rubella]
Length=591

 Score =   134 bits (337),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 89/106 (84%), Gaps = 4/106 (4%)
 Frame = -2

Query  1268  VAKRRALEAQKILQRKGKSAALEEEAEKIK----QVEAKPSLLVKATQLKKELPEVSETE  1101
             V +RRA+E + ++ R+ + A+  EE E+      +VEAKPSLLV+ATQLK+++PEVS TE
Sbjct  13    VVERRAMETKNMILRRKRKASELEEDEEEADKEKRVEAKPSLLVQATQLKRDVPEVSGTE  72

Query  1100  QMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
             Q++LQEKEM+EHLSD+KTLMSVRELA+GITYTEP+LTGWKPPL IR
Sbjct  73    QIILQEKEMMEHLSDKKTLMSVRELARGITYTEPLLTGWKPPLDIR  118



>ref|XP_002991105.1| hypothetical protein SELMODRAFT_132834 [Selaginella moellendorffii]
 gb|EFJ07913.1| hypothetical protein SELMODRAFT_132834 [Selaginella moellendorffii]
Length=601

 Score =   134 bits (336),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 2/103 (2%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PV KRR LE QK+LQRKG++++L E+       E+KPSLLVKA+QLKK+ PE+S TEQ+V
Sbjct  28    PVKKRRLLEQQKLLQRKGQNSSLVEDGRG--AAESKPSLLVKASQLKKDQPEISATEQLV  85

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
              QEK+MI+ LS+RKTLMSVRELAKGITYT PM T W+PP  +R
Sbjct  86    RQEKDMIDRLSERKTLMSVRELAKGITYTNPMQTDWRPPSHVR  128



>emb|CDX79384.1| BnaC06g19190D [Brassica napus]
Length=390

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 85/103 (83%), Gaps = 3/103 (3%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAK RA++ QKILQRKGK +A E+E  K+ +  +KPSLLV+ATQLK++ PEV+ TE ++
Sbjct  12    PVAKLRAMQKQKILQRKGKVSAFEKE--KVTE-SSKPSLLVQATQLKRDAPEVTATEHII  68

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
             LQEKEM++ LSD+KTLMSVRELAKGITY EPM TGW+P   +R
Sbjct  69    LQEKEMLDRLSDKKTLMSVRELAKGITYIEPMTTGWEPLSYVR  111



>ref|XP_002991649.1| hypothetical protein SELMODRAFT_236355 [Selaginella moellendorffii]
 gb|EFJ07220.1| hypothetical protein SELMODRAFT_236355 [Selaginella moellendorffii]
Length=585

 Score =   133 bits (335),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 2/103 (2%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PV KRR LE QK+LQRKG++++L E+       E+KPSLLVKA+QLKK+ PE+S TEQ+V
Sbjct  12    PVKKRRLLEQQKLLQRKGQNSSLVEDGRG--AAESKPSLLVKASQLKKDQPEISVTEQLV  69

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
              QEK+MI+ LS+RKTLMSVRELAKGITYT PM T W+PP  +R
Sbjct  70    RQEKDMIDRLSERKTLMSVRELAKGITYTNPMQTDWRPPSHVR  112



>ref|XP_009104465.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Brassica 
rapa]
Length=591

 Score =   130 bits (328),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 89/106 (84%), Gaps = 3/106 (3%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQV---EAKPSLLVKATQLKKELPEVSETE  1101
             PVAKRRA+EAQKILQRKGK    EE  ++ K+V    +KPSLL++ATQLK++ PEV+ T+
Sbjct  13    PVAKRRAMEAQKILQRKGKVEEEEEAEKEKKKVAESSSKPSLLLQATQLKRDAPEVTATD  72

Query  1100  QMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
             Q++LQEKEM++ LS++KTLMSVRELAKGITYTEPM TGW+PP  +R
Sbjct  73    QIILQEKEMMDRLSEKKTLMSVRELAKGITYTEPMTTGWEPPSHVR  118



>ref|XP_001777066.1| predicted protein [Physcomitrella patens]
 gb|EDQ58059.1| predicted protein [Physcomitrella patens]
Length=616

 Score =   123 bits (308),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 81/110 (74%), Gaps = 7/110 (6%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALE-------EEAEKIKQVEAKPSLLVKATQLKKELPEV  1113
             PV KRR + AQ++L +K    A         +E E +K  E KPSLLVK++QLKK+ PE+
Sbjct  34    PVKKRRLMAAQQLLNKKAVKGANGANMTSTLDEQEGLKSSEIKPSLLVKSSQLKKDAPEI  93

Query  1112  SETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
             S TE +V+QEKEMIE LS++K L+ VRELAKGI+YTEPM TGWKPPLAIR
Sbjct  94    SVTEALVMQEKEMIERLSEKKHLVPVRELAKGISYTEPMQTGWKPPLAIR  143



>gb|EEC72494.1| hypothetical protein OsI_05864 [Oryza sativa Indica Group]
Length=513

 Score =   120 bits (300),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -2

Query  1178  QVEAKPSLLVKATQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEP  999
             +  AKPSLLVKATQLK+  PEV+ TEQ+++QEKEMIEHLSDRKTLMSVRELAKGITY++P
Sbjct  83    EASAKPSLLVKATQLKRAAPEVTHTEQLIMQEKEMIEHLSDRKTLMSVRELAKGITYSDP  142

Query  998   MLTGWKPPLAIRK  960
             + TGWKPPL +R+
Sbjct  143   LKTGWKPPLRLRR  155



>sp|Q0E3X4.2|RH35A_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 35A [Oryza 
sativa Japonica Group]
 dbj|BAD38045.1| putative DEAD-box protein abstrakt [Oryza sativa Japonica Group]
Length=627

 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -2

Query  1178  QVEAKPSLLVKATQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEP  999
             +  AKPSLLVKATQLK+  PEV+ TEQ+++QEKEMIEHLSDRKTLMSVRELAKGITY++P
Sbjct  83    EASAKPSLLVKATQLKRAAPEVTHTEQLIMQEKEMIEHLSDRKTLMSVRELAKGITYSDP  142

Query  998   MLTGWKPPLAIRK  960
             + TGWKPPL +R+
Sbjct  143   LKTGWKPPLRLRR  155



>ref|XP_003570939.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35A [Brachypodium 
distachyon]
Length=613

 Score =   119 bits (299),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 86/124 (69%), Gaps = 16/124 (13%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRK-GKSAALEE---------------EAEKIKQVEAKPSLLVKAT  1140
             PVAKRRA+EA ++  R+  K AA  +                +       AKPSLLV +T
Sbjct  23    PVAKRRAMEADRLRNRRISKPAAASDGSPASLPPPPPPPPTNSPAPDAAAAKPSLLVTST  82

Query  1139  QLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             QLK+  PEV+ TEQ++LQEKEMIE+LSDRKTLMSVRELAKGITYTEP+LTGWKPPL +R+
Sbjct  83    QLKRAAPEVTATEQVILQEKEMIENLSDRKTLMSVRELAKGITYTEPLLTGWKPPLRLRR  142

Query  959   YDKS  948
               ++
Sbjct  143   MPRT  146



>ref|XP_006646888.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35A-like [Oryza 
brachyantha]
Length=625

 Score =   118 bits (296),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  1166  KPSLLVKATQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             KPSLLVKATQLK+  PEV+ TEQ+++QEKEMIEHLSDRKTLMSVRELAKGITY++P+ TG
Sbjct  85    KPSLLVKATQLKRAAPEVTHTEQLIMQEKEMIEHLSDRKTLMSVRELAKGITYSDPLQTG  144

Query  986   WKPPLAIRK  960
             WKPPL +R+
Sbjct  145   WKPPLRLRR  153



>ref|XP_010442969.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like isoform 
X1 [Camelina sativa]
Length=592

 Score =   116 bits (291),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 5/107 (5%)
 Frame = -2

Query  1268  VAKRRALEAQK-ILQRK----GKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSET  1104
             V +RRA+   K +LQRK         LE   E I +  AKPSLL++AT LK+++P+VS T
Sbjct  13    VEQRRAMVKDKFLLQRKRKASELEEELEANKENIAEASAKPSLLLQATNLKRDVPQVSAT  72

Query  1103  EQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
             + ++LQEKEM+E LSD+KTLMSVRELAKGITYTEP+LTGWKPPL IR
Sbjct  73    DLIILQEKEMMERLSDKKTLMSVRELAKGITYTEPLLTGWKPPLHIR  119



>ref|XP_008373987.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like isoform 
X1 [Malus domestica]
Length=607

 Score =   116 bits (291),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 90/131 (69%), Gaps = 20/131 (15%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALE-----------EEAEKIKQVEAK-----PSLLVKAT  1140
             PVAK RA+EAQKIL+RK K A  E           EE +K+ ++ A+     PSL+VKA+
Sbjct  13    PVAKWRAIEAQKILERKRKFAGGELESARTKKRKEEELDKLSKLAAQEKPKPPSLVVKAS  72

Query  1139  QLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             +LK + PE++  ++MV +E+E+IE LSDRK L+SV ELAKGITYT+P+ TGWKPPL IR+
Sbjct  73    RLKHDAPEITPAQEMVQKEREIIESLSDRKALLSVGELAKGITYTDPIPTGWKPPLHIRR  132

Query  959   YDKS*SIMQCN  927
               +     QC+
Sbjct  133   MTRK----QCD  139



>ref|XP_006382733.1| hypothetical protein POPTR_0005s04880g [Populus trichocarpa]
 gb|ERP60530.1| hypothetical protein POPTR_0005s04880g [Populus trichocarpa]
Length=487

 Score =   114 bits (285),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 3/95 (3%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PV KRRAL AQ ILQR G S+ALE+E EK K  EAKPSLLVKA+QLK++ PE+S+TEQ+V
Sbjct  17    PVVKRRALAAQMILQRTGDSSALEDELEKSKLAEAKPSLLVKASQLKRDQPEISQTEQIV  76

Query  1091  LQEKEMIEHLSDRKTLMS--VREL-AKGITYTEPM  996
              QEKEMIEHLSD+KTLMS  ++ L AKGI    P+
Sbjct  77    QQEKEMIEHLSDKKTLMSPILKMLKAKGIVQPTPI  111



>gb|KCW79127.1| hypothetical protein EUGRSUZ_C00570 [Eucalyptus grandis]
Length=348

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 4/87 (5%)
 Frame = -2

Query  1187  KIKQVEAKPSLLVKATQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITY  1008
             K K  + KPSLLVKATQLK++ PE++ T+QMV  EKEM+++LSDRKTLMSV ELAKGI Y
Sbjct  18    KAKLAKVKPSLLVKATQLKRDQPEITPTKQMVQHEKEMLKNLSDRKTLMSVHELAKGIIY  77

Query  1007  TEPMLTGWKPPLAIRKYDKS*SIMQCN  927
             TEP+LTGWKP L IR+        QCN
Sbjct  78    TEPLLTGWKPLLPIRRMSGK----QCN  100



>gb|ACG29152.1| ATP-dependent RNA helicase DDX41 [Zea mays]
Length=618

 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 80/119 (67%), Gaps = 15/119 (13%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQ-RKGKSAALEEEAE--------------KIKQVEAKPSLLVKATQ  1137
             PVAKRRA+EA+++ Q R  KSA     +                +    AKPSLLVKATQ
Sbjct  28    PVAKRRAMEAERLRQLRLSKSAPASAVSSLPMPPPPPLLPAQTSVPDAAAKPSLLVKATQ  87

Query  1136  LKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             LK+  PEV+ TEQ + QEKE+IE+LSD K+L SVRE+AKGI YTEP+ TGWKPPL +R+
Sbjct  88    LKRAAPEVTATEQRIQQEKEVIENLSDNKSLRSVREIAKGIIYTEPIQTGWKPPLRLRR  146



>gb|ACR35233.1| unknown [Zea mays]
 gb|AFW88429.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=618

 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 80/119 (67%), Gaps = 15/119 (13%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQ-RKGKSAALEEEAE--------------KIKQVEAKPSLLVKATQ  1137
             PVAKRRA+EA+++ Q R  KSA     +                +    AKPSLLVKATQ
Sbjct  28    PVAKRRAMEAERLRQLRLSKSAPASAVSSLPMPPPPPLLPAQTSVPDAAAKPSLLVKATQ  87

Query  1136  LKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             LK+  PEV+ TEQ + QEKE+IE+LSD K+L SVRE+AKGI YTEP+ TGWKPPL +R+
Sbjct  88    LKRAAPEVTATEQRIQQEKEVIENLSDNKSLRSVREIAKGIIYTEPIQTGWKPPLRLRR  146



>ref|NP_001147853.1| ATP-dependent RNA helicase DDX41 [Zea mays]
 gb|ACG28899.1| ATP-dependent RNA helicase DDX41 [Zea mays]
Length=616

 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 80/119 (67%), Gaps = 15/119 (13%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQ-RKGKSAALEEEAE--------------KIKQVEAKPSLLVKATQ  1137
             PVAKRRA+EA+++ Q R  KSA     +                +    AKPSLLVKATQ
Sbjct  26    PVAKRRAMEAERLRQLRLSKSAPASAVSSLPMPPPPPLLPAQTSVPDAAAKPSLLVKATQ  85

Query  1136  LKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             LK+  PEV+ TEQ + QEKE+IE+LSD K+L SVRE+AKGI YTEP+ TGWKPPL +R+
Sbjct  86    LKRAAPEVTATEQRIQQEKEVIENLSDNKSLRSVREIAKGIIYTEPIQTGWKPPLRLRR  144



>ref|XP_004294217.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Fragaria 
vesca subsp. vesca]
Length=593

 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 84/118 (71%), Gaps = 15/118 (13%)
 Frame = -2

Query  1271  PVAKRRALEAQ------------KILQRKGKSAA--LEEEAEKIKQVEAK-PSLLVKATQ  1137
             PVAKRRA+ AQ            KIL+RK +S++  ++ + E+ K+     PSLLV A+Q
Sbjct  10    PVAKRRAIAAQRLLEKQRAIAKQKILKRKRRSSSEQVDSKVEESKENRTNLPSLLVTASQ  69

Query  1136  LKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
             LK++ PE++  EQ++ QEK+MIE L DRK+LMSV ELAKGITYT+P+ TGWKPPL IR
Sbjct  70    LKRDAPEITPKEQLLQQEKQMIEQLPDRKSLMSVHELAKGITYTDPLPTGWKPPLKIR  127



>ref|XP_010094212.1| hypothetical protein L484_016755 [Morus notabilis]
 gb|EXB55388.1| hypothetical protein L484_016755 [Morus notabilis]
Length=92

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  1223  KGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMVLQEKEMIEHLSDRKTL  1044
             +GKS+ALEEE EK KQ EAK SLLVKA+QLK++ PE+S TE +V QEKE+IEHLSDRKTL
Sbjct  22    QGKSSALEEELEKSKQAEAKQSLLVKASQLKRKAPEISPTELIVRQEKEIIEHLSDRKTL  81

Query  1043  MSVRELAKGIT  1011
             MSVRELAKGIT
Sbjct  82    MSVRELAKGIT  92



>ref|XP_002465295.1| hypothetical protein SORBIDRAFT_01g035760 [Sorghum bicolor]
 gb|EER92293.1| hypothetical protein SORBIDRAFT_01g035760 [Sorghum bicolor]
Length=618

 Score =   109 bits (273),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 79/119 (66%), Gaps = 15/119 (13%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQ-RKGKSAALEEEAE--------------KIKQVEAKPSLLVKATQ  1137
             PVAKRRA+EA+++ Q R  KSA     +                +    AKPSLLVKATQ
Sbjct  28    PVAKRRAMEAERLRQLRLNKSAPTSAASTLPLPPPPPLLPAQASVPDAAAKPSLLVKATQ  87

Query  1136  LKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             LK+  PEV+ TEQ + QEKE+IE+LSD K+L SVRE+AKGI YT+ + TGWKPPL +R+
Sbjct  88    LKRAAPEVTATEQRIQQEKEVIENLSDNKSLRSVREIAKGIIYTDSIQTGWKPPLRLRR  146



>sp|Q5Z6G5.1|RH35B_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 35B [Oryza 
sativa Japonica Group]
 dbj|BAD54454.1| putative DEAD-box protein abstrakt [Oryza sativa Japonica Group]
 gb|EAZ38145.1| hypothetical protein OsJ_22496 [Oryza sativa Japonica Group]
Length=619

 Score =   109 bits (273),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 81/121 (67%), Gaps = 14/121 (12%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEE-------------EAEKIKQVEAKPSLLVKATQLK  1131
             PVAKRRA+EA++ L+R  K                    +  + +V  K SLLVKAT+LK
Sbjct  31    PVAKRRAMEAER-LRRATKPPTTNAVAVAAPPPPPRSTSSPAVGEVAVKTSLLVKATKLK  89

Query  1130  KELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             +E PEV+  E+++ QE+EMIEHLSDRK LM V E+AKGI+Y+EP+ TGW+PPL +R+  +
Sbjct  90    REAPEVTPAERLLQQEREMIEHLSDRKALMPVGEIAKGISYSEPITTGWRPPLRLRRMPR  149

Query  950   S  948
             S
Sbjct  150   S  150



>gb|EAZ02224.1| hypothetical protein OsI_24319 [Oryza sativa Indica Group]
Length=620

 Score =   108 bits (269),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 80/121 (66%), Gaps = 14/121 (12%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEE-------------EAEKIKQVEAKPSLLVKATQLK  1131
             PVAKRRA+EA++ L+R  K                    +    +V  K SLLVKAT+LK
Sbjct  32    PVAKRRAMEAER-LRRATKPPTTNAVAVAAPPPPPRSTSSPAAGEVAVKTSLLVKATKLK  90

Query  1130  KELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDK  951
             +E PEV+  E+++ QE+EMIEHLSDRK LM V E+AKGI+Y+EP+ TGW+PPL +R+  +
Sbjct  91    REAPEVTPAERLLQQEREMIEHLSDRKALMPVGEIAKGISYSEPITTGWRPPLRLRRMPR  150

Query  950   S  948
             S
Sbjct  151   S  151



>ref|XP_008373988.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like isoform 
X2 [Malus domestica]
Length=597

 Score =   106 bits (265),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 90/121 (74%), Gaps = 10/121 (8%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEA-EKIKQVEAK-----PSLLVKATQLKKELPEVS  1110
             PVAK RA+EAQKIL+RK K+   +EE  +K+ ++ A+     PSL+VKA++LK + PE++
Sbjct  13    PVAKWRAIEAQKILERKRKTKKRKEEELDKLSKLAAQEKPKPPSLVVKASRLKHDAPEIT  72

Query  1109  ETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQC  930
               ++MV +E+E+IE LSDRK L+SV ELAKGITYT+P+ TGWKPPL IR+  +     QC
Sbjct  73    PAQEMVQKEREIIESLSDRKALLSVGELAKGITYTDPIPTGWKPPLHIRRMTRK----QC  128

Query  929   N  927
             +
Sbjct  129   D  129



>ref|XP_004951889.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35A-like [Setaria 
italica]
Length=620

 Score =   102 bits (255),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 78/120 (65%), Gaps = 16/120 (13%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQ-RKGKSAALEEEAE--------------KIKQVEAKPSLLVKATQ  1137
             PVAKRRALEA+++ Q R  K A     +                     AKPSLLVK+TQ
Sbjct  29    PVAKRRALEAERLRQLRLSKPAPSSAASSLAMPPPPPPPPTQPSAPDAAAKPSLLVKSTQ  88

Query  1136  LKKELPEVSETEQMVLQEKEMIEHLS-DRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             LK+  PEV+ TEQ + QEKE+IE+LS D K+L SVRE+AKGI YTEP+ TGWKPPL +R+
Sbjct  89    LKRAAPEVTATEQRIQQEKEVIENLSSDSKSLRSVREIAKGIIYTEPIQTGWKPPLRLRR  148



>ref|XP_010039676.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like [Eucalyptus 
grandis]
Length=187

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 56/71 (79%), Gaps = 4/71 (6%)
 Frame = -2

Query  1139  QLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             QLK++ PE++ TEQMV  EKEM+E+L DRKTLMSVRELAKGI YTEP+LTGWKP L IR+
Sbjct  2     QLKRDQPEITPTEQMVQHEKEMLENLFDRKTLMSVRELAKGIIYTEPLLTGWKPLLPIRR  61

Query  959   YDKS*SIMQCN  927
                  S  QCN
Sbjct  62    M----SGKQCN  68



>emb|CDY38671.1| BnaC02g23080D [Brassica napus]
Length=519

 Score = 94.0 bits (232),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 58/104 (56%), Gaps = 44/104 (42%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+E QKILQRKGK                                         
Sbjct  12    PVAKRRAMEEQKILQRKGK-----------------------------------------  30

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
                KEM+EHLSD+KTLMSVRELAKGITYTEP+LTGWKPPL +RK
Sbjct  31    ---KEMMEHLSDKKTLMSVRELAKGITYTEPLLTGWKPPLHVRK  71



>emb|CDY39973.1| BnaC06g40510D [Brassica napus]
Length=518

 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 57/104 (55%), Gaps = 45/104 (43%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+E QKILQRKG                                          
Sbjct  12    PVAKRRAMEEQKILQRKG------------------------------------------  29

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
                KEM+EHLSD+KTLMSVRELAKGITYTEP+LTGWKPPL IRK
Sbjct  30    ---KEMMEHLSDKKTLMSVRELAKGITYTEPLLTGWKPPLRIRK  70



>emb|CDY61276.1| BnaA06g38640D [Brassica napus]
Length=519

 Score = 92.0 bits (227),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 57/104 (55%), Gaps = 44/104 (42%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+E QKILQRKGK                                         
Sbjct  12    PVAKRRAMEEQKILQRKGK-----------------------------------------  30

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
                KEM+EHLSD+KTLMSVRELAKGITYTEP+ TGWKPPL IRK
Sbjct  31    ---KEMMEHLSDKKTLMSVRELAKGITYTEPLSTGWKPPLRIRK  71



>emb|CDX87315.1| BnaA07g35580D [Brassica napus]
Length=518

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 56/104 (54%), Gaps = 45/104 (43%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+E QKILQRKG                                          
Sbjct  12    PVAKRRAMEEQKILQRKG------------------------------------------  29

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
                 +M+EHLSD+KTLMSVRELAKGITYTEP+LTGWKPPL IRK
Sbjct  30    ---GKMMEHLSDKKTLMSVRELAKGITYTEPLLTGWKPPLRIRK  70



>gb|EAZ21753.1| hypothetical protein OsJ_05388 [Oryza sativa Japonica Group]
Length=516

 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -2

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             +QEKEMIEHLSDRKTLMSVRELAKGITY++P+ TGWKPPL +R+
Sbjct  1     MQEKEMIEHLSDRKTLMSVRELAKGITYSDPLKTGWKPPLRLRR  44



>emb|CDX67949.1| BnaA07g19890D [Brassica napus]
Length=544

 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 55/103 (53%), Gaps = 44/103 (43%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAKRRA+EAQKILQRKGK                                         
Sbjct  13    PVAKRRAMEAQKILQRKGK-----------------------------------------  31

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
                KEM++ LS++KTLMSVRELAKGITYTEPM TGW+PP  +R
Sbjct  32    ---KEMMDRLSEKKTLMSVRELAKGITYTEPMTTGWEPPSHVR  71



>gb|KCW54172.1| hypothetical protein EUGRSUZ_I00150 [Eucalyptus grandis]
Length=236

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 43/57 (75%), Gaps = 4/57 (7%)
 Frame = -2

Query  1097  MVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQCN  927
             MV  EKEM+E+LSDRKTLMSVRELAKGI YTE +LTGWKP L IR+        QCN
Sbjct  1     MVQHEKEMLENLSDRKTLMSVRELAKGIIYTELLLTGWKPLLPIRRMSGK----QCN  53



>emb|CDY21912.1| BnaC09g00180D [Brassica napus]
Length=372

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 67/102 (66%), Gaps = 27/102 (26%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLK---KELPEVSETE  1101
             PVAKRRA++     +RKGK   + E+ EK+      PSLLVKATQ +   +   +VS TE
Sbjct  166   PVAKRRAMQ-----ERKGK---VMEDKEKLA-----PSLLVKATQQQLKRRRRRDVSATE  212

Query  1100  QMVLQEKEMIEHLS-DRKTLMSVRELAKGITYTEPMLTGWKP  978
             Q++LQEKEM+EHLS D+KTLMSVRELAK          GW+P
Sbjct  213   QIILQEKEMMEHLSCDKKTLMSVRELAK----------GWEP  244



>ref|XP_010442977.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like isoform 
X2 [Camelina sativa]
Length=542

 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = -2

Query  1103  EQMVLQEK-EMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
             ++ +LQ K +M+E LSD+KTLMSVRELAKGITYTEP+LTGWKPPL IR
Sbjct  22    DKFLLQRKRKMMERLSDKKTLMSVRELAKGITYTEPLLTGWKPPLHIR  69



>ref|XP_009796211.1| PREDICTED: prostatic spermine-binding protein-like [Nicotiana 
sylvestris]
 ref|XP_009796212.1| PREDICTED: prostatic spermine-binding protein-like [Nicotiana 
sylvestris]
Length=176

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  201  MEVGGLSSEVPALTETVVMSvleavvaetllvaQRSVACLFILTGCLLRNNGALPDLSGV  380
            MEV  LSSE+      V+ SV+EA+ AETLL AQRSVA L I+ G +L++  ALP+L G 
Sbjct  1    MEVSNLSSELAVFGRMVMESVVEAIFAETLLAAQRSVASLLIVAGTMLKDANALPELIGA  60

Query  381  EQRFPFEELHKKNEAEVENK  440
            E+RFPFEELHK  +A VENK
Sbjct  61   EKRFPFEELHKMEKAGVENK  80



>ref|XP_009595108.1| PREDICTED: nucleolin-like [Nicotiana tomentosiformis]
Length=174

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +3

Query  201  MEVGGLSSEVPALTETVVMSvleavvaetllvaQRSVACLFILTGCLLRNNGALPDLSGV  380
            MEV  LSSEV A    V+ SV+EAV AETLL AQRSVA L I+   +L++  ALP+L G 
Sbjct  1    MEVSNLSSEVAAFGRMVMESVVEAVFAETLLAAQRSVASLLIVAETMLKDANALPELIGT  60

Query  381  EQRFPFEELHKKNEAEVENK  440
            E+RFPFEELHK  +A +ENK
Sbjct  61   EKRFPFEELHKMEKAGIENK  80



>ref|XP_008373989.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 35-like isoform 
X3 [Malus domestica]
Length=546

 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 56/115 (49%), Gaps = 49/115 (43%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             PVAK RA+EAQKIL+RK                                           
Sbjct  13    PVAKWRAIEAQKILERK-------------------------------------------  29

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQCN  927
                KE+IE LSDRK L+SV ELAKGITYT+P+ TGWKPPL IR+  +     QC+
Sbjct  30    --RKEIIESLSDRKALLSVGELAKGITYTDPIPTGWKPPLHIRRMTRK----QCD  78



>ref|XP_002966549.1| hypothetical protein SELMODRAFT_230807 [Selaginella moellendorffii]
 gb|EFJ32576.1| hypothetical protein SELMODRAFT_230807 [Selaginella moellendorffii]
Length=581

 Score = 72.4 bits (176),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 7/107 (7%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPE----VSET  1104
             P+ KRR  E Q++LQRK  S  +E   ++  +  A  SLL KA+ L+ E  +    +S +
Sbjct  10    PIRKRRLAEQQRLLQRK--SQKIEGNKKEEPKSCAPLSLLEKASLLQHEKQQEGGPLSPS  67

Query  1103  EQMVLQEKEMIEHLSD-RKTLMSVRELAKGITYTEPMLTGWKPPLAI  966
             E++  QEK+M++ L+D ++ L+ V E++KGI YTEPM TGW PPL +
Sbjct  68    EELQRQEKDMLDRLNDEKRVLLPVSEISKGIKYTEPMHTGWTPPLHV  114



>ref|XP_006350114.1| PREDICTED: nucleolin-like isoform X1 [Solanum tuberosum]
 ref|XP_006350115.1| PREDICTED: nucleolin-like isoform X2 [Solanum tuberosum]
Length=174

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +3

Query  201  MEVGGLSSEVPALTETVVMSvleavvaetllvaQRSVACLFILTGCLLRNNGALPDLSGV  380
            MEV  L S+V      VV SVLEAVVAETLL AQRSVA L I+ G +L++  ALPDL G 
Sbjct  1    MEVS-LRSDVAVFGRMVVGSVLEAVVAETLLAAQRSVASLLIVAGIMLKDADALPDLIGT  59

Query  381  EQRFPFEELHKKNEAEVENK  440
            ++RFPFEELHK ++A  ENK
Sbjct  60   DKRFPFEELHKMDKAGPENK  79



>ref|XP_004251738.1| PREDICTED: phosphopantothenoylcysteine decarboxylase subunit 
VHS3-like [Solanum lycopersicum]
Length=174

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +3

Query  201  MEVGGLSSEVPALTETVVMSvleavvaetllvaQRSVACLFILTGCLLRNNGALPDLSGV  380
            MEV  L S+V      VV SVLEAVVAE LL AQRS A L I+ G +L++  +LPDL G 
Sbjct  1    MEVCSLRSDVAVFGRMVVGSVLEAVVAEILLAAQRSAASLLIVAGIMLKDADSLPDLIGT  60

Query  381  EQRFPFEELHKKNEAEVENK  440
            ++RFPFEELHK ++A  ENK
Sbjct  61   DKRFPFEELHKMDKAGPENK  80



>gb|EMT08209.1| DEAD-box ATP-dependent RNA helicase 35A [Aegilops tauschii]
Length=511

 Score = 68.9 bits (167),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  1076  MIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYDKS  948
             MI++LS++ TLMSVRELAKGITYTEP+ TGWKPPL +R+  ++
Sbjct  1     MIDNLSNKNTLMSVRELAKGITYTEPLRTGWKPPLRLRRMPRT  43



>ref|NP_195063.1| putative DEAD-box ATP-dependent RNA helicase 43 [Arabidopsis 
thaliana]
 sp|Q9SZB4.1|RH43_ARATH RecName: Full=Putative DEAD-box ATP-dependent RNA helicase 43 
[Arabidopsis thaliana]
 emb|CAB38795.1| putative protein [Arabidopsis thaliana]
 emb|CAB80054.1| putative protein [Arabidopsis thaliana]
 gb|AEE86216.1| putative DEAD-box ATP-dependent RNA helicase 43 [Arabidopsis 
thaliana]
Length=542

 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  1082  KEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             K M+EHLSD+K LMSV ELA+GITYTEP+ T WKPPL +RK
Sbjct  30    KGMMEHLSDKKKLMSVGELARGITYTEPLSTWWKPPLHVRK  70



>ref|XP_002982390.1| hypothetical protein SELMODRAFT_116186 [Selaginella moellendorffii]
 gb|EFJ16635.1| hypothetical protein SELMODRAFT_116186 [Selaginella moellendorffii]
Length=577

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 67/104 (64%), Gaps = 7/104 (7%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPE----VSET  1104
             P+ KRR  + Q++LQRK  S  +E + ++  +  A  SLL KA+ L+ E  +    +  +
Sbjct  9     PIRKRRFAKQQRLLQRK--SQKIEGQKKEEPKSCAPLSLLEKASLLQHEKQQEGRPLRPS  66

Query  1103  EQMVLQEKEMIEHLSD-RKTLMSVRELAKGITYTEPMLTGWKPP  975
             E++  QEK+M++ L+D ++ L+ V E++KGI YTEPM TGW PP
Sbjct  67    EELQRQEKDMLDRLNDEKRMLLPVSEISKGIKYTEPMHTGWTPP  110



>ref|XP_002404560.1| DEAD box protein abstrakt, putative [Ixodes scapularis]
 gb|EEC01223.1| DEAD box protein abstrakt, putative [Ixodes scapularis]
Length=568

 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 57/89 (64%), Gaps = 4/89 (4%)
 Frame = -2

Query  1229  QRKGKSAALEEEAEKIKQVEAKP--SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHL  1062
              R G S A ++E ++  +   K   SLL + T+LKK  E  + S  E+ + +E++++E +
Sbjct  7     DRSGGSTATDDEDDQRDEYGRKSNVSLLDQHTELKKKAEARKESALEKQLKEEEKILESV  66

Query  1061  SDRKTLMSVRELAKGITYTEPMLTGWKPP  975
             ++R+ LM V ELAKGI Y +P+ TGW+PP
Sbjct  67    AERRALMGVAELAKGIQYDQPIQTGWRPP  95



>ref|XP_002956712.1| hypothetical protein VOLCADRAFT_77220 [Volvox carteri f. nagariensis]
 gb|EFJ42169.1| hypothetical protein VOLCADRAFT_77220 [Volvox carteri f. nagariensis]
Length=648

 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 60/107 (56%), Gaps = 3/107 (3%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQ--RKGKSAALEEEA-EKIKQVEAKPSLLVKATQLKKELPEVSETE  1101
             P+ KRR  E  ++++  R G+  + E    E       K SLLV   + +K+    +E +
Sbjct  66    PLRKRREQEESRLVKLLRGGREGSAERSGSEPPSGDRPKESLLVITARTRKDAGAPNEAQ  125

Query  1100  QMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
              ++ +E +++ H   ++ L +V+ELA G+TY+  M TGWKPPL  R+
Sbjct  126   ALLEEEADIMRHALQKQALKAVKELATGVTYSRSMETGWKPPLRYRR  172



>ref|XP_002528806.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF33579.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=500

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 4/39 (10%)
 Frame = -2

Query  1043  MSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQCN  927
             MSVRELAKGITYTEP+LTGWKPPL IR+  +     QC+
Sbjct  1     MSVRELAKGITYTEPLLTGWKPPLQIRRMSRK----QCD  35



>ref|XP_006816434.1| PREDICTED: probable ATP-dependent RNA helicase DDX41 [Saccoglossus 
kowalevskii]
Length=573

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = -2

Query  1169  AKPSLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPM  996
             A  SLL + ++LKK  E+ + ++ ++ + +E+++++ + ++K LM+V+ELAKGITYTE +
Sbjct  86    ANVSLLDQHSELKKKAEVSKETKLDKQLEEEEKILQSIQEQKALMTVKELAKGITYTEAL  145

Query  995   LTGWKPPLAI  966
             +TGWKPP  I
Sbjct  146   VTGWKPPRYI  155



>ref|XP_010091276.1| DEAD-box ATP-dependent RNA helicase 35 [Morus notabilis]
 gb|EXB44197.1| DEAD-box ATP-dependent RNA helicase 35 [Morus notabilis]
Length=137

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 4/39 (10%)
 Frame = -2

Query  1043  MSVRELAKGITYTEPMLTGWKPPLAIRKYDKS*SIMQCN  927
             MSVRELAKGITYT+P+ TGWKPPL IR+  K     QC+
Sbjct  1     MSVRELAKGITYTDPLPTGWKPPLPIRRMSKK----QCD  35



>ref|XP_010656525.1| PREDICTED: prostatic spermine-binding protein [Vitis vinifera]
 emb|CBI25563.3| unnamed protein product [Vitis vinifera]
Length=173

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  201  MEVGGLSSEVPALTETVVMSvleavvaetllvaQRSVACLFILTGCLLRNNGALPDLSGV  380
            MEVG LSS V AL + +V   +EAVV ETL+ A RS+A + +++G L+    A P L G+
Sbjct  1    MEVGSLSSAVVALEKMMVCCAMEAVVVETLVAAGRSLASILMMSGSLMNVVNASPQLVGM  60

Query  381  EQRFPFEELHKKNEAEVEN  437
            ++RFPF+ELH++ + + +N
Sbjct  61   DERFPFDELHRRKQPDTKN  79



>ref|XP_003384704.1| PREDICTED: probable ATP-dependent RNA helicase DDX41 [Amphimedon 
queenslandica]
Length=622

 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 68/117 (58%), Gaps = 16/117 (14%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKP-------------SLLVKATQLK  1131
             P+ +RR  E +K+ + K K +  EE+ EK K+    P             SLL + ++LK
Sbjct  37    PLRERRKKELEKLEKFKQKRSRFEEQ-EKPKETTGGPEEAEPEIGPRSKVSLLDQHSELK  95

Query  1130  K--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAI  966
             K  E  +VSE ++   +E++++ ++ + + LMSV ELAKG+ Y E ++TGW+PP  I
Sbjct  96    KKAEAHKVSELDKQKEEEEKILHNIQETRALMSVGELAKGVVYKESLVTGWRPPHYI  152



>ref|XP_005651280.1| P-loop containing nucleoside triphosphate hydrolase protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE26736.1| P-loop containing nucleoside triphosphate hydrolase protein [Coccomyxa 
subellipsoidea C-169]
Length=576

 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -2

Query  1175  VEAKPSLLVKATQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPM  996
             V+AK SLL  A + +KE P  +E E+M+ +E+E++ +++ RK L SV E A+GI+YT  +
Sbjct  34    VQAKESLLAAAAKARKEKPAETEAEKMLREEQEIMRNITSRKALKSVMENAQGISYTRNL  93

Query  995   LTGWKPPLAIRK  960
              TGWKPPL +R+
Sbjct  94    KTGWKPPLKVRQ  105



>ref|NP_001071981.1| zinc finger protein [Ciona intestinalis]
 dbj|BAE93318.1| zinc finger protein [Ciona intestinalis]
Length=627

 Score = 58.5 bits (140),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = -2

Query  1160  SLLVKATQLKKELPEVSET--EQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + + LKK+   V ET  +  +++E++++E +++ + L SV++LA+GITY  P++TG
Sbjct  91    SLLDQHSNLKKQAEVVKETAKDLQLIEERKILESVTEARALQSVQDLAQGITYNTPLVTG  150

Query  986   WKPPLAIR  963
             W PP  IR
Sbjct  151   WSPPHFIR  158



>ref|XP_001865238.1| ATP-dependent RNA helicase abstrakt [Culex quinquefasciatus]
 gb|EDS41449.1| ATP-dependent RNA helicase abstrakt [Culex quinquefasciatus]
Length=619

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -2

Query  1247  EAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKK--ELPEVSETEQMVLQEKEM  1074
             EA  + +   ++   EE AE+    +   SLL + T+LKK  E  ++S  E+ + +E+++
Sbjct  56    EASNVGKSSSENEHDEENAEEAWGRKFNISLLDQHTELKKIAEAKKISAVEKQLKEEEKI  115

Query  1073  IEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAI  966
             +E ++++K LM V ELAKGI Y +P+ T WKPP  I
Sbjct  116   LESVAEKKALMGVAELAKGIQYEDPIKTSWKPPRYI  151



>gb|ESA13146.1| hypothetical protein GLOINDRAFT_179791 [Rhizophagus irregularis 
DAOM 181602]
Length=188

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 4/70 (6%)
 Frame = -2

Query  1160  SLLVKATQLKK----ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPML  993
             SL+ +A + KK    E    ++ E+ + +EK ++E ++ R+ L SV+ELAKGI YTEPM 
Sbjct  71    SLIDQAVEAKKQKLIEDSSKTDVEKKLEEEKAIMEAVAQRRLLASVQELAKGIIYTEPMK  130

Query  992   TGWKPPLAIR  963
             T W+PP  IR
Sbjct  131   TTWRPPRQIR  140



>ref|XP_004242730.1| PREDICTED: nucleolin [Solanum lycopersicum]
Length=198

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 59/98 (60%), Gaps = 18/98 (18%)
 Frame = +3

Query  201  MEVGGLSSEVPALTETVVMSvleavvaetllvaQRSVACLFILTGCLLRNNGALPDLSGV  380
            MEV   SS+V A  + VV SVLEAVVAETLLV QRSVA L ++ GCLL++   L +L+ +
Sbjct  1    MEVKSFSSDVAAFGKIVVNSVLEAVVAETLLVTQRSVASLLMVVGCLLKDGAPLSELATI  60

Query  381  ------------------EQRFPFEELHKKNEAEVENK  440
                              ++RFPFE L +KN+A  ENK
Sbjct  61   APSSKFVSIAPLSELISPDRRFPFEALSQKNQACTENK  98



>gb|EFA10652.1| hypothetical protein TcasGA2_TC016289 [Tribolium castaneum]
Length=619

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  +VS  E+ + +E+E++E ++++K LM V ELAKGI Y++P+ T 
Sbjct  83    SLLDQHTELKKLAEAKKVSAVERQLKKEEEILEIVAEKKALMGVSELAKGIQYSDPIKTS  142

Query  986   WKPP  975
             W+PP
Sbjct  143   WRPP  146



>ref|XP_003739731.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Metaseiulus 
occidentalis]
Length=609

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 66/115 (57%), Gaps = 9/115 (8%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKP-------SLLVKATQLKK--ELP  1119
             P+  RR  +  ++  +K ++AA +E  E     E  P       SLL +A +LKK  EL 
Sbjct  27    PLKHRRLEKLARLGVKKDQTAARKESEEDEVSNELGPIPHRPNVSLLDQAQELKKKAELR  86

Query  1118  EVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRKYD  954
             + S  E+ + +E+ +++ +++++ LM V ELAKG+ YTE + T WKPP  I  +D
Sbjct  87    KESAMERQLKEEENILDAVAEKRALMGVAELAKGVQYTESIRTSWKPPSYICDWD  141



>ref|XP_008199686.1| PREDICTED: ATP-dependent RNA helicase abstrakt [Tribolium castaneum]
Length=666

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  +VS  E+ + +E+E++E ++++K LM V ELAKGI Y++P+ T 
Sbjct  130   SLLDQHTELKKLAEAKKVSAVERQLKKEEEILEIVAEKKALMGVSELAKGIQYSDPIKTS  189

Query  986   WKPP  975
             W+PP
Sbjct  190   WRPP  193



>ref|XP_005190431.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Musca domestica]
Length=624

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  ++S+ E+ + +E++++E +  +K LM V ELAKGI Y EP+ T 
Sbjct  88    SLLDQHTELKKIAEAKKISDVEKQLKEEEKILESVQQQKALMGVAELAKGIQYDEPIKTS  147

Query  986   WKPPLAI  966
             WKPP  I
Sbjct  148   WKPPRYI  154



>ref|XP_001661885.1| DEAD box ATP-dependent RNA helicase [Aedes aegypti]
 gb|EAT36170.1| AAEL011744-PA [Aedes aegypti]
Length=619

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -2

Query  1247  EAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKK--ELPEVSETEQMVLQEKEM  1074
             EA  + +   ++   +E AE+    +   SLL + T+LKK  E  ++S  E+ + +E+++
Sbjct  56    EASNVGKSSSENEHDDENAEEAWGRKFNISLLDQHTELKKIAEAKKISAVEKQLKEEEKI  115

Query  1073  IEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAI  966
             +E ++++K LM V ELAKGI Y +P+ T WKPP  I
Sbjct  116   LESVAEKKALMGVAELAKGIQYEDPIKTSWKPPRYI  151



>ref|XP_002505158.1| DEAD/DEAH box helicase [Micromonas sp. RCC299]
 gb|ACO66416.1| DEAD/DEAH box helicase [Micromonas sp. RCC299]
Length=675

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -2

Query  1166  KPSLLVKATQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             K SLL +A  LK     ++  E++  +E  +++ ++D+K LMSV+EL+K + YT  + TG
Sbjct  133   KTSLLSRAAGLKAMASSITPAEKLAQEEAAILKSINDKKALMSVQELSKDVAYTHSIETG  192

Query  986   WKPPLAIRK  960
             WK P  IRK
Sbjct  193   WKAPAHIRK  201



>gb|AAF04040.1|AF187729_1 DEAD-box protein abstrakt [Drosophila melanogaster]
Length=614

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  ++S  E+ + +E++++E ++ +K LM V ELAKGI Y +P+ T 
Sbjct  77    SLLDQHTELKKIAEAKKLSAVEKQLREEEKIMESIAQQKALMGVAELAKGIQYEQPIKTA  136

Query  986   WKPPLAIR  963
             WKPP  IR
Sbjct  137   WKPPRYIR  144



>gb|KFM69924.1| ATP-dependent RNA helicase abstrakt, partial [Stegodyphus mimosarum]
Length=622

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 66/118 (56%), Gaps = 20/118 (17%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQV--------------EAKPSLLVKATQL  1134
             P+ +RR  +    LQR G+  A+ +E EK +                ++  SLL +  +L
Sbjct  39    PLKERRKAK----LQRLGRLGAILQEKEKYRSSTDNENDELEDDFGRKSNVSLLDQHNEL  94

Query  1133  KK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAI  966
             KK  E  + S  E+ + +E++++E +++++ LM V ELAKGI Y EP+ TGW+PP  I
Sbjct  95    KKKAEARKESALEKQLKEEEKILESVAEKRALMGVAELAKGIQYQEPIKTGWRPPRYI  152



>ref|NP_524220.1| abstrakt [Drosophila melanogaster]
 sp|Q9V3C0.1|DDX41_DROME RecName: Full=ATP-dependent RNA helicase abstrakt; Short=DEAD 
box protein abstrakt [Drosophila melanogaster]
 gb|AAF19985.1|AF212866_1 abstrakt protein [Drosophila melanogaster]
 gb|AAF52165.1| abstrakt [Drosophila melanogaster]
 gb|AAK93176.1| LD28839p [Drosophila melanogaster]
 gb|ACL85460.1| abs-PA, partial [synthetic construct]
 gb|ACL90340.1| abs-PA [synthetic construct]
Length=619

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  ++S  E+ + +E++++E ++ +K LM V ELAKGI Y +P+ T 
Sbjct  82    SLLDQHTELKKIAEAKKLSAVEKQLREEEKIMESIAQQKALMGVAELAKGIQYEQPIKTA  141

Query  986   WKPPLAIR  963
             WKPP  IR
Sbjct  142   WKPPRYIR  149



>gb|EKC40522.1| Putative ATP-dependent RNA helicase DDX41 [Crassostrea gigas]
Length=624

 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = -2

Query  1196  EAEKIKQVEAKPSLLVKATQLKKELPEVSET--EQMVLQEKEMIEHLSDRKTLMSVRELA  1023
             + E+   +++K SLL + ++LKK+     ET  E+M+ +E+ ++E ++++K LM V ELA
Sbjct  76    DGEQDIGIQSKVSLLDQHSELKKKAEAKKETAREKMLKEEERILESVAEKKALMGVAELA  135

Query  1022  KGITYTEPMLTGWKPPLAIRKYDKS  948
             KGI Y +P+ TGW+PP  I K  +S
Sbjct  136   KGIQYDKPIKTGWRPPRCILKLSES  160



>gb|KFM26973.1| DEAD-box ATP-dependent RNA helicase 35 [Auxenochlorella protothecoides]
Length=605

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 63/126 (50%), Gaps = 24/126 (19%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGK-----------------------SAALEEEAEKIKQVEAKP  1161
             PV KRR LE Q  L R G+                        AA  ++   ++Q   + 
Sbjct  22    PVKKRRQLEVQSRLSRLGRPSLVAPLNGEPLRNKDGGSSDGAGAAPRDQQPAVQQRGKES  81

Query  1160  SLLVKATQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWK  981
              L++KA  L++ L E +E E+++ +E E++  ++ +  L +  ELAK I YT+ M TGWK
Sbjct  82    LLILKAKALQEGLGE-TEQERVLKEEAELMRSITQKAALKTYAELAKDIKYTQVMKTGWK  140

Query  980   PPLAIR  963
             PPL  R
Sbjct  141   PPLKYR  146



>ref|XP_005850584.1| hypothetical protein CHLNCDRAFT_140503 [Chlorella variabilis]
 gb|EFN58482.1| hypothetical protein CHLNCDRAFT_140503 [Chlorella variabilis]
Length=458

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 55/103 (53%), Gaps = 8/103 (8%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSETEQMV  1092
             P+ KRR +E Q+ L R G++             +A P           ++P  +E E+++
Sbjct  64    PLKKRRQMEEQERLARMGRAPQ--------PTSQAHPGGGQGGEDHGSQVPPETEQERLL  115

Query  1091  LQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
              +E +++  ++ ++ L + +ELAK I+Y+  + TGWKPPL  R
Sbjct  116   KEEADIMRQVTQKQALKTYKELAKDISYSRSINTGWKPPLKYR  158



>ref|XP_005090184.1| PREDICTED: probable ATP-dependent RNA helicase DDX41-like [Aplysia 
californica]
Length=652

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -2

Query  1169  AKPSLLVKATQLKKELPEVSET--EQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPM  996
             A+ SLL +   LKK+     ET  E+M+ +E++++E + ++  LM V ELAKGI YT+P+
Sbjct  113   AQVSLLDQHNVLKKKAEARKETAREKMLKEEEKILESVKEKTALMGVAELAKGIEYTDPI  172

Query  995   LTGWKPPLAI  966
              TGW+PP  I
Sbjct  173   KTGWRPPKYI  182



>dbj|GAA49588.1| ATP-dependent RNA helicase DDX41 [Clonorchis sinensis]
Length=1343

 Score = 56.2 bits (134),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = -2

Query  1169  AKPSLLVKATQLKKELPEVSETE--QMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPM  996
             A+ SL  +  +LKK+  E  ETE  + +  E +++E ++++  LM V ELAKGI Y +P+
Sbjct  805   AQGSLFDRMWELKKKAEERKETERDKKLKVEAKILESVAEKTALMGVAELAKGIQYDKPI  864

Query  995   LTGWKPPLAIRK  960
              TGW PP  IR+
Sbjct  865   QTGWTPPSYIRE  876



>gb|ELU01455.1| hypothetical protein CAPTEDRAFT_148841 [Capitella teleta]
Length=580

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 2/76 (3%)
 Frame = -2

Query  1169  AKPSLLVKATQLKKELP--EVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPM  996
             A  SLL + ++LKKE     VSE E+ + +E++++E ++++  LM V ELAKGI Y E +
Sbjct  41    ADVSLLDQHSRLKKEAEARNVSEREKQLKEEQKILESVAEKTALMGVAELAKGIQYQESI  100

Query  995   LTGWKPPLAIRKYDKS  948
              TGW+PP  I+   +S
Sbjct  101   QTGWQPPKHIQDMPES  116



>ref|XP_005971040.1| PREDICTED: probable ATP-dependent RNA helicase DDX41 [Pantholops 
hodgsonii]
Length=622

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 67/112 (60%), Gaps = 13/112 (12%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQV-----------EAKPSLLVKATQLKK-  1128
             P+ +RR +  QK+LQR+ K AA EE+ +   +            ++  SLL +   LK+ 
Sbjct  38    PLRQRRQMLLQKLLQRRRKGAAEEEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHLKEK  97

Query  1127  -ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPP  975
              E  + S  E+ + +E++++E +++ + LMSV+E+AKGITY +P+ T W PP
Sbjct  98    AEARKESAKEKQLKEEEKILESVAEGRALMSVKEMAKGITYDDPIKTSWTPP  149



>ref|XP_004008770.1| PREDICTED: probable ATP-dependent RNA helicase DDX41 [Ovis aries]
Length=622

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 67/112 (60%), Gaps = 13/112 (12%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQV-----------EAKPSLLVKATQLKK-  1128
             P+ +RR +  QK+LQR+ K AA EE+ +   +            ++  SLL +   LK+ 
Sbjct  38    PLRQRRQMLLQKLLQRRRKGAAEEEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHLKEK  97

Query  1127  -ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPP  975
              E  + S  E+ + +E++++E +++ + LMSV+E+AKGITY +P+ T W PP
Sbjct  98    AEARKESAKEKQLKEEEKILESVAEGRALMSVKEMAKGITYDDPIKTSWTPP  149



>gb|ETN60487.1| ATP-dependent RNA helicase abstrakt [Anopheles darlingi]
Length=314

 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  ++S  E+ + +E++++E ++++K LM V ELAKGI Y +P+ T 
Sbjct  79    SLLDQHTELKKIAEAKKISAVEKQLKEEEKILESVAEKKALMGVAELAKGIQYEDPIKTS  138

Query  986   WKPPLAI  966
             W PP  I
Sbjct  139   WTPPRYI  145



>ref|XP_008211712.1| PREDICTED: ATP-dependent RNA helicase abstrakt [Nasonia vitripennis]
Length=586

 Score = 55.5 bits (132),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  + S  E+ + +E++++E +++ K LM V ELAKGI YT+P+ T 
Sbjct  84    SLLDQHTELKKLAEAKKESAMEKQLKEEEKILESVAENKALMGVAELAKGIEYTDPIKTS  143

Query  986   WKPPLAIRKYD  954
             W+PP  I   D
Sbjct  144   WRPPRTILTKD  154



>ref|XP_003696110.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Apis florea]
Length=621

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  + S  E+ + +E++++E +++ K LM V ELAKGI Y EP+ T 
Sbjct  85    SLLDQHTELKKLAEAKKESAMEKQLKEEEKILESVAENKALMGVAELAKGIQYEEPIKTS  144

Query  986   WKPPLAI  966
             W+PP A+
Sbjct  145   WRPPRAV  151



>ref|XP_006617068.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Apis dorsata]
Length=625

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  + S  E+ + +E++++E +++ K LM V ELAKGI Y EP+ T 
Sbjct  89    SLLDQHTELKKLAEAKKESAMEKQLKEEEKILESVAENKALMGVAELAKGIQYEEPIKTS  148

Query  986   WKPPLAI  966
             W+PP A+
Sbjct  149   WRPPRAV  155



>ref|XP_002117779.1| hypothetical protein TRIADDRAFT_51106 [Trichoplax adhaerens]
 gb|EDV19755.1| hypothetical protein TRIADDRAFT_51106 [Trichoplax adhaerens]
Length=569

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = -2

Query  1235  ILQRKGKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSET--EQMVLQEKEMIEHL  1062
             +L +K     L EE  +  +  +  SLL +  +LKK    ++ET  E+ + +E++++E++
Sbjct  8     LLNKKNYEVRLNEEDGRNLRPNSAVSLLDQHNELKKHAETLNETKHEKQLKEEQKILENI  67

Query  1061  SDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
             S+RK LM+  ELAKGI Y + + T W+PP  +++
Sbjct  68    SERKALMAAAELAKGIKYEKSLRTSWQPPGYLQR  101



>ref|XP_009760721.1| PREDICTED: nucleolin-like [Nicotiana sylvestris]
Length=181

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 5/84 (6%)
 Frame = +3

Query  201  MEVGGLSSEVPALTETVVMSvleavvaetllvaQRSVACLFILTGCLLRNNGALP-----  365
            MEV   SS++ A  + V+ SVLE VVAETLL AQRSVA L I+TGCLL++   L      
Sbjct  1    MEVNSFSSDIIAFGKIVMNSVLEVVVAETLLAAQRSVASLLIMTGCLLKDGAPLAAAPLS  60

Query  366  DLSGVEQRFPFEELHKKNEAEVEN  437
            +L   ++RFPF  L +KN+A  EN
Sbjct  61   ELVSPDKRFPFGLLDQKNDACPEN  84



>ref|XP_004533592.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Ceratitis 
capitata]
Length=622

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  ++S  E+ + +E++++E ++ +K LM V ELAKGI Y +P+ T 
Sbjct  86    SLLDQHTELKKIAEAKKISAVEKQLKEEEKILESVTQQKALMGVAELAKGIQYEDPIKTS  145

Query  986   WKPP  975
             W+PP
Sbjct  146   WRPP  149



>ref|XP_318117.4| AGAP004711-PA [Anopheles gambiae str. PEST]
 gb|EAA13218.5| AGAP004711-PA [Anopheles gambiae str. PEST]
Length=613

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  ++S  E+ + +E++++E ++++K LM V ELAKGI Y +P+ T 
Sbjct  79    SLLDQHTELKKIAEAKKISAVEKQLKEEEKILESVAEKKALMGVAELAKGIQYEDPIKTS  138

Query  986   WKPPLAI  966
             W PP  I
Sbjct  139   WTPPRYI  145



>gb|KFB44006.1| DEAD box ATP-dependent RNA helicase [Anopheles sinensis]
Length=614

 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  ++S  E+ + +E++++E ++++K LM V ELAKGI Y +P+ T 
Sbjct  80    SLLDQHTELKKIAEAKKISAVEKQLKEEEKILESVAEKKALMGVAELAKGIQYEDPIKTS  139

Query  986   WKPPLAI  966
             W PP  I
Sbjct  140   WTPPKYI  146



>ref|XP_003704771.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Megachile 
rotundata]
Length=625

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  + S  E+ + +E++++E +++ K LM V ELAKGI Y +P+ T 
Sbjct  89    SLLDQHTELKKLAEAKKESAMEKQLKEEEKILESVAENKALMGVAELAKGIQYEDPIKTS  148

Query  986   WKPPLAI  966
             W+PP A+
Sbjct  149   WRPPRAV  155



>ref|XP_008554237.1| PREDICTED: ATP-dependent RNA helicase abstrakt [Microplitis demolitor]
Length=618

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  + S  E+ + +E++++E +++ K LM V ELAKGI Y EP+ T 
Sbjct  82    SLLDQHTELKKLAEAKKESALEKQLKEEEKILESVAENKALMGVAELAKGIQYEEPIKTS  141

Query  986   WKPPLAI  966
             W+PP  I
Sbjct  142   WRPPRGI  148



>ref|XP_001359629.1| GA13135 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL28779.1| GA13135 [Drosophila pseudoobscura pseudoobscura]
Length=619

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  ++S  E+ + +E +++E ++ +K LM V ELAKGI Y +P+ T 
Sbjct  82    SLLDQHTELKKIAEAKKLSAVEKQLREEAKIMESIAQQKALMGVAELAKGIQYEDPIKTS  141

Query  986   WKPPLAI  966
             W+PP  I
Sbjct  142   WRPPRYI  148



>ref|XP_003401085.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Bombus terrestris]
Length=625

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  + S  E+ + +E++++E +++ K LM V ELAKGI Y +P+ T 
Sbjct  89    SLLDQHTELKKLAEAKKESAMEKQLKEEEKILESVAENKALMGVAELAKGIQYEDPIKTS  148

Query  986   WKPPLAI  966
             W+PP A+
Sbjct  149   WRPPRAV  155



>ref|XP_002160326.1| PREDICTED: ATP-dependent RNA helicase abstrakt [Hydra vulgaris]
Length=605

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 56/87 (64%), Gaps = 5/87 (6%)
 Frame = -2

Query  1202  EEEAEKIKQVEAKP---SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMS  1038
             ++E +K +++E K    SLL +   LK+  EL + +E E+ + +E++++E +++ K LM+
Sbjct  53    DDEGKKDQEIEIKKNAVSLLDQHHVLKEQAELIKETEIEKRLKEEQKILESIAEHKALMA  112

Query  1037  VRELAKGITYTEPMLTGWKPPLAIRKY  957
               ELA GITYT+P+ T W PP  +  Y
Sbjct  113   ATELAHGITYTDPIKTSWVPPRYVLNY  139



>ref|XP_003490595.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Bombus impatiens]
Length=625

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  + S  E+ + +E++++E +++ K LM V ELAKGI Y +P+ T 
Sbjct  89    SLLDQHTELKKLAEAKKESAMEKQLKEEEKILESVAENKALMGVAELAKGIQYEDPIKTS  148

Query  986   WKPPLAI  966
             W+PP A+
Sbjct  149   WRPPRAV  155



>gb|KDR18857.1| ATP-dependent RNA helicase abstrakt [Zootermopsis nevadensis]
Length=618

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 68/119 (57%), Gaps = 17/119 (14%)
 Frame = -2

Query  1271  PVAKRRALEAQKI---------LQRKGKSAALEE---EAEKIKQVEAKPS---LLVKATQ  1137
             PV +R+  +  K+           ++GKS++  E   E ++  QV  + S   LL + T+
Sbjct  34    PVKERKKFQLVKLGRLTQLKEEFGQRGKSSSENEHDNEDDEDGQVWGRKSNISLLDQHTE  93

Query  1136  LKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAI  966
             LKK  E  + S  E+ + +E++++E ++++K LM V ELAKGI Y +P+ T WKPP  I
Sbjct  94    LKKLAEAKKESAMERQLKEEEKILESVAEKKALMGVAELAKGIQYEDPIKTCWKPPQYI  152



>ref|XP_009630528.1| PREDICTED: glutamic acid-rich protein-like [Nicotiana tomentosiformis]
Length=193

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 55/96 (57%), Gaps = 17/96 (18%)
 Frame = +3

Query  201  MEVGGLSSEVPALTETVVMSvleavvaetllvaQRSVACLFILTGCLLRNNGALPDLSGV  380
            MEV   SS++ A  + V+ SVLE VVAETLL AQRSVA L I+TGCLL+    LP L+  
Sbjct  1    MEVNSFSSDIVAFGKIVMNSVLEVVVAETLLEAQRSVASLLIMTGCLLKAGAPLPGLAAA  60

Query  381  -----------------EQRFPFEELHKKNEAEVEN  437
                             ++RFPF  L +KNEA  EN
Sbjct  61   PLSELVSSAPLSELVSSDKRFPFGLLDQKNEACPEN  96



>ref|XP_006563505.1| PREDICTED: ATP-dependent RNA helicase abstrakt [Apis mellifera]
Length=627

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 2/66 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  + S  E+ + +E++++E +++ K LM V ELAKGI Y EP+ T 
Sbjct  91    SLLDQHTELKKLAEAKKESAMEKQLKEEEKILESVAENKALMGVAELAKGIQYEEPIKTS  150

Query  986   WKPPLA  969
             W+PP A
Sbjct  151   WRPPRA  156



>ref|XP_001700112.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO98406.1| predicted protein [Chlamydomonas reinhardtii]
Length=637

 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 57/112 (51%), Gaps = 8/112 (7%)
 Frame = -2

Query  1271  PVAKRRALEAQKI--LQRKGKSAALEEEAEKIKQVEAKP------SLLVKATQLKKELPE  1116
             P+ KRR  E  ++  L R G+ A   E     +     P      SLLV   +  K+   
Sbjct  53    PLRKRREAEESRLVALLRGGRRAGSAEPDNGGRAGSEPPGDRPKESLLVITARNLKQTGA  112

Query  1115  VSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIRK  960
              +E +  + +E++++ H   ++ L +V+ELA G+ YT  + TGWKPPL  R+
Sbjct  113   PTEAQAALQEEEDIMRHALQKQALKAVKELATGVEYTHSIGTGWKPPLRYRR  164



>ref|XP_004998067.1| DEAD box polypeptide 41 [Salpingoeca rosetta]
 gb|EGD75891.1| DEAD box polypeptide 41 [Salpingoeca rosetta]
Length=619

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -2

Query  1118  EVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
             E S+ E+ + QE+E++  + + K L SV ELAKGI+Y EP+ T W+PP  +R
Sbjct  103   EQSDLEKQLTQEQEILRSIRNAKELKSVEELAKGISYAEPIRTSWRPPRHVR  154



>emb|CDI55090.1| probable DEAD-box ATP-dependent RNA helicase 35 [Melanopsichium 
pennsylvanicum 4]
Length=647

 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 64/120 (53%), Gaps = 17/120 (14%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRK--GKSAAL---------EEEAEKIKQVEAKP--SLLVKATQLK  1131
             P+ +RR  + QKI  R   G SA           E++ ++  +   +P  SLL +A  L+
Sbjct  64    PLKQRRMQQIQKIQSRARAGSSATSSSNLPLEPEEDDEDQHDRAAQRPQRSLLDEARMLR  123

Query  1130  -KELPEVSETEQMVL---QEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
              K+L E  E  Q  +   +E++++E  + R+ L S  ELAKGI YTEP+ T W PP  IR
Sbjct  124   DKKLAEEGERSQADIDAEEERKILEAHAARRKLASDMELAKGIQYTEPLKTSWTPPSYIR  183



>gb|EFZ11376.1| hypothetical protein SINV_10914 [Solenopsis invicta]
Length=626

 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  + S  E+ + +E++++E +++ K LM V ELAKGI Y +P+ T 
Sbjct  90    SLLDQHTELKKLAEAKKESAMEKQLKEEEKILESVAENKALMGVAELAKGIQYKDPIKTN  149

Query  986   WKPPLAI  966
             W+PP  I
Sbjct  150   WQPPRVI  156



>gb|ERL84963.1| hypothetical protein D910_02386 [Dendroctonus ponderosae]
Length=617

 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = -2

Query  1157  LLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGW  984
             LL +  +L+K  E  +VS  E+ + +E+E++E ++++K LM V ELAKGI Y +P+ T W
Sbjct  82    LLDQHNELRKLAEAKKVSAAERQLKKEEEILEIVAEKKALMGVSELAKGIQYNDPIKTSW  141

Query  983   KPPLAIRKYDKS  948
              PP  +  + +S
Sbjct  142   TPPRYVLAFPQS  153



>gb|ENN75170.1| hypothetical protein YQE_08283, partial [Dendroctonus ponderosae]
Length=617

 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = -2

Query  1157  LLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGW  984
             LL +  +L+K  E  +VS  E+ + +E+E++E ++++K LM V ELAKGI Y +P+ T W
Sbjct  82    LLDQHNELRKLAEAKKVSAAERQLKKEEEILEIVAEKKALMGVSELAKGIQYNDPIKTSW  141

Query  983   KPPLAIRKYDKS  948
              PP  +  + +S
Sbjct  142   TPPRYVLAFPQS  153



>ref|NP_491962.1| Protein SACY-1 [Caenorhabditis elegans]
 emb|CCD72466.1| Protein SACY-1 [Caenorhabditis elegans]
Length=630

 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -2

Query  1172  EAKPSLLVKATQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPML  993
             EA+ +LL K  ++ +    + E+E+ +++E+E+++ ++    L++V EL KG  Y EP++
Sbjct  92    EARKTLLEKHAEIMETQGVIDESERQLMEEEELLDKVTRGGGLLAVAELTKGEKYEEPIV  151

Query  992   TGWKPPLAIRK  960
             T W+PP  IR+
Sbjct  152   TAWRPPGHIRR  162



>ref|XP_009163941.1| hypothetical protein T265_12816, partial [Opisthorchis viverrini]
 gb|KER32327.1| hypothetical protein T265_12816, partial [Opisthorchis viverrini]
Length=645

 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = -2

Query  1172  EAKPSLLVKATQLKKELPEVSETEQ--MVLQEKEMIEHLSDRKTLMSVRELAKGITYTEP  999
              A+ SL  +  +LKK+  E  ETE+   +  E +++E ++++  LM V ELAKGI Y +P
Sbjct  106   HAQGSLFDRMWELKKKAEERKETERDKKLKVEAKILESVAEKTALMGVAELAKGIQYDKP  165

Query  998   MLTGWKPPLAIR  963
             + TGW PP  IR
Sbjct  166   IQTGWTPPSYIR  177



>emb|CCF48697.1| probable DEAD-box ATP-dependent RNA helicase 35 [Ustilago hordei]
Length=639

 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 64/116 (55%), Gaps = 13/116 (11%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQR-KGKSAAL------EEEAEKIKQVEAKP--SLLVKATQLK-KEL  1122
             P+ +RR L+ Q +  R +G SA +      EE+ +       +P  SLL +A  L+ K+L
Sbjct  61    PLKQRRLLQLQHVQSRARGSSANMSHNEPEEEDPQPQDDTPQRPQRSLLDEARILREKQL  120

Query  1121  PEVSETEQMVLQEKE---MIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAIR  963
              E  E  Q  ++ +E   ++E  + R+ L S  ELAKGI YTEP+ T W+PP  IR
Sbjct  121   AEQGEKTQAEVEAEEERRILEAHAARRKLASDLELAKGIQYTEPLTTSWRPPSYIR  176



>ref|XP_001952119.1| PREDICTED: ATP-dependent RNA helicase abstrakt [Acyrthosiphon 
pisum]
Length=615

 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 67/120 (56%), Gaps = 22/120 (18%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIK-------------QVEAKPS---LLVKAT  1140
             PV +R+  E  K+    G+ + L+EE+ K+K             QV  + S   LL + T
Sbjct  30    PVRERKKQELLKL----GRLSKLKEESGKVKISSEELDDDESEGQVWGRKSNISLLDQHT  85

Query  1139  QLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAI  966
             +LKK  E  + SE E+ + +E++++E ++++K LM V ELAKGI Y +P+ T W  P  I
Sbjct  86    ELKKLAEAKKESEMEKQLKEEEKILESVAEKKALMGVAELAKGIQYDDPIKTSWTAPRYI  145



>gb|EFN64767.1| ATP-dependent RNA helicase abstrakt [Camponotus floridanus]
Length=620

 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  + S  E+ + +E++++E +++ K LM V ELAKGI Y +P+ T 
Sbjct  84    SLLDQHTELKKLAEAKKESAMEKQLKEEEKILESVAENKALMGVAELAKGIQYKDPIKTN  143

Query  986   WKPPLAIRKYDKS  948
             W+PP  I  + ++
Sbjct  144   WQPPRIILSFGEA  156



>ref|XP_001748669.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ86556.1| predicted protein [Monosiga brevicollis MX1]
Length=592

 Score = 52.8 bits (125),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 66/112 (59%), Gaps = 13/112 (12%)
 Frame = -2

Query  1271  PVAKRR-ALEAQKILQRKGKSAALEEEAEKIKQVEAKP----------SLLVKATQLKK-  1128
             PV KR+  ++AQ++ +RK  +   +   E+ +Q EA+           SL+    +LK+ 
Sbjct  27    PVKKRKEMMQAQRLARRKQPTLEEKAREERRRQQEAEQGAREGPAAGISLMEAHEKLKRA  86

Query  1127  ELPEV-SETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPP  975
             + P V SE +  + QE+E++ ++   K L SV ELAKGI+YTEP+ T W+PP
Sbjct  87    QGPRVESELDIQLKQEEEILRNIRHAKELKSVEELAKGISYTEPLKTSWRPP  138



>ref|XP_005992418.1| PREDICTED: probable ATP-dependent RNA helicase DDX41 [Latimeria 
chalumnae]
Length=617

 Score = 52.8 bits (125),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 68/115 (59%), Gaps = 13/115 (11%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKSAALEEEAEKIKQ-------VEAKP----SLLVKATQLKK-  1128
             PV +R+    QK+++ +GK  A E++ +   +       +   P    SLL +  QLK+ 
Sbjct  33    PVKQRKQQMLQKLIRLRGKGIAEEDQRDSGSEHRDDEDDLHLGPRSSVSLLDQHQQLKEK  92

Query  1127  -ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAI  966
              E  + S  E+ + +E++++E +++ + LMSV+E+AKGITY +P+ T WKPP  I
Sbjct  93    AEARKESAKEKQLKEEEKILESVAEGRALMSVKEMAKGITYDDPIKTSWKPPHYI  147



>gb|EHJ74551.1| putative ATP-dependent RNA helicase abstrakt [Danaus plexippus]
Length=613

 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + ++LK+  E   +S  E+   +E+ +++ ++  K LM V ELAKGI Y+EP+ T 
Sbjct  80    SLLDQHSELKRLAEARALSAAERQAKEEEHILDSVAQSKALMGVAELAKGIQYSEPIKTS  139

Query  986   WKPPLAI  966
             WKPP  I
Sbjct  140   WKPPGCI  146



>ref|XP_009058354.1| hypothetical protein LOTGIDRAFT_163615 [Lottia gigantea]
 gb|ESO91087.1| hypothetical protein LOTGIDRAFT_163615 [Lottia gigantea]
Length=613

 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 70/121 (58%), Gaps = 19/121 (16%)
 Frame = -2

Query  1271  PVAKRRALEAQKILQRKGKS-AALEEEAEKIKQVE----------------AKPSLLVKA  1143
             P+ +R+  + Q I ++ G++ A +++E EK +                   A  SLL + 
Sbjct  23    PIKQRKKQQMQAIEKKLGRTVATIKQEEEKKESTNDEEEVEEDPESSVGPNAHISLLDQH  82

Query  1142  TQLKKELPEVSET--EQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLA  969
             ++LKK+     ET  E+++ +E++++E ++++K LM V ELAKGI Y +P+ TGW+PP  
Sbjct  83    SELKKKAEAKKETAREKLLKEEEKILESVAEKKALMGVAELAKGIQYEDPIKTGWRPPRY  142

Query  968   I  966
             I
Sbjct  143   I  143



>ref|XP_003060455.1| DEAD/DEAH box helicase [Micromonas pusilla CCMP1545]
 gb|EEH55224.1| DEAD/DEAH box helicase [Micromonas pusilla CCMP1545]
Length=671

 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  1160  SLLVKATQLKKELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWK  981
             SLL +A  LK+   + +  +++V +E  ++++++++K LMS +E++K +TYT+ + TGWK
Sbjct  131   SLLSRAAGLKEMANKQTPAQKLVEEEAAIMKNITEKKALMSAQEISKDVTYTQSIETGWK  190

Query  980   PPLAI  966
             PP  I
Sbjct  191   PPTHI  195



>ref|XP_796437.3| PREDICTED: probable ATP-dependent RNA helicase DDX41 [Strongylocentrotus 
purpuratus]
Length=620

 Score = 52.4 bits (124),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 62/108 (57%), Gaps = 10/108 (9%)
 Frame = -2

Query  1262  KRRALEAQKILQRK-------GKSAALEEEAEKIKQVEAKPSLLVKATQLKKELPEVSET  1104
             K++    QKI+ R+       G+   LEEE E      A  SLL + ++LKK+      T
Sbjct  44    KQKVDRIQKIVTRRVVEPNEDGEKQYLEEE-ELDTGPRANVSLLDQHSELKKKAESTKST  102

Query  1103  --EQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTGWKPPLAI  966
               ++ + +E++++ ++ +++ L +  ELAKGI Y+E ++TGWKPP  I
Sbjct  103   ALDKQLEEEQKILNNIQEQRALKTAAELAKGIIYSESLVTGWKPPRCI  150



>gb|EFN82776.1| ATP-dependent RNA helicase abstrakt [Harpegnathos saltator]
Length=624

 Score = 52.4 bits (124),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  1160  SLLVKATQLKK--ELPEVSETEQMVLQEKEMIEHLSDRKTLMSVRELAKGITYTEPMLTG  987
             SLL + T+LKK  E  + S  E+ + +E++++E +++ K LM V ELAKGI Y +P+ T 
Sbjct  88    SLLDQHTELKKLAEAKKESAMEKQLKEEEKILESVAENKALMGVAELAKGIQYKDPIKTS  147

Query  986   WKPPLAI  966
             W PP  I
Sbjct  148   WHPPRVI  154



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4235478590672