BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25347_g5_i1 len=1068 path=[16077:0-0 16078:1-21 347:22-36
362:37-1067]

Length=1068
                                                                      Score     E

gb|AAF45022.1|  RNase-like protein                                    78.2    3e-13   Calystegia sepium
pdb|1JY5|A  Chain A, Rnase-Related Protein From Calystegia Sepium     67.8    6e-10   



>gb|AAF45022.1| RNase-like protein [Calystegia sepium]
Length=253

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = -3

Query  1063  SAIKNALGVTPIVKCNGHSPIREIQICFDKTLQIEECPTYAPSKCPSRVKLPIKNVTQVP  884
             SAI++AL VTP+VKC   + + ++QICFDKTLQ++ECP+ A S CPS V LPIKN  + P
Sbjct  184   SAIQSALRVTPVVKCKSDA-VEQVQICFDKTLQLQECPSTA-STCPSLVSLPIKNTIK-P  240

Query  883   ETTNYLSFRG  854
               TN LSFRG
Sbjct  241   LETNNLSFRG  250



>pdb|1JY5|A Chain A, Rnase-Related Protein From Calystegia Sepium
 pdb|1JY5|B Chain B, Rnase-Related Protein From Calystegia Sepium
Length=212

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = -3

Query  1063  SAIKNALGVTPIVKCNGHSPIREIQICFDKTLQIEECPTYAPSKCPSRVKLPIKNV  896
             SAI++AL VTP+VKC   + + ++QICFDKTLQ++ECP+ A S CPS V LPIKN 
Sbjct  156   SAIQSALRVTPVVKCKSDA-VEQVQICFDKTLQLQECPSTA-STCPSLVSLPIKNT  209



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2484844096704