BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25341_g2_i7 len=2444 path=[2422:0-48 @11339@!:49-338 2761:339-354
2777:355-407 2830:408-413 @2836@!:414-1285 3708:1286-1286
@3709@!:1287-1932 11681:1933-2443]

Length=2444
                                                                      Score     E

ref|XP_004229153.1|  PREDICTED: paladin                                 517   0.0      
ref|XP_006365451.1|  PREDICTED: paladin-like isoform X2                 516   0.0      
ref|XP_006365450.1|  PREDICTED: paladin-like isoform X1                 516   0.0      
ref|XP_011079463.1|  PREDICTED: paladin                                 513   0.0      
ref|XP_009625448.1|  PREDICTED: paladin-like                            512   0.0      
ref|XP_009759729.1|  PREDICTED: paladin                                 511   0.0      
ref|XP_007051345.1|  Uncharacterized protein isoform 2                  506   0.0      
ref|XP_007051344.1|  Uncharacterized protein isoform 1                  506   0.0      
gb|EYU46893.1|  hypothetical protein MIMGU_mgv1a000330mg                504   0.0      
ref|XP_010091448.1|  hypothetical protein L484_013904                   496   0.0      
ref|XP_002282028.2|  PREDICTED: paladin                                 497   0.0      Vitis vinifera
ref|XP_007221462.1|  hypothetical protein PRUPE_ppa000439mg             488   0.0      
emb|CBI37075.3|  unnamed protein product                                496   0.0      
ref|XP_003554588.1|  PREDICTED: paladin-like                            493   0.0      
ref|XP_002515140.1|  conserved hypothetical protein                     496   0.0      Ricinus communis
gb|KHN43392.1|  Paladin                                                 492   0.0      
ref|XP_006375411.1|  hypothetical protein POPTR_0014s10550g             506   0.0      
ref|XP_011039874.1|  PREDICTED: paladin-like isoform X2                 514   0.0      
ref|XP_009341534.1|  PREDICTED: paladin-like                            489   0.0      
gb|KHN14188.1|  Paladin                                                 488   0.0      
ref|XP_010245396.1|  PREDICTED: paladin isoform X1                      493   0.0      
ref|XP_008343230.1|  PREDICTED: paladin-like                            489   0.0      
ref|XP_004495834.1|  PREDICTED: paladin-like                            492   0.0      
ref|XP_003520779.1|  PREDICTED: paladin-like isoform X1                 488   0.0      
ref|XP_010245398.1|  PREDICTED: paladin isoform X3                      493   0.0      
ref|XP_011039866.1|  PREDICTED: paladin-like isoform X1                 514   0.0      
ref|XP_004288658.1|  PREDICTED: paladin-like                            488   0.0      
gb|KDP28373.1|  hypothetical protein JCGZ_14144                         501   0.0      
ref|XP_002301459.2|  hypothetical protein POPTR_0002s18520g             505   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003535306.1|  PREDICTED: paladin-like isoform X1                 492   0.0      
ref|XP_006589084.1|  PREDICTED: paladin-like isoform X4                 492   0.0      
ref|XP_002301458.2|  hypothetical protein POPTR_0002s18520g             504   0.0      Populus trichocarpa [western balsam poplar]
gb|AES61538.2|  metal ion-binding protein                               484   0.0      
ref|XP_003555761.1|  PREDICTED: paladin-like isoform X1                 484   0.0      
ref|XP_006589083.1|  PREDICTED: paladin-like isoform X3                 491   0.0      
ref|XP_011025294.1|  PREDICTED: paladin isoform X1                      502   0.0      
ref|XP_004494491.1|  PREDICTED: paladin-like                            485   0.0      
ref|XP_011025295.1|  PREDICTED: paladin isoform X2                      501   0.0      
gb|KDO86721.1|  hypothetical protein CISIN_1g0008351mg                  493   0.0      
gb|KDO86718.1|  hypothetical protein CISIN_1g0008351mg                  492   0.0      
ref|XP_008458276.1|  PREDICTED: paladin                                 498   0.0      
ref|XP_006491438.1|  PREDICTED: paladin-like isoform X3                 491   0.0      
ref|XP_006444662.1|  hypothetical protein CICLE_v10018541mg             492   0.0      
ref|XP_006491437.1|  PREDICTED: paladin-like isoform X2                 491   0.0      
ref|XP_006491436.1|  PREDICTED: paladin-like isoform X1                 491   0.0      
ref|XP_007163266.1|  hypothetical protein PHAVU_001G220000g             478   0.0      
ref|XP_003591287.1|  Paladin                                            484   0.0      
ref|XP_010523868.1|  PREDICTED: paladin-like isoform X2                 499   0.0      
ref|XP_010679493.1|  PREDICTED: paladin isoform X1                      480   0.0      
ref|XP_010679494.1|  PREDICTED: paladin isoform X2                      480   0.0      
gb|ABN05887.1|  [2Fe-2S]-binding                                        485   0.0      Medicago truncatula
ref|XP_010523869.1|  PREDICTED: paladin-like isoform X3                 499   0.0      
ref|XP_010523867.1|  PREDICTED: paladin-like isoform X1                 498   0.0      
gb|AES82318.2|  metal ion-binding protein                               485   0.0      
ref|XP_004166079.1|  PREDICTED: paladin-like                            479   0.0      
ref|XP_004138513.1|  PREDICTED: paladin-like                            479   0.0      
ref|XP_010544901.1|  PREDICTED: paladin-like isoform X3                 496   0.0      
ref|XP_010544900.1|  PREDICTED: paladin-like isoform X2                 496   0.0      
ref|XP_010544899.1|  PREDICTED: paladin-like isoform X1                 496   0.0      
ref|XP_008227749.1|  PREDICTED: LOW QUALITY PROTEIN: paladin            492   0.0      
ref|XP_010512582.1|  PREDICTED: paladin                                 493   0.0      
ref|XP_010413320.1|  PREDICTED: paladin-like isoform X2                 493   0.0      
ref|XP_010413319.1|  PREDICTED: paladin-like isoform X1                 493   0.0      
ref|XP_006290508.1|  hypothetical protein CARUB_v10016586mg             491   0.0      
emb|CAB71908.1|  putative protein                                       492   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008798514.1|  PREDICTED: paladin isoform X2                      485   0.0      
ref|XP_010473779.1|  PREDICTED: uncharacterized protein LOC104753188    491   0.0      
ref|XP_002876651.1|  metal ion binding protein                          492   0.0      
ref|XP_008798513.1|  PREDICTED: paladin isoform X1                      485   0.0      
ref|XP_010035361.1|  PREDICTED: paladin isoform X3                      483   0.0      
ref|NP_191760.2|  uncharacterized protein                               491   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010035359.1|  PREDICTED: paladin isoform X1                      483   0.0      
ref|XP_010035360.1|  PREDICTED: paladin isoform X2                      483   0.0      
gb|KCW46724.1|  hypothetical protein EUGRSUZ_K00546                     483   0.0      
emb|CDY11391.1|  BnaA09g39570D                                          494   0.0      
ref|XP_006402420.1|  hypothetical protein EUTSA_v10005753mg             493   0.0      
ref|XP_010905896.1|  PREDICTED: paladin                                 491   0.0      
gb|KFK35385.1|  hypothetical protein AALP_AA5G278400                    496   0.0      
ref|XP_010035529.1|  PREDICTED: paladin-like                            476   0.0      
gb|KCW46950.1|  hypothetical protein EUGRSUZ_K00763                     476   0.0      
ref|XP_010245397.1|  PREDICTED: paladin isoform X2                      493   0.0      
ref|XP_009116873.1|  PREDICTED: LOW QUALITY PROTEIN: paladin            488   0.0      
ref|XP_003626100.1|  Paladin                                            465   0.0      
ref|NP_001190158.1|  uncharacterized protein                            481   0.0      
ref|XP_006589082.1|  PREDICTED: paladin-like isoform X2                 492   0.0      
ref|XP_006605769.1|  PREDICTED: paladin-like isoform X2                 484   0.0      
ref|XP_006841555.1|  hypothetical protein AMTR_s00003p00177190          476   0.0      
ref|XP_009386586.1|  PREDICTED: paladin                                 450   0.0      
ref|XP_004982503.1|  PREDICTED: paladin-like                            470   0.0      
ref|XP_009363139.1|  PREDICTED: LOW QUALITY PROTEIN: paladin            467   0.0      
ref|NP_001050571.1|  Os03g0586700                                       469   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEE59421.1|  hypothetical protein OsJ_11578                          469   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC75650.1|  hypothetical protein OsI_12405                          469   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006651575.1|  PREDICTED: paladin-like                            467   0.0      
emb|CDP17042.1|  unnamed protein product                                493   0.0      
gb|KHG05599.1|  Paladin                                                 491   0.0      
ref|XP_002966937.1|  hypothetical protein SELMODRAFT_86711              426   0.0      
gb|KDO86720.1|  hypothetical protein CISIN_1g0008351mg                  492   0.0      
ref|XP_002464278.1|  hypothetical protein SORBIDRAFT_01g015540          461   8e-177   Sorghum bicolor [broomcorn]
emb|CDY16323.1|  BnaC01g23580D                                          422   1e-176   
tpg|DAA50154.1|  TPA: hypothetical protein ZEAMMB73_212285              457   1e-175   
tpg|DAA50155.1|  TPA: hypothetical protein ZEAMMB73_212285              457   1e-175   
ref|XP_002961070.1|  hypothetical protein SELMODRAFT_164100             425   4e-175   
dbj|BAJ95291.1|  predicted protein                                      458   4e-175   
ref|XP_008665018.1|  PREDICTED: uncharacterized protein LOC103643638    455   5e-175   
emb|CDY33295.1|  BnaA01g19620D                                          418   3e-174   
ref|XP_003562330.1|  PREDICTED: paladin                                 458   1e-173   
gb|KHG09004.1|  Paladin                                                 363   3e-160   
ref|XP_001766909.1|  predicted protein                                  407   2e-155   
gb|EPS73348.1|  hypothetical protein M569_01409                         339   1e-152   
ref|XP_001773894.1|  predicted protein                                  385   3e-147   
gb|EMT06697.1|  hypothetical protein F775_21513                         452   4e-141   
gb|EMS46929.1|  hypothetical protein TRIUR3_15351                       434   6e-139   
ref|XP_008381644.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    340   1e-129   
ref|XP_010515494.1|  PREDICTED: paladin-like                            250   2e-106   
gb|EPS58742.1|  hypothetical protein M569_16071                         235   1e-100   
emb|CDY71546.1|  BnaCnng73370D                                          280   8e-81    
gb|KHG19274.1|  Paladin                                                 211   4e-80    
ref|XP_002948448.1|  hypothetical protein VOLCADRAFT_120628             222   2e-77    
ref|XP_005844920.1|  hypothetical protein CHLNCDRAFT_26452              264   4e-71    
gb|KFK34389.1|  hypothetical protein AALP_AA5G138900                    235   4e-67    
gb|KFM27931.1|  Triosephosphate isomerase, chloroplastic                252   5e-66    
gb|EMS46930.1|  hypothetical protein TRIUR3_15352                       231   2e-64    
ref|XP_004345330.1|  hypothetical protein CAOG_06581                    203   5e-59    
ref|XP_001700224.1|  predicted protein                                  214   1e-55    Chlamydomonas reinhardtii
gb|KDR78950.1|  hypothetical protein GALMADRAFT_244621                  167   3e-54    
gb|EPB92542.1|  hypothetical protein HMPREF1544_00555                   174   3e-54    
ref|XP_004340328.1|  [2Fe2S]-binding, putative                          213   4e-54    
ref|XP_007318442.1|  hypothetical protein SERLADRAFT_438035             179   7e-54    
gb|EGN98834.1|  hypothetical protein SERLA73DRAFT_73426                 179   9e-54    
gb|KDQ57083.1|  hypothetical protein JAAARDRAFT_194263                  163   2e-53    
ref|XP_010035356.1|  PREDICTED: uncharacterized protein LOC104424603    192   2e-52    
ref|XP_006680796.1|  hypothetical protein BATDEDRAFT_35709              149   2e-52    
emb|CCF49131.1|  uncharacterized protein UHOR_08550                     172   2e-52    
gb|EST07320.1|  metal ion binding/oxidoreductase                        172   4e-52    
dbj|GAK67388.1|  metal ion binding oxidoreductase                       172   4e-52    
dbj|GAC76331.1|  hypothetical protein PANT_20c00064                     172   4e-52    
ref|XP_007867527.1|  hypothetical protein GLOTRDRAFT_116807             174   9e-52    
ref|XP_007766033.1|  hypothetical protein CONPUDRAFT_100245             171   1e-51    
ref|XP_007383326.1|  hypothetical protein PUNSTDRAFT_125979             178   1e-51    
gb|EMD34003.1|  hypothetical protein CERSUDRAFT_117523                  175   3e-51    
ref|XP_007300130.1|  hypothetical protein STEHIDRAFT_153038             175   4e-51    
emb|CBQ71295.1|  conserved hypothetical protein                         168   4e-51    
ref|XP_007881966.1|  hypothetical protein PFL1_06237                    171   2e-50    
emb|CDI56586.1|  conserved hypothetical protein                         171   2e-50    
dbj|GAC94223.1|  metal ion binding/oxidoreductase                       167   2e-50    
ref|XP_007393753.1|  hypothetical protein PHACADRAFT_159548             174   4e-50    
ref|XP_001836455.2|  hypothetical protein CC1G_07102                    177   4e-50    Coprinopsis cinerea okayama7#130
ref|XP_003031568.1|  hypothetical protein SCHCODRAFT_82158              179   7e-50    
emb|CDO71831.1|  hypothetical protein BN946_scf184939.g55               173   9e-50    
ref|XP_004340331.1|  [2Fe2S]-binding, putative                          188   1e-49    
ref|XP_007362596.1|  hypothetical protein DICSQDRAFT_133514             170   3e-49    
dbj|GAA95288.1|  hypothetical protein E5Q_01944                         177   5e-49    
emb|CEG76654.1|  hypothetical protein RMATCC62417_11516                 173   2e-48    
ref|XP_006459279.1|  hypothetical protein AGABI2DRAFT_149440            172   2e-48    
ref|XP_007342889.1|  hypothetical protein AURDEDRAFT_161927             172   3e-48    
gb|EJU05109.1|  hypothetical protein DACRYDRAFT_93438                   151   4e-48    
gb|EPB85124.1|  hypothetical protein HMPREF1544_08096                   194   1e-47    
ref|XP_007330496.1|  hypothetical protein AGABI1DRAFT_100687            171   1e-47    
ref|XP_007263156.1|  hypothetical protein FOMMEDRAFT_75682              172   1e-47    
ref|XP_003194171.1|  hypothetical protein CGB_E1280C                    176   2e-47    
gb|KDN52550.1|  hypothetical protein K437DRAFT_272412                   159   1e-46    
emb|CCL99307.1|  predicted protein                                      156   2e-46    
ref|XP_009545553.1|  hypothetical protein HETIRDRAFT_157046             157   4e-46    
ref|XP_008039528.1|  hypothetical protein TRAVEDRAFT_59033              162   7e-46    
ref|XP_001731926.1|  hypothetical protein MGL_1194                      162   1e-45    Malassezia globosa CBS 7966
gb|EPY20257.1|  metal ion binding protein                               163   1e-45    
emb|CCU97986.1|  unnamed protein product                                165   2e-45    
ref|XP_007003108.1|  hypothetical protein TREMEDRAFT_71244              186   4e-45    
ref|XP_007845369.1|  metal ion binding oxidoreductase                   145   5e-45    
emb|CDS10751.1|  hypothetical protein LRAMOSA11237                      182   6e-44    
ref|XP_775384.1|  hypothetical protein CNBE1000                         179   6e-43    Cryptococcus neoformans var. neoformans B-3501A
gb|EUC64838.1|  paladin                                                 157   7e-43    
gb|KEP53878.1|  paladin                                                 157   8e-43    
gb|AFR95381.2|  hypothetical protein CNAG_02453                         178   9e-43    
emb|CDH52841.1|  metal ion binding oxidoreductase                       178   1e-42    
gb|EIE75770.1|  hypothetical protein RO3G_00474                         176   3e-42    
emb|CCC49677.1|  conserved hypothetical protein                         177   3e-42    
gb|EKF26835.1|  hypothetical protein MOQ_009457                         175   9e-42    
gb|ESS66180.1|  hypothetical protein TCDM_05183                         175   1e-41    
gb|EKG08643.1|  hypothetical protein TCSYLVIO_000202                    175   1e-41    
emb|CEG74475.1|  hypothetical protein RMATCC62417_09684                 174   1e-41    
emb|CEI97280.1|  hypothetical protein RMCBS344292_11416                 174   2e-41    
emb|CEI95581.1|  hypothetical protein RMCBS344292_09763                 174   2e-41    
gb|KDQ24421.1|  hypothetical protein PLEOSDRAFT_1113782                 174   2e-41    
ref|XP_814992.1|  hypothetical protein                                  174   3e-41    Trypanosoma cruzi strain CL Brener
emb|CCA74608.1|  hypothetical protein PIIN_08560                        135   3e-41    
ref|XP_003307081.2|  hypothetical protein PGTG_00031                    173   5e-41    
ref|XP_007418547.1|  hypothetical protein MELLADRAFT_118580             172   1e-40    
gb|EKC97283.1|  hypothetical protein A1Q2_08441                         172   1e-40    
gb|EPY27173.1|  metal ion binding protein                               171   1e-40    
gb|EJT49655.1|  hypothetical protein A1Q1_01153                         171   3e-40    
gb|KDE05245.1|  hypothetical protein MVLG_04380                         171   3e-40    
emb|CCD14361.1|  unnamed protein product                                170   4e-40    
ref|XP_762163.1|  hypothetical protein UM06016.1                        170   4e-40    Ustilago maydis 521
ref|XP_009312944.1|  metal ion binding protein                          170   6e-40    
emb|CCW72255.1|  unnamed protein product                                169   6e-40    
gb|ESL11393.1|  hypothetical protein TRSC58_00858                       169   7e-40    
gb|KDQ19345.1|  hypothetical protein BOTBODRAFT_62757                   169   9e-40    
ref|XP_001683492.1|  conserved hypothetical protein                     169   1e-39    Leishmania major strain Friedlin
ref|XP_001465845.1|  conserved hypothetical protein                     167   6e-39    Leishmania infantum JPCM5
ref|XP_010699317.1|  hypothetical protein LPMP_231610                   166   7e-39    
ref|XP_003861064.1|  hypothetical protein, conserved                    166   7e-39    
ref|XP_001565229.1|  conserved hypothetical protein                     166   7e-39    Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_003875787.1|  conserved hypothetical protein                     165   2e-38    
gb|EPT01640.1|  hypothetical protein FOMPIDRAFT_1119753                 164   4e-38    
ref|XP_570850.1|  hypothetical protein                                  162   2e-37    Cryptococcus neoformans var. neoformans JEC21
ref|XP_008869505.1|  hypothetical protein H310_06280                    128   2e-37    
gb|EPZ34073.1|  hypothetical protein O9G_005505                         159   1e-36    
ref|XP_847172.1|  hypothetical protein                                  159   1e-36    Trypanosoma brucei brucei TREU927
emb|CBH13371.1|  hypothetical protein, conserved                        159   1e-36    Trypanosoma brucei gambiense DAL972
gb|EMS18219.1|  metal ion binding protein                               157   9e-36    
emb|CEI95582.1|  hypothetical protein RMCBS344292_09764                 150   9e-36    
ref|XP_009267768.1|  Rho-GTPase-activating protein 5                    155   4e-35    
ref|XP_006956965.1|  hypothetical protein WALSEDRAFT_59683              152   1e-34    
ref|XP_009600981.1|  PREDICTED: paladin                                 114   1e-33    
gb|KGB78067.1|  hypothetical protein CNBG_4154                          128   2e-33    
gb|KDO23649.1|  hypothetical protein SPRG_11097                         108   1e-32    
ref|XP_009757297.1|  PREDICTED: paladin-like                            134   3e-32    
gb|KDN50525.1|  hypothetical protein RSAG8_01023                        142   2e-31    
ref|XP_008908159.1|  hypothetical protein PPTG_12724                    106   3e-31    
gb|ETO71692.1|  hypothetical protein F444_12002                         108   5e-31    
ref|XP_008908161.1|  hypothetical protein, variant 2                    108   6e-31    
gb|ETO71694.1|  hypothetical protein, variant 2                         108   6e-31    
emb|CCO28893.1|  Paladin                                                119   6e-31    
gb|ETI30001.1|  hypothetical protein F443_22880                         107   7e-31    
gb|ETP40902.1|  hypothetical protein F442_11830                         107   7e-31    
ref|XP_010515500.1|  PREDICTED: paladin-like isoform X4                 131   7e-31    
ref|XP_008908160.1|  hypothetical protein, variant 1                    107   8e-31    
gb|ETO71693.1|  hypothetical protein, variant 1                         107   8e-31    
gb|ETL89698.1|  hypothetical protein L917_11404                         105   2e-30    
gb|ETL89700.1|  hypothetical protein, variant 2                         105   3e-30    
gb|ETL89699.1|  hypothetical protein, variant 1                         105   4e-30    
ref|XP_010515497.1|  PREDICTED: paladin-like isoform X1                 130   9e-30    
emb|CCI39244.1|  unnamed protein product                                135   2e-29    
ref|XP_009495967.1|  hypothetical protein H696_03833                    135   5e-29    
gb|KFG26252.1|  hypothetical protein NESG_01371                         134   1e-28    
gb|EHY66079.1|  hypothetical protein NERG_00775                         133   2e-28    
gb|EPR79011.1|  Paladin-like protein                                    129   4e-28    
emb|CCA20737.1|  paladinlike protein putative                           131   6e-28    
gb|KDO86716.1|  hypothetical protein CISIN_1g0008352mg                  119   1e-27    
ref|XP_010515499.1|  PREDICTED: paladin-like isoform X3                 121   2e-27    
gb|KCW46718.1|  hypothetical protein EUGRSUZ_K005411                    118   3e-27    
ref|XP_010515498.1|  PREDICTED: paladin-like isoform X2                 121   4e-27    
gb|KDO20602.1|  hypothetical protein SPRG_12958                         126   1e-26    
gb|KDO18091.1|  hypothetical protein SPRG_16545                         124   2e-26    
emb|CCO28892.1|  Paladin                                                122   3e-26    
ref|XP_009839293.1|  hypothetical protein H257_13473                    125   3e-26    
ref|XP_009839294.1|  hypothetical protein, variant                    91.7    2e-25    
ref|XP_008610483.1|  hypothetical protein SDRG_06481                    123   2e-25    
gb|KDO86715.1|  hypothetical protein CISIN_1g0008352mg                  112   3e-25    
ref|XP_008075028.1|  hypothetical protein VCUG_02014                    120   1e-24    
gb|EIJ89051.1|  hypothetical protein NEQG_00870                         119   4e-24    
emb|CDY16324.1|  BnaC01g23590D                                          109   5e-24    
gb|KFV99345.1|  Paladin                                               90.9    9e-23    
ref|XP_010159364.1|  PREDICTED: paladin                               89.4    2e-22    
ref|XP_002898155.1|  paladin-like protein                               113   2e-22    
gb|KFO69556.1|  Paladin                                               88.6    3e-22    
ref|XP_009554306.1|  PREDICTED: paladin                               88.6    3e-22    
ref|XP_008621629.1|  hypothetical protein SDRG_17170                    110   1e-21    
gb|ELQ76216.1|  protein-tyrosine-phosphatase                            107   1e-21    
gb|ETM42973.1|  hypothetical protein L914_11455                         107   4e-21    
ref|XP_009525292.1|  hypothetical protein PHYSODRAFT_360267             108   6e-21    
ref|XP_009996506.1|  PREDICTED: paladin                               88.2    1e-20    
gb|KFU90052.1|  Paladin                                               87.0    2e-20    
gb|EMT06698.1|  hypothetical protein F775_32692                         100   2e-19    
gb|KGG52219.1|  hypothetical protein DI09_19p10                         102   9e-19    
gb|EMS46928.1|  hypothetical protein TRIUR3_15350                     98.6    1e-18    
gb|KHG27810.1|  L-aspartate oxidase                                   86.3    4e-18    
emb|CBN81517.1|  Paladin                                              98.6    1e-17    
gb|ETO26326.1|  hypothetical protein RFI_10812                        96.3    3e-17    
gb|KFP17966.1|  Paladin                                               96.7    4e-17    
ref|XP_009639488.1|  PREDICTED: LOW QUALITY PROTEIN: paladin          96.3    4e-17    
ref|XP_007897235.1|  PREDICTED: paladin-like                          73.6    4e-17    
emb|CBK20746.2|  unnamed protein product                              92.8    5e-17    
gb|KFP71706.1|  Paladin                                               95.9    6e-17    
ref|XP_009082294.1|  PREDICTED: paladin                               95.9    6e-17    
ref|XP_001631799.1|  predicted protein                                91.7    9e-17    Nematostella vectensis
ref|XP_006791167.1|  PREDICTED: paladin-like isoform X1               95.5    9e-17    
ref|XP_006791168.1|  PREDICTED: paladin-like isoform X2               95.1    1e-16    
gb|ETO31327.1|  hypothetical protein RFI_05794                        94.0    1e-16    
ref|XP_010866655.1|  PREDICTED: paladin isoform X1                    70.9    1e-16    
ref|XP_010578234.1|  PREDICTED: paladin                               94.4    2e-16    
ref|XP_009953447.1|  PREDICTED: LOW QUALITY PROTEIN: paladin          94.0    3e-16    
ref|XP_005471433.1|  PREDICTED: paladin-like                          94.0    3e-16    
gb|KFW68314.1|  Paladin                                               93.6    3e-16    
emb|CAG04802.1|  unnamed protein product                              93.6    4e-16    
ref|XP_004561299.1|  PREDICTED: paladin-like isoform X1               93.6    4e-16    
ref|XP_004561300.1|  PREDICTED: paladin-like isoform X2               93.6    4e-16    
ref|XP_004561301.1|  PREDICTED: paladin-like isoform X3               93.6    4e-16    
ref|XP_005736483.1|  PREDICTED: paladin-like isoform X1               93.6    4e-16    
ref|XP_005919636.1|  PREDICTED: paladin-like isoform X1               93.2    4e-16    
ref|XP_010742256.1|  PREDICTED: paladin                               93.2    4e-16    
ref|XP_005736484.1|  PREDICTED: paladin-like isoform X2               93.2    4e-16    
ref|XP_005919637.1|  PREDICTED: paladin-like isoform X2               93.2    4e-16    
gb|EMC85802.1|  Paladin                                               92.4    5e-16    
ref|XP_009575016.1|  PREDICTED: paladin-like                          90.9    5e-16    
ref|XP_007421757.1|  PREDICTED: paladin isoform X1                    92.8    5e-16    
gb|KFO86977.1|  Paladin                                               92.8    6e-16    
gb|ETO13244.1|  hypothetical protein RFI_24133                        92.4    7e-16    
ref|XP_009324247.1|  PREDICTED: paladin                               92.4    8e-16    
gb|KFV65917.1|  Paladin                                               92.0    9e-16    
ref|XP_008287060.1|  PREDICTED: paladin isoform X3                    92.0    1e-15    
ref|XP_008287059.1|  PREDICTED: paladin isoform X2                    92.0    1e-15    
ref|XP_008287058.1|  PREDICTED: paladin isoform X1                    92.0    1e-15    
ref|XP_006027953.1|  PREDICTED: paladin isoform X1                    92.0    1e-15    
ref|XP_006265119.1|  PREDICTED: paladin                               92.0    1e-15    
ref|XP_010129960.1|  PREDICTED: paladin                               91.7    1e-15    
ref|XP_009896958.1|  PREDICTED: paladin                               91.7    1e-15    
ref|XP_008104862.1|  PREDICTED: paladin                               91.7    1e-15    
gb|ETE67025.1|  Paladin                                               91.3    2e-15    
gb|KFM02557.1|  Paladin                                               91.3    2e-15    
ref|XP_004080460.1|  PREDICTED: paladin-like                          91.3    2e-15    
ref|XP_005533156.1|  PREDICTED: paladin                               91.3    2e-15    
ref|NP_989440.2|  paladin                                             90.9    2e-15    
ref|XP_001700223.1|  predicted protein                                91.3    2e-15    
emb|CAG31799.1|  hypothetical protein RCJMB04_11g7                    90.5    3e-15    
gb|AAN03688.1|AF411975_1  paladin                                     90.5    3e-15    
sp|Q8JHZ8.2|PALD_CHICK  RecName: Full=Paladin                         90.5    3e-15    
gb|EMP40601.1|  Paladin                                               90.1    4e-15    
ref|XP_007054730.1|  PREDICTED: paladin                               90.1    4e-15    
ref|XP_009870135.1|  PREDICTED: LOW QUALITY PROTEIN: paladin          89.4    4e-15    
ref|XP_009288864.1|  PREDICTED: paladin                               90.1    4e-15    
ref|XP_005048031.1|  PREDICTED: paladin isoform X2                    90.1    4e-15    
ref|XP_006122848.1|  PREDICTED: paladin isoform X4                    90.1    4e-15    
ref|XP_006122849.1|  PREDICTED: paladin isoform X5                    90.1    4e-15    
ref|XP_006122845.1|  PREDICTED: paladin isoform X1                    90.1    5e-15    
ref|XP_005048030.1|  PREDICTED: paladin isoform X1                    90.1    5e-15    
ref|XP_006122847.1|  PREDICTED: paladin isoform X3                    90.1    5e-15    
ref|XP_006122846.1|  PREDICTED: paladin isoform X2                    89.7    5e-15    
gb|KFQ97725.1|  Paladin                                               89.7    5e-15    
ref|XP_009464353.1|  PREDICTED: paladin                               89.7    6e-15    
ref|XP_009097098.1|  PREDICTED: paladin                               89.7    6e-15    
ref|XP_005495230.1|  PREDICTED: paladin                               89.4    7e-15    
ref|XP_005028420.1|  PREDICTED: LOW QUALITY PROTEIN: paladin          89.4    7e-15    
ref|XP_005433490.1|  PREDICTED: paladin                               89.4    7e-15    
ref|XP_005281918.1|  PREDICTED: paladin isoform X2                    89.4    7e-15    
ref|XP_009674545.1|  PREDICTED: LOW QUALITY PROTEIN: paladin          88.6    7e-15    
ref|XP_005281919.1|  PREDICTED: paladin isoform X3                    89.4    7e-15    
ref|XP_005235191.1|  PREDICTED: paladin                               89.4    8e-15    
ref|XP_005281917.1|  PREDICTED: paladin isoform X1                    89.4    8e-15    
ref|XP_003961217.1|  PREDICTED: paladin-like                          89.4    8e-15    
ref|XP_005430089.1|  PREDICTED: paladin                               89.0    9e-15    
gb|EDL93027.1|  rCG21974, isoform CRA_b                               73.6    1e-14    
ref|NP_001029300.2|  paladin                                          73.9    1e-14    
ref|XP_007558358.1|  PREDICTED: paladin isoform X2                    88.6    1e-14    
ref|XP_007558359.1|  PREDICTED: paladin isoform X3                    88.6    1e-14    
gb|KGL98007.1|  Paladin                                               88.6    1e-14    
gb|KFP30514.1|  Paladin                                               88.6    1e-14    
ref|XP_010197214.1|  PREDICTED: paladin                               88.2    1e-14    
ref|XP_007558360.1|  PREDICTED: paladin isoform X4                    88.2    1e-14    
ref|XP_009802807.1|  PREDICTED: uncharacterized protein LOC104248272  81.6    1e-14    
ref|XP_007558357.1|  PREDICTED: paladin isoform X1                    88.2    2e-14    
ref|XP_010866691.1|  PREDICTED: paladin isoform X2                    88.2    2e-14    
ref|XP_002396208.1|  hypothetical protein MPER_03599                  82.0    2e-14    
ref|XP_009933250.1|  PREDICTED: paladin                               87.8    2e-14    
ref|XP_010167139.1|  PREDICTED: LOW QUALITY PROTEIN: paladin          87.8    2e-14    
ref|XP_008633740.1|  PREDICTED: paladin                               87.4    3e-14    
gb|KFO60490.1|  Paladin                                               87.4    3e-14    
ref|XP_009889238.1|  PREDICTED: paladin                               87.4    3e-14    
gb|KFZ50479.1|  Paladin                                               87.4    3e-14    
ref|XP_010406929.1|  PREDICTED: paladin                               87.4    3e-14    
ref|XP_010221912.1|  PREDICTED: LOW QUALITY PROTEIN: paladin          87.0    3e-14    
ref|XP_008944235.1|  PREDICTED: paladin-like                          84.7    4e-14    
ref|XP_005153753.1|  PREDICTED: paladin                               86.3    6e-14    
ref|XP_009986228.1|  PREDICTED: paladin                               85.5    6e-14    
gb|ESL12102.1|  hypothetical protein TRSC58_00136                     83.2    6e-14    
gb|KFV19041.1|  Paladin                                               85.5    6e-14    
ref|XP_010779183.1|  PREDICTED: paladin isoform X1                    85.9    1e-13    
ref|XP_010779185.1|  PREDICTED: paladin isoform X2                    85.5    1e-13    
ref|XP_008925344.1|  PREDICTED: paladin                               85.1    1e-13    
ref|XP_008312787.1|  PREDICTED: paladin isoform X1                    85.1    1e-13    
ref|XP_008312788.1|  PREDICTED: paladin isoform X2                    85.1    2e-13    
ref|XP_008435133.1|  PREDICTED: paladin isoform X3                    85.1    2e-13    
ref|XP_008435132.1|  PREDICTED: paladin isoform X2                    85.1    2e-13    
ref|XP_007235508.1|  PREDICTED: paladin-like                          85.1    2e-13    
ref|XP_008435130.1|  PREDICTED: paladin isoform X1                    85.1    2e-13    
ref|XP_008312789.1|  PREDICTED: paladin isoform X3                    84.7    2e-13    
ref|XP_007478264.1|  PREDICTED: paladin                               84.0    2e-13    
ref|XP_008435134.1|  PREDICTED: paladin isoform X4                    84.7    2e-13    
gb|KFP03896.1|  Paladin                                               84.7    2e-13    
ref|XP_008495925.1|  PREDICTED: paladin                               84.7    2e-13    
gb|ELT97506.1|  hypothetical protein CAPTEDRAFT_103765                84.7    2e-13    
ref|XP_006630331.1|  PREDICTED: paladin-like                          84.3    2e-13    
ref|XP_001631798.1|  predicted protein                                81.3    3e-13    
gb|ETO30423.1|  hypothetical protein RFI_06697                        84.0    3e-13    
ref|XP_006813259.1|  PREDICTED: paladin-like                          83.6    4e-13    
ref|XP_005794644.1|  PREDICTED: paladin-like                          82.8    8e-13    
emb|CDX76607.1|  BnaC08g31930D                                        75.1    9e-13    
ref|NP_001006726.1|  paladin                                          82.8    9e-13    
ref|XP_005991456.1|  PREDICTED: paladin                               82.4    9e-13    
ref|XP_010083358.1|  PREDICTED: LOW QUALITY PROTEIN: paladin          82.0    1e-12    
ref|XP_004701454.1|  PREDICTED: paladin                               64.7    3e-12    
gb|KFR10986.1|  Paladin                                               54.3    4e-12    
ref|XP_007897773.1|  PREDICTED: paladin                               79.7    7e-12    
gb|ELU40403.1|  hypothetical protein AG1IA_05558                      78.2    1e-11    
ref|XP_007961351.1|  PREDICTED: paladin                               79.0    1e-11    
ref|XP_006889104.1|  PREDICTED: paladin                               78.2    2e-11    
gb|KCW46717.1|  hypothetical protein EUGRSUZ_K005412                  72.4    2e-11    
ref|NP_055246.2|  paladin                                             77.8    2e-11    
dbj|BAA86588.2|  KIAA1274 protein                                     77.8    3e-11    
ref|XP_010361150.1|  PREDICTED: paladin isoform X2                    77.8    3e-11    
dbj|BAG10022.1|  paladin                                              77.8    3e-11    
ref|XP_010361151.1|  PREDICTED: paladin isoform X3                    77.8    3e-11    
ref|XP_010361149.1|  PREDICTED: paladin isoform X1                    77.4    3e-11    
ref|XP_005565684.1|  PREDICTED: paladin isoform X4                    77.0    4e-11    
gb|EHH64782.1|  hypothetical protein EGM_18093                        77.0    4e-11    
ref|XP_005565681.1|  PREDICTED: paladin isoform X1                    77.0    4e-11    
gb|ERE87221.1|  paladin-like protein                                  77.0    5e-11    
gb|EGV93769.1|  Paladin                                               77.0    5e-11    
ref|XP_010016464.1|  PREDICTED: paladin                               77.0    5e-11    
gb|KFQ52896.1|  Paladin                                               77.0    5e-11    
ref|XP_007167791.1|  PREDICTED: paladin isoform X1                    76.6    5e-11    
ref|XP_007638821.1|  PREDICTED: paladin                               76.6    5e-11    
gb|ERE87220.1|  paladin-like protein                                  76.6    6e-11    
ref|XP_002192334.2|  PREDICTED: paladin                               50.8    6e-11    
tpg|DAA14189.1|  TPA: KIAA1274-like                                   76.6    6e-11    
ref|XP_005070895.1|  PREDICTED: paladin                               76.6    7e-11    
gb|KHG10113.1|  Paladin                                               72.4    7e-11    
ref|NP_001193533.1|  paladin                                          76.3    8e-11    
ref|XP_006212938.1|  PREDICTED: paladin                               76.3    8e-11    
emb|CAN67124.1|  hypothetical protein VITISV_040165                   70.5    8e-11    
ref|XP_003783803.1|  PREDICTED: paladin                               76.3    9e-11    
ref|NP_942106.1|  paladin                                             75.9    9e-11    
ref|XP_008832123.1|  PREDICTED: paladin                               75.9    1e-10    
ref|XP_002115848.1|  hypothetical protein TRIADDRAFT_59685            75.5    1e-10    
ref|XP_005997648.1|  PREDICTED: paladin-like                          75.5    1e-10    
ref|XP_005904296.1|  PREDICTED: paladin                               75.5    1e-10    
gb|ELR50179.1|  Paladin                                               75.5    2e-10    
ref|XP_006051221.1|  PREDICTED: paladin isoform X1                    75.5    2e-10    
ref|XP_004657863.1|  PREDICTED: paladin                               75.1    2e-10    
ref|XP_004615483.1|  PREDICTED: paladin                               74.7    2e-10    
ref|XP_007120887.1|  PREDICTED: paladin                               74.7    2e-10    
gb|KFQ33285.1|  Paladin                                               48.9    3e-10    
ref|XP_010850532.1|  PREDICTED: paladin isoform X2                    74.3    3e-10    
ref|XP_005968564.1|  PREDICTED: paladin isoform X1                    74.3    3e-10    
ref|XP_802321.1|  hypothetical protein                                70.9    3e-10    
ref|XP_006972766.1|  PREDICTED: paladin                               74.3    3e-10    
ref|XP_003928683.1|  PREDICTED: paladin                               74.3    3e-10    
ref|XP_005968565.1|  PREDICTED: paladin isoform X2                    74.3    3e-10    
ref|XP_005699207.1|  PREDICTED: paladin isoform X3                    73.9    3e-10    
ref|XP_010850530.1|  PREDICTED: paladin isoform X1                    74.3    3e-10    
gb|AAH66756.1|  Paladin                                               74.3    3e-10    
ref|XP_006513770.1|  PREDICTED: paladin isoform X3                    73.9    4e-10    
ref|XP_009008047.1|  PREDICTED: paladin                               73.9    4e-10    
gb|EHH19114.1|  hypothetical protein EGK_19759                        73.9    4e-10    
ref|XP_005699206.1|  PREDICTED: paladin isoform X2                    73.9    4e-10    
ref|XP_005699205.1|  PREDICTED: paladin isoform X1                    73.9    4e-10    
ref|XP_007938910.1|  PREDICTED: paladin                               73.9    5e-10    
ref|NP_038781.2|  paladin                                             73.6    5e-10    
ref|XP_006513768.1|  PREDICTED: paladin isoform X1                    73.6    5e-10    
gb|AAI44847.1|  X99384 protein                                        73.6    5e-10    
gb|AAI44848.1|  CDNA sequence X99384                                  73.6    6e-10    
gb|AAI37696.1|  X99384 protein                                        73.6    6e-10    
ref|XP_010587639.1|  PREDICTED: LOW QUALITY PROTEIN: paladin          73.2    6e-10    
ref|XP_007454618.1|  PREDICTED: paladin isoform X1                    73.2    7e-10    
ref|XP_003815995.1|  PREDICTED: paladin isoform X1                    73.2    7e-10    
ref|XP_007454619.1|  PREDICTED: paladin isoform X2                    73.2    7e-10    
ref|XP_008967207.1|  PREDICTED: paladin isoform X2                    73.2    8e-10    
ref|XP_004680862.1|  PREDICTED: paladin                               73.2    8e-10    
ref|XP_007655331.1|  PREDICTED: paladin                               72.4    1e-09    
ref|XP_004311074.1|  PREDICTED: paladin                               72.4    1e-09    
ref|XP_006761006.1|  PREDICTED: paladin isoform X7                    72.4    1e-09    
ref|XP_006915609.1|  PREDICTED: paladin                               72.4    1e-09    
ref|XP_006761005.1|  PREDICTED: paladin isoform X6                    72.0    2e-09    
gb|ELK09564.1|  Paladin                                               72.0    2e-09    
gb|ELK32388.1|  Paladin                                               72.0    2e-09    
ref|XP_006761000.1|  PREDICTED: paladin isoform X1                    72.0    2e-09    
ref|XP_004280828.1|  PREDICTED: paladin isoform 2                     72.0    2e-09    
ref|XP_006100033.1|  PREDICTED: paladin                               72.0    2e-09    
ref|XP_004049594.1|  PREDICTED: paladin                               71.6    2e-09    
ref|XP_004280827.1|  PREDICTED: paladin isoform 1                     71.6    2e-09    
ref|NP_001082854.1|  paladin                                          71.6    2e-09    
ref|XP_005156906.1|  PREDICTED: paladin isoform X1                    71.2    3e-09    
ref|XP_009305595.1|  PREDICTED: paladin isoform X3                    71.2    3e-09    
ref|XP_008592586.1|  PREDICTED: paladin                               71.2    3e-09    
ref|XP_003473790.1|  PREDICTED: paladin isoform X1                    71.2    3e-09    
ref|XP_005156905.1|  PREDICTED: paladin isoform X2                    71.2    3e-09    
ref|XP_006745647.1|  PREDICTED: paladin                               70.9    4e-09    
ref|XP_004393720.1|  PREDICTED: paladin                               70.1    6e-09    
ref|XP_004884874.1|  PREDICTED: paladin isoform X1                    70.1    6e-09    
ref|XP_004884877.1|  PREDICTED: paladin isoform X4                    70.1    6e-09    
gb|EAW54405.1|  KIAA1274, isoform CRA_b                               70.1    6e-09    
ref|XP_002805749.1|  PREDICTED: paladin-like                          69.7    7e-09    
ref|XP_006837528.1|  PREDICTED: paladin                               69.7    7e-09    
ref|XP_008694222.1|  PREDICTED: paladin                               69.7    7e-09    
gb|EPZ35834.1|  hypothetical protein O9G_006308                       65.1    8e-09    
ref|XP_007524235.1|  PREDICTED: paladin                               69.7    8e-09    
ref|XP_008056044.1|  PREDICTED: paladin                               69.7    9e-09    
ref|XP_007167794.1|  PREDICTED: paladin isoform X4                    69.7    9e-09    
ref|XP_008536449.1|  PREDICTED: paladin-like                          69.3    9e-09    
ref|XP_004769572.1|  PREDICTED: paladin isoform X1                    69.3    1e-08    
ref|XP_007249573.1|  PREDICTED: paladin-like isoform X3               69.3    1e-08    
ref|XP_007249571.1|  PREDICTED: paladin-like isoform X1               69.3    1e-08    
ref|XP_004769576.1|  PREDICTED: paladin isoform X5                    68.9    1e-08    
ref|XP_007249572.1|  PREDICTED: paladin-like isoform X2               68.9    1e-08    
ref|XP_004427079.1|  PREDICTED: paladin                               68.9    1e-08    
ref|XP_005602639.1|  PREDICTED: paladin                               68.6    2e-08    
ref|XP_004021484.1|  PREDICTED: LOW QUALITY PROTEIN: paladin          68.2    3e-08    
sp|P70261.1|PALD_MOUSE  RecName: Full=Paladin                         67.4    4e-08    



>ref|XP_004229153.1| PREDICTED: paladin [Solanum lycopersicum]
Length=1255

 Score =   517 bits (1332),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/294 (84%), Positives = 268/294 (91%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY SL+PS A  V+S++ RPSEM QVAALR+GEVLG QTVLKSD
Sbjct  392   YSIIRRLLRRDPMGALGYVSLEPSLAKLVDSSDDRPSEMGQVAALRNGEVLGPQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC HP LPE LEGA NFREIPGFPVYGVANPTVSGI SVIQRIGSSK GRPVFWHNM
Sbjct  452   HCPGCQHPGLPEILEGAPNFREIPGFPVYGVANPTVSGIRSVIQRIGSSKGGRPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVE+MEARLKDDIMREAERY GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVEKMEARLKDDIMREAERYQGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHVSSD+VQTP+EVFKCLEA+GFPIKYAR+PITD KAPKSSDFD L+
Sbjct  572   IHETDDGQIFDAWEHVSSDAVQTPVEVFKCLEADGFPIKYARVPITDGKAPKSSDFDVLS  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMGIGRTTTGTV ACL+KLRID GRPIRVL+DA + +L
Sbjct  632   FNIASASKDTAFVFNCQMGIGRTTTGTVTACLLKLRIDRGRPIRVLHDASNPDL  685


 Score =   397 bits (1021),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 188/217 (87%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             S DES+G   P A L+LK+RP+  ++  FGINDILLLWKITRLFDNGVECREALDAIIDR
Sbjct  691   SDDESEGQSHPPASLVLKSRPQTHTNDAFGINDILLLWKITRLFDNGVECREALDAIIDR  750

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR+LFNQQ  EPRERRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  751   CSALQNIRQAVLQYRKLFNQQHNEPRERRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  810

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQG+S  TFK WLHQRPEVQAMKWSIRLRPGRFFTIPEELR PHE +HGDAVMEAIVKD
Sbjct  811   CGQGKSRMTFKDWLHQRPEVQAMKWSIRLRPGRFFTIPEELRAPHESQHGDAVMEAIVKD  870

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVY+V
Sbjct  871   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYRV  907


 Score =   212 bits (539),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NSIGRVS C +N  D + NSE+AIRRGEYTVIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  254  GIPRSNSIGRVSDCISNLNDTLANSEEAIRRGEYTVIRSLIRVLEGGVEGKRQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C+SMQNLREAIA YRNSILRQPDEMKREAALSFFVEYLERY FLICFAVYLHT+RDAL  
Sbjct  314  CSSMQNLREAIAIYRNSILRQPDEMKREAALSFFVEYLERYYFLICFAVYLHTQRDALFA  373

Query  410  TS  415
             S
Sbjct  374  GS  375


 Score =   259 bits (663),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/242 (53%), Positives = 169/242 (70%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV   R G VLG +T+LKSDH PGC +  L   ++GA N+R+     V+GVA PT
Sbjct  7     PKEPEQVMKQRDGSVLGKKTILKSDHFPGCQNKRLSPHIDGAPNYRKAASLHVHGVAIPT  66

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             V GI +V+  IG+   G+   + W N+REE V+YING+PFVLREVERP+ N LEYTGI+ 
Sbjct  67    VEGIQNVLDHIGTQLSGKKTHILWINLREEPVLYINGRPFVLREVERPFSN-LEYTGINR  125

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE ME RLKDD+++EA RY   I+V  E  DGQ+ D WE V+ DSV+TPL+V++ L+ 
Sbjct  126   TRVEEMEDRLKDDVLQEAARYGNKILVTDELPDGQMVDQWEPVTYDSVKTPLQVYEELQT  185

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             + + ++Y R+PITD+K+PK  DFD L   ++ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  186   KEYLVEYERVPITDEKSPKELDFDILVHRVSQADVNTQIIFNCQMGRGRTTTGMVIATLV  245

Query  1221  KL  1226
              L
Sbjct  246   YL  247


 Score =   138 bits (348),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 92/259 (36%), Positives = 136/259 (53%), Gaps = 21/259 (8%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +   + G+P+Y +A PT++G
Sbjct  864   MEAIVKDRNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYRVDGYPIYSMATPTIAG  922

Query  696   ILSVIQRIG---SSKE--GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G   +SKE   + V   ++REE V+YING PFVLRE+ +P ++ L++ GI  
Sbjct  923   AKEMLTYLGANQTSKERSAKRVVLTDLREEAVVYINGTPFVLRELNKPVES-LKHVGITG  981

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEV  1022
               VE +EARLKDDI  E  R  G  M++H       +    I   WE++  D V+TP EV
Sbjct  982   SLVEHLEARLKDDIQCEI-RQSGGRMLLHREEYNPTSNQVSIIGYWENIFVDDVKTPAEV  1040

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T +K   SSD D  A+         + +F    G G      
Sbjct  1041  YASLKNEGYDITYRRIPLTREKEALSSDID--AIQYCKDDAAGSYLFVSHTGFGGIAYAM  1098

Query  1203  VIACL-----VKLRIDYGR  1244
              I CL      KL +D  R
Sbjct  1099  AIICLRLEAEAKLSLDIHR  1117


 Score = 80.9 bits (198),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+CS++QN+R+A+  YR    +Q  E + R  AL+  
Sbjct  289   VIRSLIRVLEGGVEGKRQVDKVIDKCSSMQNLREAIAIYRNSILRQPDEMK-REAALSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP-GR  1747
              EYLERY+ LI FA YL +     F G   +  +F  W+  RPE+ + ++  +R  P G 
Sbjct  348   VEYLERYYFLICFAVYLHTQRDALFAGSS-AHCSFSDWMKARPELYSIIRRLLRRDPMGA  406

Query  1748  FFTIPEELRTPHELKHGD---AVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQI-H  1915
                +  E      +   D   + M  +   RNG VLG  ++L     PG +     +I  
Sbjct  407   LGYVSLEPSLAKLVDSSDDRPSEMGQVAALRNGEVLGPQTVLKSDHCPGCQHPGLPEILE  466

Query  1916  GAPHVYKV  1939
             GAP+  ++
Sbjct  467   GAPNFREI  474


 Score = 67.4 bits (163),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +2

Query  119  NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD  298
            ++ DA    +  ++  + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q +
Sbjct  714  HTNDAFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKLFNQQHN  773

Query  299  EMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            E + R  AL+   EYLERY  LI FA YL +E
Sbjct  774  EPRERRVALNRGAEYLERYFRLIAFAAYLGSE  805


 Score = 66.6 bits (161),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHL EDI+ +++EL++  D+D+E RAYLMDMGIRALR
Sbjct  1167  VDAVIERCAGAGHLGEDIVQYSQELERKLDEDEERRAYLMDMGIRALR  1214


 Score = 63.2 bits (152),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 58/113 (51%), Gaps = 2/113 (2%)
 Frame = +2

Query  107   DIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSIL  286
             ++  + E+A R G+Y  I SL RVL  G E K  VD VI+RCA   +L E I  Y   + 
Sbjct  1133  NVQISDEEARRMGDYRDILSLTRVLVHGPESKTDVDAVIERCAGAGHLGEDIVQYSQELE  1192

Query  287   RQ--PDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
             R+   DE +R   +   +  L RY FLI F  YL++   A     +  + RP+
Sbjct  1193  RKLDEDEERRAYLMDMGIRALRRYFFLITFRSYLYSSSPAELSFKEWMDARPE  1245


 Score = 60.1 bits (144),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 62/114 (54%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVAL-NRG  1573
             +  +TR+  +G E +  +DA+I+RC+   ++ + ++QY +   ++  E  ERR  L + G
Sbjct  1150  ILSLTRVLVHGPESKTDVDAVIERCAGAGHLGEDIVQYSQELERKLDEDEERRAYLMDMG  1209

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
                L RYF LI F +YL S +         +  +FK W+  RPE+  +  ++R+
Sbjct  1210  IRALRRYFFLITFRSYLYSSS--------PAELSFKEWMDARPELGHLCNNLRI  1255



>ref|XP_006365451.1| PREDICTED: paladin-like isoform X2 [Solanum tuberosum]
Length=1193

 Score =   516 bits (1330),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/294 (84%), Positives = 268/294 (91%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY SL+PS A  V+ST+ RPSEM QVAALR+GEVLG QTVLKSD
Sbjct  392   YSIIRRLLRRDPMGALGYVSLEPSLAKLVDSTDDRPSEMGQVAALRNGEVLGPQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC HP LPE LEGA NFREIPGFPVYGVANPTVSGI SVIQRIGSSK GRPVFWHNM
Sbjct  452   HCPGCQHPGLPEILEGAPNFREIPGFPVYGVANPTVSGIRSVIQRIGSSKGGRPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVE+MEARLKDDIMREAERY GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVEKMEARLKDDIMREAERYQGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHVSSD+VQTP+EVFKCLEA+GFPIKYAR+PITD KAP+SSDFD L+
Sbjct  572   IHETDDGQIFDAWEHVSSDAVQTPVEVFKCLEADGFPIKYARVPITDGKAPRSSDFDVLS  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMGIGRTTTGTV ACL+KLRID GRPIRVL+DA + +L
Sbjct  632   FNIASASKDTAFVFNCQMGIGRTTTGTVTACLLKLRIDCGRPIRVLHDASNPDL  685


 Score =   401 bits (1031),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 190/217 (88%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDES+G   P APL+LK+RP+  ++  FGINDILLLWKITRLFDNGVECREALDAIIDR
Sbjct  691   SGDESEGQSHPPAPLVLKSRPQTHTNDAFGINDILLLWKITRLFDNGVECREALDAIIDR  750

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR+LFNQQ  EPRERRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  751   CSALQNIRQAVLQYRKLFNQQHNEPRERRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  810

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLHQRPEVQAMKWSIRLRPGRFFTIPEELR  HE +HGDAVMEAIVKD
Sbjct  811   CGQGESRMTFKDWLHQRPEVQAMKWSIRLRPGRFFTIPEELRAAHESQHGDAVMEAIVKD  870

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVY+V
Sbjct  871   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYRV  907


 Score =   211 bits (538),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NSIGRVS C +N  D + NSE+AIRRGEYTVIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  254  GIPRSNSIGRVSDCISNLNDTLANSEEAIRRGEYTVIRSLIRVLEGGVEGKRQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C+SMQNLREAIA YRNSILRQPDEMKREAALSFFVEYLERY FLICFAVYLHT+RDAL  
Sbjct  314  CSSMQNLREAIAIYRNSILRQPDEMKREAALSFFVEYLERYYFLICFAVYLHTQRDALFA  373

Query  410  TS  415
             S
Sbjct  374  GS  375


 Score =   258 bits (658),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 170/242 (70%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV   R G VLG +T+LKSDH PGC +  L   ++GA N+R+     V+GVA PT
Sbjct  7     PKEPEQVMKRRDGSVLGKKTILKSDHFPGCQNKRLSPHIDGAPNYRKADSLHVHGVAIPT  66

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             V GI +V+  IG+   G+   + W N+REE V+YING+PFVLREVERP+ N LEYTGI+ 
Sbjct  67    VEGIQNVLDHIGTKLSGKKTHILWINLREEPVLYINGRPFVLREVERPFSN-LEYTGINR  125

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE ME RLK+D+++EA RY   I+V  E  DGQ+ D WE V+ DSV+TPL+V++ L++
Sbjct  126   TRVEEMEDRLKEDVLQEAARYGNKILVTDELPDGQMVDQWEPVTYDSVKTPLQVYEELQS  185

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             + + ++Y R+PITD+K+PK  DFD L   ++ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  186   KEYLVEYERVPITDEKSPKELDFDILVHRVSQADVKTQIIFNCQMGRGRTTTGMVIATLV  245

Query  1221  KL  1226
              L
Sbjct  246   YL  247


 Score =   141 bits (356),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 138/261 (53%), Gaps = 21/261 (8%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +   + G+P+Y +A PT++G
Sbjct  864   MEAIVKDRNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYRVDGYPIYSMATPTIAG  922

Query  696   ILSVIQRIG---SSKE--GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G   +SKE   + V   ++REE V+YING PFVLRE+ +P ++ L++ GI  
Sbjct  923   AKEMLTYLGANQTSKERFAKRVILTDLREEAVVYINGTPFVLRELNKPVES-LKHVGITG  981

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEV  1022
               VE +EARLKDDI  E  R  G  M++H       +    I   WE++  D V+TP EV
Sbjct  982   SLVEHLEARLKDDIQCEI-RQSGGRMLLHREEFNPTSNQVSIIGYWENIFVDDVKTPAEV  1040

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T +K   SSD D  A+         + +F    G G      
Sbjct  1041  YASLKYEGYDIIYRRIPLTREKDALSSDID--AIQYCKDDAAGSYLFVSHTGFGGIAYAM  1098

Query  1203  VIACL-----VKLRIDYGRPI  1250
              I CL     VKL +D  RP 
Sbjct  1099  AIICLRLEAEVKLSLDIHRPF  1119


 Score = 81.3 bits (199),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 94/188 (50%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+CS++QN+R+A+  YR    +Q  E + R  AL+  
Sbjct  289   VIRSLIRVLEGGVEGKRQVDKVIDKCSSMQNLREAIAIYRNSILRQPDEMK-REAALSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA YL +     F G   +  +F  W+  RPE+ + ++  +R  P   
Sbjct  348   VEYLERYYFLICFAVYLHTQRDALFAGSS-AHCSFSDWMKARPELYSIIRRLLRRDPMGA  406

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQI-H  1915
              G     P   +         + M  +   RNG VLG  ++L     PG +     +I  
Sbjct  407   LGYVSLEPSLAKLVDSTDDRPSEMGQVAALRNGEVLGPQTVLKSDHCPGCQHPGLPEILE  466

Query  1916  GAPHVYKV  1939
             GAP+  ++
Sbjct  467   GAPNFREI  474


 Score = 67.0 bits (162),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +2

Query  119  NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD  298
            ++ DA    +  ++  + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q +
Sbjct  714  HTNDAFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKLFNQQHN  773

Query  299  EMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            E + R  AL+   EYLERY  LI FA YL +E
Sbjct  774  EPRERRVALNRGAEYLERYFRLIAFAAYLGSE  805



>ref|XP_006365450.1| PREDICTED: paladin-like isoform X1 [Solanum tuberosum]
Length=1255

 Score =   516 bits (1330),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/294 (84%), Positives = 268/294 (91%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY SL+PS A  V+ST+ RPSEM QVAALR+GEVLG QTVLKSD
Sbjct  392   YSIIRRLLRRDPMGALGYVSLEPSLAKLVDSTDDRPSEMGQVAALRNGEVLGPQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC HP LPE LEGA NFREIPGFPVYGVANPTVSGI SVIQRIGSSK GRPVFWHNM
Sbjct  452   HCPGCQHPGLPEILEGAPNFREIPGFPVYGVANPTVSGIRSVIQRIGSSKGGRPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVE+MEARLKDDIMREAERY GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVEKMEARLKDDIMREAERYQGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHVSSD+VQTP+EVFKCLEA+GFPIKYAR+PITD KAP+SSDFD L+
Sbjct  572   IHETDDGQIFDAWEHVSSDAVQTPVEVFKCLEADGFPIKYARVPITDGKAPRSSDFDVLS  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMGIGRTTTGTV ACL+KLRID GRPIRVL+DA + +L
Sbjct  632   FNIASASKDTAFVFNCQMGIGRTTTGTVTACLLKLRIDCGRPIRVLHDASNPDL  685


 Score =   401 bits (1030),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 190/217 (88%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDES+G   P APL+LK+RP+  ++  FGINDILLLWKITRLFDNGVECREALDAIIDR
Sbjct  691   SGDESEGQSHPPAPLVLKSRPQTHTNDAFGINDILLLWKITRLFDNGVECREALDAIIDR  750

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR+LFNQQ  EPRERRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  751   CSALQNIRQAVLQYRKLFNQQHNEPRERRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  810

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLHQRPEVQAMKWSIRLRPGRFFTIPEELR  HE +HGDAVMEAIVKD
Sbjct  811   CGQGESRMTFKDWLHQRPEVQAMKWSIRLRPGRFFTIPEELRAAHESQHGDAVMEAIVKD  870

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVY+V
Sbjct  871   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYRV  907


 Score =   211 bits (538),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NSIGRVS C +N  D + NSE+AIRRGEYTVIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  254  GIPRSNSIGRVSDCISNLNDTLANSEEAIRRGEYTVIRSLIRVLEGGVEGKRQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C+SMQNLREAIA YRNSILRQPDEMKREAALSFFVEYLERY FLICFAVYLHT+RDAL  
Sbjct  314  CSSMQNLREAIAIYRNSILRQPDEMKREAALSFFVEYLERYYFLICFAVYLHTQRDALFA  373

Query  410  TS  415
             S
Sbjct  374  GS  375


 Score =   258 bits (658),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 170/242 (70%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV   R G VLG +T+LKSDH PGC +  L   ++GA N+R+     V+GVA PT
Sbjct  7     PKEPEQVMKRRDGSVLGKKTILKSDHFPGCQNKRLSPHIDGAPNYRKADSLHVHGVAIPT  66

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             V GI +V+  IG+   G+   + W N+REE V+YING+PFVLREVERP+ N LEYTGI+ 
Sbjct  67    VEGIQNVLDHIGTKLSGKKTHILWINLREEPVLYINGRPFVLREVERPFSN-LEYTGINR  125

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE ME RLK+D+++EA RY   I+V  E  DGQ+ D WE V+ DSV+TPL+V++ L++
Sbjct  126   TRVEEMEDRLKEDVLQEAARYGNKILVTDELPDGQMVDQWEPVTYDSVKTPLQVYEELQS  185

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             + + ++Y R+PITD+K+PK  DFD L   ++ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  186   KEYLVEYERVPITDEKSPKELDFDILVHRVSQADVKTQIIFNCQMGRGRTTTGMVIATLV  245

Query  1221  KL  1226
              L
Sbjct  246   YL  247


 Score =   142 bits (357),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 138/261 (53%), Gaps = 21/261 (8%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +   + G+P+Y +A PT++G
Sbjct  864   MEAIVKDRNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYRVDGYPIYSMATPTIAG  922

Query  696   ILSVIQRIG---SSKE--GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G   +SKE   + V   ++REE V+YING PFVLRE+ +P ++ L++ GI  
Sbjct  923   AKEMLTYLGANQTSKERFAKRVILTDLREEAVVYINGTPFVLRELNKPVES-LKHVGITG  981

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEV  1022
               VE +EARLKDDI  E  R  G  M++H       +    I   WE++  D V+TP EV
Sbjct  982   SLVEHLEARLKDDIQCEI-RQSGGRMLLHREEFNPTSNQVSIIGYWENIFVDDVKTPAEV  1040

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T +K   SSD D  A+         + +F    G G      
Sbjct  1041  YASLKYEGYDIIYRRIPLTREKDALSSDID--AIQYCKDDAAGSYLFVSHTGFGGIAYAM  1098

Query  1203  VIACL-----VKLRIDYGRPI  1250
              I CL     VKL +D  RP 
Sbjct  1099  AIICLRLEAEVKLSLDIHRPF  1119


 Score = 81.3 bits (199),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 94/188 (50%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+CS++QN+R+A+  YR    +Q  E + R  AL+  
Sbjct  289   VIRSLIRVLEGGVEGKRQVDKVIDKCSSMQNLREAIAIYRNSILRQPDEMK-REAALSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA YL +     F G   +  +F  W+  RPE+ + ++  +R  P   
Sbjct  348   VEYLERYYFLICFAVYLHTQRDALFAGSS-AHCSFSDWMKARPELYSIIRRLLRRDPMGA  406

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQI-H  1915
              G     P   +         + M  +   RNG VLG  ++L     PG +     +I  
Sbjct  407   LGYVSLEPSLAKLVDSTDDRPSEMGQVAALRNGEVLGPQTVLKSDHCPGCQHPGLPEILE  466

Query  1916  GAPHVYKV  1939
             GAP+  ++
Sbjct  467   GAPNFREI  474


 Score = 68.6 bits (166),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHL EDI+ +++EL++  DDD+E RAYLMDMGIRALR
Sbjct  1167  VDAVIERCAGAGHLGEDIVQYSQELERKLDDDEERRAYLMDMGIRALR  1214


 Score = 67.0 bits (162),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +2

Query  119  NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD  298
            ++ DA    +  ++  + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q +
Sbjct  714  HTNDAFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKLFNQQHN  773

Query  299  EMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            E + R  AL+   EYLERY  LI FA YL +E
Sbjct  774  EPRERRVALNRGAEYLERYFRLIAFAAYLGSE  805


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 58/113 (51%), Gaps = 2/113 (2%)
 Frame = +2

Query  107   DIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSIL  286
             ++  + E+A + G+Y  I SL RVL  G E K  VD VI+RCA   +L E I  Y   + 
Sbjct  1133  NVQISDEEAQKMGDYRDILSLTRVLVHGPESKTDVDAVIERCAGAGHLGEDIVQYSQELE  1192

Query  287   RQ--PDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
             R+   DE +R   +   +  L RY FLI F  YL++   A     +  + RP+
Sbjct  1193  RKLDDDEERRAYLMDMGIRALRRYFFLITFRSYLYSSSPAELTFKEWMDARPE  1245


 Score = 60.5 bits (145),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 62/114 (54%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVAL-NRG  1573
             +  +TR+  +G E +  +DA+I+RC+   ++ + ++QY +   ++  +  ERR  L + G
Sbjct  1150  ILSLTRVLVHGPESKTDVDAVIERCAGAGHLGEDIVQYSQELERKLDDDEERRAYLMDMG  1209

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
                L RYF LI F +YL S +         +  TFK W+  RPE+  +  ++R+
Sbjct  1210  IRALRRYFFLITFRSYLYSSS--------PAELTFKEWMDARPELGHLCNNLRI  1255



>ref|XP_011079463.1| PREDICTED: paladin [Sesamum indicum]
Length=1244

 Score =   513 bits (1322),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 245/295 (83%), Positives = 264/295 (89%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA+LKP+ A    S +GRP EM QVAALR+GEVLGSQTVLKSD
Sbjct  383   YSILRRLLRRDPMGALGYANLKPALAKSAVSADGRPLEMSQVAALRNGEVLGSQTVLKSD  442

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC HPSLPERLEGA NFREIPGFPVYGVANPT+ GI SVIQRIGSSK GRPVFWHNM
Sbjct  443   HCPGCQHPSLPERLEGAPNFREIPGFPVYGVANPTIDGIRSVIQRIGSSKGGRPVFWHNM  502

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE V+YINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDI+REAERY GAIMV
Sbjct  503   REEPVVYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDILREAERYQGAIMV  562

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQI D+WEHVS  +VQTP EVF+C E +GFPIKYAR+PITD KAPK SDFDTLA
Sbjct  563   IHETDDGQISDAWEHVSLPAVQTPREVFRCFEEDGFPIKYARVPITDGKAPKGSDFDTLA  622

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV-LNDALHEEL  1283
             +NI SASK TA VFNCQMGIGRTTTGTVIACL+KLRIDYGRPIRV + D  H+EL
Sbjct  623   MNIISASKDTAFVFNCQMGIGRTTTGTVIACLLKLRIDYGRPIRVCVGDPSHKEL  677


 Score =   378 bits (970),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             S +ES+  +     +  K R  +DS   FGINDILLLWKITRLFDNGVECREALD+IIDR
Sbjct  681   SDNESENQLSSSMCISGKHRTTEDSGRSFGINDILLLWKITRLFDNGVECREALDSIIDR  740

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR+LFNQQ  EPRERRVALNRGAEYLERYFRLIAFAAYLGS+ FDGF
Sbjct  741   CSALQNIRQAVLQYRQLFNQQHVEPRERRVALNRGAEYLERYFRLIAFAAYLGSEEFDGF  800

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQG+S  TFK WLHQRPEVQAMKWSIRLRPGRFFT+PEELR PHE +HGDAVMEAIVKD
Sbjct  801   CGQGKSRMTFKSWLHQRPEVQAMKWSIRLRPGRFFTVPEELRAPHESQHGDAVMEAIVKD  860

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSS+IQIHGAPHVYKV
Sbjct  861   RNGSVLGKGSILKMYFFPGQRTSSNIQIHGAPHVYKV  897


 Score =   202 bits (515),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NS+G+VS C +  T  +PN+E++IRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  245  GIPRSNSMGKVSDCCSTITPDLPNTEESIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  304

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIA YR+SIL Q DEMKREA+LSFFVEYLERY FLICFAVYLHTER+ALHP
Sbjct  305  CASMQNLREAIACYRSSILCQADEMKREASLSFFVEYLERYYFLICFAVYLHTEREALHP  364

Query  410  TS  415
             S
Sbjct  365  IS  366


 Score =   204 bits (518),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 137/192 (71%), Gaps = 4/192 (2%)
 Frame = +3

Query  657   FPVYGVANPTVSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYK  830
              PV+GVA PT+ GI +V++ IG+   G    V W N+REE V+YIN +PFVLR+VE+P+ 
Sbjct  49    LPVHGVAIPTIDGIRNVLKHIGAHMNGEQIRVLWINLREEPVVYINSRPFVLRDVEQPFS  108

Query  831   NMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQT  1010
             N LEYTGI+  R+E+ME RLK+D++ EA RY   I+V  E  DGQ+ D WE VS DSV+T
Sbjct  109   N-LEYTGINRARLEQMEDRLKEDVLMEAARYGNKILVTDELPDGQMVDQWEPVSHDSVKT  167

Query  1011  PLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRT  1190
             PL+V++ L  + + + Y R+PITD+K+PK  DFD L   I+ A+  T +VFNCQMG GRT
Sbjct  168   PLQVYEELTHQ-YLVDYERVPITDEKSPKEQDFDILVRKISQANVRTEIVFNCQMGRGRT  226

Query  1191  TTGTVIACLVKL  1226
             TTG VIA L+ +
Sbjct  227   TTGMVIATLIYI  238


 Score = 77.0 bits (188),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 61/219 (28%), Positives = 102/219 (47%), Gaps = 10/219 (5%)
 Frame = +2

Query  1301  SDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSAL  1480
             S G V      I    P  + S   G  +  ++  + R+ + GVE +  +D +ID+C+++
Sbjct  251   SMGKVSDCCSTITPDLPNTEESIRRG--EYAVIRSLIRVLEGGVEGKRQVDKVIDKCASM  308

Query  1481  QNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQG  1660
             QN+R+A+  YR     Q  E + R  +L+   EYLERY+ LI FA YL ++  +      
Sbjct  309   QNLREAIACYRSSILCQADEMK-REASLSFFVEYLERYYFLICFAVYLHTER-EALHPIS  366

Query  1661  ESMTTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEELRTPHELKHGDAVMEAIVK  1825
                 +F  W+  RPE+ + ++  +R  P    G     P   ++          M  +  
Sbjct  367   PGKCSFTEWMRARPELYSILRRLLRRDPMGALGYANLKPALAKSAVSADGRPLEMSQVAA  426

Query  1826  DRNGSVLGKGSILTMYFFPG-QRTSSHIQIHGAPHVYKV  1939
              RNG VLG  ++L     PG Q  S   ++ GAP+  ++
Sbjct  427   LRNGEVLGSQTVLKSDHCPGCQHPSLPERLEGAPNFREI  465


 Score =   129 bits (325),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 83/246 (34%), Positives = 131/246 (53%), Gaps = 18/246 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT++G
Sbjct  854   MEAIVKDRNGSVLGKGSILKMYFFPG-QRTSSNIQIHGAPHVYKVDGYPVYSMATPTIAG  912

Query  696   ILSVIQRIGS--SKEG---RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  + EG   + V   ++REE V+YIN  PFVLRE+ +P  + L++ GI  
Sbjct  913   AKEMLAYLGAKPTAEGSDPQKVVLTDLREEAVVYINNTPFVLRELNKPV-DTLKHIGITG  971

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHET------ADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G  M++H            +   WE++  D ++TP EV
Sbjct  972   PVVEHMEARLKEDIISEI-RQSGGRMLLHREEYNPALQQASVVGYWENIFVDDIKTPAEV  1030

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLAL-NIASASKYTALVFNCQMGIGRTTTG  1199
             +  L+ EG+ I Y R P+T ++   +SD D++      SA  Y   +F    G G     
Sbjct  1031  YAALKHEGYNIAYKRTPLTREREALASDVDSIQYCKEDSAGSY---LFVSHTGFGGVAYA  1087

Query  1200  TVIACL  1217
               I C+
Sbjct  1088  MAIICI  1093


 Score = 72.8 bits (177),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +3

Query  1935  RCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             +C+GAGHLR+DI+Y++KEL+K  +D DEHRAYL+DMGI+ALR
Sbjct  1160  KCSGAGHLRDDILYYSKELEKLSNDSDEHRAYLVDMGIKALR  1201


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  720  ITRLFDNGVECREALDSIIDRCSALQNIRQAVLQYRQLFNQQHVEPRERRVALNRGAEYL  779

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  780  ERYFRLIAFAAYLGSE  795


 Score = 63.5 bits (153),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 3/105 (3%)
 Frame = +2

Query  83    SSCGANATDIMPNSEDAIRR-GEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             S C +N+ +   NS++  R+ G+Y  I SLIRVL  G E K  VD VID+C+   +LR+ 
Sbjct  1111  SPCSSNSQEEFSNSDEEARKMGDYRDILSLIRVLVQGPESKADVDSVIDKCSGAGHLRDD  1170

Query  260   IATYRNSI--LRQPDEMKREAALSFFVEYLERY*FLICFAVYLHT  388
             I  Y   +  L    +  R   +   ++ L RY FLI F  YL++
Sbjct  1171  ILYYSKELEKLSNDSDEHRAYLVDMGIKALRRYFFLIAFRSYLYS  1215


 Score = 54.7 bits (130),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 57/114 (50%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVAL-NRG  1573
             +  + R+   G E +  +D++ID+CS   ++R  +L Y +   +   +  E R  L + G
Sbjct  1137  ILSLIRVLVQGPESKADVDSVIDKCSGAGHLRDDILYYSKELEKLSNDSDEHRAYLVDMG  1196

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LIAF +YL S + +           F  W+  RPE+  +  ++R+
Sbjct  1197  IKALRRYFFLIAFRSYLYSTSANEM--------KFTAWMDARPELGHLCNNLRI  1242



>ref|XP_009625448.1| PREDICTED: paladin-like [Nicotiana tomentosiformis]
Length=908

 Score =   512 bits (1319),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 245/289 (85%), Positives = 263/289 (91%), Gaps = 0/289 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYASLKPS A  V++ + RP EM QVAALR+GEVLG QTVLKSD
Sbjct  392   YSIIRRLLRRDPMGALGYASLKPSLAKLVDTADSRPCEMGQVAALRNGEVLGPQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC HP LPE LEGA NFREIPGFPVYGVANPTV+GI SVIQRIGSSK G PVFWHNM
Sbjct  452   HCPGCQHPGLPEILEGAPNFREIPGFPVYGVANPTVNGIRSVIQRIGSSKGGHPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVE+MEARLKDDIMREA+RY GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVEKMEARLKDDIMREADRYQGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHVSSD+VQTP+EVFKCLEA+GFPIKYAR+PITD KAPKSSDFD L 
Sbjct  572   IHETDDGQIFDAWEHVSSDAVQTPVEVFKCLEADGFPIKYARVPITDGKAPKSSDFDLLT  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDA  1268
              NIASASK TA VFNCQMGIGRTTTGTVIACL+K RID+GRPIRVLNDA
Sbjct  632   FNIASASKDTAFVFNCQMGIGRTTTGTVIACLLKSRIDHGRPIRVLNDA  680


 Score =   399 bits (1026),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 191/218 (88%), Positives = 198/218 (91%), Gaps = 0/218 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDES+G   P A L+ K RP+ DS+  FGINDILLLWKITRLFDNGVECREALDAIIDR
Sbjct  691   SGDESEGEAHPPALLVSKNRPQIDSNDAFGINDILLLWKITRLFDNGVECREALDAIIDR  750

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR+L NQQ  EPRERRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  751   CSALQNIRQAVLQYRKLCNQQHIEPRERRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  810

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLHQRPEVQAMKWSIRLRPGRFFTIPEELR PHE +HGDAVMEAIVKD
Sbjct  811   CGQGESRMTFKDWLHQRPEVQAMKWSIRLRPGRFFTIPEELRAPHESQHGDAVMEAIVKD  870

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKVC  1942
             RNGSVLGKGSIL MYFFPGQR SSHIQIHGAPHVYKVC
Sbjct  871   RNGSVLGKGSILKMYFFPGQRISSHIQIHGAPHVYKVC  908


 Score =   212 bits (540),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NSIGRVS C +N  D +PNSE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  254  GIPRSNSIGRVSDCVSNLNDTLPNSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C+SMQNLREAIA YRNSILRQPDEMKREAALSFFVEYLERY FLICFAVYLHT+RDAL  
Sbjct  314  CSSMQNLREAIAIYRNSILRQPDEMKREAALSFFVEYLERYYFLICFAVYLHTQRDALFS  373

Query  410  TS  415
             S
Sbjct  374  RS  375


 Score =   260 bits (664),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 171/242 (71%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV   R G VLG +T+LKSDH PGC +  L   ++GA N+R+     V+GVA PT
Sbjct  7     PKEPEQVMKRRDGSVLGKKTILKSDHFPGCQNRRLSPHIDGAPNYRKAGSSHVHGVAIPT  66

Query  687   VSGILSVIQRIGSSKEGRPV--FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             V GI +V+  IG+   G+     W N+REE VIYING+PFVLREVERP+ N LEYTGI+ 
Sbjct  67    VEGIQNVLDHIGAQLSGKKTHFLWINLREEPVIYINGRPFVLREVERPFSN-LEYTGINR  125

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             +RVE+ME RLK+D++ EA RY   I+V  E  DGQ+ D WE V+SDSV+TPL+V++ L+A
Sbjct  126   KRVEQMEDRLKEDVLLEAARYGNKILVTDELPDGQMVDQWEPVTSDSVKTPLQVYEELQA  185

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             + + + Y R+PITD+K+PK  DFD L L ++ A   T ++FNCQMG GRTTTG VI+ LV
Sbjct  186   QEYLVDYERVPITDEKSPKELDFDILVLRVSQADVNTQIIFNCQMGRGRTTTGMVISTLV  245

Query  1221  KL  1226
              L
Sbjct  246   YL  247


 Score = 80.9 bits (198),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 93/188 (49%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+CS++QN+R+A+  YR    +Q  E + R  AL+  
Sbjct  289   VIRSLIRVLEGGVEGKRQVDKVIDKCSSMQNLREAIAIYRNSILRQPDEMK-REAALSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA YL +   D    +  +  +F  W+  RPE+ + ++  +R  P   
Sbjct  348   VEYLERYYFLICFAVYLHTQR-DALFSRSSAQCSFSDWMKARPELYSIIRRLLRRDPMGA  406

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQI-H  1915
              G     P   +           M  +   RNG VLG  ++L     PG +     +I  
Sbjct  407   LGYASLKPSLAKLVDTADSRPCEMGQVAALRNGEVLGPQTVLKSDHCPGCQHPGLPEILE  466

Query  1916  GAPHVYKV  1939
             GAP+  ++
Sbjct  467   GAPNFREI  474


 Score = 67.0 bits (162),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = +2

Query  119  NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD  298
            +S DA    +  ++  + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  
Sbjct  714  DSNDAFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKLCNQQHI  773

Query  299  EMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            E + R  AL+   EYLERY  LI FA YL +E
Sbjct  774  EPRERRVALNRGAEYLERYFRLIAFAAYLGSE  805



>ref|XP_009759729.1| PREDICTED: paladin [Nicotiana sylvestris]
Length=1097

 Score =   511 bits (1315),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 245/289 (85%), Positives = 262/289 (91%), Gaps = 0/289 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY SLKPS A  V++ + RP EM QVAALR+GEVLG QTVLKSD
Sbjct  232   YSIIRRLLRRDPMGALGYVSLKPSLAKLVDTADSRPCEMGQVAALRNGEVLGPQTVLKSD  291

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC HP LPE LEGA NFREIPGFPVYGVANPTVSGI SVIQRIGSSK G PVFWHNM
Sbjct  292   HCPGCQHPGLPEILEGAPNFREIPGFPVYGVANPTVSGIRSVIQRIGSSKGGHPVFWHNM  351

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVE+MEARLKDDIMREA+RY GAIMV
Sbjct  352   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVEKMEARLKDDIMREADRYQGAIMV  411

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHVSSD+VQTP+EVFKCLEA+GFPIKYAR+PITD KAPKSSDFD L 
Sbjct  412   IHETDDGQIFDAWEHVSSDAVQTPVEVFKCLEADGFPIKYARVPITDGKAPKSSDFDLLT  471

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDA  1268
              NIASASK TA VFNCQMGIGRTTTGTVIACL+K RID+GRPIRVLNDA
Sbjct  472   FNIASASKDTAFVFNCQMGIGRTTTGTVIACLLKSRIDHGRPIRVLNDA  520


 Score =   395 bits (1016),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 191/217 (88%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDES+G   P A L+ K RP+ DSS  FGINDILLLWKITRLFDNGVECREALDAIIDR
Sbjct  531   SGDESEGENHPPALLVSKNRPQIDSSDTFGINDILLLWKITRLFDNGVECREALDAIIDR  590

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR+L NQQ  EPRERRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  591   CSALQNIRQAVLQYRKLCNQQHIEPRERRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  650

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLHQRPEVQAMKWSIRLRPGRFFTIPEELR P E +HGDAVMEAIVKD
Sbjct  651   CGQGESRMTFKDWLHQRPEVQAMKWSIRLRPGRFFTIPEELRAPQESQHGDAVMEAIVKD  710

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  711   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  747


 Score =   212 bits (540),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NSIGRVS C +N  D +PNSE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  94   GIPRSNSIGRVSDCVSNLNDTLPNSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  153

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C+SMQNLREAIA YRNSILRQPDEMKREAALSFFVEYLERY FLICFAVYLHT+RDAL  
Sbjct  154  CSSMQNLREAIAIYRNSILRQPDEMKREAALSFFVEYLERYYFLICFAVYLHTQRDALFS  213

Query  410  TS  415
             S
Sbjct  214  RS  215


 Score =   138 bits (347),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/261 (35%), Positives = 138/261 (53%), Gaps = 21/261 (8%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++ G P+Y +A PT++G
Sbjct  704   MEAIVKDRNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDGHPIYSMATPTIAG  762

Query  696   ILSVIQRIG---SSKE--GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G   +SKE   + V   ++REE V+YING PFVLRE+++P ++ L++ GI  
Sbjct  763   AKEMLTYLGAEQTSKESVAKRVVLTDLREEAVVYINGTPFVLRELDKPVES-LKHVGITG  821

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADG------QIFDSWEHVSSDSVQTPLEV  1022
               VE +EARLKDDI+ E  R  G  M++H            I   WE++  D V+TP EV
Sbjct  822   SLVEHLEARLKDDILSEI-RQSGGRMLLHREEYSPSLNQVSIIGYWENIFVDDVKTPAEV  880

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T ++   S+D D  A+         + +F    G G      
Sbjct  881   YASLKYEGYDIIYRRIPLTREREALSTDID--AIQYCKDGAAGSYLFVSHTGFGGIAYAM  938

Query  1203  VIACL-----VKLRIDYGRPI  1250
              I CL      KL +D  RP 
Sbjct  939   AIICLRLEAEAKLSLDIHRPF  959


 Score = 58.2 bits (139),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 70/146 (48%), Gaps = 12/146 (8%)
 Frame = +2

Query  1304  DGHVPPYAPL-ILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSAL  1480
             +G V P  PL     +   + + + G  D   +  +TR+  +G E +  +D +I+RC+  
Sbjct  960   EGTVLPCPPLENFNVQNSNEEARKMG--DYRDILSLTRVLVHGPESKTDVDIVIERCAGA  1017

Query  1481  QNIRQAVLQYRRLFNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQ  1657
              ++R+ +++Y +   +   E  ERR  L + G   L RYF LI F +YL        C  
Sbjct  1018  GHLREDIVEYSKELEKNLDEDEERRAYLMDMGIRALRRYFFLITFRSYLYC------CSP  1071

Query  1658  GESMTTFKHWLHQRPEVQAMKWSIRL  1735
              E    F  W+  RPE+  +  ++R+
Sbjct  1072  AE--IRFSEWMDARPELGHLCNNLRI  1095


 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 93/188 (49%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+CS++QN+R+A+  YR    +Q  E + R  AL+  
Sbjct  129   VIRSLIRVLEGGVEGKRQVDKVIDKCSSMQNLREAIAIYRNSILRQPDEMK-REAALSFF  187

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA YL +   D    +  +  +F  W+  RPE+ + ++  +R  P   
Sbjct  188   VEYLERYYFLICFAVYLHTQR-DALFSRSSAQCSFSDWMKARPELYSIIRRLLRRDPMGA  246

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQI-H  1915
              G     P   +           M  +   RNG VLG  ++L     PG +     +I  
Sbjct  247   LGYVSLKPSLAKLVDTADSRPCEMGQVAALRNGEVLGPQTVLKSDHCPGCQHPGLPEILE  306

Query  1916  GAPHVYKV  1939
             GAP+  ++
Sbjct  307   GAPNFREI  314


 Score = 72.8 bits (177),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGHLREDI+ ++KEL+K  D+D+E RAYLMDMGIRALR
Sbjct  1007  VDIVIERCAGAGHLREDIVEYSKELEKNLDEDEERRAYLMDMGIRALR  1054


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = +2

Query  119  NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD  298
            +S D     +  ++  + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  
Sbjct  554  DSSDTFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKLCNQQHI  613

Query  299  EMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            E + R  AL+   EYLERY  LI FA YL +E
Sbjct  614  EPRERRVALNRGAEYLERYFRLIAFAAYLGSE  645


 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 59/113 (52%), Gaps = 2/113 (2%)
 Frame = +2

Query  107   DIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSIL  286
             ++  ++E+A + G+Y  I SL RVL  G E K  VD VI+RCA   +LRE I  Y   + 
Sbjct  973   NVQNSNEEARKMGDYRDILSLTRVLVHGPESKTDVDIVIERCAGAGHLREDIVEYSKELE  1032

Query  287   RQ--PDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
             +    DE +R   +   +  L RY FLI F  YL+    A    S+  + RP+
Sbjct  1033  KNLDEDEERRAYLMDMGIRALRRYFFLITFRSYLYCCSPAEIRFSEWMDARPE  1085



>ref|XP_007051345.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX95502.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=990

 Score =   506 bits (1303),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/293 (82%), Positives = 264/293 (90%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYASLKPS    +ES +GRP E+  VAALR+GEVLGSQTVLKSD
Sbjct  389   YSIIRRLLRRDPMGALGYASLKPSLTKVIESGDGRPHEVGVVAALRNGEVLGSQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GILSVIQRIGS+K GRPVFWHNM
Sbjct  449   HCPGCQNVSLPERVEGAPNFREVPGFPVYGVANPTIDGILSVIQRIGSAKGGRPVFWHNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  509   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAERYEGAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+SDS+QTPLEVFKCL  +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  569   IHETDDGQIFDAWEHVNSDSIQTPLEVFKCLGDDGFPIKYARVPITDGKAPKSSDFDTLA  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
              N+ASASK T+ VFNCQMG GRTTTGTVIACLVKLRIDYGRPI+ L D +  E
Sbjct  629   ANVASASKDTSFVFNCQMGRGRTTTGTVIACLVKLRIDYGRPIKALVDDMSRE  681


 Score =   367 bits (943),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = +2

Query  1337  LKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRR  1516
             +K + + +    FGI+DILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR+
Sbjct  705   VKVKTENEQGRAFGIDDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRK  764

Query  1517  LFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQ  1696
             +FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGFCGQGE M TFK+WLHQ
Sbjct  765   VFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGFCGQGECMMTFKNWLHQ  824

Query  1697  RPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYF  1876
             RPEVQAMKWSIRLRPGRFFT+PEELR PHE +HGDAVMEAIVK RNGSVLG GSIL MYF
Sbjct  825   RPEVQAMKWSIRLRPGRFFTVPEELRAPHESQHGDAVMEAIVKARNGSVLGNGSILKMYF  884

Query  1877  FPGQRTSSHIQIHGAPHVYKV  1939
             FPGQRTSS+IQIHGAPHV+KV
Sbjct  885   FPGQRTSSNIQIHGAPHVFKV  905


 Score =   209 bits (531),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGRV   G+N TD MPNSE AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  251  GIPRTNSIGRVFESGSNVTDSMPNSEVAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  310

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C+SMQNLREAIA YRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY H+ER AL  
Sbjct  311  CSSMQNLREAIAAYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYFHSERAALRS  370

Query  410  TS  415
            +S
Sbjct  371  SS  372


 Score =   271 bits (692),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/242 (55%), Positives = 175/242 (72%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  +R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT
Sbjct  4     PKEPEQVMKMRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQADSLRVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V++ IG+ K+G+   V W ++REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  64    IVGIQNVLKHIGAQKDGKQAHVLWISLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ 
Sbjct  123   HRVEQMEARLKEDILMEAARYANKILVTDELPDGQMVDQWERVSFDSVKTPLEVYEELQL  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  183   EGYLVDYERVPITDEKSPKELDFDILVNKISQADISTEVIFNCQMGRGRTTTGMVIATLV  242

Query  1221  KL  1226
              L
Sbjct  243   YL  244


 Score = 83.6 bits (205),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 96/195 (49%), Gaps = 22/195 (11%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+CS++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  286   VIRSLIRVLEGGVEGKRQVDKVIDKCSSMQNLREAIAAYRNSILRQPDEMK-REASLSFF  344

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSI--------  1729
              EYLERY+ LI FA Y  S+            T+F  W+  RPE+ ++   +        
Sbjct  345   VEYLERYYFLICFAVYFHSER-AALRSSSCDHTSFADWMKARPELYSIIRRLLRRDPMGA  403

Query  1730  ----RLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRT  1894
                  L+P     I      PHE+     V+ A+   RNG VLG  ++L     PG Q  
Sbjct  404   LGYASLKPSLTKVIESGDGRPHEV----GVVAAL---RNGEVLGSQTVLKSDHCPGCQNV  456

Query  1895  SSHIQIHGAPHVYKV  1939
             S   ++ GAP+  +V
Sbjct  457   SLPERVEGAPNFREV  471


 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 71/119 (60%), Gaps = 8/119 (7%)
 Frame = +3

Query  516  MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
            M+ +   R+G VLG+ ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  862  MEAIVKARNGSVLGNGSILKMYFFPG-QRTSSNIQIHGAPHVFKVDEYPVYSMATPTISG  920

Query  696  ILSVIQRIGSSKE------GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGI  854
               ++  +G++K       G+ V   ++REE V+YING PFVLRE+ +P  + L++ GI
Sbjct  921  AKEMLAYLGANKSKAEGFAGQKVVVTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGI  978


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  728  ITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYL  787

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  788  ERYFRLIAFAAYLGSE  803



>ref|XP_007051344.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX95501.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1257

 Score =   506 bits (1303),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/293 (82%), Positives = 264/293 (90%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYASLKPS    +ES +GRP E+  VAALR+GEVLGSQTVLKSD
Sbjct  389   YSIIRRLLRRDPMGALGYASLKPSLTKVIESGDGRPHEVGVVAALRNGEVLGSQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GILSVIQRIGS+K GRPVFWHNM
Sbjct  449   HCPGCQNVSLPERVEGAPNFREVPGFPVYGVANPTIDGILSVIQRIGSAKGGRPVFWHNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  509   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAERYEGAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+SDS+QTPLEVFKCL  +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  569   IHETDDGQIFDAWEHVNSDSIQTPLEVFKCLGDDGFPIKYARVPITDGKAPKSSDFDTLA  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
              N+ASASK T+ VFNCQMG GRTTTGTVIACLVKLRIDYGRPI+ L D +  E
Sbjct  629   ANVASASKDTSFVFNCQMGRGRTTTGTVIACLVKLRIDYGRPIKALVDDMSRE  681


 Score =   368 bits (945),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = +2

Query  1337  LKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRR  1516
             +K + + +    FGI+DILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR+
Sbjct  705   VKVKTENEQGRAFGIDDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRK  764

Query  1517  LFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQ  1696
             +FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGFCGQGE M TFK+WLHQ
Sbjct  765   VFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGFCGQGECMMTFKNWLHQ  824

Query  1697  RPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYF  1876
             RPEVQAMKWSIRLRPGRFFT+PEELR PHE +HGDAVMEAIVK RNGSVLG GSIL MYF
Sbjct  825   RPEVQAMKWSIRLRPGRFFTVPEELRAPHESQHGDAVMEAIVKARNGSVLGNGSILKMYF  884

Query  1877  FPGQRTSSHIQIHGAPHVYKV  1939
             FPGQRTSS+IQIHGAPHV+KV
Sbjct  885   FPGQRTSSNIQIHGAPHVFKV  905


 Score =   209 bits (531),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGRV   G+N TD MPNSE AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  251  GIPRTNSIGRVFESGSNVTDSMPNSEVAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  310

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C+SMQNLREAIA YRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY H+ER AL  
Sbjct  311  CSSMQNLREAIAAYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYFHSERAALRS  370

Query  410  TS  415
            +S
Sbjct  371  SS  372


 Score =   271 bits (692),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 133/242 (55%), Positives = 175/242 (72%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  +R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT
Sbjct  4     PKEPEQVMKMRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQADSLRVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V++ IG+ K+G+   V W ++REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  64    IVGIQNVLKHIGAQKDGKQAHVLWISLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ 
Sbjct  123   HRVEQMEARLKEDILMEAARYANKILVTDELPDGQMVDQWERVSFDSVKTPLEVYEELQL  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  183   EGYLVDYERVPITDEKSPKELDFDILVNKISQADISTEVIFNCQMGRGRTTTGMVIATLV  242

Query  1221  KL  1226
              L
Sbjct  243   YL  244


 Score =   134 bits (338),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 133/245 (54%), Gaps = 17/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG+ ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  862   MEAIVKARNGSVLGNGSILKMYFFPG-QRTSSNIQIHGAPHVFKVDEYPVYSMATPTISG  920

Query  696   ILSVIQRIGSSKE------GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G++K       G+ V   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  921   AKEMLAYLGANKSKAEGFAGQKVVVTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGIT  979

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLE  1019
                VE MEARLK+DI+ E  R  G  M++H       +    +   WE++ +D V++P E
Sbjct  980   GPVVEHMEARLKEDILSEV-RQSGGRMLLHREEYSPLSNQSSVVGYWENIFADDVKSPAE  1038

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTG  1199
             V+  L+ EG+ I Y RIP+T ++   +SD D +      +S+    ++    G G     
Sbjct  1039  VYAALKNEGYNIAYRRIPLTREREALASDVDEIQNCQDDSSR--CYLYISHTGFGGVAYA  1096

Query  1200  TVIAC  1214
               I C
Sbjct  1097  MAIIC  1101


 Score = 84.0 bits (206),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 96/195 (49%), Gaps = 22/195 (11%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+CS++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  286   VIRSLIRVLEGGVEGKRQVDKVIDKCSSMQNLREAIAAYRNSILRQPDEMK-REASLSFF  344

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSI--------  1729
              EYLERY+ LI FA Y  S+            T+F  W+  RPE+ ++   +        
Sbjct  345   VEYLERYYFLICFAVYFHSERA-ALRSSSCDHTSFADWMKARPELYSIIRRLLRRDPMGA  403

Query  1730  ----RLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRT  1894
                  L+P     I      PHE+     V+ A+   RNG VLG  ++L     PG Q  
Sbjct  404   LGYASLKPSLTKVIESGDGRPHEV----GVVAAL---RNGEVLGSQTVLKSDHCPGCQNV  456

Query  1895  SSHIQIHGAPHVYKV  1939
             S   ++ GAP+  +V
Sbjct  457   SLPERVEGAPNFREV  471


 Score = 79.7 bits (195),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGHLR+DI+++ KEL+K  DDDDEHRAYLMDMGI+ALR
Sbjct  1167  VDIIIERCAGAGHLRDDILHYNKELEKVTDDDDEHRAYLMDMGIKALR  1214


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  728  ITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYL  787

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  788  ERYFRLIAFAAYLGSE  803


 Score = 56.6 bits (135),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSI--LRQ  292
             + E+A+R G+Y  I SL RVL  G + K  VD +I+RCA   +LR+ I  Y   +  +  
Sbjct  1137  SDEEALRMGDYRDILSLTRVLIHGPKSKADVDIIIERCAGAGHLRDDILHYNKELEKVTD  1196

Query  293   PDEMKREAALSFFVEYLERY*FLICFAVYLH  385
              D+  R   +   ++ L RY FLI F  YL+
Sbjct  1197  DDDEHRAYLMDMGIKALRRYFFLITFRSYLY  1227


 Score = 53.9 bits (128),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 63/131 (48%), Gaps = 10/131 (8%)
 Frame = +2

Query  1349  PKKDSSHE-FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFN  1525
             P + S  E   + D   +  +TR+  +G + +  +D II+RC+   ++R  +L Y +   
Sbjct  1133  PSRTSDEEALRMGDYRDILSLTRVLIHGPKSKADVDIIIERCAGAGHLRDDILHYNKELE  1192

Query  1526  QQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRP  1702
             +   +  E R  L + G + L RYF LI F +YL       +C      T F  W+  RP
Sbjct  1193  KVTDDDDEHRAYLMDMGIKALRRYFFLITFRSYL-------YC-TSPIETKFTSWMDARP  1244

Query  1703  EVQAMKWSIRL  1735
             E+  +  ++R+
Sbjct  1245  ELGHLCSNLRI  1255



>gb|EYU46893.1| hypothetical protein MIMGU_mgv1a000330mg [Erythranthe guttata]
Length=1250

 Score =   504 bits (1298),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 241/293 (82%), Positives = 260/293 (89%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA+ KPS AN   S + RP EM QVAALR+GEVLGSQTVLKSD
Sbjct  389   YSILRRLLRRDPMGALGYANPKPSLANSAGSADRRPLEMSQVAALRNGEVLGSQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC HP L ER+EGA NFREIPGFPVYGVANPTV GI SVIQRIGSSK GRPVFWHNM
Sbjct  449   HCPGCQHPCLRERVEGAPNFREIPGFPVYGVANPTVDGIRSVIQRIGSSKGGRPVFWHNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE V+YINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDI+REAERY GAIMV
Sbjct  509   REEPVVYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDILREAERYQGAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQI D+WEHVS  +VQTP EVF C EA+GFPIKYAR+PITD KAPK SDFDTLA
Sbjct  569   IHETDDGQISDAWEHVSLHAVQTPREVFTCFEADGFPIKYARVPITDGKAPKGSDFDTLA  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
             +NI SASK TA VFNCQMGIGRTTTGTVIACL+KLRI+YGRPIRV+ D L ++
Sbjct  629   MNIVSASKDTAFVFNCQMGIGRTTTGTVIACLLKLRINYGRPIRVVVDDLSQK  681


 Score =   380 bits (976),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  1355  KDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQR  1534
             +DS H FGINDILLLWKITRLFDNGVECREALD+IIDRCSALQNIRQAVLQYR+LFNQQ 
Sbjct  709   EDSGHSFGINDILLLWKITRLFDNGVECREALDSIIDRCSALQNIRQAVLQYRQLFNQQH  768

Query  1535  TEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA  1714
              EPRERRVALNRGAEYLERYFRLIAFAAYLGS AFDGFCGQGES  TFK WLHQRPEVQA
Sbjct  769   VEPRERRVALNRGAEYLERYFRLIAFAAYLGSKAFDGFCGQGESRMTFKSWLHQRPEVQA  828

Query  1715  MKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRT  1894
             MKWSIRLRPGRFFT+PEELR PHE +HGDAVMEAIVKDRNGSVLGKGSIL MYFFPGQRT
Sbjct  829   MKWSIRLRPGRFFTVPEELRAPHESQHGDAVMEAIVKDRNGSVLGKGSILKMYFFPGQRT  888

Query  1895  SSHIQIHGAPHVYKV  1939
             SSHI IHGAPHVYKV
Sbjct  889   SSHIPIHGAPHVYKV  903


 Score =   204 bits (518),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT+S+G++S C ++ T  +PNSE++IRRGEY+VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  251  GIPRTSSMGKISDCSSSITFDLPNSEESIRRGEYSVIRSLIRVLEGGVEGKRQVDKVIDK  310

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIA+YR+SIL Q DEMKREA+LSFFVEYLERY FLICFAVYLHTERDAL+P
Sbjct  311  CASMQNLREAIASYRSSILCQADEMKREASLSFFVEYLERYYFLICFAVYLHTERDALYP  370

Query  410  TS  415
             S
Sbjct  371  VS  372


 Score =   251 bits (640),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 167/242 (69%), Gaps = 4/242 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV   R G VLG +T+LKSDH PGCH+  L   ++GA N+R+    PV+GVA PT
Sbjct  5     PKEPEQVIKQRDGSVLGKKTILKSDHFPGCHNKRLVPHVDGAPNYRKANSLPVHGVAIPT  64

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+   G    V W N+REE V+YIN +PFVLR+VE+P+ N LEYTGI+ 
Sbjct  65    TDGIRNVLKHIGAHMNGEQIRVLWINLREEPVVYINSRPFVLRDVEQPFSN-LEYTGINR  123

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+ME RLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L  
Sbjct  124   VRVEQMEDRLKEDILIEAARYGNKILVTDELPDGQMVDQWEPVSHDSVKTPLEVYEEL-T  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
               + + Y R+P+TD+K+PK  DFD L   I+ A+  T ++FNCQMG GRTTTG VIA L+
Sbjct  183   HHYLVDYERVPVTDEKSPKEQDFDILVHKISKANVRTEIIFNCQMGRGRTTTGMVIATLI  242

Query  1221  KL  1226
              +
Sbjct  243   YI  244


 Score =   129 bits (323),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 131/247 (53%), Gaps = 20/247 (8%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPS-LPERLEGALNFREIPGFPVYGVANPTVS  692
             M+ +   R+G VLG  ++LK    PG    S +P  + GA +  ++ G+PVY +A PT+ 
Sbjct  860   MEAIVKDRNGSVLGKGSILKMYFFPGQRTSSHIP--IHGAPHVYKVDGYPVYSMATPTIV  917

Query  693   GILSVIQRIGS--SKEG---RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
             G   ++  +G+  + EG   + V   ++REE V+YIN  PFVLRE+ +P  + L++ GI 
Sbjct  918   GAEEMLAYLGAKPTAEGNASKKVVVTDLREEAVVYINNTPFVLRELNKPV-DTLKHIGIT  976

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHET------ADGQIFDSWEHVSSDSVQTPLE  1019
                VE MEARLK+DI+ E  R  G  M++H            +   WE++  D V+TP E
Sbjct  977   GPVVEHMEARLKEDIISEI-RNSGGRMLLHREEYNPALKQASVIGYWENIFVDDVKTPAE  1035

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLAL-NIASASKYTALVFNCQMGIGRTTT  1196
             V+  L+ EG+ I Y R P+T ++   +SD D++      SA  Y   +F    G G    
Sbjct  1036  VYAALKHEGYNIAYQRTPLTREREALASDVDSIQYCKDESAGSY---LFVSHTGFGGVAY  1092

Query  1197  GTVIACL  1217
                I C+
Sbjct  1093  AMAIICI  1099


 Score = 80.1 bits (196),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 89/184 (48%), Gaps = 8/184 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR     Q  E + R  +L+  
Sbjct  286   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIASYRSSILCQADEMK-REASLSFF  344

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA YL ++  D          +F  W+  RPE+ + ++  +R  P   
Sbjct  345   VEYLERYYFLICFAVYLHTER-DALYPVSPGQCSFTEWMRARPELYSILRRLLRRDPMGA  403

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P    +          M  +   RNG VLG  ++L     PG Q      ++ 
Sbjct  404   LGYANPKPSLANSAGSADRRPLEMSQVAALRNGEVLGSQTVLKSDHCPGCQHPCLRERVE  463

Query  1916  GAPH  1927
             GAP+
Sbjct  464   GAPN  467


 Score = 71.2 bits (173),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +3

Query  1926  MFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             +  RCAGAGHLR+DI+Y+ KE +K  +D DE+RAYL+DMGI+ALR
Sbjct  1163  VIDRCAGAGHLRDDILYYNKEFEKLSNDSDEYRAYLVDMGIKALR  1207


 Score = 63.5 bits (153),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 55/103 (53%), Gaps = 3/103 (3%)
 Frame = +2

Query  89    CGANATDIMPNSEDAIRR-GEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIA  265
             C +N+   + NS+D  R+ G+Y  I SLIRVL  G E K  VD VIDRCA   +LR+ I 
Sbjct  1119  CSSNSRGELFNSDDEARKMGDYRDILSLIRVLVHGPESKAGVDSVIDRCAGAGHLRDDIL  1178

Query  266   TYRNSI--LRQPDEMKREAALSFFVEYLERY*FLICFAVYLHT  388
              Y      L    +  R   +   ++ L RY FLI F  YL++
Sbjct  1179  YYNKEFEKLSNDSDEYRAYLVDMGIKALRRYFFLIAFRSYLYS  1221


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  726  ITRLFDNGVECREALDSIIDRCSALQNIRQAVLQYRQLFNQQHVEPRERRVALNRGAEYL  785

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL ++
Sbjct  786  ERYFRLIAFAAYLGSK  801


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 61/118 (52%), Gaps = 12/118 (10%)
 Frame = +2

Query  1385  DILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVAL  1564
             DIL L    R+  +G E +  +D++IDRC+   ++R  +L Y + F +   +  E R  L
Sbjct  1142  DILSL---IRVLVHGPESKAGVDSVIDRCAGAGHLRDDILYYNKEFEKLSNDSDEYRAYL  1198

Query  1565  -NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + G + L RYF LIAF +YL S +         +   F  W+  RPE+  +  ++R+
Sbjct  1199  VDMGIKALRRYFFLIAFRSYLYSTS--------ATEIRFTSWMDARPELAHLCNNLRI  1248



>ref|XP_010091448.1| hypothetical protein L484_013904 [Morus notabilis]
 gb|EXB44485.1| hypothetical protein L484_013904 [Morus notabilis]
Length=1223

 Score =   496 bits (1276),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 235/293 (80%), Positives = 262/293 (89%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA+LKPS     EST GRPSEM  VAA R+GEVLGSQTVLKSD
Sbjct  385   YSIIRRLLRRDPMGALGYANLKPSLMKIAESTGGRPSEMGIVAASRNGEVLGSQTVLKSD  444

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER++GA NFRE+PGFPVYGVANPT+ GI SVI+RIG  K G PV WHNM
Sbjct  445   HCPGCQNQSLPERVDGAPNFREVPGFPVYGVANPTIDGIRSVIKRIGGYKGGCPVLWHNM  504

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAE Y GAIMV
Sbjct  505   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAEHYGGAIMV  564

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+SD++QTPLEVFKCLEA+GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  565   IHETDDGQIFDAWEHVNSDAIQTPLEVFKCLEADGFPIKYARVPITDGKAPKSSDFDTLA  624

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
             +NIAS+SK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPI++L D++  E
Sbjct  625   MNIASSSKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIKILLDSMTHE  677


 Score =   373 bits (957),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 193/217 (89%), Gaps = 2/217 (1%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G  P  A  + K R +K+    FGINDILLLWKITRLFDNGVECREALDAIIDR
Sbjct  685   SGEETGG--PVAASDVAKVRIEKEQGQSFGINDILLLWKITRLFDNGVECREALDAIIDR  742

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  743   CSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  802

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLH+RPEVQAMKWSIRLRPGRFFT+PEELR P+E ++GDAVMEAIVK 
Sbjct  803   CGQGESRMTFKDWLHKRPEVQAMKWSIRLRPGRFFTVPEELRAPYESQNGDAVMEAIVKA  862

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSS+IQIHGAPHVYKV
Sbjct  863   RNGSVLGKGSILKMYFFPGQRTSSNIQIHGAPHVYKV  899


 Score =   205 bits (522),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGR+S   AN TD + NS++A+RRGEY VIRSL+RVLEGG+EGK+QVDKVIDR
Sbjct  247  GIPRTNSIGRISDSAANVTDHISNSDEALRRGEYAVIRSLVRVLEGGLEGKRQVDKVIDR  306

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKREA LSFFVEYLERY FLICFAVY+H+E+ AL  
Sbjct  307  CASMQNLREAIATYRNSILRQPDEMKREALLSFFVEYLERYYFLICFAVYIHSEKSALQS  366

Query  410  TS  415
            +S
Sbjct  367  SS  368


 Score =   256 bits (654),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 165/230 (72%), Gaps = 3/230 (1%)
 Frame = +3

Query  537   RSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQR  716
             R G VLG +T+LKSDH PGCH+  L   ++GA N+R+     V+GVA PT+ GI +V+  
Sbjct  14    RGGAVLGKKTILKSDHFPGCHNKRLSPHIDGAPNYRQAECLHVHGVAIPTMDGIRNVLNH  73

Query  717   IGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKD  896
             I ++K  R + W ++REE V+YING+PFVLR+VERP+ N LEYTGI+  RVE+MEARL+D
Sbjct  74    I-NAKTSR-LLWISLREEPVVYINGRPFVLRDVERPFSN-LEYTGINRARVEQMEARLRD  130

Query  897   DIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPI  1076
             DI  EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ EG+ + Y R+PI
Sbjct  131   DIFVEAARYENKILVTDELPDGQMVDQWEPVSRDSVKTPLEVYEELQVEGYLVDYERVPI  190

Query  1077  TDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             TD+KAPK SDFD L   I+ A   T ++FNCQMG GRTTTG VI  LV L
Sbjct  191   TDEKAPKESDFDILVHKISQADINTEIIFNCQMGRGRTTTGMVITTLVYL  240


 Score =   132 bits (331),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 125/224 (56%), Gaps = 13/224 (6%)
 Frame = +3

Query  489   ESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVY  668
             ES NG  + M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY
Sbjct  848   ESQNG-DAVMEAIVKARNGSVLGKGSILKMYFFPG-QRTSSNIQIHGAPHVYKVDGYPVY  905

Query  669   GVANPTVSGILSVIQRIGSSKEG-----RPVFWHNMREEHVIYINGKPFVLREVERPYKN  833
              +A PT++G   ++  + +  E      + V   ++REE V+YING PFVLRE+ +P  +
Sbjct  906   SMATPTIAGAKEMLSYLSAKPEAEGFAAQKVILTDLREEAVVYINGTPFVLRELNKPV-D  964

Query  834   MLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHETAD-----GQIFDSWEHVSSD  998
              L++ GI    VE ME RLK+DI+ E  +  G I++  E  +       +   WE++  D
Sbjct  965   TLKHAGITGPVVEHMEMRLKEDILAEVRQSGGRILLHREEYNPALKQSSVIGYWENIFPD  1024

Query  999   SVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNI  1130
              V+TP EV+  L+ +G+ I Y RIP+T ++   SSD D +   I
Sbjct  1025  GVKTPSEVYTSLKGDGYNITYRRIPLTREREALSSDVDEIQYCI  1068


 Score = 82.4 bits (202),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 93/188 (49%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + G+E +  +D +IDRC+++QN+R+A+  YR    +Q  E + R   L+  
Sbjct  282   VIRSLVRVLEGGLEGKRQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REALLSFF  340

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ S+             +F  W+  RPE+ + ++  +R  P   
Sbjct  341   VEYLERYYFLICFAVYIHSEK-SALQSSSLDNVSFADWMRARPELYSIIRRLLRRDPMGA  399

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++         + M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  400   LGYANLKPSLMKIAESTGGRPSEMGIVAASRNGEVLGSQTVLKSDHCPGCQNQSLPERVD  459

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  460   GAPNFREV  467


 Score = 80.1 bits (196),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  1923  LMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             L+  RCAGAGHLR+DI Y+ KEL+KFPD DDEH AYLMDMGI+ALR
Sbjct  1135  LVIERCAGAGHLRDDIFYYRKELEKFPDIDDEHGAYLMDMGIKALR  1180


 Score = 64.3 bits (155),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  722  ITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYL  781

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  782  ERYFRLIAFAAYLGSE  797


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 54/108 (50%), Gaps = 2/108 (2%)
 Frame = +2

Query  122   SEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDE  301
             +E+ +R G+Y  I SL RVL  G E K   D VI+RCA   +LR+ I  YR  + + PD 
Sbjct  1104  NEETLRMGDYRDILSLTRVLVYGPESKADADLVIERCAGAGHLRDDIFYYRKELEKFPDI  1163

Query  302   MKREAA--LSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
                  A  +   ++ L RY FLI F  YL     A    +   E RP+
Sbjct  1164  DDEHGAYLMDMGIKALRRYFFLITFRSYLLCTPAANTTFASWMEARPE  1211



>ref|XP_002282028.2| PREDICTED: paladin [Vitis vinifera]
Length=1257

 Score =   497 bits (1279),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 239/295 (81%), Positives = 264/295 (89%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA+L+PS     +S +GRP EM  VAA R+GEVLGSQTVLKSD
Sbjct  391   YSIIRRLLRRDPMGALGYANLEPSLTKIADSADGRPYEMGVVAARRNGEVLGSQTVLKSD  450

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI RIGSSK GRPVFWHNM
Sbjct  451   HCPGCQNSSLPERVEGAPNFREVPGFPVYGVANPTIDGIQSVIWRIGSSKSGRPVFWHNM  510

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGI+ ERVERMEARLK+DI+REAE Y  AIMV
Sbjct  511   REEPVIYINGKPFVLREVERPYKNMLEYTGIERERVERMEARLKEDILREAEHYGHAIMV  570

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET D +IFD+WEHVSSDSVQTPLEVF+CLEA GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  571   IHETDDRKIFDAWEHVSSDSVQTPLEVFRCLEANGFPIKYARVPITDGKAPKSSDFDTLA  630

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV-LNDALHEEL  1283
             +NIASASK TA VFNCQMGIGRTTTGTVIACL+KLRIDYGRPIR+ L+D  HEE+
Sbjct  631   VNIASASKDTAFVFNCQMGIGRTTTGTVIACLLKLRIDYGRPIRILLDDISHEEV  685


 Score =   371 bits (953),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G+       I   R +K+    FGI+DILLLWKITRLFDNGVECREALDA+IDR
Sbjct  691   SGEETGGNGAASTSSISNVRTEKEQGRAFGIDDILLLWKITRLFDNGVECREALDAVIDR  750

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  751   CSALQNIRQAVLQYRKVFNQQHAEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  810

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WL +RPEVQAMKWSIRLRPGRFFT+PEELR PHE +HGDAVMEAIVK 
Sbjct  811   CGQGESKMTFKSWLQRRPEVQAMKWSIRLRPGRFFTVPEELRAPHESQHGDAVMEAIVKA  870

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVY+V
Sbjct  871   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYEV  907


 Score =   203 bits (517),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G+PR++SIG+V   G N +D +PNSE+AIRRGEY  IRSLIRVLEGGVEGK+QVDKVID+
Sbjct  253  GMPRSDSIGKVFDSGTNVSDHLPNSEEAIRRGEYAAIRSLIRVLEGGVEGKRQVDKVIDK  312

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQ DEMKREA LSFFVEYLERY FLICFAVY+HT+R ALHP
Sbjct  313  CASMQNLREAIATYRNSILRQRDEMKREALLSFFVEYLERYYFLICFAVYIHTDRAALHP  372

Query  410  TS  415
             S
Sbjct  373  DS  374


 Score =   265 bits (678),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 174/242 (72%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT
Sbjct  6     PREPEQVMKLRGGSVLGRKTILKSDHFPGCQNKRLSPQIDGAPNYRQADSVHVHGVAIPT  65

Query  687   VSGILSVIQRIGSS--KEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V++ IG+   ++   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  66    IDGIRNVLEHIGAQVDRKQTQVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  124

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ 
Sbjct  125   ARVEQMEARLKEDILMEAARYGYKILVTDELPDGQMVDQWEPVSRDSVKTPLEVYEELQV  184

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+P+TD+K+PK  DFD L   I+ A+  T ++FNCQMG GRTTTG VIA LV
Sbjct  185   EGYLVDYERVPVTDEKSPKELDFDILVHKISQANINTEIIFNCQMGRGRTTTGMVIATLV  244

Query  1221  KL  1226
              L
Sbjct  245   YL  246


 Score =   135 bits (341),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 146/296 (49%), Gaps = 24/296 (8%)
 Frame = +3

Query  387   QNEMHFTLLRRLLRRDPMGALGYA-SLKPSPANDVESTNGRPSE-------MDQVAALRS  542
             Q E   T    L RR  + A+ ++  L+P     V      P E       M+ +   R+
Sbjct  813   QGESKMTFKSWLQRRPEVQAMKWSIRLRPGRFFTVPEELRAPHESQHGDAVMEAIVKARN  872

Query  543   GEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIG  722
             G VLG  ++LK    PG    S   ++ GA +  E+ G+PVY +A PT++G   ++  +G
Sbjct  873   GSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYEVDGYPVYSMATPTITGAKEMLAYLG  931

Query  723   SS--KEG---RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEAR  887
             +    EG   + V   ++REE V+YING PFVLRE+ +P  + L++ GI    VE MEAR
Sbjct  932   AKPIAEGSFHQKVILTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGITGPVVEHMEAR  990

Query  888   LKDDIMREAERYHGAIMVIHETA------DGQIFDSWEHVSSDSVQTPLEVFKCLEAEGF  1049
             LK+DI+ E  R  G  M++H            +   WE++  D V+TP EV+  L+ EG+
Sbjct  991   LKEDILSEV-RQSGGRMLLHREEYSPALNQCSVIGYWENIFVDDVKTPAEVYAALKDEGY  1049

Query  1050  PIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACL  1217
              I + RIP+T ++   +SD D  A+           +F    G G       I C+
Sbjct  1050  NIAHRRIPLTREREALASDVD--AIQYCKDDSAGCYLFVSHTGFGGVAYAMAIICI  1103


 Score = 65.1 bits (157),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D VIDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  730  ITRLFDNGVECREALDAVIDRCSALQNIRQAVLQYRKVFNQQHAEPRVRRVALNRGAEYL  789

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  790  ERYFRLIAFAAYLGSE  805


 Score = 84.3 bits (207),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 95/189 (50%), Gaps = 18/189 (10%)
 Frame = +2

Query  1406  ITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYL  1585
             + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +QR E + R   L+   EYL
Sbjct  292   LIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQRDEMK-REALLSFFVEYL  350

Query  1586  ERYFRLIAFAAYLGSDAF----DGFCGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFF  1753
             ERY+ LI FA Y+ +D      D F       ++F  W+  RPE+ ++   + LR     
Sbjct  351   ERYYFLICFAVYIHTDRAALHPDSF-----GHSSFADWMRARPELYSIIRRL-LRRDPMG  404

Query  1754  TIPEELRTPHELKHGDAV------MEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQI  1912
              +      P   K  D+       M  +   RNG VLG  ++L     PG Q +S   ++
Sbjct  405   ALGYANLEPSLTKIADSADGRPYEMGVVAARRNGEVLGSQTVLKSDHCPGCQNSSLPERV  464

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  465   EGAPNFREV  473


 Score = 75.5 bits (184),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAG+LR DI++++KEL+KF + DDEHRAYLMDMGI+ALR
Sbjct  1167  VDIVIERCAGAGNLRHDILFYSKELEKFSNGDDEHRAYLMDMGIKALR  1214


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 63/133 (47%), Gaps = 9/133 (7%)
 Frame = +2

Query  1340  KTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRL  1519
             +  P +DS     + D   +  +TR+   G + +  +D +I+RC+   N+R  +L Y + 
Sbjct  1131  ENSPSRDSDEVHKMGDYRDILSLTRVLMYGPKSKADVDIVIERCAGAGNLRHDILFYSKE  1190

Query  1520  FNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQ  1696
               +      E R  L + G + L RYF LI F +YL       +C    + T F  W+  
Sbjct  1191  LEKFSNGDDEHRAYLMDMGIKALRRYFFLITFRSYL-------YCTSA-TETEFTAWMDA  1242

Query  1697  RPEVQAMKWSIRL  1735
             RPE+  +  ++R+
Sbjct  1243  RPELGHLCNNLRM  1255


 Score = 53.9 bits (128),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 47/91 (52%), Gaps = 2/91 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSI--LRQ  292
             +S++  + G+Y  I SL RVL  G + K  VD VI+RCA   NLR  I  Y   +     
Sbjct  1137  DSDEVHKMGDYRDILSLTRVLMYGPKSKADVDIVIERCAGAGNLRHDILFYSKELEKFSN  1196

Query  293   PDEMKREAALSFFVEYLERY*FLICFAVYLH  385
              D+  R   +   ++ L RY FLI F  YL+
Sbjct  1197  GDDEHRAYLMDMGIKALRRYFFLITFRSYLY  1227



>ref|XP_007221462.1| hypothetical protein PRUPE_ppa000439mg [Prunus persica]
 gb|EMJ22661.1| hypothetical protein PRUPE_ppa000439mg [Prunus persica]
Length=1183

 Score =   488 bits (1255),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/293 (79%), Positives = 261/293 (89%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYASLKPS     ES +GRP EM  VAALR GEVLGSQTVLKSD
Sbjct  317   YSIIRRLLRRDPMGALGYASLKPSLKKIAESADGRPYEMGVVAALRKGEVLGSQTVLKSD  376

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + +LPE ++GA NFRE+PGFPVYGVANPT+ GI SVIQ+I SSK+GRPVFWHNM
Sbjct  377   HCPGCQNQNLPEGVDGAPNFREVPGFPVYGVANPTIDGIRSVIQKICSSKDGRPVFWHNM  436

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAE Y GAIMV
Sbjct  437   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAEHYGGAIMV  496

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+S+++QTPLEVFK LE +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  497   IHETDDGQIFDAWEHVNSEAIQTPLEVFKGLETDGFPIKYARVPITDGKAPKSSDFDTLA  556

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRI++GRPI++L D +  E
Sbjct  557   INIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIEHGRPIKILVDNITLE  609


 Score =   373 bits (958),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = +2

Query  1334  ILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR  1513
             +   R +KD    FG+NDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR
Sbjct  632   VTAVRNEKDQGRVFGMNDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR  691

Query  1514  RLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLH  1693
             ++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGFCGQGES  TFK+WLH
Sbjct  692   KVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGFCGQGESRMTFKNWLH  751

Query  1694  QRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMY  1873
             QRPEVQAMKWSIRLRPGRFFT+PEELR PHE +HGDAVMEAIVK R+GSVLGKGSIL MY
Sbjct  752   QRPEVQAMKWSIRLRPGRFFTVPEELRAPHESQHGDAVMEAIVKARSGSVLGKGSILKMY  811

Query  1874  FFPGQRTSSHIQIHGAPHVYKV  1939
             FFPGQRTSSHIQIHGAPHVYKV
Sbjct  812   FFPGQRTSSHIQIHGAPHVYKV  833


 Score =   210 bits (534),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIG+VS   A  TD  PNSEDAIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  179  GIPRTNSIGKVSDSSAIVTDNFPNSEDAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  238

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+ER AL  
Sbjct  239  CASMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHSERAALRS  298

Query  410  TS  415
            +S
Sbjct  299  SS  300


 Score =   182 bits (463),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 113/153 (74%), Gaps = 1/153 (1%)
 Frame = +3

Query  768   EHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIH  947
             + V+YING+PFVLR+VERP+ N LEYTGI+  R+E+MEARLK+DI+ EA RY   I+V  
Sbjct  21    KQVVYINGRPFVLRDVERPFSN-LEYTGINRARLEQMEARLKEDILIEAARYGNKILVTD  79

Query  948   ETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALN  1127
             E  DGQ+ D WE VS DSV TPLEV++ L+ +G+ + Y R+PITD+K+PK  DFD L   
Sbjct  80    ELPDGQMVDQWEPVSRDSVTTPLEVYEELQVQGYLVDYERVPITDEKSPKELDFDILVHK  139

Query  1128  IASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             I+ A     ++FNCQMG GRTTTG VIA L+ L
Sbjct  140   ISQADINAEIIFNCQMGRGRTTTGMVIATLIYL  172


 Score = 77.0 bits (188),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 107/219 (49%), Gaps = 10/219 (5%)
 Frame = +2

Query  1301  SDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSAL  1480
             S G V   + ++    P  + +   G  +  ++  + R+ + GVE +  +D +ID+C+++
Sbjct  185   SIGKVSDSSAIVTDNFPNSEDAIRRG--EYAVIRSLIRVLEGGVEGKRQVDKVIDKCASM  242

Query  1481  QNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQG  1660
             QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI FA Y+ S+         
Sbjct  243   QNLREAIATYRNSILRQPDEMK-REASLSFFVEYLERYYFLICFAVYIHSER-AALRSSS  300

Query  1661  ESMTTFKHWLHQRPEVQA-MKWSIRLRPG---RFFTIPEELRTPHELKHGDAV-MEAIVK  1825
                ++F  W+  RPE+ + ++  +R  P     + ++   L+   E   G    M  +  
Sbjct  301   VGYSSFADWMKARPELYSIIRRLLRRDPMGALGYASLKPSLKKIAESADGRPYEMGVVAA  360

Query  1826  DRNGSVLGKGSILTMYFFPGQRTSSHIQ-IHGAPHVYKV  1939
              R G VLG  ++L     PG +  +  + + GAP+  +V
Sbjct  361   LRKGEVLGSQTVLKSDHCPGCQNQNLPEGVDGAPNFREV  399


 Score =   134 bits (336),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/253 (33%), Positives = 134/253 (53%), Gaps = 15/253 (6%)
 Frame = +3

Query  489   ESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVY  668
             ES +G  + M+ +   RSG VLG  ++LK    PG    S   ++ GA +  ++ G+PVY
Sbjct  782   ESQHG-DAVMEAIVKARSGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDGYPVY  839

Query  669   GVANPTVSGILSVIQRIGSSKEG-----RPVFWHNMREEHVIYINGKPFVLREVERPYKN  833
              +A PT+ G   ++  +G+  +      + V   ++REE V+YING PFVLRE+ +P  +
Sbjct  840   SMATPTIPGAKEMLAYLGAKPKAEGSAAQKVILTDLREEAVVYINGTPFVLRELNKPV-D  898

Query  834   MLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHET-----ADGQIFDSWEHVSSD  998
              L++ GI    VE MEARLK+DI+ E  R  G +++  E          +    E++ +D
Sbjct  899   TLKHVGITGPVVEHMEARLKEDILSEVRRSGGRMLLHREEYSPALNQSSVIGYLENIFAD  958

Query  999   SVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMG  1178
              V+TP EV+  L+ EG+ I Y RIP+T ++   +SD D +   I  ++     +F    G
Sbjct  959   DVKTPAEVYAALKDEGYNITYRRIPLTREREALASDVDAIQYCIDDSA--GCYLFVSHTG  1016

Query  1179  IGRTTTGTVIACL  1217
              G       I C+
Sbjct  1017  FGGVAYAMAIICI  1029


 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGHLR+DI+Y++KEL+KFPDDDDEHRAYLMDMGI+ALR
Sbjct  1093  VDVVIERCAGAGHLRDDILYYSKELEKFPDDDDEHRAYLMDMGIKALR  1140


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  656  ITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYL  715

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  716  ERYFRLIAFAAYLGSE  731


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 57/109 (52%), Gaps = 3/109 (3%)
 Frame = +2

Query  122   SEDAIRR-GEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD  298
             S++ +RR G+Y  I SL RVL  G + K  VD VI+RCA   +LR+ I  Y   + + PD
Sbjct  1063  SDEEVRRMGDYRDILSLTRVLVYGPKSKADVDVVIERCAGAGHLRDDILYYSKELEKFPD  1122

Query  299   EMKREAA--LSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
             +     A  +   ++ L RY FLI F  YL+    A    +   + RP+
Sbjct  1123  DDDEHRAYLMDMGIKALRRYFFLITFRSYLYCTSAAEIKFASWMDARPE  1171



>emb|CBI37075.3| unnamed protein product [Vitis vinifera]
Length=1255

 Score =   496 bits (1278),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 239/295 (81%), Positives = 264/295 (89%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA+L+PS     +S +GRP EM  VAA R+GEVLGSQTVLKSD
Sbjct  389   YSIIRRLLRRDPMGALGYANLEPSLTKIADSADGRPYEMGVVAARRNGEVLGSQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI RIGSSK GRPVFWHNM
Sbjct  449   HCPGCQNSSLPERVEGAPNFREVPGFPVYGVANPTIDGIQSVIWRIGSSKSGRPVFWHNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGI+ ERVERMEARLK+DI+REAE Y  AIMV
Sbjct  509   REEPVIYINGKPFVLREVERPYKNMLEYTGIERERVERMEARLKEDILREAEHYGHAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET D +IFD+WEHVSSDSVQTPLEVF+CLEA GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  569   IHETDDRKIFDAWEHVSSDSVQTPLEVFRCLEANGFPIKYARVPITDGKAPKSSDFDTLA  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV-LNDALHEEL  1283
             +NIASASK TA VFNCQMGIGRTTTGTVIACL+KLRIDYGRPIR+ L+D  HEE+
Sbjct  629   VNIASASKDTAFVFNCQMGIGRTTTGTVIACLLKLRIDYGRPIRILLDDISHEEV  683


 Score =   371 bits (952),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G+       I   R +K+    FGI+DILLLWKITRLFDNGVECREALDA+IDR
Sbjct  689   SGEETGGNGAASTSSISNVRTEKEQGRAFGIDDILLLWKITRLFDNGVECREALDAVIDR  748

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  749   CSALQNIRQAVLQYRKVFNQQHAEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  808

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WL +RPEVQAMKWSIRLRPGRFFT+PEELR PHE +HGDAVMEAIVK 
Sbjct  809   CGQGESKMTFKSWLQRRPEVQAMKWSIRLRPGRFFTVPEELRAPHESQHGDAVMEAIVKA  868

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVY+V
Sbjct  869   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYEV  905


 Score =   203 bits (516),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G+PR++SIG+V   G N +D +PNSE+AIRRGEY  IRSLIRVLEGGVEGK+QVDKVID+
Sbjct  251  GMPRSDSIGKVFDSGTNVSDHLPNSEEAIRRGEYAAIRSLIRVLEGGVEGKRQVDKVIDK  310

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQ DEMKREA LSFFVEYLERY FLICFAVY+HT+R ALHP
Sbjct  311  CASMQNLREAIATYRNSILRQRDEMKREALLSFFVEYLERYYFLICFAVYIHTDRAALHP  370

Query  410  TS  415
             S
Sbjct  371  DS  372


 Score =   265 bits (678),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 174/242 (72%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT
Sbjct  4     PREPEQVMKLRGGSVLGRKTILKSDHFPGCQNKRLSPQIDGAPNYRQADSVHVHGVAIPT  63

Query  687   VSGILSVIQRIGSS--KEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V++ IG+   ++   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  64    IDGIRNVLEHIGAQVDRKQTQVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ 
Sbjct  123   ARVEQMEARLKEDILMEAARYGYKILVTDELPDGQMVDQWEPVSRDSVKTPLEVYEELQV  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+P+TD+K+PK  DFD L   I+ A+  T ++FNCQMG GRTTTG VIA LV
Sbjct  183   EGYLVDYERVPVTDEKSPKELDFDILVHKISQANINTEIIFNCQMGRGRTTTGMVIATLV  242

Query  1221  KL  1226
              L
Sbjct  243   YL  244


 Score =   135 bits (341),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 146/296 (49%), Gaps = 24/296 (8%)
 Frame = +3

Query  387   QNEMHFTLLRRLLRRDPMGALGYA-SLKPSPANDVESTNGRPSE-------MDQVAALRS  542
             Q E   T    L RR  + A+ ++  L+P     V      P E       M+ +   R+
Sbjct  811   QGESKMTFKSWLQRRPEVQAMKWSIRLRPGRFFTVPEELRAPHESQHGDAVMEAIVKARN  870

Query  543   GEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIG  722
             G VLG  ++LK    PG    S   ++ GA +  E+ G+PVY +A PT++G   ++  +G
Sbjct  871   GSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYEVDGYPVYSMATPTITGAKEMLAYLG  929

Query  723   SS--KEG---RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEAR  887
             +    EG   + V   ++REE V+YING PFVLRE+ +P  + L++ GI    VE MEAR
Sbjct  930   AKPIAEGSFHQKVILTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGITGPVVEHMEAR  988

Query  888   LKDDIMREAERYHGAIMVIHETA------DGQIFDSWEHVSSDSVQTPLEVFKCLEAEGF  1049
             LK+DI+ E  R  G  M++H            +   WE++  D V+TP EV+  L+ EG+
Sbjct  989   LKEDILSEV-RQSGGRMLLHREEYSPALNQCSVIGYWENIFVDDVKTPAEVYAALKDEGY  1047

Query  1050  PIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACL  1217
              I + RIP+T ++   +SD D  A+           +F    G G       I C+
Sbjct  1048  NIAHRRIPLTREREALASDVD--AIQYCKDDSAGCYLFVSHTGFGGVAYAMAIICI  1101


 Score = 65.1 bits (157),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D VIDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  728  ITRLFDNGVECREALDAVIDRCSALQNIRQAVLQYRKVFNQQHAEPRVRRVALNRGAEYL  787

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  788  ERYFRLIAFAAYLGSE  803


 Score = 84.3 bits (207),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 95/189 (50%), Gaps = 18/189 (10%)
 Frame = +2

Query  1406  ITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYL  1585
             + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +QR E + R   L+   EYL
Sbjct  290   LIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQRDEMK-REALLSFFVEYL  348

Query  1586  ERYFRLIAFAAYLGSDAF----DGFCGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFF  1753
             ERY+ LI FA Y+ +D      D F       ++F  W+  RPE+ ++   + LR     
Sbjct  349   ERYYFLICFAVYIHTDRAALHPDSF-----GHSSFADWMRARPELYSIIRRL-LRRDPMG  402

Query  1754  TIPEELRTPHELKHGDAV------MEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQI  1912
              +      P   K  D+       M  +   RNG VLG  ++L     PG Q +S   ++
Sbjct  403   ALGYANLEPSLTKIADSADGRPYEMGVVAARRNGEVLGSQTVLKSDHCPGCQNSSLPERV  462

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  463   EGAPNFREV  471


 Score = 75.5 bits (184),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAG+LR DI++++KEL+KF + DDEHRAYLMDMGI+ALR
Sbjct  1165  VDIVIERCAGAGNLRHDILFYSKELEKFSNGDDEHRAYLMDMGIKALR  1212


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 63/133 (47%), Gaps = 9/133 (7%)
 Frame = +2

Query  1340  KTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRL  1519
             +  P +DS     + D   +  +TR+   G + +  +D +I+RC+   N+R  +L Y + 
Sbjct  1129  ENSPSRDSDEVHKMGDYRDILSLTRVLMYGPKSKADVDIVIERCAGAGNLRHDILFYSKE  1188

Query  1520  FNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQ  1696
               +      E R  L + G + L RYF LI F +YL       +C    + T F  W+  
Sbjct  1189  LEKFSNGDDEHRAYLMDMGIKALRRYFFLITFRSYL-------YCTSA-TETEFTAWMDA  1240

Query  1697  RPEVQAMKWSIRL  1735
             RPE+  +  ++R+
Sbjct  1241  RPELGHLCNNLRM  1253


 Score = 53.9 bits (128),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 47/91 (52%), Gaps = 2/91 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSI--LRQ  292
             +S++  + G+Y  I SL RVL  G + K  VD VI+RCA   NLR  I  Y   +     
Sbjct  1135  DSDEVHKMGDYRDILSLTRVLMYGPKSKADVDIVIERCAGAGNLRHDILFYSKELEKFSN  1194

Query  293   PDEMKREAALSFFVEYLERY*FLICFAVYLH  385
              D+  R   +   ++ L RY FLI F  YL+
Sbjct  1195  GDDEHRAYLMDMGIKALRRYFFLITFRSYLY  1225



>ref|XP_003554588.1| PREDICTED: paladin-like [Glycine max]
Length=1247

 Score =   493 bits (1268),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/294 (80%), Positives = 262/294 (89%), Gaps = 1/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY+SLKPS     EST+GRPSEM  VAALR GEVLGSQTVLKSD
Sbjct  386   YSIIRRLLRRDPMGALGYSSLKPSLKKIAESTDGRPSEMGVVAALRKGEVLGSQTVLKSD  445

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +PSLPER++GA NFRE+PGFPVYGVANPT+ GI SVIQRIGSSK GRP+ WHNM
Sbjct  446   HCPGCQNPSLPERVDGAPNFREVPGFPVYGVANPTIDGIRSVIQRIGSSKGGRPILWHNM  505

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVE+MEARLK+DI+REA++Y GAIMV
Sbjct  506   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVEKMEARLKEDILREAKQYGGAIMV  565

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET D  IFD+WE V+SD +QTPLEVFK LEAEG PIKYAR+PITD KAPKSSDFDTLA
Sbjct  566   IHETDDKHIFDAWEDVTSDVIQTPLEVFKSLEAEGLPIKYARVPITDGKAPKSSDFDTLA  625

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEE  1280
              NIASA+K TA VFNCQMG GRT+TGTVIACLVKLRIDYGRPI++L +D  HEE
Sbjct  626   NNIASAAKDTAFVFNCQMGRGRTSTGTVIACLVKLRIDYGRPIKILGDDVTHEE  679


 Score =   372 bits (955),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE+ G+V   +   L+ +     +  FGINDILLLWKIT LFDNGVECREALD IIDR
Sbjct  686   SGDEAGGYVTTLSSNTLQRKTDDKQNCAFGINDILLLWKITTLFDNGVECREALDVIIDR  745

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  746   CSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  805

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLHQRPEVQAMKWSIRLRPGRFFT+PE+LR P E +HGDAVMEAIVK 
Sbjct  806   CGQGESKMTFKVWLHQRPEVQAMKWSIRLRPGRFFTVPEDLREPQESQHGDAVMEAIVKA  865

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  866   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  902


 Score =   201 bits (511),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR+NSIGR+     N  D +PNSE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  248  GFPRSNSIGRIFQSMTNVADHLPNSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  307

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+ER AL  
Sbjct  308  CASMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHSERAALRS  367

Query  410  TS  415
             +
Sbjct  368  NT  369


 Score =   257 bits (656),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 171/241 (71%), Gaps = 5/241 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIP-GFPVYGVANP  683
             P E +QV  +R G VLG +T+LKSDH PGC +  L  +++GA N+R+      V+GVA P
Sbjct  5     PKEPEQVMKMRGGCVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQASDSLHVHGVAIP  64

Query  684   TVSGILSVIQRIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
             T+ GI +V+  IG+  +   V W ++REE + YING+PFVLR+VERP+ N LEYTGI+ E
Sbjct  65    TIHGIRNVLNHIGARLK---VLWISLREEPLAYINGRPFVLRDVERPFSN-LEYTGINRE  120

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAE  1043
             RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ E
Sbjct  121   RVEQMEARLKEDILVEAARYGNKILVTDELPDGQMVDQWEPVSCDSVKTPLEVYEELQVE  180

Query  1044  GFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVK  1223
             G+ + Y R+PITD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV 
Sbjct  181   GYLVDYERVPITDEKSPKELDFDILVNKISQADVNTEIIFNCQMGRGRTTTGMVIATLVY  240

Query  1224  L  1226
             L
Sbjct  241   L  241


 Score =   138 bits (347),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 134/255 (53%), Gaps = 18/255 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  859   MEAIVKARNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDEYPVYCMATPTISG  917

Query  696   ILSVIQRIGS----SKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  +G+    S   + V   ++REE V+YIN  PFVLRE+ +P  N L+Y GI   
Sbjct  918   AKEMLDYLGAKPKPSLTAQKVILTDLREEAVVYINYTPFVLRELNKPV-NTLKYVGITGP  976

Query  864   RVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEVF  1025
              VE MEARLK+DI+ E  R  G  M++H       T    +   WE++ +D V+TP EV+
Sbjct  977   VVEHMEARLKEDILAEI-RQSGGRMLLHREEYNPSTNQSGVVGYWENIQADDVKTPAEVY  1035

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+ +G+ I Y RIP+T ++   +SD D  A+         + +F    G G       
Sbjct  1036  SALKDDGYDIVYQRIPLTRERNALASDID--AIQYCQDDSAGSYLFVSHTGFGGVAYAMA  1093

Query  1206  IACLVKLRIDYGRPI  1250
             I C   +R+D G  +
Sbjct  1094  IIC---IRLDAGSKV  1105


 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  283   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-REASLSFF  341

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRPG--  1744
              EYLERY+ LI FA Y+ S+             +F  W+  RPE+ + ++  +R  P   
Sbjct  342   VEYLERYYFLICFAVYIHSERA-ALRSNTADHCSFADWMRARPELYSIIRRLLRRDPMGA  400

Query  1745  -RFFTIPEELRTPHELKHG-DAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
               + ++   L+   E   G  + M  +   R G VLG  ++L     PG Q  S   ++ 
Sbjct  401   LGYSSLKPSLKKIAESTDGRPSEMGVVAALRKGEVLGSQTVLKSDHCPGCQNPSLPERVD  460

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  461   GAPNFREV  468


 Score = 77.0 bits (188),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +3

Query  1854  GLFLRCTSFLVRELQVTFKFMVRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYL  2033
             G  L  T  L+   Q   K  V ++  RC+GAGH+REDI+Y+  E +KF DDDDE RAYL
Sbjct  1138  GDILNLTRVLIHGPQS--KADVDIVIERCSGAGHIREDILYYNGEFEKFTDDDDEERAYL  1195

Query  2034  MDMGIRALR  2060
             MDMGI+ALR
Sbjct  1196  MDMGIKALR  1204


 Score = 61.2 bits (147),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            +  + + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  725  ITTLFDNGVECREALDVIIDRCSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYL  784

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  785  ERYFRLIAFAAYLGSE  800


 Score = 57.0 bits (136),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 59/114 (52%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQ-QRTEPRERRVALNRG  1573
             +  +TR+  +G + +  +D +I+RCS   +IR+ +L Y   F +    +  ER   ++ G
Sbjct  1140  ILNLTRVLIHGPQSKADVDIVIERCSGAGHIREDILYYNGEFEKFTDDDDEERAYLMDMG  1199

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL       +C    +M  F  W+  RPE+  +  ++R+
Sbjct  1200  IKALRRYFFLITFRSYL-------YCNSPANM-EFAAWMDARPELAHLCNNLRI  1245


 Score = 53.9 bits (128),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 62/128 (48%), Gaps = 6/128 (5%)
 Frame = +2

Query  92    GANATDIMPN---SEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAI  262
             GA   + +P+   +E A+  G+Y  I +L RVL  G + K  VD VI+RC+   ++RE I
Sbjct  1115  GAVTEEDLPSQTSNEMALSMGDYGDILNLTRVLIHGPQSKADVDIVIERCSGAGHIREDI  1174

Query  263   ATYRNSILRQPDEMKREAA--LSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRP  436
               Y     +  D+   E A  +   ++ L RY FLI F  YL+    A    +   + RP
Sbjct  1175  LYYNGEFEKFTDDDDEERAYLMDMGIKALRRYFFLITFRSYLYCNSPANMEFAAWMDARP  1234

Query  437   DGCTRLCK  460
             +    LC 
Sbjct  1235  E-LAHLCN  1241



>ref|XP_002515140.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47124.1| conserved hypothetical protein [Ricinus communis]
Length=1249

 Score =   496 bits (1276),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 238/290 (82%), Positives = 260/290 (90%), Gaps = 0/290 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYAS KPS     ES +GRP EM  VAALR+GEVLGSQTVLKSD
Sbjct  383   YSILRRLLRRDPMGALGYASSKPSLMKIAESADGRPHEMGVVAALRNGEVLGSQTVLKSD  442

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC   +LPER+EGA NFRE+PGFPVYGVANPT+ GILSVIQRIGSSK GRP+FWHNM
Sbjct  443   HCPGCQIHTLPERVEGAPNFREVPGFPVYGVANPTIDGILSVIQRIGSSKGGRPIFWHNM  502

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEY+GID ERV+ MEARLK+DI+REAE Y GAIMV
Sbjct  503   REEPVIYINGKPFVLREVERPYKNMLEYSGIDRERVQGMEARLKEDILREAESYGGAIMV  562

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+ DSV+TPLEVFKCLE +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  563   IHETDDGQIFDAWEHVNFDSVKTPLEVFKCLEVDGFPIKYARVPITDGKAPKSSDFDTLA  622

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDAL  1271
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL D +
Sbjct  623   VNIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLVDDM  672


 Score =   363 bits (933),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G+     P   + R   + +  FGI+DILLLWKITRLFDNGVECREALDA+IDR
Sbjct  683   SGEETGGNAARSPPSNTRMRTGTEQARAFGIDDILLLWKITRLFDNGVECREALDAVIDR  742

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVL YR++ NQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  743   CSALQNIRQAVLHYRKVVNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  802

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLHQRPEVQAMKWSIRLRPGRFFTIPEELR P E +HGDAVMEA +K 
Sbjct  803   CGQGESRMTFKTWLHQRPEVQAMKWSIRLRPGRFFTIPEELRAPQESQHGDAVMEATIKA  862

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLG GSIL MYFFPGQRTSSH+QIHGAPHVYKV
Sbjct  863   RNGSVLGTGSILKMYFFPGQRTSSHLQIHGAPHVYKV  899


 Score =   206 bits (524),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGRV   G   TD +PNSE+AIRRGEY VIRSL RVLEGGVEGK+QVDKVID+
Sbjct  245  GIPRTNSIGRVFDTGPTVTDNLPNSEEAIRRGEYAVIRSLTRVLEGGVEGKRQVDKVIDK  304

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIA YRN ILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+ERDAL  
Sbjct  305  CASMQNLREAIANYRNRILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHSERDALRS  364

Query  410  TS  415
            +S
Sbjct  365  SS  366


 Score =   254 bits (650),  Expect(2) = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 166/242 (69%), Gaps = 9/242 (4%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E++QV  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+    PV+GVA PT
Sbjct  4     PKELEQVMKLRGGSVLGKKTILKSDHFPGCQNKRLTPQIDGAPNYRQADSLPVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  64    TEGIRNVLKHIGAQKDGKRVQVIWFNLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+ME+RLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DS    L++      
Sbjct  123   SRVEQMESRLKEDILMEAARYGNKILVTDELPDGQMVDQWEPVSRDSANEELQL------  176

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+   Y R+P+TD+K+P+  DFD L   I  A   T ++FNCQMG GRTTTG VIA LV
Sbjct  177   EGYLFDYERVPVTDEKSPEEPDFDILVDKIYQADLNTEIIFNCQMGRGRTTTGMVIATLV  236

Query  1221  KL  1226
              L
Sbjct  237   YL  238


 Score = 86.3 bits (212),  Expect(2) = 8e-84, Method: Compositional matrix adjust.
 Identities = 61/219 (28%), Positives = 107/219 (49%), Gaps = 10/219 (5%)
 Frame = +2

Query  1301  SDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSAL  1480
             S G V    P +    P  + +   G  +  ++  +TR+ + GVE +  +D +ID+C+++
Sbjct  251   SIGRVFDTGPTVTDNLPNSEEAIRRG--EYAVIRSLTRVLEGGVEGKRQVDKVIDKCASM  308

Query  1481  QNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQG  1660
             QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI FA Y+ S+  D      
Sbjct  309   QNLREAIANYRNRILRQPDEMK-REASLSFFVEYLERYYFLICFAVYIHSER-DALRSSS  366

Query  1661  ESMTTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEELRTPHELKHGDAVMEAIVK  1825
                ++F  W+  RPE+ + ++  +R  P    G   + P  ++           M  +  
Sbjct  367   FGHSSFADWMRARPELYSILRRLLRRDPMGALGYASSKPSLMKIAESADGRPHEMGVVAA  426

Query  1826  DRNGSVLGKGSILTMYFFPGQRTSSHIQ-IHGAPHVYKV  1939
              RNG VLG  ++L     PG +  +  + + GAP+  +V
Sbjct  427   LRNGEVLGSQTVLKSDHCPGCQIHTLPERVEGAPNFREV  465


 Score =   136 bits (343),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/245 (34%), Positives = 131/245 (53%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     R+G VLG+ ++LK    PG    S   ++ GA +  ++ G+PVY +A PT++G
Sbjct  856   MEATIKARNGSVLGTGSILKMYFFPG-QRTSSHLQIHGAPHVYKVDGYPVYSMATPTIAG  914

Query  696   ILSVIQRIGSSKEG-----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+   G     + V   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  915   AKEMLAYLGAKPNGEGSLAQKVILTDLREEAVVYINGTPFVLRELHKPV-DTLKHVGITG  973

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G  M++H       T    +   WE++ ++ V+TP EV
Sbjct  974   PLVEHMEARLKEDIVSEV-RESGGRMLLHREEYNPATNQSSVIGYWENIFANDVKTPAEV  1032

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ + Y RIP+T ++   +SD D  A+         + +F    G G      
Sbjct  1033  YAALKDEGYDMTYRRIPLTRERDALASDVD--AIQYCKDDCAGSYLFVSHTGFGGIAYAM  1090

Query  1203  VIACL  1217
              I CL
Sbjct  1091  AIICL  1095


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  +C GAGHLR+DI+Y++KEL+K P  DDE  A+LMDMG++ALR
Sbjct  1159  VDIVIDKCVGAGHLRDDILYYSKELRKCPHHDDEQLAHLMDMGVKALR  1206


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D VIDRC+++QN+R+A+  YR  + +Q  E + R  AL+   EYL
Sbjct  722  ITRLFDNGVECREALDAVIDRCSALQNIRQAVLHYRKVVNQQHVEPRVRRVALNRGAEYL  781

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  782  ERYFRLIAFAAYLGSE  797


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 53/101 (52%), Gaps = 5/101 (5%)
 Frame = +2

Query  107   DIMPN---SEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRN  277
             +I+P+    E+  R G+Y  I SL RVL  G + K  VD VID+C    +LR+ I  Y  
Sbjct  1122  EILPSQLSEEETFRMGDYRDILSLTRVLMYGPKSKADVDIVIDKCVGAGHLRDDILYYSK  1181

Query  278   SILRQP--DEMKREAALSFFVEYLERY*FLICFAVYLHTER  394
              + + P  D+ +    +   V+ L RY FLI F  YL+  +
Sbjct  1182  ELRKCPHHDDEQLAHLMDMGVKALRRYFFLITFRSYLYCAK  1222



>gb|KHN43392.1| Paladin [Glycine soja]
Length=1209

 Score =   492 bits (1267),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/294 (80%), Positives = 262/294 (89%), Gaps = 1/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY+SLKPS     EST+GRPSEM  VAALR GEVLGSQTVLKSD
Sbjct  357   YSIIRRLLRRDPMGALGYSSLKPSLKKIAESTDGRPSEMGVVAALRKGEVLGSQTVLKSD  416

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +PSLPER++GA NFRE+PGFPVYGVANPT+ GI SVIQRIGSSK GRP+ WHNM
Sbjct  417   HCPGCQNPSLPERVDGAPNFREVPGFPVYGVANPTIDGIRSVIQRIGSSKGGRPILWHNM  476

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVE+MEARLK+DI+REA++Y GAIMV
Sbjct  477   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVEKMEARLKEDILREAKQYGGAIMV  536

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET D  IFD+WE V+SD +QTPLEVFK LEAEG PIKYAR+PITD KAPKSSDFDTLA
Sbjct  537   IHETDDKHIFDAWEDVTSDVIQTPLEVFKSLEAEGLPIKYARVPITDGKAPKSSDFDTLA  596

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEE  1280
              NIASA+K TA VFNCQMG GRT+TGTVIACLVKLRIDYGRPI++L +D  HEE
Sbjct  597   NNIASAAKDTAFVFNCQMGRGRTSTGTVIACLVKLRIDYGRPIKILGDDVTHEE  650


 Score =   372 bits (954),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE+ G+V   +   L+ +     +  FGINDILLLWKIT LFDNGVECREALD IIDR
Sbjct  657   SGDEAGGYVTTLSSNTLQRKTDDKQNCAFGINDILLLWKITTLFDNGVECREALDVIIDR  716

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  717   CSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  776

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLHQRPEVQAMKWSIRLRPGRFFT+PE+LR P E +HGDAVMEAIVK 
Sbjct  777   CGQGESKMTFKVWLHQRPEVQAMKWSIRLRPGRFFTVPEDLREPQESQHGDAVMEAIVKA  836

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  837   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  873


 Score =   201 bits (511),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR+NSIGR+     N  D +PNSE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  219  GFPRSNSIGRIFQSMTNVADHLPNSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  278

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+ER AL  
Sbjct  279  CASMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHSERAALRS  338

Query  410  TS  415
             +
Sbjct  339  NT  340


 Score =   219 bits (559),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 154/228 (68%), Gaps = 5/228 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIP-GFPVYGVANP  683
             P E +QV  +R G VLG +T+LKSDH PGC +  L  +++GA N+R+      V+GVA P
Sbjct  5     PKEPEQVMKMRGGCVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQASDSLHVHGVAIP  64

Query  684   TVSGILSVIQRIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
             T+ GI +V+  IG+  +   V W ++REE + YING+PFVLR+VERP+ N LEYTGI+ E
Sbjct  65    TIHGIRNVLNHIGARLK---VLWISLREEPLAYINGRPFVLRDVERPFSN-LEYTGINRE  120

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAE  1043
             RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ E
Sbjct  121   RVEQMEARLKEDILVEAARYGNKILVTDELPDGQMVDQWEPVSCDSVKTPLEVYEELQVE  180

Query  1044  GFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGR  1187
             G+ + Y R+PITD+K+PK  DFD L  ++       A  F     IGR
Sbjct  181   GYLVDYERVPITDEKSPKELDFDILFPSLLPCHSAAAAGFPRSNSIGR  228


 Score =   137 bits (346),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 87/255 (34%), Positives = 134/255 (53%), Gaps = 18/255 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  830   MEAIVKARNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDEYPVYCMATPTISG  888

Query  696   ILSVIQRIGS----SKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  +G+    S   + V   ++REE V+YIN  PFVLRE+ +P  N L+Y GI   
Sbjct  889   AKEMLDYLGAKPKPSLTAQKVILTDLREEAVVYINYTPFVLRELNKPV-NTLKYVGITGP  947

Query  864   RVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEVF  1025
              VE MEARLK+DI+ E  R  G  M++H       T    +   WE++ +D V+TP EV+
Sbjct  948   VVEHMEARLKEDILAEI-RQSGGRMLLHREEYNPSTNQSGVVGYWENIQADDVKTPAEVY  1006

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+ +G+ I Y RIP+T ++   +SD D  A+         + +F    G G       
Sbjct  1007  SALKDDGYDIVYQRIPLTRERNALASDID--AIQYCQDDSAGSYLFVSHTGFGGVAYAMA  1064

Query  1206  IACLVKLRIDYGRPI  1250
             I C   +R+D G  +
Sbjct  1065  IIC---IRLDAGSKV  1076


 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  254   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-REASLSFF  312

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRPG--  1744
              EYLERY+ LI FA Y+ S+             +F  W+  RPE+ + ++  +R  P   
Sbjct  313   VEYLERYYFLICFAVYIHSERA-ALRSNTADHCSFADWMRARPELYSIIRRLLRRDPMGA  371

Query  1745  -RFFTIPEELRTPHELKHG-DAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
               + ++   L+   E   G  + M  +   R G VLG  ++L     PG Q  S   ++ 
Sbjct  372   LGYSSLKPSLKKIAESTDGRPSEMGVVAALRKGEVLGSQTVLKSDHCPGCQNPSLPERVD  431

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  432   GAPNFREV  439


 Score = 77.0 bits (188),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +3

Query  1854  GLFLRCTSFLVRELQVTFKFMVRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYL  2033
             G  L  T  L+   Q   K  V ++  RC+GAGH+REDI+Y+  E +KF DDDDE RAYL
Sbjct  1109  GDILNLTRVLIHGPQS--KADVDIVIERCSGAGHIREDILYYNGEFEKFTDDDDEERAYL  1166

Query  2034  MDMGIRALR  2060
             MDMGI+ALR
Sbjct  1167  MDMGIKALR  1175


 Score = 61.2 bits (147),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            +  + + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  696  ITTLFDNGVECREALDVIIDRCSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYL  755

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  756  ERYFRLIAFAAYLGSE  771



>ref|XP_006375411.1| hypothetical protein POPTR_0014s10550g [Populus trichocarpa]
 gb|ERP53208.1| hypothetical protein POPTR_0014s10550g [Populus trichocarpa]
Length=1259

 Score =   506 bits (1304),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 242/295 (82%), Positives = 267/295 (91%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYASLKPS     ES +GRP EMD VAALR+GEVLGSQTVLKSD
Sbjct  392   YSIIRRLLRRDPMGALGYASLKPSLMKIAESADGRPHEMDVVAALRNGEVLGSQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +P LPER++GA NFRE+PGFPVYGVANPT+ GILSVI+RIGSSK GRPVFWHNM
Sbjct  452   HCPGCQNPGLPERVDGAPNFREVPGFPVYGVANPTIDGILSVIRRIGSSKGGRPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEY+GI  ERVERMEARLK+DI+REAERY GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPYKNMLEYSGIGRERVERMEARLKEDILREAERYGGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+SDS++TPLEVFK L  +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  572   IHETNDGQIFDAWEHVNSDSIKTPLEVFKGLVTDGFPIKYARVPITDGKAPKSSDFDTLA  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL +D  HEE+
Sbjct  632   INIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLADDMTHEEM  686


 Score =   355 bits (912),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G        I   +   +    FGI+DILLLWKITRLFDNG+ECREALDAIIDR
Sbjct  692   SGEETGGDPAASTSDIASVKTDMEQGRAFGIDDILLLWKITRLFDNGMECREALDAIIDR  751

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++ NQQ  EPR RRVAL+RGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  752   CSALQNIRQAVLQYRKMVNQQHVEPRVRRVALSRGAEYLERYFRLIAFAAYLGSEAFDGF  811

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES   FK WLHQR EVQAMKWSIRL+PGRFFT+PEELRTP E +HGDAVMEA V+ 
Sbjct  812   CGQGESRMAFKSWLHQRSEVQAMKWSIRLKPGRFFTVPEELRTPQESQHGDAVMEATVRV  871

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQI GAPHVYKV
Sbjct  872   RNGSVLGKGSILKMYFFPGQRTSSHIQIQGAPHVYKV  908


 Score =   202 bits (513),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GI RTNS+GR+   G N  + +PNSEDA+RRGEY V+RSLIRVLEGGVEGKKQVDKVID+
Sbjct  254  GIQRTNSVGRIFDFGLNVNENLPNSEDALRRGEYAVVRSLIRVLEGGVEGKKQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIA YRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+ER AL  
Sbjct  314  CASMQNLREAIANYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHSERVALRS  373

Query  410  TSQV  421
            +S V
Sbjct  374  SSFV  377


 Score =   263 bits (671),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 168/240 (70%), Gaps = 3/240 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E +QV  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+    PV+GVA PT+ 
Sbjct  9     EPEQVMKLRGGSVLGKKTILKSDHFPGCQNKRLTPQIDGAPNYRQADSLPVHGVAIPTIE  68

Query  693   GILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             G  +VI+ I   K+G+   V W N+REE ++YING+PFVLR+VERP+ N LEYTGI+  R
Sbjct  69    GCRNVIKHIRGRKDGKQAQVLWFNLREEPLVYINGRPFVLRDVERPFSN-LEYTGINRSR  127

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ EG
Sbjct  128   VEEMEARLKEDILMEAARYGNKILVTDELPDGQMVDQWEPVSCDSVKTPLEVYEDLQEEG  187

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             +   Y R+P+TD+K+P+  DFDTL   I        ++FNCQMG GRTTTG VIA LV L
Sbjct  188   YLYDYERVPVTDEKSPEEQDFDTLVDRIYQTDLNADIIFNCQMGRGRTTTGMVIATLVFL  247


 Score =   135 bits (340),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 133/244 (55%), Gaps = 14/244 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+    +R+G VLG  ++LK    PG    S   +++GA +  ++ G+PVY +A PT++G
Sbjct  865   MEATVRVRNGSVLGKGSILKMYFFPG-QRTSSHIQIQGAPHVYKVDGYPVYSMATPTITG  923

Query  696   ILSVIQRIGSSK--EG---RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  + +    EG   R V   ++REE V+YING P+VLRE+ +P  ++L++ GI  
Sbjct  924   AKEMLAYLSAKPKIEGSLTRKVILTDLREEAVVYINGTPYVLRELNKPV-DVLKHVGITG  982

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEVF  1025
               VE MEARLK+DI+ E  +  G I++  E     T    +   WE++S D V+TP EV+
Sbjct  983   PVVELMEARLKEDIVSEIRQSGGRILLHREEYNPATNQSCVIGYWENISVDDVKTPAEVY  1042

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+ EG+ I Y RIP+T ++   +SD D  A+         + +F    G G       
Sbjct  1043  AALKDEGYDITYRRIPLTREREALTSDVD--AIQYCKEDCEGSYLFVSHTGFGGVGYAMA  1100

Query  1206  IACL  1217
             I C+
Sbjct  1101  IICI  1104


 Score = 80.9 bits (198),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 94/195 (48%), Gaps = 22/195 (11%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE ++ +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  289   VVRSLIRVLEGGVEGKKQVDKVIDKCASMQNLREAIANYRNSILRQPDEMK-REASLSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSI--------  1729
              EYLERY+ LI FA Y+ S+            ++F  W+  RPE+ ++   +        
Sbjct  348   VEYLERYYFLICFAVYIHSERV-ALRSSSFVHSSFADWMRARPELYSIIRRLLRRDPMGA  406

Query  1730  ----RLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRT  1894
                  L+P            PHE       M+ +   RNG VLG  ++L     PG Q  
Sbjct  407   LGYASLKPSLMKIAESADGRPHE-------MDVVAALRNGEVLGSQTVLKSDHCPGCQNP  459

Query  1895  SSHIQIHGAPHVYKV  1939
                 ++ GAP+  +V
Sbjct  460   GLPERVDGAPNFREV  474


 Score = 77.8 bits (190),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  +CAGAGHLR+DI+Y+ KEL+K P DDDE RAYLMDMGI+ALR
Sbjct  1169  VDIVIEKCAGAGHLRDDILYYNKELRKSPGDDDEQRAYLMDMGIKALR  1216


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR  + +Q  E + R  ALS   EYL
Sbjct  731  ITRLFDNGMECREALDAIIDRCSALQNIRQAVLQYRKMVNQQHVEPRVRRVALSRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  791  ERYFRLIAFAAYLGSE  806


 Score = 63.5 bits (153),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 60/109 (55%), Gaps = 2/109 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP-  295
             + E+A+R G+Y  I SL RVL  G + K  VD VI++CA   +LR+ I  Y   + + P 
Sbjct  1139  SDEEALRMGDYRDILSLTRVLAHGPKSKADVDIVIEKCAGAGHLRDDILYYNKELRKSPG  1198

Query  296   -DEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
              D+ +R   +   ++ L RY FLI F  YL++ + +    +   + RP+
Sbjct  1199  DDDEQRAYLMDMGIKALRRYFFLITFRSYLYSTKASETKFTSWMDSRPE  1247


 Score = 53.9 bits (128),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 59/114 (52%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVAL-NRG  1573
             +  +TR+  +G + +  +D +I++C+   ++R  +L Y +   +   +  E+R  L + G
Sbjct  1152  ILSLTRVLAHGPKSKADVDIVIEKCAGAGHLRDDILYYNKELRKSPGDDDEQRAYLMDMG  1211

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL S           S T F  W+  RPE++ +  ++R+
Sbjct  1212  IKALRRYFFLITFRSYLYSTK--------ASETKFTSWMDSRPELRHLCNNLRM  1257



>ref|XP_011039874.1| PREDICTED: paladin-like isoform X2 [Populus euphratica]
Length=1258

 Score =   514 bits (1324),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/295 (83%), Positives = 270/295 (92%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA+LKPS     EST+GRP EMD VAALR+GEVLGSQTVLKSD
Sbjct  392   YSIIRRLLRRDPMGALGYANLKPSLMKIAESTDGRPHEMDVVAALRNGEVLGSQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +P LPER++GA NFRE+PGFPVYGVANPT+ GILSVI+RIGSSK GRPVFWHNM
Sbjct  452   HCPGCQNPGLPERVDGAPNFREVPGFPVYGVANPTIDGILSVIRRIGSSKGGRPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGI  ERVERMEARLK+DI+REAERY GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPYKNMLEYTGIGRERVERMEARLKEDILREAERYGGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+SDS++TPLEVFKCL+ +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  572   IHETDDGQIFDAWEHVNSDSIKTPLEVFKCLDTDGFPIKYARVPITDGKAPKSSDFDTLA  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL +D  HEE+
Sbjct  632   MNIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLCHDMTHEEM  686


 Score =   347 bits (890),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 180/217 (83%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G        I   +   +    FGI+DILLLWKITRLFDNG+ECREALDAIIDR
Sbjct  692   SGEETGGDPAASTSDIASVKTDMEQGRAFGIDDILLLWKITRLFDNGMECREALDAIIDR  751

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++ NQQ  EPR RRVAL+RGAEYLERYF LIAFAAYLGS+AFDGF
Sbjct  752   CSALQNIRQAVLQYRKVVNQQHVEPRVRRVALSRGAEYLERYFCLIAFAAYLGSEAFDGF  811

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES   FK WLHQR EVQAMKWSIRLRPGRFFT+PEELRT  E +HGDAVMEA V+ 
Sbjct  812   CGQGESRMAFKSWLHQRSEVQAMKWSIRLRPGRFFTVPEELRTLQESQHGDAVMEATVRV  871

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLG GSIL MYFFPGQRTSSHIQI GAPHVYKV
Sbjct  872   RNGSVLGTGSILKMYFFPGQRTSSHIQIQGAPHVYKV  908


 Score =   202 bits (514),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GI RTNS+GR+   G N  + +PNSEDA+RRGEY VIRSLIRVLEGGVEGKKQVDKVID+
Sbjct  254  GIQRTNSVGRIFDFGLNVNENLPNSEDALRRGEYAVIRSLIRVLEGGVEGKKQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIA YRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+ER AL  
Sbjct  314  CASMQNLREAIANYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHSERVALRS  373

Query  410  TSQV  421
            +S V
Sbjct  374  SSFV  377


 Score =   263 bits (673),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/240 (55%), Positives = 168/240 (70%), Gaps = 3/240 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E +QV  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+    PV+GVA PT+ 
Sbjct  9     EPEQVMKLRGGSVLGKKTILKSDHFPGCQNKRLTPQIDGAPNYRQADSLPVHGVAIPTIE  68

Query  693   GILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             G  +VI+ I   K+G+   V W N+REE ++YING+PFVLR+VERP+ N LEYTGI+  R
Sbjct  69    GCRNVIKHIRGRKDGKQAQVLWFNLREEPLVYINGRPFVLRDVERPFSN-LEYTGINRSR  127

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ EG
Sbjct  128   VEEMEARLKEDILMEAARYGNKILVTDELPDGQMVDQWEPVSCDSVKTPLEVYEDLQEEG  187

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             +   Y R+PITD+K+P+  DFDTL   I        ++FNCQMG GRTTTG VIA LV L
Sbjct  188   YLYDYERVPITDEKSPEEQDFDTLVDRIYQTDLNADIIFNCQMGRGRTTTGMVIATLVFL  247


 Score =   136 bits (343),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 135/244 (55%), Gaps = 14/244 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+    +R+G VLG+ ++LK    PG    S   +++GA +  ++ G+PVY +A PT++G
Sbjct  865   MEATVRVRNGSVLGTGSILKMYFFPG-QRTSSHIQIQGAPHVYKVDGYPVYSMATPTITG  923

Query  696   ILSVIQRIGSSK--EG---RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  + +    EG   R V   ++REE V+YING P+VLRE+ +P  ++L++ GI  
Sbjct  924   AKEMLAYLSAKPKIEGSLTRKVILTDLREEAVVYINGTPYVLRELNKPV-DVLKHVGITG  982

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEVF  1025
               VE MEARLK+DI+ E  +  G I++  E     T    +   WE++S D+V+TP EV+
Sbjct  983   PVVELMEARLKEDIVSEIRQSGGRILLHREEYNPATNQSCVIGYWENISVDAVKTPAEVY  1042

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+ EG+ I Y RIP+T ++   +SD D  A+         + +F    G G       
Sbjct  1043  AALKDEGYDITYRRIPLTREREALTSDVD--AIQYCKEDCEGSYLFVSHTGFGGVGYAMA  1100

Query  1206  IACL  1217
             I C+
Sbjct  1101  IICI  1104


 Score = 81.3 bits (199),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 94/195 (48%), Gaps = 22/195 (11%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE ++ +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  289   VIRSLIRVLEGGVEGKKQVDKVIDKCASMQNLREAIANYRNSILRQPDEMK-REASLSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSI--------  1729
              EYLERY+ LI FA Y+ S+            ++F  W+  RPE+ ++   +        
Sbjct  348   VEYLERYYFLICFAVYIHSERV-ALRSSSFVHSSFADWMRARPELYSIIRRLLRRDPMGA  406

Query  1730  ----RLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRT  1894
                  L+P            PHE       M+ +   RNG VLG  ++L     PG Q  
Sbjct  407   LGYANLKPSLMKIAESTDGRPHE-------MDVVAALRNGEVLGSQTVLKSDHCPGCQNP  459

Query  1895  SSHIQIHGAPHVYKV  1939
                 ++ GAP+  +V
Sbjct  460   GLPERVDGAPNFREV  474


 Score = 76.6 bits (187),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  +CAGAGHLR+DI+Y+ KEL+K  DDDDE RAYLMDMGI+ALR
Sbjct  1168  VDIVIEKCAGAGHLRDDILYYNKELQKSRDDDDEQRAYLMDMGIKALR  1215


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR  + +Q  E + R  ALS   EYL
Sbjct  731  ITRLFDNGMECREALDAIIDRCSALQNIRQAVLQYRKVVNQQHVEPRVRRVALSRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  791  ERYFCLIAFAAYLGSE  806


 Score = 61.2 bits (147),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 59/109 (54%), Gaps = 2/109 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSIL--RQ  292
             + E+A+R G+Y  I SL RVL  G + K  VD VI++CA   +LR+ I  Y   +   R 
Sbjct  1138  SDEEALRMGDYRDILSLTRVLTHGPKSKADVDIVIEKCAGAGHLRDDILYYNKELQKSRD  1197

Query  293   PDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
              D+ +R   +   ++ L RY FLI F  YL++ + +    +   + RP+
Sbjct  1198  DDDEQRAYLMDMGIKALRRYFFLITFRSYLYSTKASETKFTSWMDSRPE  1246


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 60/114 (53%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVAL-NRG  1573
             +  +TR+  +G + +  +D +I++C+   ++R  +L Y +   + R +  E+R  L + G
Sbjct  1151  ILSLTRVLTHGPKSKADVDIVIEKCAGAGHLRDDILYYNKELQKSRDDDDEQRAYLMDMG  1210

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL S           S T F  W+  RPE++ +  ++R+
Sbjct  1211  IKALRRYFFLITFRSYLYSTK--------ASETKFTSWMDSRPELRHLCNNLRM  1256



>ref|XP_009341534.1| PREDICTED: paladin-like [Pyrus x bretschneideri]
Length=1256

 Score =   489 bits (1259),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/290 (80%), Positives = 259/290 (89%), Gaps = 0/290 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYAS KPS     ES +GRP EM  VAALR GEVLGSQTVLKSD
Sbjct  390   YSIIRRLLRRDPMGALGYASSKPSLKKIAESADGRPCEMGAVAALRKGEVLGSQTVLKSD  449

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + +LPER++GA NFRE+PGF VYGVANPT+ GI SVI RIGSSK+GRPVFWHNM
Sbjct  450   HCPGCQNQNLPERVDGAPNFREVPGFSVYGVANPTIDGIRSVIHRIGSSKDGRPVFWHNM  509

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REA+ Y GAIMV
Sbjct  510   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREADHYGGAIMV  569

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+S+++QTPLEVFK LE +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  570   IHETDDGQIFDAWEHVNSEAIQTPLEVFKGLEEDGFPIKYARVPITDGKAPKSSDFDTLA  629

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDAL  1271
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPI++L D +
Sbjct  630   INIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIKILVDNI  679


 Score =   378 bits (971),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE+ G        +   R +K+ S  FG+NDILLLWKITRLFDNGVECREALDAIIDR
Sbjct  690   SGDETGGSSVAATSSVTNFRNEKEQSRVFGMNDILLLWKITRLFDNGVECREALDAIIDR  749

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVL YR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  750   CSALQNIRQAVLHYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  809

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK+WLHQRPEVQAMKWSIRLRPGRFFT+PEELR PHE +HGDAVMEAIVK 
Sbjct  810   CGQGESRMTFKNWLHQRPEVQAMKWSIRLRPGRFFTVPEELRAPHESQHGDAVMEAIVKA  869

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  870   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  906


 Score =   194 bits (494),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIG++S       D  P+SEDAIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  252  GIPRTNSIGKISESSEIVGDNFPSSEDAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  311

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAI TYRNSI+RQPDEMKREA+LSFF+EYLERY FLICF VY+H+E  AL  
Sbjct  312  CASMQNLREAIGTYRNSIMRQPDEMKREASLSFFMEYLERYYFLICFTVYIHSEGAALRS  371

Query  410  TS  415
            +S
Sbjct  372  SS  373


 Score =   258 bits (660),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 172/243 (71%), Gaps = 4/243 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  L   ++GA N+R+     V+GVA PT
Sbjct  4     PKEPEQVMKLRGGSVLGKKTILKSDHFPGCQNKRLYPHIDGAPNYRQADLLHVHGVAIPT  63

Query  687   VSGILSVIQRIGSSK-EGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
             + GI +V+  IG+ + +G+   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+
Sbjct  64    IDGIQNVLNHIGAQEIDGKRAQVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGIN  122

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLE  1037
               RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS +SV+TPLEV++ L+
Sbjct  123   RARVEQMEARLKEDILTEAARYGNKILVTDELPDGQMVDQWEPVSRESVKTPLEVYEELQ  182

Query  1038  AEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACL  1217
              +G+ + Y R+PITD+K+PK  DFD L   I+ A     ++FNCQMG GRTTTG VIA L
Sbjct  183   EQGYLVDYERVPITDEKSPKELDFDILVHKISQADINAEIIFNCQMGRGRTTTGMVIATL  242

Query  1218  VKL  1226
             + L
Sbjct  243   IYL  245


 Score =   132 bits (332),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 129/245 (53%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT+ G
Sbjct  863   MEAIVKARNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDGYPVYSMATPTIPG  921

Query  696   ILSVIQRIGSSKEG-----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  +      R V   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  922   AKEMLAYLGAKPKAEGSAARKVVLIDLREEAVVYINGTPFVLRELNKPV-DTLKHVGITG  980

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETA------DGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G  M++H            +    E++ +D V+TP EV
Sbjct  981   PVVEHMEARLKEDILSEV-RQSGGRMLLHREEYSPALNQSSVIGYLENIFADDVKTPAEV  1039

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T ++   +SD D +   I  ++     +F    G G      
Sbjct  1040  YAALKDEGYNIAYRRIPLTREREALASDVDAIQYCIDDSA--GCYLFVSHTGFGGVAYAM  1097

Query  1203  VIACL  1217
              I C+
Sbjct  1098  AIICI  1102


 Score = 79.7 bits (195),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGHLR+DI+Y++KELKKFPD DDE  AYLMDMGI+AL+
Sbjct  1166  VDIVIERCAGAGHLRDDILYYSKELKKFPDADDEQGAYLMDMGIKALK  1213


 Score = 77.4 bits (189),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 93/188 (49%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  287   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIGTYRNSIMRQPDEMK-REASLSFF  345

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI F  Y+ S+            ++F  W+  RPE+ + ++  +R  P   
Sbjct  346   MEYLERYYFLICFTVYIHSEGA-ALRSSSCDYSSFADWMKARPELYSIIRRLLRRDPMGA  404

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G   + P   +           M A+   R G VLG  ++L     PG Q  +   ++ 
Sbjct  405   LGYASSKPSLKKIAESADGRPCEMGAVAALRKGEVLGSQTVLKSDHCPGCQNQNLPERVD  464

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  465   GAPNFREV  472


 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  729  ITRLFDNGVECREALDAIIDRCSALQNIRQAVLHYRKVFNQQHVEPRVRRVALNRGAEYL  788

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  789  ERYFRLIAFAAYLGSE  804


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD  298
             + E+ +R G+Y  I SL RVL  G + K  VD VI+RCA   +LR+ I  Y   + + PD
Sbjct  1136  SDEEVLRMGDYRDILSLTRVLVYGPKSKADVDIVIERCAGAGHLRDDILYYSKELKKFPD  1195

Query  299   EMKREAA--LSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
                 + A  +   ++ L+RY FLI F  YL+    A    +   + RP+
Sbjct  1196  ADDEQGAYLMDMGIKALKRYFFLITFRSYLYCTCAADIKFTSWMDARPE  1244



>gb|KHN14188.1| Paladin [Glycine soja]
Length=1247

 Score =   488 bits (1255),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/294 (80%), Positives = 261/294 (89%), Gaps = 1/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY+SLKPS     EST+GRPSEM  VAALR GEVLGSQTVLKSD
Sbjct  386   YSIIRRLLRRDPMGALGYSSLKPSLKKIAESTDGRPSEMGVVAALRKGEVLGSQTVLKSD  445

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +PSLPER++GA NFRE+PGFPVYGVANPT+ GI SVI+RIGSSK GRP+ WHNM
Sbjct  446   HCPGCQNPSLPERVDGAPNFREVPGFPVYGVANPTIDGIRSVIRRIGSSKGGRPILWHNM  505

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGI  +RVE+MEARLK+DI+REA++Y GAIMV
Sbjct  506   REEPVIYINGKPFVLREVERPYKNMLEYTGIGRDRVEKMEARLKEDILREAKQYGGAIMV  565

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET D  IFD+WE V+SD +QTPLEVFK LEAEGFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  566   IHETDDKHIFDAWEDVTSDVIQTPLEVFKSLEAEGFPIKYARMPITDGKAPKSSDFDTLA  625

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEE  1280
              NIASA+K TA VFNCQMG GRT+TGTVIACLVKLRIDYGRPI++L  D  HEE
Sbjct  626   NNIASAAKDTAFVFNCQMGRGRTSTGTVIACLVKLRIDYGRPIKILGGDVTHEE  679


 Score =   373 bits (957),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE+ G+V   +   L+ +   + +  FGINDILLLWKIT LFDNGVECREALDAIIDR
Sbjct  686   SGDETGGYVNTLSSNTLQRKTDDEQNRAFGINDILLLWKITTLFDNGVECREALDAIIDR  745

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  746   CSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  805

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLHQRPEVQAMKWSIRLRPGRFFT+PE+LR P E +HGDAVME IVK 
Sbjct  806   CGQGESKMTFKVWLHQRPEVQAMKWSIRLRPGRFFTVPEDLREPQESQHGDAVMETIVKA  865

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  866   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  902


 Score =   201 bits (511),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR+NSIGR+     N  D +PNSE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  248  GFPRSNSIGRIFQSMTNVADHLPNSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  307

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+ER AL  
Sbjct  308  CASMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHSERAALRS  367

Query  410  TS  415
             +
Sbjct  368  NT  369


 Score =   258 bits (659),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 171/241 (71%), Gaps = 5/241 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIP-GFPVYGVANP  683
             P E +QV  +R G VLG +T+LKSDH PGC +  L  +++GA N+R+      V+GVA P
Sbjct  5     PKEPEQVMKMRGGCVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQASDSLHVHGVAIP  64

Query  684   TVSGILSVIQRIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
             TV GI +V+  IG+  +   V W ++REE + YING+PFVLR+VERP+ N LEYTGI+ E
Sbjct  65    TVHGIRNVLNHIGARLK---VLWISLREEPLAYINGRPFVLRDVERPFSN-LEYTGINRE  120

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAE  1043
             RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ E
Sbjct  121   RVEQMEARLKEDILAEAARYGNKILVTDELPDGQMVDQWEPVSCDSVKTPLEVYEELQVE  180

Query  1044  GFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVK  1223
             G+ + Y R+PITD+K+PK  DFD L   I+ A   T +VFNCQMG GRTTTG VIA LV 
Sbjct  181   GYLVDYERVPITDEKSPKELDFDILVNKISQADVNTEIVFNCQMGRGRTTTGMVIATLVY  240

Query  1224  L  1226
             L
Sbjct  241   L  241


 Score =   135 bits (341),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/255 (34%), Positives = 133/255 (52%), Gaps = 18/255 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  859   METIVKARNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDEYPVYCMATPTISG  917

Query  696   ILSVIQRIGS----SKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  +G+    S   +     ++REE V+YIN  PFVLRE+ +P  N L+Y GI   
Sbjct  918   AKEMLDYLGAKPKPSLTAQKAILTDLREEAVVYINYTPFVLRELNKPV-NTLKYVGITGP  976

Query  864   RVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEVF  1025
              VE MEARLK+DI+ E  R  G  M++H       T    +   WE++ +D V+TP EV+
Sbjct  977   VVEHMEARLKEDILAEI-RQSGGRMLLHREEYNPSTNQSGVVGYWENIRADDVKTPAEVY  1035

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+ +G+ I Y RIP+T ++   +SD D  A+         + +F    G G       
Sbjct  1036  SALKDDGYDIVYQRIPLTRERHALASDID--AIQYCQDDSAGSYLFVSHTGFGGVAYAMA  1093

Query  1206  IACLVKLRIDYGRPI  1250
             I C   +R+D G  +
Sbjct  1094  IIC---IRLDAGSKV  1105


 Score = 57.8 bits (138),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 67/128 (52%), Gaps = 11/128 (9%)
 Frame = +2

Query  1361  SSHEFGIN--DILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQ-Q  1531
             +S+E  ++  D   +  +TR+  +G + +  +D +I+RC+   +IR+ +L Y R F +  
Sbjct  1126  TSNEMALSMGDYRDILNLTRVLIHGPQSKADVDIVIERCAGAGHIREDILYYNREFEKFT  1185

Query  1532  RTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQ  1711
               +  ER   ++ G + L RYF LI F +YL       +C    + T F  W+  RPE+ 
Sbjct  1186  DDDDEERGYLMDMGIKALRRYFFLITFRSYL-------YC-TSPANTEFAAWMDARPELG  1237

Query  1712  AMKWSIRL  1735
              +  ++R+
Sbjct  1238  HLCNNLRI  1245


 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  283   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-REASLSFF  341

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRPG--  1744
              EYLERY+ LI FA Y+ S+             +F  W+  RPE+ + ++  +R  P   
Sbjct  342   VEYLERYYFLICFAVYIHSERA-ALRSNTADHCSFADWMRARPELYSIIRRLLRRDPMGA  400

Query  1745  -RFFTIPEELRTPHELKHG-DAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
               + ++   L+   E   G  + M  +   R G VLG  ++L     PG Q  S   ++ 
Sbjct  401   LGYSSLKPSLKKIAESTDGRPSEMGVVAALRKGEVLGSQTVLKSDHCPGCQNPSLPERVD  460

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  461   GAPNFREV  468


 Score = 77.8 bits (190),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGH+REDI+Y+ +E +KF DDDDE R YLMDMGI+ALR
Sbjct  1157  VDIVIERCAGAGHIREDILYYNREFEKFTDDDDEERGYLMDMGIKALR  1204


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            +  + + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  725  ITTLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYL  784

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  785  ERYFRLIAFAAYLGSE  800



>ref|XP_010245396.1| PREDICTED: paladin isoform X1 [Nelumbo nucifera]
Length=1293

 Score =   493 bits (1270),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/293 (80%), Positives = 262/293 (89%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRR+PMGALGYASLKPS     ES +GRP EM  VAALR+GEVLGSQTVLKSD
Sbjct  391   YSILRRLLRRNPMGALGYASLKPSLMKIAESADGRPCEMGVVAALRNGEVLGSQTVLKSD  450

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI +VIQRIGSSK GRPVFWHNM
Sbjct  451   HCPGCQNLSLPERVEGAPNFREVPGFPVYGVANPTIDGIQAVIQRIGSSKGGRPVFWHNM  510

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE V+YINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  511   REEPVVYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAERYGGAIMV  570

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+S +VQTP+EV++CLEA G PIKYAR+PITD KAPKSS FDTLA
Sbjct  571   IHETNDGQIFDAWEHVNSQAVQTPVEVYRCLEASGLPIKYARVPITDGKAPKSSGFDTLA  630

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
             +NIASASK TA VFNCQMG GRTTTGTVIACL++LRIDYGRPIR+  +++  E
Sbjct  631   MNIASASKDTAFVFNCQMGRGRTTTGTVIACLLRLRIDYGRPIRMHLESMSSE  683


 Score =   353 bits (907),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG E  G+         K R +K+ +  FGINDI LL KITRLFDNGVECRE LDAIIDR
Sbjct  690   SGGEEAGNGTVSISYSEKARKEKEPNRAFGINDIPLLRKITRLFDNGVECREVLDAIIDR  749

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIR+AVL+YR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  750   CSALQNIREAVLRYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  809

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQG+S TTFK WL+QRPEVQAMKWSIRLRPGRFFT+PEELR P E +HGDAVMEA+VK 
Sbjct  810   CGQGDSKTTFKVWLNQRPEVQAMKWSIRLRPGRFFTVPEELRVPRESQHGDAVMEALVKA  869

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             R+GS+LGKGSIL MYFFPGQRTS+HIQIHGAPHVYKV
Sbjct  870   RSGSILGKGSILKMYFFPGQRTSNHIQIHGAPHVYKV  906


 Score =   214 bits (545),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIG+VS  G++ TD  PNSE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  253  GIPRTNSIGKVSDAGSDITDNFPNSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  312

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYR+SILRQPDEMKREA+LSFFVEYLERY FLICFAVY+HTER ALHP
Sbjct  313  CASMQNLREAIATYRSSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHTERAALHP  372


 Score =   273 bits (699),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 135/242 (56%), Positives = 173/242 (71%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV   R G VLG +T+LKSDH PGC +  L  +++G+ N+R+     V+GVA PT
Sbjct  6     PKEPEQVMKQRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGSPNYRQADSSRVHGVAMPT  65

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V+  IG+ K G+   V WHN+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  66    IDGIRNVLDHIGAQKNGKKTQVLWHNLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  124

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLKDDI+ EA RY   I+V  E  DGQ+ D WE V+ DSV+TPLEV++ L+ 
Sbjct  125   ARVEQMEARLKDDILVEAARYGNKILVTDELPDGQMVDQWELVTHDSVKTPLEVYEELQM  184

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK  DFD L   I+ A   T +VFNCQMG GRTTTG VIA LV
Sbjct  185   EGYLVDYERVPITDEKSPKEQDFDILVHKISQADIDTEIVFNCQMGRGRTTTGMVIATLV  244

Query  1221  KL  1226
              L
Sbjct  245   YL  246


 Score =   133 bits (334),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/246 (36%), Positives = 132/246 (54%), Gaps = 18/246 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG +LG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT++G
Sbjct  863   MEALVKARSGSILGKGSILKMYFFPG-QRTSNHIQIHGAPHVYKVDGYPVYSMATPTITG  921

Query  696   ILSVIQRIG--SSKEGR---PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G  S+  G     V   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  922   AREMLSFLGARSTMGGNIAPKVIVTDLREEAVVYINGTPFVLRELNQPV-DTLKHVGITG  980

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E   + G  M++H      E     +   WE+V  + V+TP EV
Sbjct  981   PLVEHMEARLKEDILAEIS-HSGGQMLLHREEYCPELNQSSVIGYWENVLLEDVKTPAEV  1039

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTL-ALNIASASKYTALVFNCQMGIGRTTTG  1199
             F  L+ EG+ + Y RIP+T ++   +SD D +  L   SA  Y   +F    G G     
Sbjct  1040  FASLKDEGYILDYRRIPLTREREALASDVDAIQCLKDDSAGCY---LFVSHTGFGGVAYA  1096

Query  1200  TVIACL  1217
               I CL
Sbjct  1097  MAITCL  1102


 Score = 76.6 bits (187),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 94/188 (50%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  288   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDEMK-REASLSFF  346

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ ++            ++F  W+  RPE+ + ++  +R  P   
Sbjct  347   VEYLERYYFLICFAVYIHTERA-ALHPSSSCQSSFSDWMRARPELYSILRRLLRRNPMGA  405

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  406   LGYASLKPSLMKIAESADGRPCEMGVVAALRNGEVLGSQTVLKSDHCPGCQNLSLPERVE  465

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  466   GAPNFREV  473


 Score = 67.8 bits (164),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + GVE ++ +D +IDRC+++QN+REA+  YR    +Q  E + R  AL+  
Sbjct  725  LLRKITRLFDNGVECREVLDAIIDRCSALQNIREAVLRYRKVFNQQHVEPRVRRVALNRG  784

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI FA YL +E
Sbjct  785  AEYLERYFRLIAFAAYLGSE  804


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = +3

Query  1908  KFMVRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALRP--VTNVN  2078
             K  V ++  RCAGAG+LR+DI+Y+ +EL+   D DD+ +  L+DMGI+ALR    T VN
Sbjct  1163  KAEVDIVIERCAGAGNLRDDILYYRRELENCHDCDDDKKGNLLDMGIKALRKSLTTQVN  1221



>ref|XP_008343230.1| PREDICTED: paladin-like [Malus domestica]
Length=1256

 Score =   489 bits (1260),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/290 (80%), Positives = 259/290 (89%), Gaps = 0/290 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYASL PS     ES +GRP EM  VAALR GEVLGSQTVLKSD
Sbjct  390   YSIIRRLLRRDPMGALGYASLNPSLKKIAESADGRPCEMGVVAALRKGEVLGSQTVLKSD  449

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + +LPER++GA NFRE+PGF VYGVANPT+ GI SVI RIGSSK+GRPVFWHNM
Sbjct  450   HCPGCQNQNLPERVDGAPNFREVPGFSVYGVANPTIDGIRSVIHRIGSSKDGRPVFWHNM  509

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REA+ Y GAIMV
Sbjct  510   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREADHYGGAIMV  569

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+S+++QTPLEVFK LE +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  570   IHETDDGQIFDAWEHVNSEAIQTPLEVFKGLEEDGFPIKYARVPITDGKAPKSSDFDTLA  629

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDAL  1271
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPI++L D +
Sbjct  630   INIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIKILVDNI  679


 Score =   376 bits (966),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE+ G        +   R +K+ S  FG+NDILLLWKITRLFDNGVECREALDAIIDR
Sbjct  690   SGDETGGSSAASTSSVTNFRNEKEQSRVFGMNDILLLWKITRLFDNGVECREALDAIIDR  749

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  750   CSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  809

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK+WLHQRPEVQAMKWSIRLRPGRFFT+PEELR PHE +HGDAVMEAI+K 
Sbjct  810   CGQGESRMTFKNWLHQRPEVQAMKWSIRLRPGRFFTVPEELRAPHESQHGDAVMEAIIKA  869

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  870   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  906


 Score =   195 bits (496),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIG++S       D +P+SEDAIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  252  GIPRTNSIGKISESSEIVGDNVPSSEDAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  311

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSI+RQPDEMK+EA+LSFF+EYLERY FLICF VY+H+E  AL  
Sbjct  312  CASMQNLREAIATYRNSIMRQPDEMKKEASLSFFMEYLERYYFLICFTVYIHSEGAALRS  371

Query  410  TS  415
            +S
Sbjct  372  SS  373


 Score =   261 bits (667),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 172/243 (71%), Gaps = 4/243 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  L   ++GA N+R+     V+GVA PT
Sbjct  4     PKEPEQVMKLRGGSVLGKKTILKSDHFPGCQNKRLYPHIDGAPNYRQADSLHVHGVAIPT  63

Query  687   VSGILSVIQRIGSSK-EGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
             + GI +V+  IG+ + +G+   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+
Sbjct  64    IDGIQNVLNHIGAQQIDGKRAQVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGIN  122

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLE  1037
               RVE+MEARLK+D++ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+
Sbjct  123   RARVEQMEARLKEDLLTEAARYGNKILVTDELPDGQMVDQWEPVSRDSVKTPLEVYEELQ  182

Query  1038  AEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACL  1217
              +G+ + Y R+PITD+K+PK  DFD L   I+ A     ++FNCQMG GRTTTG VIA L
Sbjct  183   EQGYLVDYERVPITDEKSPKELDFDILVHKISQADINAEIIFNCQMGRGRTTTGMVIATL  242

Query  1218  VKL  1226
             + L
Sbjct  243   IYL  245


 Score =   130 bits (328),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/245 (33%), Positives = 129/245 (53%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT+ G
Sbjct  863   MEAIIKARNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDGYPVYSMATPTILG  921

Query  696   ILSVIQRIGSSKEG-----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  +      + V   ++REE ++YING PFVLRE+ +P  + L++ GI  
Sbjct  922   AKEMLAYLGAKPKAEGSAAQKVVLTDLREEAIVYINGTPFVLRELNKPV-DTLKHVGITG  980

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETA------DGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G  M++H            +    E++ +D V+TP EV
Sbjct  981   SVVEHMEARLKEDILSEV-RQSGGRMLLHREEYSPALNQSSVIGYLENIFADDVKTPAEV  1039

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T ++   +SD D +   I  ++     +F    G G      
Sbjct  1040  YAALKDEGYNIAYRRIPLTREREALASDVDAIQYCIDDSA--GCYLFVSHTGFGGVAYAM  1097

Query  1203  VIACL  1217
              I C+
Sbjct  1098  AIICI  1102


 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGHLR+DI+Y++KELKKFPD DDE RA LMDMGI+AL+
Sbjct  1166  VDIVIERCAGAGHLRDDILYYSKELKKFPDADDEQRACLMDMGIKALK  1213


 Score = 73.9 bits (180),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 93/188 (49%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + +  +L+  
Sbjct  287   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSIMRQPDEMK-KEASLSFF  345

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRPG--  1744
              EYLERY+ LI F  Y+ S+              F  W+  RPE+ + ++  +R  P   
Sbjct  346   MEYLERYYFLICFTVYIHSEGA-ALRSSSCDYIGFADWMKARPELYSIIRRLLRRDPMGA  404

Query  1745  -RFFTIPEELRTPHELKHGDAV-MEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
               + ++   L+   E   G    M  +   R G VLG  ++L     PG Q  +   ++ 
Sbjct  405   LGYASLNPSLKKIAESADGRPCEMGVVAALRKGEVLGSQTVLKSDHCPGCQNQNLPERVD  464

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  465   GAPNFREV  472


 Score = 63.9 bits (154),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  729  ITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYL  788

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  789  ERYFRLIAFAAYLGSE  804


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP-  295
             + E+ +R G+Y  I SL RVL  G + K  VD VI+RCA   +LR+ I  Y   + + P 
Sbjct  1136  SDEEVLRMGDYRDILSLTRVLVYGPKSKADVDIVIERCAGAGHLRDDILYYSKELKKFPD  1195

Query  296   -DEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
              D+ +R   +   ++ L+RY FLI F  YL+    A    +   + RP+
Sbjct  1196  ADDEQRACLMDMGIKALKRYFFLITFRSYLYCTCAADIKFTSWMDARPE  1244



>ref|XP_004495834.1| PREDICTED: paladin-like [Cicer arietinum]
Length=1252

 Score =   492 bits (1266),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 231/293 (79%), Positives = 260/293 (89%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY+SLKPS     EST+GRPSEM  VAALR+GEVLGSQTVLKSD
Sbjct  389   YSIIRRLLRRDPMGALGYSSLKPSLMKIAESTDGRPSEMGVVAALRNGEVLGSQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +P LPER+EGA NFRE+PGFPVYGVANPT+ GI SV++RIGSSK GRPV WHNM
Sbjct  449   HCPGCQNPRLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVLRRIGSSKSGRPVLWHNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNM EYTGI  ERVE+MEARLK+DI+REAE+Y  AIMV
Sbjct  509   REEPVIYINGKPFVLREVERPYKNMREYTGIGRERVEKMEARLKEDILREAEQYDNAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQI+D+WE V+SD +QTPLEVFK LE +GFPIKYAR+PITD KAPKSSDFDT+A
Sbjct  569   IHETDDGQIYDAWEQVTSDVIQTPLEVFKSLEVDGFPIKYARVPITDGKAPKSSDFDTMA  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
              NIASA+K TA VFNCQMG GRTTTGTVIACLVKLRIDYGRPI++L D + +E
Sbjct  629   FNIASATKETAFVFNCQMGRGRTTTGTVIACLVKLRIDYGRPIKILGDNVTQE  681


 Score =   360 bits (924),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 188/217 (87%), Gaps = 3/217 (1%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE  G+V   AP  L+ +  +   H FGINDILLLWKIT  FDNGVECREALD IIDR
Sbjct  689   SGDEVGGYVT--APNNLQIKIDEKQKHVFGINDILLLWKITAFFDNGVECREALDGIIDR  746

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVL+YR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  747   CSALQNIRQAVLEYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  806

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CG G+S  +FK+WLHQRPEVQAMKWSIRLRPGRFFT+PEELR P E +HGDAVMEA VK 
Sbjct  807   CG-GKSKVSFKNWLHQRPEVQAMKWSIRLRPGRFFTVPEELRAPQESQHGDAVMEAFVKA  865

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             R+GSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  866   RSGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  902


 Score =   209 bits (531),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NS+GR+S C  N  D +PNSE+AIRRGEYTVIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  251  GIPRSNSVGRISQCLTNVPDHIPNSEEAIRRGEYTVIRSLIRVLEGGVEGKRQVDKVIDK  310

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+E  AL  
Sbjct  311  CASMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHSEMAALRT  370

Query  410  TS  415
            +S
Sbjct  371  SS  372


 Score =   267 bits (683),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 133/242 (55%), Positives = 171/242 (71%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E ++V  LR G VLG +T+LKSDH PGC +  L   +EGA N+R+     V+GVA PT
Sbjct  4     PKEPEEVMKLRGGSVLGKKTILKSDHFPGCQNKRLRPHIEGAPNYRQAESLHVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRPV--FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+  EG  V   W ++REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  64    NDGIRNVLKHIGAQPEGNKVHVLWISLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             ERVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS +SV TPLEV++ L+ 
Sbjct  123   ERVEQMEARLKEDILMEAARYGNKILVTDELPDGQMVDQWESVSCNSVMTPLEVYQELQV  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA L+
Sbjct  183   EGYLVDYERVPITDEKSPKEMDFDILVHKISQADVNTEIIFNCQMGRGRTTTGMVIATLI  242

Query  1221  KL  1226
              L
Sbjct  243   YL  244


 Score =   129 bits (325),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/245 (33%), Positives = 130/245 (53%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     RSG VLG  ++LK    PG    S   ++ GA +  ++  + VY +A PT+SG
Sbjct  859   MEAFVKARSGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDEYSVYCMATPTISG  917

Query  696   ILSVIQRIGSSKEGRP-----VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                +++ +G++ + +      V   ++REE V+YI G PFVLRE+ +PY + L++ GI  
Sbjct  918   AKEMLKYLGANPKAKASATQKVILTDLREEAVVYIKGTPFVLRELNKPY-DTLKHVGITG  976

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E ++  G +M++H       T    +   WE++  D V+T +EV
Sbjct  977   PVVEHMEARLKEDIIAEIKQ-SGGLMLLHREEYNPSTNQSNVVGYWENILVDDVKTTVEV  1035

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ E + I Y RIP+T ++   +SD D  A+         + +F    G G      
Sbjct  1036  YSALKDEDYDIVYQRIPLTRERDALASDVD--AIQYCKDDSAESYLFVSHTGFGGVAYAM  1093

Query  1203  VIACL  1217
              I C+
Sbjct  1094  AIICI  1098


 Score = 82.8 bits (203),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 95/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  286   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-REASLSFF  344

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ S+          S ++F  W+  RPE+ + ++  +R  P   
Sbjct  345   VEYLERYYFLICFAVYIHSE-MAALRTSSASHSSFADWMRARPELYSIIRRLLRRDPMGA  403

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++         + M  +   RNG VLG  ++L     PG Q      ++ 
Sbjct  404   LGYSSLKPSLMKIAESTDGRPSEMGVVAALRNGEVLGSQTVLKSDHCPGCQNPRLPERVE  463

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  464   GAPNFREV  471


 Score = 74.7 bits (182),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +3

Query  1935  RCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             RCAGAGHLR+DI+Y+ KE +KF D DDE RAYLMDMG++ALR
Sbjct  1168  RCAGAGHLRDDILYYYKEFEKFTDGDDEERAYLMDMGVKALR  1209


 Score = 60.8 bits (146),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +2

Query  179  LEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*  355
             + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYLERY 
Sbjct  730  FDNGVECREALDGIIDRCSALQNIRQAVLEYRKVFNQQHVEPRVRRVALNRGAEYLERYF  789

Query  356  FLICFAVYLHTE  391
             LI FA YL +E
Sbjct  790  RLIAFAAYLGSE  801


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSI--LRQ  292
             ++E A++ G+Y  I SL RVL  G + K  VD VIDRCA   +LR+ I  Y         
Sbjct  1132  SNEAALKMGDYRDILSLTRVLIHGPQSKADVDNVIDRCAGAGHLRDDILYYYKEFEKFTD  1191

Query  293   PDEMKREAALSFFVEYLERY*FLICFAVYLH  385
              D+ +R   +   V+ L RY FLI F  YLH
Sbjct  1192  GDDEERAYLMDMGVKALRRYFFLITFRSYLH  1222



>ref|XP_003520779.1| PREDICTED: paladin-like isoform X1 [Glycine max]
Length=1247

 Score =   488 bits (1255),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/294 (80%), Positives = 261/294 (89%), Gaps = 1/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY+SLKPS     EST+GRPSEM  VAALR GEVLGSQTVLKSD
Sbjct  386   YSIIRRLLRRDPMGALGYSSLKPSLKKIAESTDGRPSEMGVVAALRKGEVLGSQTVLKSD  445

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +PSLPER++GA NFRE+PGFPVYGVANPT+ GI SVI+RIGSSK GRP+ WHNM
Sbjct  446   HCPGCQNPSLPERVDGAPNFREVPGFPVYGVANPTIDGIRSVIRRIGSSKGGRPILWHNM  505

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGI  +RVE+MEARLK+DI+REA++Y GAIMV
Sbjct  506   REEPVIYINGKPFVLREVERPYKNMLEYTGIGRDRVEKMEARLKEDILREAKQYGGAIMV  565

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET D  IFD+WE V+SD +QTPLEVFK LEAEGFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  566   IHETDDKHIFDAWEDVTSDVIQTPLEVFKSLEAEGFPIKYARMPITDGKAPKSSDFDTLA  625

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEE  1280
              NIASA+K TA VFNCQMG GRT+TGTVIACLVKLRIDYGRPI++L  D  HEE
Sbjct  626   NNIASAAKDTAFVFNCQMGRGRTSTGTVIACLVKLRIDYGRPIKILGGDVTHEE  679


 Score =   372 bits (956),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE+ G+V   +   L+ +   + +  FGINDILLLWKIT LFDNGVECREALDAIIDR
Sbjct  686   SGDETGGYVNTLSSNTLQRKTDDEQNRAFGINDILLLWKITTLFDNGVECREALDAIIDR  745

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  746   CSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  805

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLHQRPEVQAMKWSIRLRPGRFFT+PE+LR P E +HGDAVME IVK 
Sbjct  806   CGQGESRMTFKVWLHQRPEVQAMKWSIRLRPGRFFTVPEDLREPQESQHGDAVMETIVKA  865

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  866   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  902


 Score =   201 bits (510),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR+NSIGR+     N  D +PNSE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  248  GFPRSNSIGRIFQSMTNVADHLPNSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  307

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+ER AL  
Sbjct  308  CASMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHSERAALRS  367

Query  410  TS  415
             +
Sbjct  368  NT  369


 Score =   258 bits (660),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 171/241 (71%), Gaps = 5/241 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIP-GFPVYGVANP  683
             P E +QV  +R G VLG +T+LKSDH PGC +  L  +++GA N+R+      V+GVA P
Sbjct  5     PKEPEQVMKMRGGCVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQASDSLHVHGVAIP  64

Query  684   TVSGILSVIQRIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
             TV GI +V+  IG+  +   V W ++REE + YING+PFVLR+VERP+ N LEYTGI+ E
Sbjct  65    TVHGIRNVLNHIGARLK---VLWISLREEPLAYINGRPFVLRDVERPFSN-LEYTGINRE  120

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAE  1043
             RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ E
Sbjct  121   RVEQMEARLKEDILAEAARYGNKILVTDELPDGQMVDQWEPVSCDSVKTPLEVYEELQVE  180

Query  1044  GFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVK  1223
             G+ + Y R+PITD+K+PK  DFD L   I+ A   T +VFNCQMG GRTTTG VIA LV 
Sbjct  181   GYLVDYERVPITDEKSPKELDFDILVNKISQADVNTEIVFNCQMGRGRTTTGMVIATLVY  240

Query  1224  L  1226
             L
Sbjct  241   L  241


 Score =   136 bits (342),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/255 (34%), Positives = 134/255 (53%), Gaps = 18/255 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  859   METIVKARNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDEYPVYCMATPTISG  917

Query  696   ILSVIQRIGS----SKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  +G+    S   +     ++REE V+YIN  PFVLRE+ +P  N L+Y GI   
Sbjct  918   AKEMLDYLGAKPKPSLTAQKAILTDLREEAVVYINYTPFVLRELNKPV-NTLKYVGITGP  976

Query  864   RVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEVF  1025
              VE MEARLK+DI+ E  R  G  M++H       T +  +   WE++ +D V+TP EV+
Sbjct  977   VVEHMEARLKEDILAEI-RQSGGRMLLHREEYNPSTNESGVVGYWENIRADDVKTPAEVY  1035

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+ +G+ I Y RIP+T ++   +SD D  A+         + +F    G G       
Sbjct  1036  SALKDDGYDIVYQRIPLTRERHALASDID--AIQYCQDDSAGSYLFVSHTGFGGVAYAMA  1093

Query  1206  IACLVKLRIDYGRPI  1250
             I C   +R+D G  +
Sbjct  1094  IIC---IRLDAGSKV  1105


 Score = 57.0 bits (136),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 67/128 (52%), Gaps = 11/128 (9%)
 Frame = +2

Query  1361  SSHEFGIN--DILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQ-Q  1531
             +S+E  ++  D   +  +TR+  +G + +  +D +I+RC+   +IR+ +L Y R F +  
Sbjct  1126  TSNEMALSMGDYRDILNLTRVLIHGPQSKADVDIVIERCAGAGHIREDILYYNREFEKFI  1185

Query  1532  RTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQ  1711
               +  ER   ++ G + L RYF LI F +YL       +C    + T F  W+  RPE+ 
Sbjct  1186  DDDDEERGYLMDMGIKALRRYFFLITFRSYL-------YC-TSPANTEFAAWMDARPELG  1237

Query  1712  AMKWSIRL  1735
              +  ++R+
Sbjct  1238  HLCNNLRI  1245


 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  283   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-REASLSFF  341

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRPG--  1744
              EYLERY+ LI FA Y+ S+             +F  W+  RPE+ + ++  +R  P   
Sbjct  342   VEYLERYYFLICFAVYIHSERA-ALRSNTADHCSFADWMRARPELYSIIRRLLRRDPMGA  400

Query  1745  -RFFTIPEELRTPHELKHG-DAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
               + ++   L+   E   G  + M  +   R G VLG  ++L     PG Q  S   ++ 
Sbjct  401   LGYSSLKPSLKKIAESTDGRPSEMGVVAALRKGEVLGSQTVLKSDHCPGCQNPSLPERVD  460

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  461   GAPNFREV  468


 Score = 77.0 bits (188),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGH+REDI+Y+ +E +KF DDDDE R YLMDMGI+ALR
Sbjct  1157  VDIVIERCAGAGHIREDILYYNREFEKFIDDDDEERGYLMDMGIKALR  1204


 Score = 62.0 bits (149),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            +  + + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  725  ITTLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYL  784

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  785  ERYFRLIAFAAYLGSE  800



>ref|XP_010245398.1| PREDICTED: paladin isoform X3 [Nelumbo nucifera]
Length=1256

 Score =   493 bits (1269),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/293 (80%), Positives = 262/293 (89%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRR+PMGALGYASLKPS     ES +GRP EM  VAALR+GEVLGSQTVLKSD
Sbjct  391   YSILRRLLRRNPMGALGYASLKPSLMKIAESADGRPCEMGVVAALRNGEVLGSQTVLKSD  450

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI +VIQRIGSSK GRPVFWHNM
Sbjct  451   HCPGCQNLSLPERVEGAPNFREVPGFPVYGVANPTIDGIQAVIQRIGSSKGGRPVFWHNM  510

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE V+YINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  511   REEPVVYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAERYGGAIMV  570

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+S +VQTP+EV++CLEA G PIKYAR+PITD KAPKSS FDTLA
Sbjct  571   IHETNDGQIFDAWEHVNSQAVQTPVEVYRCLEASGLPIKYARVPITDGKAPKSSGFDTLA  630

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
             +NIASASK TA VFNCQMG GRTTTGTVIACL++LRIDYGRPIR+  +++  E
Sbjct  631   MNIASASKDTAFVFNCQMGRGRTTTGTVIACLLRLRIDYGRPIRMHLESMSSE  683


 Score =   353 bits (907),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG E  G+         K R +K+ +  FGINDI LL KITRLFDNGVECRE LDAIIDR
Sbjct  690   SGGEEAGNGTVSISYSEKARKEKEPNRAFGINDIPLLRKITRLFDNGVECREVLDAIIDR  749

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIR+AVL+YR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  750   CSALQNIREAVLRYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  809

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQG+S TTFK WL+QRPEVQAMKWSIRLRPGRFFT+PEELR P E +HGDAVMEA+VK 
Sbjct  810   CGQGDSKTTFKVWLNQRPEVQAMKWSIRLRPGRFFTVPEELRVPRESQHGDAVMEALVKA  869

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             R+GS+LGKGSIL MYFFPGQRTS+HIQIHGAPHVYKV
Sbjct  870   RSGSILGKGSILKMYFFPGQRTSNHIQIHGAPHVYKV  906


 Score =   214 bits (544),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIG+VS  G++ TD  PNSE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  253  GIPRTNSIGKVSDAGSDITDNFPNSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  312

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYR+SILRQPDEMKREA+LSFFVEYLERY FLICFAVY+HTER ALHP
Sbjct  313  CASMQNLREAIATYRSSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHTERAALHP  372


 Score =   273 bits (699),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 135/242 (56%), Positives = 173/242 (71%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV   R G VLG +T+LKSDH PGC +  L  +++G+ N+R+     V+GVA PT
Sbjct  6     PKEPEQVMKQRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGSPNYRQADSSRVHGVAMPT  65

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V+  IG+ K G+   V WHN+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  66    IDGIRNVLDHIGAQKNGKKTQVLWHNLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  124

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLKDDI+ EA RY   I+V  E  DGQ+ D WE V+ DSV+TPLEV++ L+ 
Sbjct  125   ARVEQMEARLKDDILVEAARYGNKILVTDELPDGQMVDQWELVTHDSVKTPLEVYEELQM  184

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK  DFD L   I+ A   T +VFNCQMG GRTTTG VIA LV
Sbjct  185   EGYLVDYERVPITDEKSPKEQDFDILVHKISQADIDTEIVFNCQMGRGRTTTGMVIATLV  244

Query  1221  KL  1226
              L
Sbjct  245   YL  246


 Score =   133 bits (335),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/246 (36%), Positives = 132/246 (54%), Gaps = 18/246 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG +LG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT++G
Sbjct  863   MEALVKARSGSILGKGSILKMYFFPG-QRTSNHIQIHGAPHVYKVDGYPVYSMATPTITG  921

Query  696   ILSVIQRIG--SSKEGR---PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G  S+  G     V   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  922   AREMLSFLGARSTMGGNIAPKVIVTDLREEAVVYINGTPFVLRELNQPV-DTLKHVGITG  980

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E   + G  M++H      E     +   WE+V  + V+TP EV
Sbjct  981   PLVEHMEARLKEDILAEIS-HSGGQMLLHREEYCPELNQSSVIGYWENVLLEDVKTPAEV  1039

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTL-ALNIASASKYTALVFNCQMGIGRTTTG  1199
             F  L+ EG+ + Y RIP+T ++   +SD D +  L   SA  Y   +F    G G     
Sbjct  1040  FASLKDEGYILDYRRIPLTREREALASDVDAIQCLKDDSAGCY---LFVSHTGFGGVAYA  1096

Query  1200  TVIACL  1217
               I CL
Sbjct  1097  MAITCL  1102


 Score = 76.6 bits (187),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 94/188 (50%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  288   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDEMK-REASLSFF  346

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ ++            ++F  W+  RPE+ + ++  +R  P   
Sbjct  347   VEYLERYYFLICFAVYIHTERA-ALHPSSSCQSSFSDWMRARPELYSILRRLLRRNPMGA  405

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  406   LGYASLKPSLMKIAESADGRPCEMGVVAALRNGEVLGSQTVLKSDHCPGCQNLSLPERVE  465

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  466   GAPNFREV  473


 Score = 67.8 bits (164),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + GVE ++ +D +IDRC+++QN+REA+  YR    +Q  E + R  AL+  
Sbjct  725  LLRKITRLFDNGVECREVLDAIIDRCSALQNIREAVLRYRKVFNQQHVEPRVRRVALNRG  784

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI FA YL +E
Sbjct  785  AEYLERYFRLIAFAAYLGSE  804


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  1908  KFMVRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             K  V ++  RCAGAG+LR+DI+Y+ +EL+   D DD+ +  L+DMGI+ALR
Sbjct  1163  KAEVDIVIERCAGAGNLRDDILYYRRELENCHDCDDDKKGNLLDMGIKALR  1213


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 64/131 (49%), Gaps = 4/131 (3%)
 Frame = +2

Query  59    RTNSIGRVSSCGANATDIMPNS--EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRC  232
             R+ S+       +   D +P+   ++A   G+Y  I +L RVL  G + K +VD VI+RC
Sbjct  1114  RSESLIATQCLSSIPKDNLPSQAFDEACELGDYRDILNLTRVLMYGPKSKAEVDIVIERC  1173

Query  233   ASMQNLREAIATYRNSI--LRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALH  406
             A   NLR+ I  YR  +      D+ K+   L   ++ L RY FLI F  YL+    +  
Sbjct  1174  AGAGNLRDDILYYRRELENCHDCDDDKKGNLLDMGIKALRRYFFLITFRSYLYCTSASRI  1233

Query  407   PTSQVAEKRPD  439
               +   E RP+
Sbjct  1234  GFTAWMEARPE  1244


 Score = 57.4 bits (137),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 63/127 (50%), Gaps = 11/127 (9%)
 Frame = +2

Query  1358  DSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRR-LFNQQR  1534
             D + E G  D   +  +TR+   G + +  +D +I+RC+   N+R  +L YRR L N   
Sbjct  1138  DEACELG--DYRDILNLTRVLMYGPKSKAEVDIVIERCAGAGNLRDDILYYRRELENCHD  1195

Query  1535  TEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA  1714
              +  ++   L+ G + L RYF LI F +YL       +C    S   F  W+  RPE+  
Sbjct  1196  CDDDKKGNLLDMGIKALRRYFFLITFRSYL-------YCTSA-SRIGFTAWMEARPELGH  1247

Query  1715  MKWSIRL  1735
             +  ++R+
Sbjct  1248  LCHNLRI  1254



>ref|XP_011039866.1| PREDICTED: paladin-like isoform X1 [Populus euphratica]
Length=1259

 Score =   514 bits (1325),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/295 (83%), Positives = 270/295 (92%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA+LKPS     EST+GRP EMD VAALR+GEVLGSQTVLKSD
Sbjct  392   YSIIRRLLRRDPMGALGYANLKPSLMKIAESTDGRPHEMDVVAALRNGEVLGSQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +P LPER++GA NFRE+PGFPVYGVANPT+ GILSVI+RIGSSK GRPVFWHNM
Sbjct  452   HCPGCQNPGLPERVDGAPNFREVPGFPVYGVANPTIDGILSVIRRIGSSKGGRPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGI  ERVERMEARLK+DI+REAERY GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPYKNMLEYTGIGRERVERMEARLKEDILREAERYGGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+SDS++TPLEVFKCL+ +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  572   IHETDDGQIFDAWEHVNSDSIKTPLEVFKCLDTDGFPIKYARVPITDGKAPKSSDFDTLA  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL +D  HEE+
Sbjct  632   MNIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLCHDMTHEEM  686


 Score =   342 bits (878),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/218 (77%), Positives = 180/218 (83%), Gaps = 1/218 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G        I   +   +    FGI+DILLLWKITRLFDNG+ECREALDAIIDR
Sbjct  692   SGEETGGDPAASTSDIASVKTDMEQGRAFGIDDILLLWKITRLFDNGMECREALDAIIDR  751

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++ NQQ  EPR RRVAL+RGAEYLERYF LIAFAAYLGS+AFDGF
Sbjct  752   CSALQNIRQAVLQYRKVVNQQHVEPRVRRVALSRGAEYLERYFCLIAFAAYLGSEAFDGF  811

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIP-EELRTPHELKHGDAVMEAIVK  1825
             CGQGES   FK WLHQR EVQAMKWSIRLRPGRFFT+P EELRT  E +HGDAVMEA V+
Sbjct  812   CGQGESRMAFKSWLHQRSEVQAMKWSIRLRPGRFFTVPQEELRTLQESQHGDAVMEATVR  871

Query  1826  DRNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
              RNGSVLG GSIL MYFFPGQRTSSHIQI GAPHVYKV
Sbjct  872   VRNGSVLGTGSILKMYFFPGQRTSSHIQIQGAPHVYKV  909


 Score =   202 bits (514),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GI RTNS+GR+   G N  + +PNSEDA+RRGEY VIRSLIRVLEGGVEGKKQVDKVID+
Sbjct  254  GIQRTNSVGRIFDFGLNVNENLPNSEDALRRGEYAVIRSLIRVLEGGVEGKKQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIA YRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+ER AL  
Sbjct  314  CASMQNLREAIANYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHSERVALRS  373

Query  410  TSQV  421
            +S V
Sbjct  374  SSFV  377


 Score =   263 bits (673),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/240 (55%), Positives = 168/240 (70%), Gaps = 3/240 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E +QV  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+    PV+GVA PT+ 
Sbjct  9     EPEQVMKLRGGSVLGKKTILKSDHFPGCQNKRLTPQIDGAPNYRQADSLPVHGVAIPTIE  68

Query  693   GILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             G  +VI+ I   K+G+   V W N+REE ++YING+PFVLR+VERP+ N LEYTGI+  R
Sbjct  69    GCRNVIKHIRGRKDGKQAQVLWFNLREEPLVYINGRPFVLRDVERPFSN-LEYTGINRSR  127

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ EG
Sbjct  128   VEEMEARLKEDILMEAARYGNKILVTDELPDGQMVDQWEPVSCDSVKTPLEVYEDLQEEG  187

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             +   Y R+PITD+K+P+  DFDTL   I        ++FNCQMG GRTTTG VIA LV L
Sbjct  188   YLYDYERVPITDEKSPEEQDFDTLVDRIYQTDLNADIIFNCQMGRGRTTTGMVIATLVFL  247


 Score =   136 bits (343),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 135/244 (55%), Gaps = 14/244 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+    +R+G VLG+ ++LK    PG    S   +++GA +  ++ G+PVY +A PT++G
Sbjct  866   MEATVRVRNGSVLGTGSILKMYFFPG-QRTSSHIQIQGAPHVYKVDGYPVYSMATPTITG  924

Query  696   ILSVIQRIGSSK--EG---RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  + +    EG   R V   ++REE V+YING P+VLRE+ +P  ++L++ GI  
Sbjct  925   AKEMLAYLSAKPKIEGSLTRKVILTDLREEAVVYINGTPYVLRELNKPV-DVLKHVGITG  983

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEVF  1025
               VE MEARLK+DI+ E  +  G I++  E     T    +   WE++S D+V+TP EV+
Sbjct  984   PVVELMEARLKEDIVSEIRQSGGRILLHREEYNPATNQSCVIGYWENISVDAVKTPAEVY  1043

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+ EG+ I Y RIP+T ++   +SD D  A+         + +F    G G       
Sbjct  1044  AALKDEGYDITYRRIPLTREREALTSDVD--AIQYCKEDCEGSYLFVSHTGFGGVGYAMA  1101

Query  1206  IACL  1217
             I C+
Sbjct  1102  IICI  1105


 Score = 81.3 bits (199),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 94/195 (48%), Gaps = 22/195 (11%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE ++ +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  289   VIRSLIRVLEGGVEGKKQVDKVIDKCASMQNLREAIANYRNSILRQPDEMK-REASLSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSI--------  1729
              EYLERY+ LI FA Y+ S+            ++F  W+  RPE+ ++   +        
Sbjct  348   VEYLERYYFLICFAVYIHSERV-ALRSSSFVHSSFADWMRARPELYSIIRRLLRRDPMGA  406

Query  1730  ----RLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRT  1894
                  L+P            PHE       M+ +   RNG VLG  ++L     PG Q  
Sbjct  407   LGYANLKPSLMKIAESTDGRPHE-------MDVVAALRNGEVLGSQTVLKSDHCPGCQNP  459

Query  1895  SSHIQIHGAPHVYKV  1939
                 ++ GAP+  +V
Sbjct  460   GLPERVDGAPNFREV  474


 Score = 77.0 bits (188),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  +CAGAGHLR+DI+Y+ KEL+K  DDDDE RAYLMDMGI+ALR
Sbjct  1169  VDIVIEKCAGAGHLRDDILYYNKELQKSRDDDDEQRAYLMDMGIKALR  1216


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR  + +Q  E + R  ALS   EYL
Sbjct  731  ITRLFDNGMECREALDAIIDRCSALQNIRQAVLQYRKVVNQQHVEPRVRRVALSRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  791  ERYFCLIAFAAYLGSE  806


 Score = 61.2 bits (147),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 59/109 (54%), Gaps = 2/109 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSIL--RQ  292
             + E+A+R G+Y  I SL RVL  G + K  VD VI++CA   +LR+ I  Y   +   R 
Sbjct  1139  SDEEALRMGDYRDILSLTRVLTHGPKSKADVDIVIEKCAGAGHLRDDILYYNKELQKSRD  1198

Query  293   PDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
              D+ +R   +   ++ L RY FLI F  YL++ + +    +   + RP+
Sbjct  1199  DDDEQRAYLMDMGIKALRRYFFLITFRSYLYSTKASETKFTSWMDSRPE  1247


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 60/114 (53%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVAL-NRG  1573
             +  +TR+  +G + +  +D +I++C+   ++R  +L Y +   + R +  E+R  L + G
Sbjct  1152  ILSLTRVLTHGPKSKADVDIVIEKCAGAGHLRDDILYYNKELQKSRDDDDEQRAYLMDMG  1211

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL S           S T F  W+  RPE++ +  ++R+
Sbjct  1212  IKALRRYFFLITFRSYLYSTK--------ASETKFTSWMDSRPELRHLCNNLRM  1257



>ref|XP_004288658.1| PREDICTED: paladin-like [Fragaria vesca subsp. vesca]
Length=1252

 Score =   488 bits (1256),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 230/293 (78%), Positives = 258/293 (88%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA+LKPS     ES + RPSEM  VAALR GEVLGSQTVLKSD
Sbjct  386   YSIIRRLLRRDPMGALGYATLKPSLMKIDESADNRPSEMGVVAALRKGEVLGSQTVLKSD  445

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + +LPER++GA NFRE+PGFPVYGVANPT+ GI SVIQRIG SK GRP+FWHNM
Sbjct  446   HCPGCQNTNLPERVDGAPNFREVPGFPVYGVANPTIDGIRSVIQRIGGSKGGRPIFWHNM  505

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAE Y GAIMV
Sbjct  506   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAEHYKGAIMV  565

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV S ++QTPLEVFK LE +GFPIKYAR+PITD KAPKSSDFD LA
Sbjct  566   IHETEDGQIFDAWEHVDSGAIQTPLEVFKSLERDGFPIKYARVPITDGKAPKSSDFDKLA  625

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
             +N+AS++K TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPI++L D +  E
Sbjct  626   MNMASSTKATAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIKILVDNIPSE  678


 Score =   372 bits (955),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G        +   R  K+  H FGINDILLLWKITRLFDNGVECREALDAIIDR
Sbjct  686   SGEETGGTSTTSPSSVTNVRTDKEKGHVFGINDILLLWKITRLFDNGVECREALDAIIDR  745

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYRR+FNQQ  E R RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  746   CSALQNIRQAVLQYRRVFNQQHVEQRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  805

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK+WLHQRPEVQAMKWSI+LRPGRF T+PEELR PHE +HGDAVMEAI+K+
Sbjct  806   CGQGESRMTFKNWLHQRPEVQAMKWSIKLRPGRFLTVPEELRAPHEAQHGDAVMEAIIKN  865

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             R GSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  866   RTGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  902


 Score =   198 bits (503),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIG+VS       D +PNSEDAIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  252  GIPRTNSIGKVSDSSVIVADNLPNSEDAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  311

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLH  385
            C+SMQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H
Sbjct  312  CSSMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIH  363


 Score =   256 bits (653),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 170/243 (70%), Gaps = 4/243 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV   R G VLG +T+LKSDH PGC +  L   ++GA N+R+     V+GVA PT
Sbjct  4     PKEPEQVMKQRGGSVLGKKTILKSDHFPGCQNKRLSPHIDGAPNYRQADKLRVHGVAIPT  63

Query  687   VSGILSVIQRIGSSK-EGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
             + GI +V++ IG+ + +G+   V W N+REE ++YING+PFVLR+ ERP+ N LEYTGI+
Sbjct  64    IDGIQNVLKHIGAQQTDGKQAQVLWINLREEPLVYINGRPFVLRDAERPFSN-LEYTGIN  122

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLE  1037
               RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+
Sbjct  123   RARVEQMEARLKEDILVEAARYGNKILVTDELPDGQMVDQWEPVSRDSVKTPLEVYEELQ  182

Query  1038  AEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACL  1217
               G+ + Y R+P+TD+K+PK  DFD L   I+ A     ++FNCQMG GRTTTG VIA L
Sbjct  183   VIGYLVDYERVPVTDEKSPKELDFDILVHKISQADINAEIIFNCQMGRGRTTTGMVIATL  242

Query  1218  VKL  1226
             + L
Sbjct  243   IYL  245


 Score = 79.3 bits (194),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 106/219 (48%), Gaps = 14/219 (6%)
 Frame = +2

Query  1301  SDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSAL  1480
             S G V   + ++    P  + +   G  +  ++  + R+ + GVE +  +D +ID+CS++
Sbjct  258   SIGKVSDSSVIVADNLPNSEDAIRRG--EYAVIRSLIRVLEGGVEGKRQVDKVIDKCSSM  315

Query  1481  QNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQG  1660
             QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI FA Y+ S          
Sbjct  316   QNLREAIATYRNSILRQPDEMK-REASLSFFVEYLERYYFLICFAVYIHSLRS-----SS  369

Query  1661  ESMTTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEELRTPHELKHGDAVMEAIVK  1825
                ++F  W+  RPE+ + ++  +R  P    G     P  ++      +  + M  +  
Sbjct  370   SDHSSFADWMKARPELYSIIRRLLRRDPMGALGYATLKPSLMKIDESADNRPSEMGVVAA  429

Query  1826  DRNGSVLGKGSILTMYFFPG-QRTSSHIQIHGAPHVYKV  1939
              R G VLG  ++L     PG Q T+   ++ GAP+  +V
Sbjct  430   LRKGEVLGSQTVLKSDHCPGCQNTNLPERVDGAPNFREV  468


 Score =   133 bits (335),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/246 (34%), Positives = 132/246 (54%), Gaps = 18/246 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT+ G
Sbjct  859   MEAIIKNRTGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDGYPVYSMATPTIPG  917

Query  696   ILSVIQRIGSSKEGR-----PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  E +      V   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  918   AKEMLAYLGAKPEAQGSAPAKVVLTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGITG  976

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETA------DGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G+ M++H            +    E++ +D V+TP EV
Sbjct  977   PVVEHMEARLKEDILSEVRR-SGSRMLLHREEFNPSLNQSSVIGYLENIFADDVKTPAEV  1035

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIA-SASKYTALVFNCQMGIGRTTTG  1199
             +  L+ EG+ I Y RIP+T ++   +SD D +   +  SA  Y   +F    G G  +  
Sbjct  1036  YASLKDEGYNISYRRIPLTREREALASDVDAIQYCVNDSAGSY---LFVSHTGFGGVSYA  1092

Query  1200  TVIACL  1217
               I C+
Sbjct  1093  MAITCV  1098


 Score = 74.7 bits (182),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  1926  MFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             +  RCAGAGHLR+DI+Y++KEL+KF D DDE RA LMDMGI+ALR
Sbjct  1165  VIERCAGAGHLRDDILYYSKELEKFSDGDDEQRANLMDMGIKALR  1209


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  725  ITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRVFNQQHVEQRVRRVALNRGAEYL  784

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  785  ERYFRLIAFAAYLGSE  800


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSI--LRQPD  298
             E+ +R G+Y  I SL RVL  G + K  VD VI+RCA   +LR+ I  Y   +      D
Sbjct  1134  EEVLRMGDYRDILSLTRVLVYGPKSKADVDSVIERCAGAGHLRDDILYYSKELEKFSDGD  1193

Query  299   EMKREAALSFFVEYLERY*FLICFAVYLHTERDA  400
             + +R   +   ++ L RY FLI F  YL+  + A
Sbjct  1194  DEQRANLMDMGIKALRRYFFLITFRSYLYCTKPA  1227



>gb|KDP28373.1| hypothetical protein JCGZ_14144 [Jatropha curcas]
Length=1255

 Score =   501 bits (1291),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 241/295 (82%), Positives = 263/295 (89%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA  KPS     ES + RP EM  VAALR+GEVLGSQTVLKSD
Sbjct  389   YSIIRRLLRRDPMGALGYAKKKPSLMKIAESADDRPHEMGVVAALRNGEVLGSQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + +LPER+EGA NFRE+PGFPVYGVANPT+ GILSVIQRIGSSK GRP+FWHNM
Sbjct  449   HCPGCQNSNLPERVEGAPNFREVPGFPVYGVANPTIDGILSVIQRIGSSKGGRPIFWHNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  509   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAERYGGAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET D QIFD+WEHV SDSV+TPLEVFKCLEA+GFPIKYAR+PITD KAPKSSDFDTL 
Sbjct  569   IHETNDKQIFDAWEHVDSDSVKTPLEVFKCLEADGFPIKYARVPITDGKAPKSSDFDTLV  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL +D   EE+
Sbjct  629   INIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLVDDTTREEV  683


 Score =   350 bits (898),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 180/217 (83%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE+  +         + R   +    FGI+DILLLWKITRLF NGVECREALDA+IDR
Sbjct  689   SGDETGSNAASSPASNARVRTGAEPGRAFGIDDILLLWKITRLFVNGVECREALDAVIDR  748

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIR+AVL YR++ NQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  749   CSALQNIREAVLHYRKVVNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  808

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQG    TFK WLHQRPEVQAMKWSIRLRPGRFFTIPEELR P E +HGDAVMEA +K 
Sbjct  809   CGQGAMRMTFKSWLHQRPEVQAMKWSIRLRPGRFFTIPEELRAPQESQHGDAVMEATIKA  868

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             R+GSVLG GSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  869   RSGSVLGTGSILKMYFFPGQRTSSHIQIHGAPHVYKV  905


 Score =   206 bits (524),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR NSIGRV   G+   D +PNSE+AIRRGEY VIRSL RVLEGGVEGK+QVDKVID+
Sbjct  251  GIPRNNSIGRVFDAGSTVADNLPNSEEAIRRGEYPVIRSLTRVLEGGVEGKRQVDKVIDK  310

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIA+YRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+ERDAL  
Sbjct  311  CASMQNLREAIASYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHSERDALRS  370

Query  410  TSQV  421
            +S V
Sbjct  371  SSFV  374


 Score =   271 bits (692),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/242 (56%), Positives = 172/242 (71%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E++QV   R G VLG +T+LK DH PGC +  L  +++GA N+R+    PV+GVA PT
Sbjct  4     PKELEQVMRGRGGSVLGKKTILKGDHFPGCQNKRLTPQIDGAPNYRQADSLPVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+GR   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  64    TEGIRNVLKHIGAQKDGRRAQVLWFNLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV+TPLE  + L+ 
Sbjct  123   SRVEQMEARLKEDILIEASRYGNKILVTDELPDGQMVDQWEPVSRDSVKTPLEANEELQL  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+   Y R+PITD+K+P+  DFDTL   I  A+  T +VFNCQMG GRTTTG VIA LV
Sbjct  183   EGYLFDYERVPITDEKSPEEQDFDTLVDRIYGANLNTEIVFNCQMGRGRTTTGMVIATLV  242

Query  1221  KL  1226
              L
Sbjct  243   YL  244


 Score =   140 bits (354),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 132/245 (54%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     RSG VLG+ ++LK    PG    S   ++ GA +  ++ GFPVY +A PT++G
Sbjct  862   MEATIKARSGSVLGTGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDGFPVYSMATPTIAG  920

Query  696   ILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  +      + V   ++REE V+YING PFVLR++ +P  + L++ GI  
Sbjct  921   AKEMLSYLGAHPKVEGSYAQKVILTDLREEAVVYINGTPFVLRDLHKPV-DTLKHVGITG  979

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G  M++H       T    +   WE++ +D V+TP EV
Sbjct  980   SMVENMEARLKEDILSEV-RQSGGRMLLHREEYNPATNQSSVIGYWENIFADDVKTPAEV  1038

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T ++   +SD D  A+   +     + +F    G G      
Sbjct  1039  YAALKDEGYDITYRRIPLTREREALASDVD--AIQYCTDDCAGSYLFVSHTGFGGVAYAM  1096

Query  1203  VIACL  1217
              I C+
Sbjct  1097  AITCI  1101


 Score = 86.3 bits (212),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 99/189 (52%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  +TR+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  286   VIRSLTRVLEGGVEGKRQVDKVIDKCASMQNLREAIASYRNSILRQPDEMK-REASLSFF  344

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFF  1753
              EYLERY+ LI FA Y+ S+  D         ++F  W+  RPE+ ++   + LR     
Sbjct  345   VEYLERYYFLICFAVYIHSER-DALRSSSFVHSSFADWMRARPELYSIIRRL-LRRDPMG  402

Query  1754  TIPEELRTPHELKHGDAV------MEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQI  1912
              +    + P  +K  ++       M  +   RNG VLG  ++L     PG Q ++   ++
Sbjct  403   ALGYAKKKPSLMKIAESADDRPHEMGVVAALRNGEVLGSQTVLKSDHCPGCQNSNLPERV  462

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  463   EGAPNFREV  471


 Score = 73.2 bits (178),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  1935  RCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             +C+GAGHLR+DI+Y++KELKK PDDDDE R  +MDMGI+ALR
Sbjct  1171  KCSGAGHLRDDILYYSKELKKNPDDDDEQRTCIMDMGIKALR  1212


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+   GVE ++ +D VIDRC+++QN+REA+  YR  + +Q  E + R  AL+   EYL
Sbjct  728  ITRLFVNGVECREALDAVIDRCSALQNIREAVLHYRKVVNQQHVEPRVRRVALNRGAEYL  787

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  788  ERYFRLIAFAAYLGSE  803


 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP-  295
             + E+ +R G+Y  I SL RVL  G + K+ VD  ID+C+   +LR+ I  Y   + + P 
Sbjct  1135  SDEETLRMGDYRDILSLTRVLINGPKSKEDVDGFIDKCSGAGHLRDDILYYSKELKKNPD  1194

Query  296   -DEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
              D+ +R   +   ++ L RY FLI F  YL+  +      S   + RP+
Sbjct  1195  DDDEQRTCIMDMGIKALRRYFFLITFRSYLYCAKPTETRFSSWMDARPE  1243


 Score = 60.5 bits (145),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 60/114 (53%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVA-LNRG  1573
             +  +TR+  NG + +E +D  ID+CS   ++R  +L Y +   +   +  E+R   ++ G
Sbjct  1148  ILSLTRVLINGPKSKEDVDGFIDKCSGAGHLRDDILYYSKELKKNPDDDDEQRTCIMDMG  1207

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL       +C +  + T F  W+  RPE+  +  ++R+
Sbjct  1208  IKALRRYFFLITFRSYL-------YCAK-PTETRFSSWMDARPELGHLCNNLRI  1253



>ref|XP_002301459.2| hypothetical protein POPTR_0002s18520g [Populus trichocarpa]
 gb|EEE80732.2| hypothetical protein POPTR_0002s18520g [Populus trichocarpa]
Length=1259

 Score =   505 bits (1301),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 241/295 (82%), Positives = 268/295 (91%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRR+PMGALGYAS KPSP    ES +GRP EM  VAALR+GEVLGSQTVLKSD
Sbjct  392   YSIIRRLLRRNPMGALGYASPKPSPMRIAESADGRPHEMGVVAALRNGEVLGSQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +PSLPER++GA NFRE+PGFPVYGVANPT+ GILSVIQRIGSSK G PVFWHNM
Sbjct  452   HCPGCQNPSLPERVDGAPNFREVPGFPVYGVANPTIDGILSVIQRIGSSKGGCPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYING+PFVLREVERP+KNMLEYTGI  ERVERMEARLK+DI+REAERY GAIMV
Sbjct  512   REEPVIYINGEPFVLREVERPFKNMLEYTGIGRERVERMEARLKEDILREAERYGGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+SDS++TPLEVFKCL+ +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  572   IHETDDGQIFDAWEHVNSDSIKTPLEVFKCLDTDGFPIKYARVPITDGKAPKSSDFDTLA  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDAL-HEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL D + HEE+
Sbjct  632   MNIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLADDMNHEEV  686


 Score =   357 bits (915),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G        I   +   +    FGI+DILLLWKITRLFDNG+ECREALDAIIDR
Sbjct  692   SGEETGGDTAATTSDIGSVKTDMEQGRAFGIDDILLLWKITRLFDNGMECREALDAIIDR  751

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++ NQQ  EPR RRVAL+RGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  752   CSALQNIRQAVLQYRKVVNQQHVEPRVRRVALSRGAEYLERYFRLIAFAAYLGSEAFDGF  811

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLHQRPEVQA+KWSIRLRPGRFFT+PE LRTP E +HGDAVMEA V+ 
Sbjct  812   CGQGESRMTFKSWLHQRPEVQAIKWSIRLRPGRFFTVPEGLRTPQESQHGDAVMEATVRV  871

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAP+VYKV
Sbjct  872   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPNVYKV  908


 Score =   195 bits (496),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GI RTNS+GR+   G N  + +PNSE+A+ RGEY VIRSLIRVLEGGVEGKKQVDKVID+
Sbjct  254  GIQRTNSVGRICEFGLNVNENLPNSEEALLRGEYAVIRSLIRVLEGGVEGKKQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIA YRNSILRQ DEMKREA+LSFFVEYLERY  LICFAVY+H+ERDAL  
Sbjct  314  CASMQNLREAIANYRNSILRQSDEMKREASLSFFVEYLERYYSLICFAVYIHSERDALRS  373

Query  410  TS  415
            +S
Sbjct  374  SS  375


 Score =   255 bits (652),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 165/240 (69%), Gaps = 3/240 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E ++V  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+    PV+GVA PT+ 
Sbjct  9     EPEKVMKLRGGSVLGKKTILKSDHFPGCQNKRLTPQIDGAPNYRQAESLPVHGVAIPTIE  68

Query  693   GILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             G  +VI+ I   K+G+   V W N+REE ++YING+PFVLR+VERP+ N LEYTGI+  R
Sbjct  69    GCRNVIKHIRGRKDGKQAQVLWFNLREEPLVYINGRPFVLRDVERPFSN-LEYTGINRSR  127

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE MEARLK+DI+ EA RY   I V  E  DGQ+ D WE VS DSV+TP+EV++ L+ EG
Sbjct  128   VEEMEARLKEDILMEAARYGNKIHVTDELPDGQMVDQWEPVSCDSVKTPVEVYEDLQVEG  187

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
                 Y R+PITD+K+P+  DFD L   I      T ++FNCQMG GRTTTG VI  LV L
Sbjct  188   HLYDYERVPITDEKSPEEQDFDILVDRIYQTDLNTDIIFNCQMGRGRTTTGMVITTLVYL  247


 Score =   130 bits (328),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/245 (34%), Positives = 129/245 (53%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+    +R+G VLG  ++LK    PG    S   ++ GA N  ++ G+PVY +A PT++G
Sbjct  865   MEATVRVRNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPNVYKVDGYPVYSMATPTIAG  923

Query  696   ILSVIQ------RIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                V+       +IG S   + V   ++REE  +YING PFV RE+ +P  + L++ GI 
Sbjct  924   AKEVLAYLKAKPKIGGSL-AQKVIVTDLREEAAVYINGTPFVPRELNKPV-DTLKHVGIT  981

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHETAD-----GQIFDSWEHVSSDSVQTPLEV  1022
                +E MEARLK+DI+ E  R  G +++  E  D       I   WE++S+D V+TP EV
Sbjct  982   GPVLELMEARLKEDIVSEIRRSGGRLLLHREEYDPATNQSCIIGYWENISADDVKTPAEV  1041

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ + Y RIP+  ++   +SD D  A+         + +F    G G      
Sbjct  1042  YAGLKDEGYDMTYRRIPLASEREALASDVD--AIQYCKDDCAGSYLFVSHTGFGGVGYAM  1099

Query  1203  VIACL  1217
              I C+
Sbjct  1100  AIICI  1104


 Score = 87.8 bits (216),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE ++ +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  289   VIRSLIRVLEGGVEGKKQVDKVIDKCASMQNLREAIANYRNSILRQSDEMK-REASLSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ S+  D         ++F  W+  RPE+ + ++  +R  P   
Sbjct  348   VEYLERYYSLICFAVYIHSER-DALRSSSFGHSSFADWMRARPELYSIIRRLLRRNPMGA  406

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  +R           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  407   LGYASPKPSPMRIAESADGRPHEMGVVAALRNGEVLGSQTVLKSDHCPGCQNPSLPERVD  466

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  467   GAPNFREV  474


 Score = 73.9 bits (180),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALRPVTNV  2075
             V ++  +CAGAGHLR+DI Y+ KEL KFPD DDE RA L+DMGI+ALR   N+
Sbjct  1169  VDIIIEKCAGAGHLRDDIHYYIKELWKFPDSDDEQRACLLDMGIKALRRYFNL  1221


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR  + +Q  E + R  ALS   EYL
Sbjct  731  ITRLFDNGMECREALDAIIDRCSALQNIRQAVLQYRKVVNQQHVEPRVRRVALSRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  791  ERYFRLIAFAAYLGSE  806


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 2/109 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP-  295
             + E+A+R G+Y  I SL RVL  G + K  VD +I++CA   +LR+ I  Y   + + P 
Sbjct  1139  SDEEALRMGDYRDILSLTRVLIHGPQSKADVDIIIEKCAGAGHLRDDIHYYIKELWKFPD  1198

Query  296   -DEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
              D+ +R   L   ++ L RY  LI F  YL++ + +    +   + RP+
Sbjct  1199  SDDEQRACLLDMGIKALRRYFNLITFRSYLYSTKASETKFTSWMDSRPE  1247


 Score = 53.5 bits (127),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 59/114 (52%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQY-RRLFNQQRTEPRERRVALNRG  1573
             +  +TR+  +G + +  +D II++C+   ++R  +  Y + L+    ++  +R   L+ G
Sbjct  1152  ILSLTRVLIHGPQSKADVDIIIEKCAGAGHLRDDIHYYIKELWKFPDSDDEQRACLLDMG  1211

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL S           S T F  W+  RPE++ +  ++R+
Sbjct  1212  IKALRRYFNLITFRSYLYSTK--------ASETKFTSWMDSRPELRNLCNNLRI  1257



>ref|XP_003535306.1| PREDICTED: paladin-like isoform X1 [Glycine max]
 gb|KHN28744.1| Paladin [Glycine soja]
Length=1256

 Score =   492 bits (1266),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/293 (79%), Positives = 261/293 (89%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRR+PMGALGY++LKPS     EST+GRPSEM  VAALR+GEVLGSQTVLKSD
Sbjct  390   YSIIRRLLRRNPMGALGYSNLKPSLKKIAESTDGRPSEMSVVAALRNGEVLGSQTVLKSD  449

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC HP LPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+RIGSSK GRPV WHNM
Sbjct  450   HCPGCQHPRLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIRRIGSSKGGRPVLWHNM  509

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGI  ERVE+MEARLK+DI+REAE+Y  AIMV
Sbjct  510   REEPVIYINGKPFVLREVERPYKNMLEYTGIGRERVEKMEARLKEDILREAEQYGNAIMV  569

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DG I+D+WEHV+S+ +QTPLEVFK LEA+GFPIKYAR+PITD KAPKSSDFDT+A
Sbjct  570   IHETDDGHIYDAWEHVTSEMIQTPLEVFKSLEADGFPIKYARVPITDGKAPKSSDFDTVA  629

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
              NIASA+K TA VFNCQMG GRTTTGTVIACLVKLRIDYGRPI++L D +  E
Sbjct  630   FNIASAAKDTAFVFNCQMGRGRTTTGTVIACLVKLRIDYGRPIKILRDDMTRE  682


 Score =   360 bits (925),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 183/216 (85%), Gaps = 0/216 (0%)
 Frame = +2

Query  1292  GDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRC  1471
             GDE  G+V    P  L+  P +  SH FGINDILLLWKIT  FDNGVECREALDAIIDRC
Sbjct  691   GDEVGGYVTALTPDTLQIMPDEKQSHAFGINDILLLWKITAFFDNGVECREALDAIIDRC  750

Query  1472  SALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFC  1651
             SALQNIRQAVL+YR++FNQQ  EPR RRVAL RGAEYLERYFRLIAFAAYLGS+AFDGFC
Sbjct  751   SALQNIRQAVLEYRKVFNQQHVEPRVRRVALYRGAEYLERYFRLIAFAAYLGSEAFDGFC  810

Query  1652  GQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDR  1831
             GQ E    FK+W+H+RPEVQAMKWSIRLRPGRFFT+PEELR P E +HGDAVMEA VK R
Sbjct  811   GQAEYKMAFKNWMHERPEVQAMKWSIRLRPGRFFTVPEELRAPQESQHGDAVMEAFVKAR  870

Query  1832  NGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             +GSVLGKG IL  YFFPGQRTSSHIQIHGAPHVYKV
Sbjct  871   SGSVLGKGYILKTYFFPGQRTSSHIQIHGAPHVYKV  906


 Score =   204 bits (518),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NS+GRVS C  N  D +PNSE+AIRRGEYTVIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  252  GIPRSNSVGRVSQCLTNVADYIPNSEEAIRRGEYTVIRSLIRVLEGGVEGKRQVDKVIDK  311

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAI TYRNSIL QPDEMKREA+LSFFVEYLERY FLICFAVY+H+E   L  
Sbjct  312  CASMQNLREAIGTYRNSILWQPDEMKREASLSFFVEYLERYYFLICFAVYIHSEMATLCS  371

Query  410  TS  415
            +S
Sbjct  372  SS  373


 Score =   267 bits (682),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 171/242 (71%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E ++V   R G VLG +T+LKSDH PGCH+  L   ++GA N+R+     V+GVA PT
Sbjct  5     PKEPEEVMKRRGGSVLGKKTILKSDHFPGCHNKRLHPHIDGAPNYRQAESLLVHGVAIPT  64

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+  EG+   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  65    TDGIRNVLKHIGARAEGKKAQVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  123

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             ERVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS +SV+TPLEV++ L+ 
Sbjct  124   ERVEQMEARLKEDILMEAARYENKILVTDELPDGQMVDQWESVSCNSVKTPLEVYQELQV  183

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
              G+ + Y R+PITD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA L 
Sbjct  184   AGYLVDYERVPITDEKSPKEWDFDILVHKISQADVNTEIIFNCQMGRGRTTTGMVIATLF  243

Query  1221  KL  1226
              L
Sbjct  244   YL  245


 Score =   138 bits (348),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 128/245 (52%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     RSG VLG   +LK+   PG    S   ++ GA +  ++  FPVY +A PT+SG
Sbjct  863   MEAFVKARSGSVLGKGYILKTYFFPG-QRTSSHIQIHGAPHVYKVDEFPVYSMATPTISG  921

Query  696   ILSVIQRIGSS-----KEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+         + V   ++REE V+YI G PFVLRE+ +P  + L++ GI  
Sbjct  922   AKEILSYLGAKPKANVSSAQKVILTDLREEAVVYIKGTPFVLRELNKPV-DTLKHVGITG  980

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G +M+ H       T    +   WE++ +D V+TP EV
Sbjct  981   PAVEHMEARLKEDILAEI-RQSGGLMLFHREEYDPSTNKSSVVGYWENILADDVKTPAEV  1039

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y+RIP+T ++   +SD D  A+         + +F    G G      
Sbjct  1040  YSTLKDEGYDIIYSRIPLTRERDALASDID--AIQYCKDDSAESYLFVSHTGFGGVAYAM  1097

Query  1203  VIACL  1217
              I C+
Sbjct  1098  AIICI  1102


 Score = 54.7 bits (130),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 67/135 (50%), Gaps = 13/135 (10%)
 Frame = +2

Query  1337  LKTRPKKDSSHEFG-INDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR  1513
             L +R   +++ + G   DIL L   TR+   G + +   D +I+RC+   ++R  +L Y 
Sbjct  1131  LASRASNEAALKMGDYRDILSL---TRVLIRGPQSKADADIVIERCAGAGHLRDDILYYH  1187

Query  1514  RLFNQ-QRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWL  1690
             + F +    +  ER   ++ G + L RYF LI F +YL       +C    +M  F  W+
Sbjct  1188  KEFEKFTDGDDEERAYLMDMGVKALRRYFFLITFRSYL-------YCTSPANM-KFSAWM  1239

Query  1691  HQRPEVQAMKWSIRL  1735
               RPE+  +  ++R+
Sbjct  1240  DARPELGHLCNNLRI  1254


 Score = 84.0 bits (206),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR     Q  E + R  +L+  
Sbjct  287   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIGTYRNSILWQPDEMK-REASLSFF  345

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRPG--  1744
              EYLERY+ LI FA Y+ S+     C      ++F  W+  RPE+ + ++  +R  P   
Sbjct  346   VEYLERYYFLICFAVYIHSE-MATLCSSSVDRSSFTDWMRDRPELYSIIRRLLRRNPMGA  404

Query  1745  -RFFTIPEELRTPHELKHG-DAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
               +  +   L+   E   G  + M  +   RNG VLG  ++L     PG Q      ++ 
Sbjct  405   LGYSNLKPSLKKIAESTDGRPSEMSVVAALRNGEVLGSQTVLKSDHCPGCQHPRLPERVE  464

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  465   GAPNFREV  472


 Score = 75.5 bits (184),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +3

Query  1863  LRCTSFLVRELQVTFKFMVRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDM  2042
             L  T  L+R  Q   K    ++  RCAGAGHLR+DI+Y+ KE +KF D DDE RAYLMDM
Sbjct  1150  LSLTRVLIRGPQS--KADADIVIERCAGAGHLRDDILYYHKEFEKFTDGDDEERAYLMDM  1207

Query  2043  GIRALR  2060
             G++ALR
Sbjct  1208  GVKALR  1213


 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 62/109 (57%), Gaps = 3/109 (3%)
 Frame = +2

Query  74   GRVSSCGANATDIMPNSEDAIRRG--EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQN  247
            G V++   +   IMP+ + +   G  +  ++  +    + GVE ++ +D +IDRC+++QN
Sbjct  696  GYVTALTPDTLQIMPDEKQSHAFGINDILLLWKITAFFDNGVECREALDAIIDRCSALQN  755

Query  248  LREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            +R+A+  YR    +Q  E + R  AL    EYLERY  LI FA YL +E
Sbjct  756  IRQAVLEYRKVFNQQHVEPRVRRVALYRGAEYLERYFRLIAFAAYLGSE  804


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (48%), Gaps = 4/121 (3%)
 Frame = +2

Query  89    CGANATDIMP--NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAI  262
             C A   ++    ++E A++ G+Y  I SL RVL  G + K   D VI+RCA   +LR+ I
Sbjct  1124  CAATEENLASRASNEAALKMGDYRDILSLTRVLIRGPQSKADADIVIERCAGAGHLRDDI  1183

Query  263   ATYRNSI--LRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRP  436
               Y          D+ +R   +   V+ L RY FLI F  YL+    A    S   + RP
Sbjct  1184  LYYHKEFEKFTDGDDEERAYLMDMGVKALRRYFFLITFRSYLYCTSPANMKFSAWMDARP  1243

Query  437   D  439
             +
Sbjct  1244  E  1244



>ref|XP_006589084.1| PREDICTED: paladin-like isoform X4 [Glycine max]
Length=1019

 Score =   492 bits (1267),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/293 (79%), Positives = 261/293 (89%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRR+PMGALGY++LKPS     EST+GRPSEM  VAALR+GEVLGSQTVLKSD
Sbjct  153   YSIIRRLLRRNPMGALGYSNLKPSLKKIAESTDGRPSEMSVVAALRNGEVLGSQTVLKSD  212

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC HP LPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+RIGSSK GRPV WHNM
Sbjct  213   HCPGCQHPRLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIRRIGSSKGGRPVLWHNM  272

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGI  ERVE+MEARLK+DI+REAE+Y  AIMV
Sbjct  273   REEPVIYINGKPFVLREVERPYKNMLEYTGIGRERVEKMEARLKEDILREAEQYGNAIMV  332

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DG I+D+WEHV+S+ +QTPLEVFK LEA+GFPIKYAR+PITD KAPKSSDFDT+A
Sbjct  333   IHETDDGHIYDAWEHVTSEMIQTPLEVFKSLEADGFPIKYARVPITDGKAPKSSDFDTVA  392

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
              NIASA+K TA VFNCQMG GRTTTGTVIACLVKLRIDYGRPI++L D +  E
Sbjct  393   FNIASAAKDTAFVFNCQMGRGRTTTGTVIACLVKLRIDYGRPIKILRDDMTRE  445


 Score =   360 bits (925),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 183/216 (85%), Gaps = 0/216 (0%)
 Frame = +2

Query  1292  GDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRC  1471
             GDE  G+V    P  L+  P +  SH FGINDILLLWKIT  FDNGVECREALDAIIDRC
Sbjct  454   GDEVGGYVTALTPDTLQIMPDEKQSHAFGINDILLLWKITAFFDNGVECREALDAIIDRC  513

Query  1472  SALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFC  1651
             SALQNIRQAVL+YR++FNQQ  EPR RRVAL RGAEYLERYFRLIAFAAYLGS+AFDGFC
Sbjct  514   SALQNIRQAVLEYRKVFNQQHVEPRVRRVALYRGAEYLERYFRLIAFAAYLGSEAFDGFC  573

Query  1652  GQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDR  1831
             GQ E    FK+W+H+RPEVQAMKWSIRLRPGRFFT+PEELR P E +HGDAVMEA VK R
Sbjct  574   GQAEYKMAFKNWMHERPEVQAMKWSIRLRPGRFFTVPEELRAPQESQHGDAVMEAFVKAR  633

Query  1832  NGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             +GSVLGKG IL  YFFPGQRTSSHIQIHGAPHVYKV
Sbjct  634   SGSVLGKGYILKTYFFPGQRTSSHIQIHGAPHVYKV  669


 Score =   204 bits (518),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NS+GRVS C  N  D +PNSE+AIRRGEYTVIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  15   GIPRSNSVGRVSQCLTNVADYIPNSEEAIRRGEYTVIRSLIRVLEGGVEGKRQVDKVIDK  74

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAI TYRNSIL QPDEMKREA+LSFFVEYLERY FLICFAVY+H+E   L  
Sbjct  75   CASMQNLREAIGTYRNSILWQPDEMKREASLSFFVEYLERYYFLICFAVYIHSEMATLCS  134

Query  410  TS  415
            +S
Sbjct  135  SS  136


 Score =   138 bits (348),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 128/245 (52%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     RSG VLG   +LK+   PG    S   ++ GA +  ++  FPVY +A PT+SG
Sbjct  626   MEAFVKARSGSVLGKGYILKTYFFPG-QRTSSHIQIHGAPHVYKVDEFPVYSMATPTISG  684

Query  696   ILSVIQRIGSS-----KEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+         + V   ++REE V+YI G PFVLRE+ +P  + L++ GI  
Sbjct  685   AKEILSYLGAKPKANVSSAQKVILTDLREEAVVYIKGTPFVLRELNKPV-DTLKHVGITG  743

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G +M+ H       T    +   WE++ +D V+TP EV
Sbjct  744   PAVEHMEARLKEDILAEI-RQSGGLMLFHREEYDPSTNKSSVVGYWENILADDVKTPAEV  802

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y+RIP+T ++   +SD D  A+         + +F    G G      
Sbjct  803   YSTLKDEGYDIIYSRIPLTRERDALASDID--AIQYCKDDSAESYLFVSHTGFGGVAYAM  860

Query  1203  VIACL  1217
              I C+
Sbjct  861   AIICI  865


 Score = 54.7 bits (130),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 67/135 (50%), Gaps = 13/135 (10%)
 Frame = +2

Query  1337  LKTRPKKDSSHEFG-INDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR  1513
             L +R   +++ + G   DIL L   TR+   G + +   D +I+RC+   ++R  +L Y 
Sbjct  894   LASRASNEAALKMGDYRDILSL---TRVLIRGPQSKADADIVIERCAGAGHLRDDILYYH  950

Query  1514  RLFNQ-QRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWL  1690
             + F +    +  ER   ++ G + L RYF LI F +YL       +C    +M  F  W+
Sbjct  951   KEFEKFTDGDDEERAYLMDMGVKALRRYFFLITFRSYL-------YCTSPANM-KFSAWM  1002

Query  1691  HQRPEVQAMKWSIRL  1735
               RPE+  +  ++R+
Sbjct  1003  DARPELGHLCNNLRI  1017


 Score = 83.6 bits (205),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR     Q  E + R  +L+  
Sbjct  50    VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIGTYRNSILWQPDEMK-REASLSFF  108

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRPG--  1744
              EYLERY+ LI FA Y+ S+     C      ++F  W+  RPE+ + ++  +R  P   
Sbjct  109   VEYLERYYFLICFAVYIHSE-MATLCSSSVDRSSFTDWMRDRPELYSIIRRLLRRNPMGA  167

Query  1745  -RFFTIPEELRTPHELKHG-DAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
               +  +   L+   E   G  + M  +   RNG VLG  ++L     PG Q      ++ 
Sbjct  168   LGYSNLKPSLKKIAESTDGRPSEMSVVAALRNGEVLGSQTVLKSDHCPGCQHPRLPERVE  227

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  228   GAPNFREV  235


 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +3

Query  1863  LRCTSFLVRELQVTFKFMVRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDM  2042
             L  T  L+R  Q   K    ++  RCAGAGHLR+DI+Y+ KE +KF D DDE RAYLMDM
Sbjct  913   LSLTRVLIRGPQS--KADADIVIERCAGAGHLRDDILYYHKEFEKFTDGDDEERAYLMDM  970

Query  2043  GIRALR  2060
             G++ALR
Sbjct  971   GVKALR  976


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 62/109 (57%), Gaps = 3/109 (3%)
 Frame = +2

Query  74   GRVSSCGANATDIMPNSEDAIRRG--EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQN  247
            G V++   +   IMP+ + +   G  +  ++  +    + GVE ++ +D +IDRC+++QN
Sbjct  459  GYVTALTPDTLQIMPDEKQSHAFGINDILLLWKITAFFDNGVECREALDAIIDRCSALQN  518

Query  248  LREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            +R+A+  YR    +Q  E + R  AL    EYLERY  LI FA YL +E
Sbjct  519  IRQAVLEYRKVFNQQHVEPRVRRVALYRGAEYLERYFRLIAFAAYLGSE  567


 Score = 56.6 bits (135),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (48%), Gaps = 4/121 (3%)
 Frame = +2

Query  89    CGANATDIMP--NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAI  262
             C A   ++    ++E A++ G+Y  I SL RVL  G + K   D VI+RCA   +LR+ I
Sbjct  887   CAATEENLASRASNEAALKMGDYRDILSLTRVLIRGPQSKADADIVIERCAGAGHLRDDI  946

Query  263   ATYRNSI--LRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRP  436
               Y          D+ +R   +   V+ L RY FLI F  YL+    A    S   + RP
Sbjct  947   LYYHKEFEKFTDGDDEERAYLMDMGVKALRRYFFLITFRSYLYCTSPANMKFSAWMDARP  1006

Query  437   D  439
             +
Sbjct  1007  E  1007



>ref|XP_002301458.2| hypothetical protein POPTR_0002s18520g [Populus trichocarpa]
 gb|EEE80731.2| hypothetical protein POPTR_0002s18520g [Populus trichocarpa]
Length=1092

 Score =   504 bits (1299),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 241/295 (82%), Positives = 268/295 (91%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRR+PMGALGYAS KPSP    ES +GRP EM  VAALR+GEVLGSQTVLKSD
Sbjct  392   YSIIRRLLRRNPMGALGYASPKPSPMRIAESADGRPHEMGVVAALRNGEVLGSQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +PSLPER++GA NFRE+PGFPVYGVANPT+ GILSVIQRIGSSK G PVFWHNM
Sbjct  452   HCPGCQNPSLPERVDGAPNFREVPGFPVYGVANPTIDGILSVIQRIGSSKGGCPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYING+PFVLREVERP+KNMLEYTGI  ERVERMEARLK+DI+REAERY GAIMV
Sbjct  512   REEPVIYINGEPFVLREVERPFKNMLEYTGIGRERVERMEARLKEDILREAERYGGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+SDS++TPLEVFKCL+ +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  572   IHETDDGQIFDAWEHVNSDSIKTPLEVFKCLDTDGFPIKYARVPITDGKAPKSSDFDTLA  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDAL-HEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL D + HEE+
Sbjct  632   MNIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLADDMNHEEV  686


 Score =   356 bits (914),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G        I   +   +    FGI+DILLLWKITRLFDNG+ECREALDAIIDR
Sbjct  692   SGEETGGDTAATTSDIGSVKTDMEQGRAFGIDDILLLWKITRLFDNGMECREALDAIIDR  751

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++ NQQ  EPR RRVAL+RGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  752   CSALQNIRQAVLQYRKVVNQQHVEPRVRRVALSRGAEYLERYFRLIAFAAYLGSEAFDGF  811

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLHQRPEVQA+KWSIRLRPGRFFT+PE LRTP E +HGDAVMEA V+ 
Sbjct  812   CGQGESRMTFKSWLHQRPEVQAIKWSIRLRPGRFFTVPEGLRTPQESQHGDAVMEATVRV  871

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAP+VYKV
Sbjct  872   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPNVYKV  908


 Score =   195 bits (495),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GI RTNS+GR+   G N  + +PNSE+A+ RGEY VIRSLIRVLEGGVEGKKQVDKVID+
Sbjct  254  GIQRTNSVGRICEFGLNVNENLPNSEEALLRGEYAVIRSLIRVLEGGVEGKKQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIA YRNSILRQ DEMKREA+LSFFVEYLERY  LICFAVY+H+ERDAL  
Sbjct  314  CASMQNLREAIANYRNSILRQSDEMKREASLSFFVEYLERYYSLICFAVYIHSERDALRS  373

Query  410  TS  415
            +S
Sbjct  374  SS  375


 Score =   255 bits (651),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 165/240 (69%), Gaps = 3/240 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E ++V  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+    PV+GVA PT+ 
Sbjct  9     EPEKVMKLRGGSVLGKKTILKSDHFPGCQNKRLTPQIDGAPNYRQAESLPVHGVAIPTIE  68

Query  693   GILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             G  +VI+ I   K+G+   V W N+REE ++YING+PFVLR+VERP+ N LEYTGI+  R
Sbjct  69    GCRNVIKHIRGRKDGKQAQVLWFNLREEPLVYINGRPFVLRDVERPFSN-LEYTGINRSR  127

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE MEARLK+DI+ EA RY   I V  E  DGQ+ D WE VS DSV+TP+EV++ L+ EG
Sbjct  128   VEEMEARLKEDILMEAARYGNKIHVTDELPDGQMVDQWEPVSCDSVKTPVEVYEDLQVEG  187

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
                 Y R+PITD+K+P+  DFD L   I      T ++FNCQMG GRTTTG VI  LV L
Sbjct  188   HLYDYERVPITDEKSPEEQDFDILVDRIYQTDLNTDIIFNCQMGRGRTTTGMVITTLVYL  247


 Score =   127 bits (320),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 120/212 (57%), Gaps = 14/212 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+    +R+G VLG  ++LK    PG    S   ++ GA N  ++ G+PVY +A PT++G
Sbjct  865   MEATVRVRNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPNVYKVDGYPVYSMATPTIAG  923

Query  696   ILSVIQ------RIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                V+       +IG S   + V   ++REE  +YING PFV RE+ +P  + L++ GI 
Sbjct  924   AKEVLAYLKAKPKIGGSL-AQKVIVTDLREEAAVYINGTPFVPRELNKPV-DTLKHVGIT  981

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHETAD-----GQIFDSWEHVSSDSVQTPLEV  1022
                +E MEARLK+DI+ E  R  G +++  E  D       I   WE++S+D V+TP EV
Sbjct  982   GPVLELMEARLKEDIVSEIRRSGGRLLLHREEYDPATNQSCIIGYWENISADDVKTPAEV  1041

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTL  1118
             +  L+ EG+ + Y RIP+  ++   +SD D +
Sbjct  1042  YAGLKDEGYDMTYRRIPLASEREALASDVDAI  1073


 Score = 87.8 bits (216),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE ++ +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  289   VIRSLIRVLEGGVEGKKQVDKVIDKCASMQNLREAIANYRNSILRQSDEMK-REASLSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ S+  D         ++F  W+  RPE+ + ++  +R  P   
Sbjct  348   VEYLERYYSLICFAVYIHSER-DALRSSSFGHSSFADWMRARPELYSIIRRLLRRNPMGA  406

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  +R           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  407   LGYASPKPSPMRIAESADGRPHEMGVVAALRNGEVLGSQTVLKSDHCPGCQNPSLPERVD  466

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  467   GAPNFREV  474


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR  + +Q  E + R  ALS   EYL
Sbjct  731  ITRLFDNGMECREALDAIIDRCSALQNIRQAVLQYRKVVNQQHVEPRVRRVALSRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  791  ERYFRLIAFAAYLGSE  806



>gb|AES61538.2| metal ion-binding protein [Medicago truncatula]
Length=1255

 Score =   484 bits (1247),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 229/293 (78%), Positives = 258/293 (88%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY+ LKPS     EST+ RPSEM  VAALR+GEVLGSQTVLKSD
Sbjct  391   YSIIRRLLRRDPMGALGYSGLKPSLKKIAESTDDRPSEMGVVAALRNGEVLGSQTVLKSD  450

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +P LPER+EGA NFRE+PGFPVYGVANPT+ GI SV++RIGSSK GRPV WHNM
Sbjct  451   HCPGCQNPRLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVLRRIGSSKGGRPVLWHNM  510

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNM EYTGI  ERVE+MEARLK+DI+REAE+Y  AIMV
Sbjct  511   REEPVIYINGKPFVLREVERPYKNMREYTGIGRERVEKMEARLKEDILREAEQYDNAIMV  570

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQI+D+WE V+SD +QTPLEVFK LEA+GFPIKYAR+PITD KAPKSSDFDT+A
Sbjct  571   IHETDDGQIYDAWEQVTSDVIQTPLEVFKSLEADGFPIKYARVPITDGKAPKSSDFDTMA  630

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
              NIASA+K TA VFNCQMG GRTTTGTVIACLVKLRID GRPI++L D + +E
Sbjct  631   FNIASATKNTAFVFNCQMGRGRTTTGTVIACLVKLRIDSGRPIKILGDNVTQE  683


 Score =   365 bits (936),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 189/217 (87%), Gaps = 2/217 (1%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE  G+V   AP  L+ +  +   H FGINDILLLWKIT  FDNGVECREALD IIDR
Sbjct  691   SGDEVGGYVT--APNNLQIKTDEKQKHVFGINDILLLWKITAFFDNGVECREALDGIIDR  748

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVL+YR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  749   CSALQNIRQAVLEYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  808

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CG+GES  +FK+WLHQRPEVQAMKWSIRLRPGRFFT+PE+LR P E +HGDAVMEA VK 
Sbjct  809   CGEGESKVSFKNWLHQRPEVQAMKWSIRLRPGRFFTVPEKLRAPQESQHGDAVMEAFVKA  868

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             R+GSVLGKGSIL MYFFPGQRTSSHIQIHGAPHV+KV
Sbjct  869   RSGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVFKV  905


 Score =   205 bits (521),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NS+G VS C  N  D MPNSE+AIRRGEYTVIRSLIRVLEGGV+GK+QVDKVID+
Sbjct  252  GIPRSNSVGTVSQCLTNVPDHMPNSEEAIRRGEYTVIRSLIRVLEGGVDGKRQVDKVIDK  311

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICF VY+H+E  AL  
Sbjct  312  CASMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFTVYIHSEMAALQA  371

Query  410  TSQVA  424
             S  +
Sbjct  372  RSAAS  376


 Score =   268 bits (686),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 173/243 (71%), Gaps = 4/243 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E ++V  LR G VLG +T+LKSDH PGC +  L   +EGA N+R+     V+GVA PT
Sbjct  4     PKEPEEVMKLRGGSVLGKKTILKSDHFPGCQNKRLRPNIEGAPNYRQADKLHVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRP---VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
             + GI +V++ IG+  EG     V W ++REE V+YING+PFVLR+VERP+ N LEYTGI+
Sbjct  64    IDGIRNVLKHIGAEIEGENKVHVLWISLREEPVVYINGRPFVLRDVERPFSN-LEYTGIN  122

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLE  1037
              ERVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS +SV+TPLEV++ L+
Sbjct  123   RERVEQMEARLKEDILNEAARYGNKILVTDELPDGQMVDQWESVSCNSVKTPLEVYQELQ  182

Query  1038  AEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACL  1217
              EG+ + Y R+P+TD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA L
Sbjct  183   VEGYLVDYERVPVTDEKSPKEQDFDILVHKISQADVNTEIIFNCQMGRGRTTTGMVIATL  242

Query  1218  VKL  1226
             + L
Sbjct  243   IYL  245


 Score =   130 bits (326),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/246 (34%), Positives = 131/246 (53%), Gaps = 18/246 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     RSG VLG  ++LK    PG    S   ++ GA +  ++  + VY +A PT+SG
Sbjct  862   MEAFVKARSGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVFKVDEYSVYSMATPTISG  920

Query  696   ILSVIQRIGSSKEGRP-----VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                +++ +G++ + +      V   ++REE V+YI G PFVLRE+ +PY + L++ GI  
Sbjct  921   AKEMLKYLGANPKAKASAAPKVILTDLREEAVVYIKGTPFVLRELNKPY-DTLKHVGITG  979

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G +M +H       T    +   WE++ ++ V+T +EV
Sbjct  980   PVVEHMEARLKEDIIAEI-RQSGGLMPLHREEYNPSTNQSNVVGYWENILAEDVKTTVEV  1038

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTL-ALNIASASKYTALVFNCQMGIGRTTTG  1199
             +  L+ EG+ I Y RIP+T ++   +SD D +      SA  Y   +F    G G     
Sbjct  1039  YSALKDEGYDIVYRRIPLTRERDALASDVDAIQCCKDDSAENY---LFVSHTGFGGVAYA  1095

Query  1200  TVIACL  1217
               I C+
Sbjct  1096  MAIICI  1101


 Score = 80.9 bits (198),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 93/188 (49%), Gaps = 7/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GV+ +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  287   VIRSLIRVLEGGVDGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-REASLSFF  345

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI F  Y+ S+          S T+F  W+  RPE+ + ++  +R  P   
Sbjct  346   VEYLERYYFLICFTVYIHSEMAALQARSAASHTSFADWMRARPELYSIIRRLLRRDPMGA  405

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P   +         + M  +   RNG VLG  ++L     PG Q      ++ 
Sbjct  406   LGYSGLKPSLKKIAESTDDRPSEMGVVAALRNGEVLGSQTVLKSDHCPGCQNPRLPERVE  465

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  466   GAPNFREV  473


 Score = 74.7 bits (182),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGHLR+DI+Y+ KE +KF D DDE RA+LMDMG++ALR
Sbjct  1165  VDIVIDRCAGAGHLRDDILYYCKEFEKFTDGDDEERAHLMDMGVKALR  1212


 Score = 60.8 bits (146),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +2

Query  179  LEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*  355
             + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYLERY 
Sbjct  732  FDNGVECREALDGIIDRCSALQNIRQAVLEYRKVFNQQHVEPRVRRVALNRGAEYLERYF  791

Query  356  FLICFAVYLHTE  391
             LI FA YL +E
Sbjct  792  RLIAFAAYLGSE  803


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSI--LRQ  292
             ++E A++ G+Y  I SL RVL  G + K  VD VIDRCA   +LR+ I  Y         
Sbjct  1135  SNEAALKMGDYRDILSLTRVLIHGPQSKADVDIVIDRCAGAGHLRDDILYYCKEFEKFTD  1194

Query  293   PDEMKREAALSFFVEYLERY*FLICFAVYLH  385
              D+ +R   +   V+ L RY FLI F  YL+
Sbjct  1195  GDDEERAHLMDMGVKALRRYFFLITFRSYLY  1225


 Score = 55.1 bits (131),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 61/118 (52%), Gaps = 12/118 (10%)
 Frame = +2

Query  1385  DILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQ-QRTEPRERRVA  1561
             DIL L   TR+  +G + +  +D +IDRC+   ++R  +L Y + F +    +  ER   
Sbjct  1147  DILSL---TRVLIHGPQSKADVDIVIDRCAGAGHLRDDILYYCKEFEKFTDGDDEERAHL  1203

Query  1562  LNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
             ++ G + L RYF LI F +YL       +C    +M  F  W+  RPE+  +  ++R+
Sbjct  1204  MDMGVKALRRYFFLITFRSYL-------YCTSPSNM-EFAAWMDARPELGHLCNNLRI  1253



>ref|XP_003555761.1| PREDICTED: paladin-like isoform X1 [Glycine max]
 gb|KHN22203.1| Paladin [Glycine soja]
Length=1256

 Score =   484 bits (1247),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 230/290 (79%), Positives = 257/290 (89%), Gaps = 0/290 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRR+PMGALGY+SLKPS     EST+GRPSEM  VAALR+GEVLGSQTVLKSD
Sbjct  390   YSIIRRLLRRNPMGALGYSSLKPSLKKIAESTDGRPSEMSVVAALRNGEVLGSQTVLKSD  449

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC HP LPER+EGA NFRE+ GFPVYGVANPT+ GI SVI RIGSSK G PV WHNM
Sbjct  450   HCPGCQHPRLPERVEGAPNFREVSGFPVYGVANPTIDGIRSVICRIGSSKGGSPVLWHNM  509

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGI  ERVE+MEARLK+DI+REAE+Y  AIMV
Sbjct  510   REEPVIYINGKPFVLREVERPYKNMLEYTGIGRERVEKMEARLKEDILREAEQYGNAIMV  569

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DG I+D+WEHV+S+ +QTPLEVFK LEA+GFPIKYAR+PITD KAPKSSDFDT+A
Sbjct  570   IHETDDGHIYDAWEHVTSEMIQTPLEVFKSLEADGFPIKYARVPITDGKAPKSSDFDTVA  629

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDAL  1271
              NIASA+K TA VFNCQMG GRTTTGTVIACLVKLRIDYGRPI++L D +
Sbjct  630   FNIASAAKDTAFVFNCQMGRGRTTTGTVIACLVKLRIDYGRPIKILRDDM  679


 Score =   365 bits (936),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE  G+V    P  L+ +P +  SH FGINDILLLWKIT  FDNGVECREALDAIIDR
Sbjct  690   SGDEVGGYVTALTPNTLQIKPDEKQSHAFGINDILLLWKITTFFDNGVECREALDAIIDR  749

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVL+YR++FNQQ  EPR RRVAL RGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  750   CSALQNIRQAVLEYRKVFNQQHVEPRVRRVALYRGAEYLERYFRLIAFAAYLGSEAFDGF  809

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGE    FK+W+H+RPEVQAMKWSIRLRPGRFFT+PEELR P E +HGDAVMEA VK 
Sbjct  810   CGQGEYKMAFKNWMHERPEVQAMKWSIRLRPGRFFTVPEELRAPRESQHGDAVMEAFVKA  869

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             R+GSVLGKG IL MYFFPGQRTSS++QIHGAPH+YKV
Sbjct  870   RSGSVLGKGYILKMYFFPGQRTSSYMQIHGAPHIYKV  906


 Score =   205 bits (522),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NS+GRVS C  N  D +PNSE+AIRRGEYTVIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  252  GIPRSNSVGRVSQCLTNVADYIPNSEEAIRRGEYTVIRSLIRVLEGGVEGKRQVDKVIDK  311

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAI TYRNSILRQPDEMK+EA+LSFFVEYLERY FLICFAVY+H+E   L  
Sbjct  312  CASMQNLREAIGTYRNSILRQPDEMKKEASLSFFVEYLERYYFLICFAVYIHSEMATLCS  371

Query  410  TS  415
             S
Sbjct  372  CS  373


 Score =   267 bits (683),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 171/242 (71%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E ++V   R G VLG +T+LKSDH PGCH+  L   ++GA N+R+     V+GVA PT
Sbjct  5     PKEPEEVMKRRGGSVLGKKTILKSDHFPGCHNKRLHPHIDGAPNYRQAESLHVHGVAIPT  64

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+  EG+   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  65    TDGIRNVLKHIGARAEGKKAQVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  123

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             ERVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS +SV+ PLEV++ L+ 
Sbjct  124   ERVEQMEARLKEDILMEAARYGNKILVTDELPDGQMVDQWESVSCNSVKAPLEVYQELQV  183

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA L 
Sbjct  184   EGYLVDYERVPITDEKSPKERDFDILVHKISQADVNTEIIFNCQMGRGRTTTGMVIATLF  243

Query  1221  KL  1226
              L
Sbjct  244   YL  245


 Score =   135 bits (340),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 129/246 (52%), Gaps = 18/246 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     RSG VLG   +LK    PG    S  + + GA +  ++  +PVY +A PT+SG
Sbjct  863   MEAFVKARSGSVLGKGYILKMYFFPGQRTSSYMQ-IHGAPHIYKVDEYPVYSMATPTISG  921

Query  696   ILSVIQRIGSSKEG-----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  +      + V   ++REE V+YI G PFVLRE+ +P  + L++ GI  
Sbjct  922   AKEMLSYLGAKPKANVSSSQKVILTDLREEAVVYIKGTPFVLRELNKPV-DTLKHVGITG  980

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G +M+ H       T    +   WE+V +D V+TP EV
Sbjct  981   LAVEHMEARLKEDILAEI-RQSGGLMLFHREEYNPSTNQSSVVGYWENVLADDVKTPAEV  1039

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLAL-NIASASKYTALVFNCQMGIGRTTTG  1199
             +  L+ EG+ I Y RIP+T ++   +SD DT+      SA  Y   +F    G G     
Sbjct  1040  YSTLKDEGYDIIYLRIPLTRERDALASDIDTIQYCKDDSAESY---LFVSHTGFGGVAYA  1096

Query  1200  TVIACL  1217
               I C+
Sbjct  1097  MAIICV  1102


 Score = 55.8 bits (133),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 68/135 (50%), Gaps = 13/135 (10%)
 Frame = +2

Query  1337  LKTRPKKDSSHEFG-INDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR  1513
             L +R   +++ + G   DIL L   TR+   G + +  +D +I+RC+   ++R  +L Y 
Sbjct  1131  LPSRASNEAALKMGDYRDILSL---TRVLIRGPQSKSDVDIVIERCAGAGHLRDDILYYH  1187

Query  1514  RLFNQ-QRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWL  1690
             + F +    +  ER   ++ G + L RYF LI F +YL       +C    +M  F  W+
Sbjct  1188  KEFEKFTDGDDEERAYLMDMGVKALRRYFFLITFRSYL-------YCTSPANM-KFAAWM  1239

Query  1691  HQRPEVQAMKWSIRL  1735
               RPE+  +  ++R+
Sbjct  1240  DARPELGHLCNNLRI  1254


 Score = 84.0 bits (206),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 98/188 (52%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + +  +L+  
Sbjct  287   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIGTYRNSILRQPDEMK-KEASLSFF  345

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRPG--  1744
              EYLERY+ LI FA Y+ S+     C      ++F  W+  RPE+ + ++  +R  P   
Sbjct  346   VEYLERYYFLICFAVYIHSE-MATLCSCSADHSSFTDWMRNRPELYSIIRRLLRRNPMGA  404

Query  1745  -RFFTIPEELRTPHELKHG-DAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
               + ++   L+   E   G  + M  +   RNG VLG  ++L     PG Q      ++ 
Sbjct  405   LGYSSLKPSLKKIAESTDGRPSEMSVVAALRNGEVLGSQTVLKSDHCPGCQHPRLPERVE  464

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  465   GAPNFREV  472


 Score = 76.6 bits (187),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = +3

Query  1863  LRCTSFLVRELQVTFKFMVRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDM  2042
             L  T  L+R  Q   K  V ++  RCAGAGHLR+DI+Y+ KE +KF D DDE RAYLMDM
Sbjct  1150  LSLTRVLIRGPQS--KSDVDIVIERCAGAGHLRDDILYYHKEFEKFTDGDDEERAYLMDM  1207

Query  2043  GIRALR  2060
             G++ALR
Sbjct  1208  GVKALR  1213


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 61/109 (56%), Gaps = 3/109 (3%)
 Frame = +2

Query  74   GRVSSCGANATDIMPNSEDAIRRG--EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQN  247
            G V++   N   I P+ + +   G  +  ++  +    + GVE ++ +D +IDRC+++QN
Sbjct  696  GYVTALTPNTLQIKPDEKQSHAFGINDILLLWKITTFFDNGVECREALDAIIDRCSALQN  755

Query  248  LREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            +R+A+  YR    +Q  E + R  AL    EYLERY  LI FA YL +E
Sbjct  756  IRQAVLEYRKVFNQQHVEPRVRRVALYRGAEYLERYFRLIAFAAYLGSE  804


 Score = 56.6 bits (135),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSI--LRQ  292
             ++E A++ G+Y  I SL RVL  G + K  VD VI+RCA   +LR+ I  Y         
Sbjct  1136  SNEAALKMGDYRDILSLTRVLIRGPQSKSDVDIVIERCAGAGHLRDDILYYHKEFEKFTD  1195

Query  293   PDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
              D+ +R   +   V+ L RY FLI F  YL+    A    +   + RP+
Sbjct  1196  GDDEERAYLMDMGVKALRRYFFLITFRSYLYCTSPANMKFAAWMDARPE  1244



>ref|XP_006589083.1| PREDICTED: paladin-like isoform X3 [Glycine max]
Length=1099

 Score =   491 bits (1265),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/293 (79%), Positives = 261/293 (89%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRR+PMGALGY++LKPS     EST+GRPSEM  VAALR+GEVLGSQTVLKSD
Sbjct  390   YSIIRRLLRRNPMGALGYSNLKPSLKKIAESTDGRPSEMSVVAALRNGEVLGSQTVLKSD  449

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC HP LPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+RIGSSK GRPV WHNM
Sbjct  450   HCPGCQHPRLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIRRIGSSKGGRPVLWHNM  509

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGI  ERVE+MEARLK+DI+REAE+Y  AIMV
Sbjct  510   REEPVIYINGKPFVLREVERPYKNMLEYTGIGRERVEKMEARLKEDILREAEQYGNAIMV  569

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DG I+D+WEHV+S+ +QTPLEVFK LEA+GFPIKYAR+PITD KAPKSSDFDT+A
Sbjct  570   IHETDDGHIYDAWEHVTSEMIQTPLEVFKSLEADGFPIKYARVPITDGKAPKSSDFDTVA  629

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
              NIASA+K TA VFNCQMG GRTTTGTVIACLVKLRIDYGRPI++L D +  E
Sbjct  630   FNIASAAKDTAFVFNCQMGRGRTTTGTVIACLVKLRIDYGRPIKILRDDMTRE  682


 Score =   360 bits (923),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 183/216 (85%), Gaps = 0/216 (0%)
 Frame = +2

Query  1292  GDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRC  1471
             GDE  G+V    P  L+  P +  SH FGINDILLLWKIT  FDNGVECREALDAIIDRC
Sbjct  691   GDEVGGYVTALTPDTLQIMPDEKQSHAFGINDILLLWKITAFFDNGVECREALDAIIDRC  750

Query  1472  SALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFC  1651
             SALQNIRQAVL+YR++FNQQ  EPR RRVAL RGAEYLERYFRLIAFAAYLGS+AFDGFC
Sbjct  751   SALQNIRQAVLEYRKVFNQQHVEPRVRRVALYRGAEYLERYFRLIAFAAYLGSEAFDGFC  810

Query  1652  GQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDR  1831
             GQ E    FK+W+H+RPEVQAMKWSIRLRPGRFFT+PEELR P E +HGDAVMEA VK R
Sbjct  811   GQAEYKMAFKNWMHERPEVQAMKWSIRLRPGRFFTVPEELRAPQESQHGDAVMEAFVKAR  870

Query  1832  NGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             +GSVLGKG IL  YFFPGQRTSSHIQIHGAPHVYKV
Sbjct  871   SGSVLGKGYILKTYFFPGQRTSSHIQIHGAPHVYKV  906


 Score =   203 bits (517),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NS+GRVS C  N  D +PNSE+AIRRGEYTVIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  252  GIPRSNSVGRVSQCLTNVADYIPNSEEAIRRGEYTVIRSLIRVLEGGVEGKRQVDKVIDK  311

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAI TYRNSIL QPDEMKREA+LSFFVEYLERY FLICFAVY+H+E   L  
Sbjct  312  CASMQNLREAIGTYRNSILWQPDEMKREASLSFFVEYLERYYFLICFAVYIHSEMATLCS  371

Query  410  TS  415
            +S
Sbjct  372  SS  373


 Score =   267 bits (682),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 171/242 (71%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E ++V   R G VLG +T+LKSDH PGCH+  L   ++GA N+R+     V+GVA PT
Sbjct  5     PKEPEEVMKRRGGSVLGKKTILKSDHFPGCHNKRLHPHIDGAPNYRQAESLLVHGVAIPT  64

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+  EG+   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  65    TDGIRNVLKHIGARAEGKKAQVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  123

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             ERVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS +SV+TPLEV++ L+ 
Sbjct  124   ERVEQMEARLKEDILMEAARYENKILVTDELPDGQMVDQWESVSCNSVKTPLEVYQELQV  183

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
              G+ + Y R+PITD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA L 
Sbjct  184   AGYLVDYERVPITDEKSPKEWDFDILVHKISQADVNTEIIFNCQMGRGRTTTGMVIATLF  243

Query  1221  KL  1226
              L
Sbjct  244   YL  245


 Score =   133 bits (335),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/212 (37%), Positives = 119/212 (56%), Gaps = 14/212 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     RSG VLG   +LK+   PG    S   ++ GA +  ++  FPVY +A PT+SG
Sbjct  863   MEAFVKARSGSVLGKGYILKTYFFPG-QRTSSHIQIHGAPHVYKVDEFPVYSMATPTISG  921

Query  696   ILSVIQRIGSS-----KEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+         + V   ++REE V+YI G PFVLRE+ +P  + L++ GI  
Sbjct  922   AKEILSYLGAKPKANVSSAQKVILTDLREEAVVYIKGTPFVLRELNKPV-DTLKHVGITG  980

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G +M+ H       T    +   WE++ +D V+TP EV
Sbjct  981   PAVEHMEARLKEDILAEI-RQSGGLMLFHREEYDPSTNKSSVVGYWENILADDVKTPAEV  1039

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTL  1118
             +  L+ EG+ I Y+RIP+T ++   +SD D +
Sbjct  1040  YSTLKDEGYDIIYSRIPLTRERDALASDIDAI  1071


 Score = 84.0 bits (206),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR     Q  E + R  +L+  
Sbjct  287   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIGTYRNSILWQPDEMK-REASLSFF  345

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRPG--  1744
              EYLERY+ LI FA Y+ S+     C      ++F  W+  RPE+ + ++  +R  P   
Sbjct  346   VEYLERYYFLICFAVYIHSE-MATLCSSSVDRSSFTDWMRDRPELYSIIRRLLRRNPMGA  404

Query  1745  -RFFTIPEELRTPHELKHG-DAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
               +  +   L+   E   G  + M  +   RNG VLG  ++L     PG Q      ++ 
Sbjct  405   LGYSNLKPSLKKIAESTDGRPSEMSVVAALRNGEVLGSQTVLKSDHCPGCQHPRLPERVE  464

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  465   GAPNFREV  472


 Score = 63.5 bits (153),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 62/109 (57%), Gaps = 3/109 (3%)
 Frame = +2

Query  74   GRVSSCGANATDIMPNSEDAIRRG--EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQN  247
            G V++   +   IMP+ + +   G  +  ++  +    + GVE ++ +D +IDRC+++QN
Sbjct  696  GYVTALTPDTLQIMPDEKQSHAFGINDILLLWKITAFFDNGVECREALDAIIDRCSALQN  755

Query  248  LREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            +R+A+  YR    +Q  E + R  AL    EYLERY  LI FA YL +E
Sbjct  756  IRQAVLEYRKVFNQQHVEPRVRRVALYRGAEYLERYFRLIAFAAYLGSE  804



>ref|XP_011025294.1| PREDICTED: paladin isoform X1 [Populus euphratica]
Length=1259

 Score =   502 bits (1293),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/295 (81%), Positives = 267/295 (91%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRR+PMGALGYAS KPSP    ES +GRP EM  VAALR+GEVLGSQTVLKSD
Sbjct  392   YSIIRRLLRRNPMGALGYASPKPSPMRMAESADGRPHEMGVVAALRNGEVLGSQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +PSL ER++GA NFRE+PGFPVYGVANPT+ GILSVIQRIGSSK G PVFWHNM
Sbjct  452   HCPGCQNPSLTERVDGAPNFREVPGFPVYGVANPTIDGILSVIQRIGSSKGGCPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYING+PFVLREVERP+KNMLEYTGI  ERVERMEARLK+DI+REAERY GAIMV
Sbjct  512   REEPVIYINGEPFVLREVERPFKNMLEYTGIGRERVERMEARLKEDILREAERYGGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+SDS++TPLEVFKCL+ +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  572   IHETDDGQIFDAWEHVNSDSIKTPLEVFKCLDTDGFPIKYARVPITDGKAPKSSDFDTLA  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL +D  HEE+
Sbjct  632   MNIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLADDVNHEEV  686


 Score =   352 bits (904),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G        +   +   +    FGI+DILLLWKITRLFDNG+ECREALDAIIDR
Sbjct  692   SGEETGGDTDATTSDVGSLKTDMEQGRAFGIDDILLLWKITRLFDNGMECREALDAIIDR  751

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++ NQQ  EPR RRVAL+RGAEYLERYF LIAFAAYLGS+AFDGF
Sbjct  752   CSALQNIRQAVLQYRKVVNQQHVEPRVRRVALSRGAEYLERYFCLIAFAAYLGSEAFDGF  811

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLHQRPEVQA+KWSIRLRPGRFFT+PE LRTP E +HGDAVMEA V+ 
Sbjct  812   CGQGESRMTFKSWLHQRPEVQAIKWSIRLRPGRFFTVPEGLRTPQESQHGDAVMEATVRV  871

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAP+VYKV
Sbjct  872   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPNVYKV  908


 Score =   199 bits (505),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GI RTNS+GR+   G N  + +PNSEDA+RRGEY VIRSLIRVLEGGVEGKKQVDKVID+
Sbjct  254  GIQRTNSVGRIFDFGLNVNENLPNSEDALRRGEYAVIRSLIRVLEGGVEGKKQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIA YRNSILRQ DEMKREA+LSFFVEYLERY  LICFAVY+H+ERDAL  
Sbjct  314  CASMQNLREAIANYRNSILRQSDEMKREASLSFFVEYLERYYSLICFAVYIHSERDALRS  373

Query  410  TS  415
            +S
Sbjct  374  SS  375


 Score =   256 bits (655),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 165/240 (69%), Gaps = 3/240 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E ++V  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+    PV+GVA PT+ 
Sbjct  9     EPEKVMKLRGGSVLGKKTILKSDHFPGCQNKRLTPQIDGAPNYRQAESLPVHGVAIPTIE  68

Query  693   GILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             G  +VI+ I   K+G+   V W N+REE ++YING+PFVLR+VERP+ N LEYTGI+  R
Sbjct  69    GCRNVIKHIRGRKDGKQAQVLWFNLREEPLVYINGRPFVLRDVERPFSN-LEYTGINRSR  127

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE MEARLK+DI+ EA RY   I V  E  DGQ+ D WE VS DSV+TP+EV+  L+ EG
Sbjct  128   VEEMEARLKEDILMEAARYGNKIHVTDELPDGQMVDQWEPVSCDSVKTPVEVYGDLQVEG  187

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
                 Y R+PITD+K+P+  DFD L   I      T ++FNCQMG GRTTTG VIA LV L
Sbjct  188   HLYDYERVPITDEKSPEEQDFDILVDRIYQTDLNTDIIFNCQMGRGRTTTGMVIATLVYL  247


 Score =   130 bits (326),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/245 (34%), Positives = 128/245 (52%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+    +R+G VLG  ++LK    PG    S   ++ GA N  ++ G+PVY +A PT++G
Sbjct  865   MEATVRVRNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPNVYKVDGYPVYSMATPTIAG  923

Query  696   ILSVIQ------RIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                V+       +IG S   + V   ++REE  +YING PFV RE+ +P  + L++ GI 
Sbjct  924   AKEVLAYLKAKPKIGGSL-AQKVILTDLREEAAVYINGTPFVPRELNKPV-DTLKHVGIT  981

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHETAD-----GQIFDSWEHVSSDSVQTPLEV  1022
                +E MEARLK+DI+ E  R  G +++  E  D       I   WE++S+D V+TP EV
Sbjct  982   GPVLELMEARLKEDIVSEIRRSGGRLLLHREEYDPATNQSCIIGYWENISADDVKTPAEV  1041

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ + Y RIP+  +    +SD D  A+         + +F    G G      
Sbjct  1042  YAGLKDEGYDMTYRRIPLASETEALASDVD--AIQYCKDDCAGSYLFVSHTGFGGVGYAM  1099

Query  1203  VIACL  1217
              I C+
Sbjct  1100  AIICI  1104


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE ++ +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  289   VIRSLIRVLEGGVEGKKQVDKVIDKCASMQNLREAIANYRNSILRQSDEMK-REASLSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ S+  D         ++F  W+  RPE+ + ++  +R  P   
Sbjct  348   VEYLERYYSLICFAVYIHSER-DALRSSSFGHSSFADWMRARPELYSIIRRLLRRNPMGA  406

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  +R           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  407   LGYASPKPSPMRMAESADGRPHEMGVVAALRNGEVLGSQTVLKSDHCPGCQNPSLTERVD  466

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  467   GAPNFREV  474


 Score = 73.9 bits (180),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALRPVTNV  2075
             V ++  +CAGAGHLR+DI Y+ KEL KFPD DDE RA L+DMGI+ALR   N+
Sbjct  1169  VDIIIEKCAGAGHLRDDIHYYVKELWKFPDSDDEQRACLLDMGIKALRRYFNL  1221


 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR  + +Q  E + R  ALS   EYL
Sbjct  731  ITRLFDNGMECREALDAIIDRCSALQNIRQAVLQYRKVVNQQHVEPRVRRVALSRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  791  ERYFCLIAFAAYLGSE  806


 Score = 56.6 bits (135),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP-  295
             + E+A R G+Y  I SL RVL  G + K  VD +I++CA   +LR+ I  Y   + + P 
Sbjct  1139  SDEEAQRMGDYRDILSLTRVLVHGPKSKADVDIIIEKCAGAGHLRDDIHYYVKELWKFPD  1198

Query  296   -DEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
              D+ +R   L   ++ L RY  LI F  YL++ + +    +   + RP+
Sbjct  1199  SDDEQRACLLDMGIKALRRYFNLITFRSYLYSTKASKTKFTSWMDSRPE  1247


 Score = 53.9 bits (128),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 59/114 (52%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQY-RRLFNQQRTEPRERRVALNRG  1573
             +  +TR+  +G + +  +D II++C+   ++R  +  Y + L+    ++  +R   L+ G
Sbjct  1152  ILSLTRVLVHGPKSKADVDIIIEKCAGAGHLRDDIHYYVKELWKFPDSDDEQRACLLDMG  1211

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL S           S T F  W+  RPE++ +  ++R+
Sbjct  1212  IKALRRYFNLITFRSYLYSTK--------ASKTKFTSWMDSRPELRNLCNNLRI  1257



>ref|XP_004494491.1| PREDICTED: paladin-like [Cicer arietinum]
Length=1249

 Score =   485 bits (1248),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 228/293 (78%), Positives = 259/293 (88%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY+SLKPS     EST+GRPSEM  VAALR GEVLGSQTVLKSD
Sbjct  386   YSIIRRLLRRDPMGALGYSSLKPSLKKIAESTDGRPSEMGIVAALRKGEVLGSQTVLKSD  445

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +P LPER++GA NFR++PGFPV+GVANPT+ GI SVI RIGS+  GRP+ WHNM
Sbjct  446   HCPGCQNPCLPERVDGAPNFRKVPGFPVFGVANPTIDGIRSVIHRIGSTNGGRPILWHNM  505

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVE+MEARLK+DI+REA++Y  AIMV
Sbjct  506   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVEKMEARLKEDILREAKQYSSAIMV  565

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DG IFD+WEHV+S+ VQTPLEVFK LEA+GFP+KYAR+PITD KAPKSSDFDTLA
Sbjct  566   IHETDDGHIFDAWEHVTSNVVQTPLEVFKSLEADGFPVKYARVPITDGKAPKSSDFDTLA  625

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
              NIASA+K T  VFNCQMG GRTTTGTVIACLVKLRIDYGRPI++L D + +E
Sbjct  626   NNIASAAKDTTFVFNCQMGRGRTTTGTVIACLVKLRIDYGRPIKILGDNVTQE  678


 Score =   361 bits (927),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 186/217 (86%), Gaps = 2/217 (1%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE  G+V   AP  L+ +  +   H FGINDILLLWKIT  FDNGVECREALD IIDR
Sbjct  686   SGDEVGGYVT--APNNLQIKIDEKQKHVFGINDILLLWKITAFFDNGVECREALDGIIDR  743

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQA+LQYR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  744   CSALQNIRQALLQYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  803

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             C QGES  TFK WLHQRPEVQAMKWSIRLRPGRFFT+PEELR   E +HGDAVMEA VK 
Sbjct  804   CCQGESRMTFKVWLHQRPEVQAMKWSIRLRPGRFFTVPEELRESQESQHGDAVMEATVKA  863

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTS+HIQIHGAPHVYKV
Sbjct  864   RNGSVLGKGSILKMYFFPGQRTSNHIQIHGAPHVYKV  900


 Score =   206 bits (524),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NSIGR+     N  D MPNSE+AIRRGEY VIRSL+RVLEGGVEGK+QVDKVID+
Sbjct  248  GIPRSNSIGRIFQSMTNVADHMPNSEEAIRRGEYAVIRSLVRVLEGGVEGKRQVDKVIDK  307

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAI TYRNSILRQPDEMKREA+LSFFVEYLERY FLICF VYLH+ERD LH 
Sbjct  308  CASMQNLREAIGTYRNSILRQPDEMKREASLSFFVEYLERYYFLICFTVYLHSERDILHS  367

Query  410  TS  415
            ++
Sbjct  368  ST  369


 Score =   264 bits (675),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 173/238 (73%), Gaps = 3/238 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E ++V  +R G VLG +T+LKSDH PGC +  L  ++EGA N+R+     V+GVA PTV 
Sbjct  7     EPEEVMRMREGSVLGKKTILKSDHFPGCQNKRLSPQIEGAPNYRQAESLHVHGVAIPTVD  66

Query  693   GILSVIQRIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVE  872
             GI +V+  IG+  +   V W ++REE ++YING+PFVLR+VERP+ N LEYTGI+ ERVE
Sbjct  67    GIRNVLNHIGARLQ--QVLWISLREEPLVYINGRPFVLRDVERPFSN-LEYTGINRERVE  123

Query  873   RMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFP  1052
             +MEARLK+DI+ EAERY   I+V  E  DGQ+ D WE VS +SV+TPLEV++ L+AEG+ 
Sbjct  124   QMEARLKEDILLEAERYGNKILVTDELPDGQMVDQWEPVSCNSVKTPLEVYEELQAEGYL  183

Query  1053  IKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + Y R+PITD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV L
Sbjct  184   VDYERVPITDEKSPKELDFDILVHKISQADVNTEIIFNCQMGRGRTTTGMVIATLVYL  241


 Score =   128 bits (322),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 128/244 (52%), Gaps = 15/244 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     R+G VLG  ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  857   MEATVKARNGSVLGKGSILKMYFFPG-QRTSNHIQIHGAPHVYKVDEYPVYCMATPTISG  915

Query  696   ILSVIQRIGSSKE----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                +++ + S  +     R V   ++REE V+YIN  PFVLRE+ +P  + L++ GI   
Sbjct  916   AKEMLKYLDSKSKSAFTARKVILTDVREEAVVYINCVPFVLRELNKPV-DTLKHVGITGP  974

Query  864   RVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEVF  1025
              VE +EARLK+DI+ E  R  G  M++H       T    +   WE++ +D V+TP EV+
Sbjct  975   VVEHLEARLKEDILAEI-RQSGGRMLLHREEYDPSTNQSAVVGYWENIQADDVKTPTEVY  1033

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+ +G+ I Y RIP+T ++   +SD D  A+         + +F    G G       
Sbjct  1034  SLLKDDGYDIFYRRIPLTRERDALASDVD--AIQYCQDDSAGSYLFVSHTGFGGVAYAMA  1091

Query  1206  IACL  1217
             I C+
Sbjct  1092  IICI  1095


 Score = 59.3 bits (142),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 73/149 (49%), Gaps = 20/149 (13%)
 Frame = +2

Query  1316  PPYAPLILKTRP-KKDSSHEFGINDILL-------LWKITRLFDNGVECREALDAIIDRC  1471
             P + P    T P  K++SH    N+  L       +  +TR+  +G + +  +D +I+RC
Sbjct  1110  PSFGP---DTYPMTKENSHSRASNETALRMGDYRDILNLTRVLVHGPQSKADVDIVIERC  1166

Query  1472  SALQNIRQAVLQYRRLFNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             +   +IR  +L Y+R F +   +  E R  L + G + L RYF LI F +YL       +
Sbjct  1167  AGAGHIRDDILYYKREFEKFTDDDDEERAYLMDMGIKALRRYFFLITFRSYL-------Y  1219

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
             C    + T F  W+  RPE+  +  ++R+
Sbjct  1220  C-ISPADTEFAAWMDARPELDHLCNNLRI  1247


 Score = 78.6 bits (192),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  283   VIRSLVRVLEGGVEGKRQVDKVIDKCASMQNLREAIGTYRNSILRQPDEMK-REASLSFF  341

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRPG--  1744
              EYLERY+ LI F  YL S+  D         ++F  W+  RPE+ + ++  +R  P   
Sbjct  342   VEYLERYYFLICFTVYLHSER-DILHSSTAGHSSFSDWMRARPELYSIIRRLLRRDPMGA  400

Query  1745  -RFFTIPEELRTPHELKHG-DAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
               + ++   L+   E   G  + M  +   R G VLG  ++L     PG Q      ++ 
Sbjct  401   LGYSSLKPSLKKIAESTDGRPSEMGIVAALRKGEVLGSQTVLKSDHCPGCQNPCLPERVD  460

Query  1916  GAPHVYKV  1939
             GAP+  KV
Sbjct  461   GAPNFRKV  468


 Score = 77.8 bits (190),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGH+R+DI+Y+ +E +KF DDDDE RAYLMDMGI+ALR
Sbjct  1159  VDIVIERCAGAGHIRDDILYYKREFEKFTDDDDEERAYLMDMGIKALR  1206


 Score = 60.5 bits (145),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +2

Query  179  LEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*  355
             + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYLERY 
Sbjct  727  FDNGVECREALDGIIDRCSALQNIRQALLQYRKVFNQQHVEPRVRRVALNRGAEYLERYF  786

Query  356  FLICFAVYLHTE  391
             LI FA YL +E
Sbjct  787  RLIAFAAYLGSE  798


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD  298
             ++E A+R G+Y  I +L RVL  G + K  VD VI+RCA   ++R+ I  Y+    +  D
Sbjct  1129  SNETALRMGDYRDILNLTRVLVHGPQSKADVDIVIERCAGAGHIRDDILYYKREFEKFTD  1188

Query  299   EMKREAA--LSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
             +   E A  +   ++ L RY FLI F  YL+    A    +   + RP+
Sbjct  1189  DDDEERAYLMDMGIKALRRYFFLITFRSYLYCISPADTEFAAWMDARPE  1237



>ref|XP_011025295.1| PREDICTED: paladin isoform X2 [Populus euphratica]
Length=1083

 Score =   501 bits (1291),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/295 (81%), Positives = 267/295 (91%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRR+PMGALGYAS KPSP    ES +GRP EM  VAALR+GEVLGSQTVLKSD
Sbjct  392   YSIIRRLLRRNPMGALGYASPKPSPMRMAESADGRPHEMGVVAALRNGEVLGSQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +PSL ER++GA NFRE+PGFPVYGVANPT+ GILSVIQRIGSSK G PVFWHNM
Sbjct  452   HCPGCQNPSLTERVDGAPNFREVPGFPVYGVANPTIDGILSVIQRIGSSKGGCPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYING+PFVLREVERP+KNMLEYTGI  ERVERMEARLK+DI+REAERY GAIMV
Sbjct  512   REEPVIYINGEPFVLREVERPFKNMLEYTGIGRERVERMEARLKEDILREAERYGGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+SDS++TPLEVFKCL+ +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  572   IHETDDGQIFDAWEHVNSDSIKTPLEVFKCLDTDGFPIKYARVPITDGKAPKSSDFDTLA  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL +D  HEE+
Sbjct  632   MNIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLADDVNHEEV  686


 Score =   352 bits (903),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G        +   +   +    FGI+DILLLWKITRLFDNG+ECREALDAIIDR
Sbjct  692   SGEETGGDTDATTSDVGSLKTDMEQGRAFGIDDILLLWKITRLFDNGMECREALDAIIDR  751

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++ NQQ  EPR RRVAL+RGAEYLERYF LIAFAAYLGS+AFDGF
Sbjct  752   CSALQNIRQAVLQYRKVVNQQHVEPRVRRVALSRGAEYLERYFCLIAFAAYLGSEAFDGF  811

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLHQRPEVQA+KWSIRLRPGRFFT+PE LRTP E +HGDAVMEA V+ 
Sbjct  812   CGQGESRMTFKSWLHQRPEVQAIKWSIRLRPGRFFTVPEGLRTPQESQHGDAVMEATVRV  871

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAP+VYKV
Sbjct  872   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPNVYKV  908


 Score =   199 bits (505),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GI RTNS+GR+   G N  + +PNSEDA+RRGEY VIRSLIRVLEGGVEGKKQVDKVID+
Sbjct  254  GIQRTNSVGRIFDFGLNVNENLPNSEDALRRGEYAVIRSLIRVLEGGVEGKKQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIA YRNSILRQ DEMKREA+LSFFVEYLERY  LICFAVY+H+ERDAL  
Sbjct  314  CASMQNLREAIANYRNSILRQSDEMKREASLSFFVEYLERYYSLICFAVYIHSERDALRS  373

Query  410  TS  415
            +S
Sbjct  374  SS  375


 Score =   256 bits (654),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 165/240 (69%), Gaps = 3/240 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E ++V  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+    PV+GVA PT+ 
Sbjct  9     EPEKVMKLRGGSVLGKKTILKSDHFPGCQNKRLTPQIDGAPNYRQAESLPVHGVAIPTIE  68

Query  693   GILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             G  +VI+ I   K+G+   V W N+REE ++YING+PFVLR+VERP+ N LEYTGI+  R
Sbjct  69    GCRNVIKHIRGRKDGKQAQVLWFNLREEPLVYINGRPFVLRDVERPFSN-LEYTGINRSR  127

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE MEARLK+DI+ EA RY   I V  E  DGQ+ D WE VS DSV+TP+EV+  L+ EG
Sbjct  128   VEEMEARLKEDILMEAARYGNKIHVTDELPDGQMVDQWEPVSCDSVKTPVEVYGDLQVEG  187

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
                 Y R+PITD+K+P+  DFD L   I      T ++FNCQMG GRTTTG VIA LV L
Sbjct  188   HLYDYERVPITDEKSPEEQDFDILVDRIYQTDLNTDIIFNCQMGRGRTTTGMVIATLVYL  247


 Score =   127 bits (318),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 119/212 (56%), Gaps = 14/212 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+    +R+G VLG  ++LK    PG    S   ++ GA N  ++ G+PVY +A PT++G
Sbjct  865   MEATVRVRNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPNVYKVDGYPVYSMATPTIAG  923

Query  696   ILSVIQ------RIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                V+       +IG S   + V   ++REE  +YING PFV RE+ +P  + L++ GI 
Sbjct  924   AKEVLAYLKAKPKIGGSL-AQKVILTDLREEAAVYINGTPFVPRELNKPV-DTLKHVGIT  981

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHETAD-----GQIFDSWEHVSSDSVQTPLEV  1022
                +E MEARLK+DI+ E  R  G +++  E  D       I   WE++S+D V+TP EV
Sbjct  982   GPVLELMEARLKEDIVSEIRRSGGRLLLHREEYDPATNQSCIIGYWENISADDVKTPAEV  1041

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTL  1118
             +  L+ EG+ + Y RIP+  +    +SD D +
Sbjct  1042  YAGLKDEGYDMTYRRIPLASETEALASDVDAI  1073


 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE ++ +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  289   VIRSLIRVLEGGVEGKKQVDKVIDKCASMQNLREAIANYRNSILRQSDEMK-REASLSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ S+  D         ++F  W+  RPE+ + ++  +R  P   
Sbjct  348   VEYLERYYSLICFAVYIHSER-DALRSSSFGHSSFADWMRARPELYSIIRRLLRRNPMGA  406

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  +R           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  407   LGYASPKPSPMRMAESADGRPHEMGVVAALRNGEVLGSQTVLKSDHCPGCQNPSLTERVD  466

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  467   GAPNFREV  474


 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR  + +Q  E + R  ALS   EYL
Sbjct  731  ITRLFDNGMECREALDAIIDRCSALQNIRQAVLQYRKVVNQQHVEPRVRRVALSRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  791  ERYFCLIAFAAYLGSE  806



>gb|KDO86721.1| hypothetical protein CISIN_1g0008351mg [Citrus sinensis]
Length=1127

 Score =   493 bits (1268),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 238/295 (81%), Positives = 262/295 (89%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA++KPS     ES +GRP EM  VAALR+G+VLGSQTVLKSD
Sbjct  262   YSIIRRLLRRDPMGALGYANVKPSLMKMAESADGRPHEMGVVAALRNGQVLGSQTVLKSD  321

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+ GFPVYGVANPT+ GI SVI+RIG  K   PVFWHNM
Sbjct  322   HCPGCQNQSLPERVEGAPNFREVSGFPVYGVANPTIDGIRSVIRRIGHFKGCCPVFWHNM  381

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  382   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAERYGGAIMV  441

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHVSS+SVQTPLEVFKCLE +GFPIKYAR+PITD KAPK+SDFD LA
Sbjct  442   IHETNDGQIFDAWEHVSSESVQTPLEVFKCLEDDGFPIKYARVPITDGKAPKTSDFDMLA  501

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLN-DALHEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL+ D  HEEL
Sbjct  502   VNIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLHEDVTHEEL  556


 Score =   353 bits (906),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 185/217 (85%), Gaps = 1/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G+       I K R  +     FGI+DILLLWKITRLFDNGV+CREALDAIIDR
Sbjct  562   SGEENGGNGAASTSSISKVR-SEGKGRAFGIDDILLLWKITRLFDNGVKCREALDAIIDR  620

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIR+AVL YR++FNQQ  EPR R VAL+RGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  621   CSALQNIREAVLHYRKVFNQQHVEPRVRMVALSRGAEYLERYFRLIAFAAYLGSEAFDGF  680

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WL QRPEVQAMKWSIR+RPGRF T+PEELR P E +HGDAVMEAIV+ 
Sbjct  681   CGQGESRMTFKSWLRQRPEVQAMKWSIRIRPGRFLTVPEELRAPQESQHGDAVMEAIVRA  740

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  741   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  777


 Score =   206 bits (523),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGRV   G++  D +PNSE+AIRRGEY VIRSL RVLEGGVEGK+QVDKVID+
Sbjct  124  GIPRTNSIGRVFDSGSSVADNLPNSEEAIRRGEYAVIRSLTRVLEGGVEGKRQVDKVIDK  183

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKR+A+LSFFVEYLERY FLICFAVY+HTER AL  
Sbjct  184  CASMQNLREAIATYRNSILRQPDEMKRQASLSFFVEYLERYYFLICFAVYIHTERAALCS  243

Query  410  TS  415
            +S
Sbjct  244  SS  245


 Score =   139 bits (351),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 130/245 (53%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT+SG
Sbjct  734   MEAIVRARNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDGYPVYSMATPTISG  792

Query  696   ILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  +      + V   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  793   AKEMLAYLGAKTKTEGSFSQKVILTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGITG  851

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G  M++H       +    +   WE++ +D V+TP EV
Sbjct  852   PVVEHMEARLKEDILTEV-RQSGGRMLLHREEYNPASNQSSVVGYWENIFADDVKTPAEV  910

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T ++   +SD D  A+           +F    G G      
Sbjct  911   YAALQDEGYNITYRRIPLTRERDALASDID--AIQYCKDDSAGCYLFVSHTGFGGVAYAM  968

Query  1203  VIACL  1217
              I CL
Sbjct  969   AIICL  973


 Score = 55.8 bits (133),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 70/146 (48%), Gaps = 15/146 (10%)
 Frame = +2

Query  1313  VPPYAPLI----LKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSAL  1480
             V P+ PL     L +    + +H+ G  D   +  +TR+   G + +  +D II+RC+  
Sbjct  990   VGPHLPLTYEENLPSWASDEEAHKMG--DYRDILNLTRVLVYGPQSKADVDTIIERCAGA  1047

Query  1481  QNIRQAVLQYRRLFNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQ  1657
              ++R  +L Y     +   E  E+R  L + G + L RYF LI F ++L       +C  
Sbjct  1048  GHLRDDILHYSEELKKFSNEYDEQRAYLMDIGIKALRRYFFLITFRSFL-------YC-T  1099

Query  1658  GESMTTFKHWLHQRPEVQAMKWSIRL  1735
               +   FK W+  RPE+  +  +IR+
Sbjct  1100  SPAEINFKSWMDGRPELGHLCNNIRI  1125


 Score =   134 bits (336),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = +3

Query  876   MEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPI  1055
             MEARLK+DI+ EA R+   I+V  E  DGQ+ D WE VS DSV+ PL+V++ L+ EG+ +
Sbjct  1     MEARLKEDIIMEAARFGNKILVTDELPDGQMVDQWEPVSCDSVKAPLDVYEELQVEGYLV  60

Query  1056  KYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
              Y R+P+TD+K+PK  DFD L   I+     T ++FNCQMG GRTTTG VIA LV L
Sbjct  61    DYERVPVTDEKSPKEQDFDILVDKISQTDLNTEVIFNCQMGRGRTTTGMVIATLVYL  117


 Score = 87.4 bits (215),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 97/188 (52%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  +TR+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R+ +L+  
Sbjct  159   VIRSLTRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-RQASLSFF  217

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ ++     C      ++F  W+  RPE+ + ++  +R  P   
Sbjct  218   VEYLERYYFLICFAVYIHTER-AALCSSSFGHSSFADWMKARPELYSIIRRLLRRDPMGA  276

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  277   LGYANVKPSLMKMAESADGRPHEMGVVAALRNGQVLGSQTVLKSDHCPGCQNQSLPERVE  336

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  337   GAPNFREV  344


 Score = 70.5 bits (171),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHLR+DI+++++ELKKF ++ DE RAYLMD+GI+ALR
Sbjct  1037  VDTIIERCAGAGHLRDDILHYSEELKKFSNEYDEQRAYLMDIGIKALR  1084


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 10/115 (9%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G   T+SI +V S G            A    +  ++  + R+ + GV+ ++ +D +IDR
Sbjct  570  GAASTSSISKVRSEGKGR---------AFGIDDILLLWKITRLFDNGVKCREALDAIIDR  620

Query  230  CASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            C+++QN+REA+  YR    +Q  E + R  ALS   EYLERY  LI FA YL +E
Sbjct  621  CSALQNIREAVLHYRKVFNQQHVEPRVRMVALSRGAEYLERYFRLIAFAAYLGSE  675



>gb|KDO86718.1| hypothetical protein CISIN_1g0008351mg, partial [Citrus sinensis]
 gb|KDO86719.1| hypothetical protein CISIN_1g0008351mg, partial [Citrus sinensis]
Length=1136

 Score =   492 bits (1267),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 238/295 (81%), Positives = 262/295 (89%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA++KPS     ES +GRP EM  VAALR+G+VLGSQTVLKSD
Sbjct  271   YSIIRRLLRRDPMGALGYANVKPSLMKMAESADGRPHEMGVVAALRNGQVLGSQTVLKSD  330

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+ GFPVYGVANPT+ GI SVI+RIG  K   PVFWHNM
Sbjct  331   HCPGCQNQSLPERVEGAPNFREVSGFPVYGVANPTIDGIRSVIRRIGHFKGCCPVFWHNM  390

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  391   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAERYGGAIMV  450

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHVSS+SVQTPLEVFKCLE +GFPIKYAR+PITD KAPK+SDFD LA
Sbjct  451   IHETNDGQIFDAWEHVSSESVQTPLEVFKCLEDDGFPIKYARVPITDGKAPKTSDFDMLA  510

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLN-DALHEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL+ D  HEEL
Sbjct  511   VNIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLHEDVTHEEL  565


 Score =   353 bits (906),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 185/217 (85%), Gaps = 1/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G+       I K R  +     FGI+DILLLWKITRLFDNGV+CREALDAIIDR
Sbjct  571   SGEENGGNGAASTSSISKVR-SEGKGRAFGIDDILLLWKITRLFDNGVKCREALDAIIDR  629

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIR+AVL YR++FNQQ  EPR R VAL+RGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  630   CSALQNIREAVLHYRKVFNQQHVEPRVRMVALSRGAEYLERYFRLIAFAAYLGSEAFDGF  689

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WL QRPEVQAMKWSIR+RPGRF T+PEELR P E +HGDAVMEAIV+ 
Sbjct  690   CGQGESRMTFKSWLRQRPEVQAMKWSIRIRPGRFLTVPEELRAPQESQHGDAVMEAIVRA  749

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  750   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  786


 Score =   206 bits (523),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGRV   G++  D +PNSE+AIRRGEY VIRSL RVLEGGVEGK+QVDKVID+
Sbjct  133  GIPRTNSIGRVFDSGSSVADNLPNSEEAIRRGEYAVIRSLTRVLEGGVEGKRQVDKVIDK  192

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKR+A+LSFFVEYLERY FLICFAVY+HTER AL  
Sbjct  193  CASMQNLREAIATYRNSILRQPDEMKRQASLSFFVEYLERYYFLICFAVYIHTERAALCS  252

Query  410  TS  415
            +S
Sbjct  253  SS  254


 Score =   139 bits (350),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 130/245 (53%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT+SG
Sbjct  743   MEAIVRARNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDGYPVYSMATPTISG  801

Query  696   ILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  +      + V   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  802   AKEMLAYLGAKTKTEGSFSQKVILTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGITG  860

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G  M++H       +    +   WE++ +D V+TP EV
Sbjct  861   PVVEHMEARLKEDILTEV-RQSGGRMLLHREEYNPASNQSSVVGYWENIFADDVKTPAEV  919

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T ++   +SD D  A+           +F    G G      
Sbjct  920   YAALQDEGYNITYRRIPLTRERDALASDID--AIQYCKDDSAGCYLFVSHTGFGGVAYAM  977

Query  1203  VIACL  1217
              I CL
Sbjct  978   AIICL  982


 Score = 55.8 bits (133),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 70/146 (48%), Gaps = 15/146 (10%)
 Frame = +2

Query  1313  VPPYAPLI----LKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSAL  1480
             V P+ PL     L +    + +H+ G  D   +  +TR+   G + +  +D II+RC+  
Sbjct  999   VGPHLPLTYEENLPSWASDEEAHKMG--DYRDILNLTRVLVYGPQSKADVDTIIERCAGA  1056

Query  1481  QNIRQAVLQYRRLFNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQ  1657
              ++R  +L Y     +   E  E+R  L + G + L RYF LI F ++L       +C  
Sbjct  1057  GHLRDDILHYSEELKKFSNEYDEQRAYLMDIGIKALRRYFFLITFRSFL-------YC-T  1108

Query  1658  GESMTTFKHWLHQRPEVQAMKWSIRL  1735
               +   FK W+  RPE+  +  +IR+
Sbjct  1109  SPAEINFKSWMDGRPELGHLCNNIRI  1134


 Score =   142 bits (358),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 89/126 (71%), Gaps = 0/126 (0%)
 Frame = +3

Query  849   GIDCERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFK  1028
             GI+  RVE+MEARLK+DI+ EA R+   I+V  E  DGQ+ D WE VS DSV+ PL+V++
Sbjct  1     GINRARVEQMEARLKEDIIMEAARFGNKILVTDELPDGQMVDQWEPVSCDSVKAPLDVYE  60

Query  1029  CLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVI  1208
              L+ EG+ + Y R+P+TD+K+PK  DFD L   I+     T ++FNCQMG GRTTTG VI
Sbjct  61    ELQVEGYLVDYERVPVTDEKSPKEQDFDILVDKISQTDLNTEVIFNCQMGRGRTTTGMVI  120

Query  1209  ACLVKL  1226
             A LV L
Sbjct  121   ATLVYL  126


 Score = 87.4 bits (215),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 97/188 (52%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  +TR+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R+ +L+  
Sbjct  168   VIRSLTRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-RQASLSFF  226

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ ++     C      ++F  W+  RPE+ + ++  +R  P   
Sbjct  227   VEYLERYYFLICFAVYIHTERA-ALCSSSFGHSSFADWMKARPELYSIIRRLLRRDPMGA  285

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  286   LGYANVKPSLMKMAESADGRPHEMGVVAALRNGQVLGSQTVLKSDHCPGCQNQSLPERVE  345

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  346   GAPNFREV  353


 Score = 70.5 bits (171),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHLR+DI+++++ELKKF ++ DE RAYLMD+GI+ALR
Sbjct  1046  VDTIIERCAGAGHLRDDILHYSEELKKFSNEYDEQRAYLMDIGIKALR  1093


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 10/115 (9%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G   T+SI +V S G            A    +  ++  + R+ + GV+ ++ +D +IDR
Sbjct  579  GAASTSSISKVRSEGKGR---------AFGIDDILLLWKITRLFDNGVKCREALDAIIDR  629

Query  230  CASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            C+++QN+REA+  YR    +Q  E + R  ALS   EYLERY  LI FA YL +E
Sbjct  630  CSALQNIREAVLHYRKVFNQQHVEPRVRMVALSRGAEYLERYFRLIAFAAYLGSE  684



>ref|XP_008458276.1| PREDICTED: paladin [Cucumis melo]
Length=1254

 Score =   498 bits (1282),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 238/295 (81%), Positives = 264/295 (89%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYASLKP+     ES +GRPSEM  VAALR+GEVLGS TVLKSD
Sbjct  390   YSIIRRLLRRDPMGALGYASLKPTLMKIAESADGRPSEMGVVAALRNGEVLGSLTVLKSD  449

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+RIGSS+ GRP+FWHNM
Sbjct  450   HCPGCQNQSLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIRRIGSSEGGRPIFWHNM  509

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  510   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAERYRGAIMV  569

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET +GQI+D+WEHVSS+SVQTP EVFK LE +GFPIKYAR+PITD KAPKSSDFD LA
Sbjct  570   IHETDNGQIYDTWEHVSSESVQTPFEVFKRLECDGFPIKYARVPITDGKAPKSSDFDALA  629

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV-LNDALHEEL  1283
             LNI SASK TA VFNCQMGIGRTTTGTVIACL+KLR+DYGRPI+V LN   HEE+
Sbjct  630   LNIVSASKDTAFVFNCQMGIGRTTTGTVIACLLKLRMDYGRPIKVLLNKKTHEEV  684


 Score =   347 bits (890),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 185/218 (85%), Gaps = 3/218 (1%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             S DE        +P I   + +K+ S  FGINDILLLWKITRLFDNG+ECREALDAIIDR
Sbjct  689   SSDEDSETNAAVSPSIYTVK-EKNESRVFGINDILLLWKITRLFDNGMECREALDAIIDR  747

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQ   EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDG 
Sbjct  748   CSALQNIRQAVLQYRKVFNQH-VEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGI  806

Query  1649  CGQGESM-TTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVK  1825
             CGQGE    TFK+WLHQRPEVQAMKWSIRLRPGRFFT+PE LR  HE +HGDAVMEA+VK
Sbjct  807   CGQGERRGMTFKNWLHQRPEVQAMKWSIRLRPGRFFTVPEALRAQHESQHGDAVMEAVVK  866

Query  1826  DRNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
              R GSVLGKGSIL MYFFPGQRTSS+IQIHGAPHV+KV
Sbjct  867   ARCGSVLGKGSILKMYFFPGQRTSSYIQIHGAPHVFKV  904


 Score =   206 bits (525),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GI RTNSIG+VS C AN  D +PNSE+AIRRGEY VIRSL RVLEGG EGK+QVD+VID+
Sbjct  252  GIARTNSIGKVSDCSANVDDNLPNSEEAIRRGEYAVIRSLTRVLEGGAEGKRQVDEVIDK  311

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQ DEMKREAALSFFVEYLERY FLICFAVY+H+ER AL  
Sbjct  312  CASMQNLREAIATYRNSILRQADEMKREAALSFFVEYLERYYFLICFAVYIHSERSALRS  371

Query  410  TS  415
            TS
Sbjct  372  TS  373


 Score =   274 bits (700),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/242 (55%), Positives = 173/242 (71%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E + V   R G VLG +T+LKSDH PGC +  L  +++GA N+R+     VYGVA PT
Sbjct  5     PKEPEHVMKFRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQASSLQVYGVAIPT  64

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V++ +G+ K+G+   V W N+REE V+YING+PFVLR+VERP+ N LEYTGID 
Sbjct  65    ILGIQNVLKHVGAQKDGQQAQVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGIDR  123

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DS++TPLEV++ L+ 
Sbjct  124   ARVEQMEARLKEDILIEASRYGNKILVTDEMPDGQMVDQWELVSHDSIKTPLEVYEELQV  183

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG  + Y R+P+TD+K+PK SDFD L   I+     TA++FNCQMG GRTTTG VIA LV
Sbjct  184   EGVHVDYERVPVTDEKSPKESDFDILVRKISQVDINTAIIFNCQMGRGRTTTGMVIATLV  243

Query  1221  KL  1226
              L
Sbjct  244   YL  245


 Score =   125 bits (313),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 77/243 (32%), Positives = 126/243 (52%), Gaps = 13/243 (5%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ V   R G VLG  ++LK    PG    S  + + GA +  ++ G+PVY +  PT++G
Sbjct  861   MEAVVKARCGSVLGKGSILKMYFFPGQRTSSYIQ-IHGAPHVFKVDGYPVYSMGTPTITG  919

Query  696   ILSVIQRIGSSKE----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  + +  E       V   ++REE V+YIN  PFVLRE+ +P+ + L++ GI   
Sbjct  920   AREMLAYLRTKLEVDTSTLNVTIIDLREEAVVYINDTPFVLRELNKPF-DTLKHAGITGP  978

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEVFK  1028
              VE MEARLK+DI+ E ++  G +++  E     +    +   WE + +D V+TP EV+ 
Sbjct  979   VVEHMEARLKEDILSEIKQSGGRMLLHREEYNPSSNQSNVIGYWESIFADDVKTPAEVYA  1038

Query  1029  CLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVI  1208
              L+ EG  + Y R+P+T ++   +SD D  A+     +     +F    G G       I
Sbjct  1039  HLKDEGHNVAYKRVPLTREREALASDVD--AIQFCKDNSAGCYLFVSHTGFGGAAYAMAI  1096

Query  1209  ACL  1217
              C+
Sbjct  1097  LCI  1099


 Score = 83.2 bits (204),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 94/188 (50%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  +TR+ + G E +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  AL+  
Sbjct  287   VIRSLTRVLEGGAEGKRQVDEVIDKCASMQNLREAIATYRNSILRQADEMK-REAALSFF  345

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ S+             +F  W+  RPE+ + ++  +R  P   
Sbjct  346   VEYLERYYFLICFAVYIHSER-SALRSTSYGHCSFAEWMKARPELYSIIRRLLRRDPMGA  404

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++         + M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  405   LGYASLKPTLMKIAESADGRPSEMGVVAALRNGEVLGSLTVLKSDHCPGCQNQSLPERVE  464

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  465   GAPNFREV  472


 Score = 81.3 bits (199),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGHLR+DI+Y+ KELKKFP  DD+HRAYLMDMGI+ALR
Sbjct  1164  VDIVIDRCAGAGHLRDDILYYCKELKKFPAYDDDHRAYLMDMGIKALR  1211


 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLE  346
            + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR    +  +   R  AL+   EYLE
Sbjct  727  ITRLFDNGMECREALDAIIDRCSALQNIRQAVLQYRKVFNQHVEPRVRRVALNRGAEYLE  786

Query  347  RY*FLICFAVYLHTE  391
            RY  LI FA YL +E
Sbjct  787  RYFRLIAFAAYLGSE  801


 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 70/132 (53%), Gaps = 4/132 (3%)
 Frame = +2

Query  53    IPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRC  232
             IP+T +   +S    ++     + E+A + G+Y  I SL RVL  G + K  VD VIDRC
Sbjct  1112  IPQTMTNTELSYAYEDSLHAQASEEEAFKIGDYRDILSLTRVLMYGPKSKADVDIVIDRC  1171

Query  233   ASMQNLREAIATYRNSILRQP--DEMKREAALSFFVEYLERY*FLICFAVYLH-TERDAL  403
             A   +LR+ I  Y   + + P  D+  R   +   ++ L RY FLI F  YL+ T+ + +
Sbjct  1172  AGAGHLRDDILYYCKELKKFPAYDDDHRAYLMDMGIKALRRYFFLITFRSYLYCTKAEEM  1231

Query  404   HPTSQVAEKRPD  439
               TS + E RP+
Sbjct  1232  KFTSWMKE-RPE  1242


 Score = 56.6 bits (135),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 61/122 (50%), Gaps = 9/122 (7%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQY-RRLFNQQRTEPRE  1549
             F I D   +  +TR+   G + +  +D +IDRC+   ++R  +L Y + L      +   
Sbjct  1139  FKIGDYRDILSLTRVLMYGPKSKADVDIVIDRCAGAGHLRDDILYYCKELKKFPAYDDDH  1198

Query  1550  RRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSI  1729
             R   ++ G + L RYF LI F +YL       +C + E M  F  W+ +RPE+  +  ++
Sbjct  1199  RAYLMDMGIKALRRYFFLITFRSYL-------YCTKAEEM-KFTSWMKERPELGHLCNNL  1250

Query  1730  RL  1735
             R+
Sbjct  1251  RI  1252



>ref|XP_006491438.1| PREDICTED: paladin-like isoform X3 [Citrus sinensis]
Length=1127

 Score =   491 bits (1265),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 237/295 (80%), Positives = 262/295 (89%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA++KPS     ES +GRP EM  VAALR+G+VLGSQTVLKSD
Sbjct  262   YSIIRRLLRRDPMGALGYANVKPSLMKMAESADGRPHEMGVVAALRNGQVLGSQTVLKSD  321

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+ GFPVYGVANPT+ GI SVI+RIG  K   PVFWHNM
Sbjct  322   HCPGCQNQSLPERVEGAPNFREVSGFPVYGVANPTIDGIRSVIRRIGHFKGCCPVFWHNM  381

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARL++DI+REAERY GAIMV
Sbjct  382   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLREDILREAERYGGAIMV  441

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHVSS+SVQTPLEVFKCLE +GFPIKYAR+PITD KAPK+SDFD LA
Sbjct  442   IHETNDGQIFDAWEHVSSESVQTPLEVFKCLEDDGFPIKYARVPITDGKAPKTSDFDMLA  501

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLN-DALHEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL+ D  HEEL
Sbjct  502   VNIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLHEDVTHEEL  556


 Score =   353 bits (906),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 185/217 (85%), Gaps = 1/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G+       I K R  +     FGI+DILLLWKITRLFDNGV+CREALDAIIDR
Sbjct  562   SGEENGGNGAASTSSISKVR-SEGKGRAFGIDDILLLWKITRLFDNGVKCREALDAIIDR  620

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIR+AVL YR++FNQQ  EPR R VAL+RGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  621   CSALQNIREAVLHYRKVFNQQHVEPRVRMVALSRGAEYLERYFRLIAFAAYLGSEAFDGF  680

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WL QRPEVQAMKWSIR+RPGRF T+PEELR P E +HGDAVMEAIV+ 
Sbjct  681   CGQGESRMTFKSWLRQRPEVQAMKWSIRIRPGRFLTVPEELRAPQESQHGDAVMEAIVRA  740

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  741   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  777


 Score =   206 bits (525),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGRV   G++  D +PNSE+AIRRGEY VIRSL RVLEGGVEGK+QVDKVID+
Sbjct  124  GIPRTNSIGRVFDSGSSVADNLPNSEEAIRRGEYAVIRSLTRVLEGGVEGKRQVDKVIDK  183

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKR+A+LSFFVEYLERY FLICFAVY+HTER AL  
Sbjct  184  CASMQNLREAIATYRNSILRQPDEMKRQASLSFFVEYLERYYFLICFAVYIHTERAALRS  243

Query  410  TS  415
            +S
Sbjct  244  SS  245


 Score =   139 bits (351),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 130/245 (53%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT+SG
Sbjct  734   MEAIVRARNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDGYPVYSMATPTISG  792

Query  696   ILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  +      + V   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  793   AKEMLAYLGAKTKTEGSFSQKVILTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGITG  851

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G  M++H       +    +   WE++ +D V+TP EV
Sbjct  852   PVVEHMEARLKEDILTEV-RQSGGRMLLHREEYNPASNQSSVVGYWENIFADDVKTPAEV  910

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T ++   +SD D  A+           +F    G G      
Sbjct  911   YAALQDEGYNITYRRIPLTRERDALASDID--AIQYCKDDSAGCYLFVSHTGFGGVAYAM  968

Query  1203  VIACL  1217
              I CL
Sbjct  969   AIICL  973


 Score = 55.8 bits (133),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 70/146 (48%), Gaps = 15/146 (10%)
 Frame = +2

Query  1313  VPPYAPLI----LKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSAL  1480
             V P+ PL     L +    + +H+ G  D   +  +TR+   G + +  +D II+RC+  
Sbjct  990   VGPHLPLTYEENLPSWASDEEAHKMG--DYRDILNLTRVLVYGPQSKADVDTIIERCAGA  1047

Query  1481  QNIRQAVLQYRRLFNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQ  1657
              ++R  +L Y     +   E  E+R  L + G + L RYF LI F ++L       +C  
Sbjct  1048  GHLRDDILHYSEELKKFSNEYDEQRAYLMDIGIKALRRYFFLITFRSFL-------YC-T  1099

Query  1658  GESMTTFKHWLHQRPEVQAMKWSIRL  1735
               +   FK W+  RPE+  +  +IR+
Sbjct  1100  SPAEINFKSWMDGRPELGHLCNNIRI  1125


 Score =   134 bits (337),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = +3

Query  876   MEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPI  1055
             MEARLK+DI+ EA R+   I+V  E  DGQ+ D WE VS DSV+ PL+V++ L+ EG+ +
Sbjct  1     MEARLKEDIIMEAARFGNKILVTDELPDGQMVDQWEPVSCDSVKAPLDVYEELQVEGYLV  60

Query  1056  KYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
              Y R+P+TD+K+PK  DFD L   I+     T ++FNCQMG GRTTTG VIA LV L
Sbjct  61    DYERVPVTDEKSPKEQDFDILVDKISQTDLNTEVIFNCQMGRGRTTTGMVIATLVYL  117


 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  +TR+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R+ +L+  
Sbjct  159   VIRSLTRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-RQASLSFF  217

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ ++            ++F  W+  RPE+ + ++  +R  P   
Sbjct  218   VEYLERYYFLICFAVYIHTER-AALRSSSFGHSSFADWMKARPELYSIIRRLLRRDPMGA  276

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  277   LGYANVKPSLMKMAESADGRPHEMGVVAALRNGQVLGSQTVLKSDHCPGCQNQSLPERVE  336

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  337   GAPNFREV  344


 Score = 70.5 bits (171),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHLR+DI+++++ELKKF ++ DE RAYLMD+GI+ALR
Sbjct  1037  VDTIIERCAGAGHLRDDILHYSEELKKFSNEYDEQRAYLMDIGIKALR  1084


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 10/115 (9%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G   T+SI +V S G            A    +  ++  + R+ + GV+ ++ +D +IDR
Sbjct  570  GAASTSSISKVRSEGKGR---------AFGIDDILLLWKITRLFDNGVKCREALDAIIDR  620

Query  230  CASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            C+++QN+REA+  YR    +Q  E + R  ALS   EYLERY  LI FA YL +E
Sbjct  621  CSALQNIREAVLHYRKVFNQQHVEPRVRMVALSRGAEYLERYFRLIAFAAYLGSE  675



>ref|XP_006444662.1| hypothetical protein CICLE_v10018541mg [Citrus clementina]
 gb|ESR57902.1| hypothetical protein CICLE_v10018541mg [Citrus clementina]
Length=1254

 Score =   492 bits (1266),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 238/295 (81%), Positives = 262/295 (89%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA++KPS     ES +GRP EM  VAALR+G+VLGSQTVLKSD
Sbjct  389   YSIIRRLLRRDPMGALGYANVKPSLMKMAESADGRPHEMGVVAALRNGQVLGSQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+ GFPVYGVANPT+ GI SVI+RIG  K   PVFWHNM
Sbjct  449   HCPGCQNQSLPERVEGAPNFREVSGFPVYGVANPTIDGIRSVIRRIGHFKGCCPVFWHNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  509   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAERYGGAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHVSS+SVQTPLEVFKCLE +GFPIKYAR+PITD KAPK+SDFD LA
Sbjct  569   IHETNDGQIFDAWEHVSSESVQTPLEVFKCLEDDGFPIKYARVPITDGKAPKTSDFDMLA  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLN-DALHEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL+ D  HEEL
Sbjct  629   VNIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLHEDVTHEEL  683


 Score =   353 bits (905),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 185/217 (85%), Gaps = 1/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G+       I K R  +     FGI+DILLLWKITRLFDNGV+CREALDAIIDR
Sbjct  689   SGEENGGNGAASTSSISKVR-SEGKGRAFGIDDILLLWKITRLFDNGVKCREALDAIIDR  747

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIR+AVL YR++FNQQ  EPR R VAL+RGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  748   CSALQNIREAVLHYRKVFNQQHVEPRVRMVALSRGAEYLERYFRLIAFAAYLGSEAFDGF  807

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WL QRPEVQAMKWSIR+RPGRF T+PEELR P E +HGDAVMEAIV+ 
Sbjct  808   CGQGESRMTFKSWLRQRPEVQAMKWSIRIRPGRFLTVPEELRAPQESQHGDAVMEAIVRA  867

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  868   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  904


 Score =   206 bits (523),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGRV   G++  D +PNSE+AIRRGEY VIRSL RVLEGGVEGK+QVDKVID+
Sbjct  251  GIPRTNSIGRVFDSGSSVADNLPNSEEAIRRGEYAVIRSLTRVLEGGVEGKRQVDKVIDK  310

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKR+A+LSFFVEYLERY FLICFAVY+HTER AL  
Sbjct  311  CASMQNLREAIATYRNSILRQPDEMKRQASLSFFVEYLERYYFLICFAVYIHTERAALCS  370

Query  410  TS  415
            +S
Sbjct  371  SS  372


 Score =   258 bits (659),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 171/240 (71%), Gaps = 3/240 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E +QV  +R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT+ 
Sbjct  6     EPEQVLKMRGGSVLGKRTILKSDHFPGCQNKRLTPQIDGAPNYRQADSLRVHGVAIPTIE  65

Query  693   GILSVIQRIGSSKEGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             GI +V++ IG+ K+G+   V W ++REE V+YING+PFVLR+V RP+ N LEYTGI+  R
Sbjct  66    GIRNVLKHIGAQKDGKRVQVLWISLREEPVVYINGRPFVLRDVGRPFSN-LEYTGINRAR  124

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE+MEARLK+DI+ EA R+   I+V  E  DGQ+ D WE VS DSV+ PL+V++ L+ EG
Sbjct  125   VEQMEARLKEDIIMEAARFGNKILVTDELPDGQMVDQWEPVSCDSVKAPLDVYEELQVEG  184

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + + Y R+P+TD+K+PK  DFD L   I+     T ++FNCQMG GRTTTG VIA LV L
Sbjct  185   YLVDYERVPVTDEKSPKEQDFDILVDKISQTDLNTEVIFNCQMGRGRTTTGMVIATLVYL  244


 Score =   139 bits (350),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 130/245 (53%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT+SG
Sbjct  861   MEAIVRARNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDGYPVYSMATPTISG  919

Query  696   ILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  +      + V   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  920   AKEMLAYLGAKTKTEGSFSQKVILTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGITG  978

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G  M++H       +    +   WE++ +D V+TP EV
Sbjct  979   PVVEHMEARLKEDILTEV-RQSGGRMLLHREEYNPASNQSSVVGYWENIFADDVKTPAEV  1037

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T ++   +SD D  A+           +F    G G      
Sbjct  1038  YTALQDEGYNITYRRIPLTRERDALASDID--AIQYCKDDSAGCYLFVSHTGFGGVAYAM  1095

Query  1203  VIACL  1217
              I CL
Sbjct  1096  AIICL  1100


 Score = 55.8 bits (133),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 70/146 (48%), Gaps = 15/146 (10%)
 Frame = +2

Query  1313  VPPYAPLI----LKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSAL  1480
             V P+ PL     L +    + +H+ G  D   +  +TR+   G + +  +D II+RC+  
Sbjct  1117  VGPHLPLTYEENLPSWASDEEAHKMG--DYRDILNLTRVLVYGPQSKADVDTIIERCAGA  1174

Query  1481  QNIRQAVLQYRRLFNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQ  1657
              ++R  +L Y     +   E  E+R  L + G + L RYF LI F ++L       +C  
Sbjct  1175  GHLRDDILHYSEELKKFSNEYDEQRAYLMDIGIKALRRYFFLITFRSFL-------YC-T  1226

Query  1658  GESMTTFKHWLHQRPEVQAMKWSIRL  1735
               +   FK W+  RPE+  +  +IR+
Sbjct  1227  SPAEINFKSWMDGRPELGHLCNNIRI  1252


 Score = 87.4 bits (215),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 97/188 (52%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  +TR+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R+ +L+  
Sbjct  286   VIRSLTRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-RQASLSFF  344

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ ++     C      ++F  W+  RPE+ + ++  +R  P   
Sbjct  345   VEYLERYYFLICFAVYIHTERA-ALCSSSFGHSSFADWMKARPELYSIIRRLLRRDPMGA  403

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  404   LGYANVKPSLMKMAESADGRPHEMGVVAALRNGQVLGSQTVLKSDHCPGCQNQSLPERVE  463

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  464   GAPNFREV  471


 Score = 70.5 bits (171),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHLR+DI+++++ELKKF ++ DE RAYLMD+GI+ALR
Sbjct  1164  VDTIIERCAGAGHLRDDILHYSEELKKFSNEYDEQRAYLMDIGIKALR  1211


 Score = 64.3 bits (155),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 10/115 (9%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G   T+SI +V S G            A    +  ++  + R+ + GV+ ++ +D +IDR
Sbjct  697  GAASTSSISKVRSEGKGR---------AFGIDDILLLWKITRLFDNGVKCREALDAIIDR  747

Query  230  CASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            C+++QN+REA+  YR    +Q  E + R  ALS   EYLERY  LI FA YL +E
Sbjct  748  CSALQNIREAVLHYRKVFNQQHVEPRVRMVALSRGAEYLERYFRLIAFAAYLGSE  802



>ref|XP_006491437.1| PREDICTED: paladin-like isoform X2 [Citrus sinensis]
Length=1254

 Score =   491 bits (1264),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 237/295 (80%), Positives = 262/295 (89%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA++KPS     ES +GRP EM  VAALR+G+VLGSQTVLKSD
Sbjct  389   YSIIRRLLRRDPMGALGYANVKPSLMKMAESADGRPHEMGVVAALRNGQVLGSQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+ GFPVYGVANPT+ GI SVI+RIG  K   PVFWHNM
Sbjct  449   HCPGCQNQSLPERVEGAPNFREVSGFPVYGVANPTIDGIRSVIRRIGHFKGCCPVFWHNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARL++DI+REAERY GAIMV
Sbjct  509   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLREDILREAERYGGAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHVSS+SVQTPLEVFKCLE +GFPIKYAR+PITD KAPK+SDFD LA
Sbjct  569   IHETNDGQIFDAWEHVSSESVQTPLEVFKCLEDDGFPIKYARVPITDGKAPKTSDFDMLA  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLN-DALHEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL+ D  HEEL
Sbjct  629   VNIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLHEDVTHEEL  683


 Score =   353 bits (905),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 185/217 (85%), Gaps = 1/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G+       I K R  +     FGI+DILLLWKITRLFDNGV+CREALDAIIDR
Sbjct  689   SGEENGGNGAASTSSISKVR-SEGKGRAFGIDDILLLWKITRLFDNGVKCREALDAIIDR  747

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIR+AVL YR++FNQQ  EPR R VAL+RGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  748   CSALQNIREAVLHYRKVFNQQHVEPRVRMVALSRGAEYLERYFRLIAFAAYLGSEAFDGF  807

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WL QRPEVQAMKWSIR+RPGRF T+PEELR P E +HGDAVMEAIV+ 
Sbjct  808   CGQGESRMTFKSWLRQRPEVQAMKWSIRIRPGRFLTVPEELRAPQESQHGDAVMEAIVRA  867

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  868   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  904


 Score =   206 bits (524),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGRV   G++  D +PNSE+AIRRGEY VIRSL RVLEGGVEGK+QVDKVID+
Sbjct  251  GIPRTNSIGRVFDSGSSVADNLPNSEEAIRRGEYAVIRSLTRVLEGGVEGKRQVDKVIDK  310

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKR+A+LSFFVEYLERY FLICFAVY+HTER AL  
Sbjct  311  CASMQNLREAIATYRNSILRQPDEMKRQASLSFFVEYLERYYFLICFAVYIHTERAALRS  370

Query  410  TS  415
            +S
Sbjct  371  SS  372


 Score =   258 bits (659),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 171/240 (71%), Gaps = 3/240 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E +QV  +R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT+ 
Sbjct  6     EPEQVLKMRGGSVLGKRTILKSDHFPGCQNKRLTPQIDGAPNYRQADSLRVHGVAIPTIE  65

Query  693   GILSVIQRIGSSKEGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             GI +V++ IG+ K+G+   V W ++REE V+YING+PFVLR+V RP+ N LEYTGI+  R
Sbjct  66    GIRNVLKHIGAQKDGKRVQVLWISLREEPVVYINGRPFVLRDVGRPFSN-LEYTGINRAR  124

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE+MEARLK+DI+ EA R+   I+V  E  DGQ+ D WE VS DSV+ PL+V++ L+ EG
Sbjct  125   VEQMEARLKEDIIMEAARFGNKILVTDELPDGQMVDQWEPVSCDSVKAPLDVYEELQVEG  184

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + + Y R+P+TD+K+PK  DFD L   I+     T ++FNCQMG GRTTTG VIA LV L
Sbjct  185   YLVDYERVPVTDEKSPKEQDFDILVDKISQTDLNTEVIFNCQMGRGRTTTGMVIATLVYL  244


 Score =   139 bits (350),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 130/245 (53%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT+SG
Sbjct  861   MEAIVRARNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDGYPVYSMATPTISG  919

Query  696   ILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  +      + V   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  920   AKEMLAYLGAKTKTEGSFSQKVILTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGITG  978

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G  M++H       +    +   WE++ +D V+TP EV
Sbjct  979   PVVEHMEARLKEDILTEV-RQSGGRMLLHREEYNPASNQSSVVGYWENIFADDVKTPAEV  1037

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T ++   +SD D  A+           +F    G G      
Sbjct  1038  YAALQDEGYNITYRRIPLTRERDALASDID--AIQYCKDDSAGCYLFVSHTGFGGVAYAM  1095

Query  1203  VIACL  1217
              I CL
Sbjct  1096  AIICL  1100


 Score = 55.8 bits (133),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 70/146 (48%), Gaps = 15/146 (10%)
 Frame = +2

Query  1313  VPPYAPLI----LKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSAL  1480
             V P+ PL     L +    + +H+ G  D   +  +TR+   G + +  +D II+RC+  
Sbjct  1117  VGPHLPLTYEENLPSWASDEEAHKMG--DYRDILNLTRVLVYGPQSKADVDTIIERCAGA  1174

Query  1481  QNIRQAVLQYRRLFNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQ  1657
              ++R  +L Y     +   E  E+R  L + G + L RYF LI F ++L       +C  
Sbjct  1175  GHLRDDILHYSEELKKFSNEYDEQRAYLMDIGIKALRRYFFLITFRSFL-------YC-T  1226

Query  1658  GESMTTFKHWLHQRPEVQAMKWSIRL  1735
               +   FK W+  RPE+  +  +IR+
Sbjct  1227  SPAEINFKSWMDGRPELGHLCNNIRI  1252


 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  +TR+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R+ +L+  
Sbjct  286   VIRSLTRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-RQASLSFF  344

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ ++            ++F  W+  RPE+ + ++  +R  P   
Sbjct  345   VEYLERYYFLICFAVYIHTERA-ALRSSSFGHSSFADWMKARPELYSIIRRLLRRDPMGA  403

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  404   LGYANVKPSLMKMAESADGRPHEMGVVAALRNGQVLGSQTVLKSDHCPGCQNQSLPERVE  463

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  464   GAPNFREV  471


 Score = 70.5 bits (171),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHLR+DI+++++ELKKF ++ DE RAYLMD+GI+ALR
Sbjct  1164  VDTIIERCAGAGHLRDDILHYSEELKKFSNEYDEQRAYLMDIGIKALR  1211


 Score = 64.3 bits (155),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 10/115 (9%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G   T+SI +V S G            A    +  ++  + R+ + GV+ ++ +D +IDR
Sbjct  697  GAASTSSISKVRSEGKGR---------AFGIDDILLLWKITRLFDNGVKCREALDAIIDR  747

Query  230  CASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            C+++QN+REA+  YR    +Q  E + R  ALS   EYLERY  LI FA YL +E
Sbjct  748  CSALQNIREAVLHYRKVFNQQHVEPRVRMVALSRGAEYLERYFRLIAFAAYLGSE  802



>ref|XP_006491436.1| PREDICTED: paladin-like isoform X1 [Citrus sinensis]
Length=1263

 Score =   491 bits (1263),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 237/295 (80%), Positives = 262/295 (89%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA++KPS     ES +GRP EM  VAALR+G+VLGSQTVLKSD
Sbjct  398   YSIIRRLLRRDPMGALGYANVKPSLMKMAESADGRPHEMGVVAALRNGQVLGSQTVLKSD  457

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+ GFPVYGVANPT+ GI SVI+RIG  K   PVFWHNM
Sbjct  458   HCPGCQNQSLPERVEGAPNFREVSGFPVYGVANPTIDGIRSVIRRIGHFKGCCPVFWHNM  517

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARL++DI+REAERY GAIMV
Sbjct  518   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLREDILREAERYGGAIMV  577

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHVSS+SVQTPLEVFKCLE +GFPIKYAR+PITD KAPK+SDFD LA
Sbjct  578   IHETNDGQIFDAWEHVSSESVQTPLEVFKCLEDDGFPIKYARVPITDGKAPKTSDFDMLA  637

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLN-DALHEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL+ D  HEEL
Sbjct  638   VNIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLHEDVTHEEL  692


 Score =   353 bits (905),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 185/217 (85%), Gaps = 1/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G+       I K R  +     FGI+DILLLWKITRLFDNGV+CREALDAIIDR
Sbjct  698   SGEENGGNGAASTSSISKVR-SEGKGRAFGIDDILLLWKITRLFDNGVKCREALDAIIDR  756

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIR+AVL YR++FNQQ  EPR R VAL+RGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  757   CSALQNIREAVLHYRKVFNQQHVEPRVRMVALSRGAEYLERYFRLIAFAAYLGSEAFDGF  816

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WL QRPEVQAMKWSIR+RPGRF T+PEELR P E +HGDAVMEAIV+ 
Sbjct  817   CGQGESRMTFKSWLRQRPEVQAMKWSIRIRPGRFLTVPEELRAPQESQHGDAVMEAIVRA  876

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  877   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  913


 Score =   206 bits (525),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGRV   G++  D +PNSE+AIRRGEY VIRSL RVLEGGVEGK+QVDKVID+
Sbjct  260  GIPRTNSIGRVFDSGSSVADNLPNSEEAIRRGEYAVIRSLTRVLEGGVEGKRQVDKVIDK  319

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKR+A+LSFFVEYLERY FLICFAVY+HTER AL  
Sbjct  320  CASMQNLREAIATYRNSILRQPDEMKRQASLSFFVEYLERYYFLICFAVYIHTERAALRS  379

Query  410  TS  415
            +S
Sbjct  380  SS  381


 Score =   251 bits (641),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/249 (51%), Positives = 172/249 (69%), Gaps = 12/249 (5%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREI---------PGFPV  665
             E +QV  +R G VLG +T+LKSDH PGC +  L  +++GA N+R++             V
Sbjct  6     EPEQVLKMRGGSVLGKRTILKSDHFPGCQNKRLTPQIDGAPNYRQMLFMLLWSYADSLRV  65

Query  666   YGVANPTVSGILSVIQRIGSSKEGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNML  839
             +GVA PT+ GI +V++ IG+ K+G+   V W ++REE V+YING+PFVLR+V RP+ N L
Sbjct  66    HGVAIPTIEGIRNVLKHIGAQKDGKRVQVLWISLREEPVVYINGRPFVLRDVGRPFSN-L  124

Query  840   EYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLE  1019
             EYTGI+  RVE+MEARLK+DI+ EA R+   I+V  E  DGQ+ D WE VS DSV+ PL+
Sbjct  125   EYTGINRARVEQMEARLKEDIIMEAARFGNKILVTDELPDGQMVDQWEPVSCDSVKAPLD  184

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTG  1199
             V++ L+ EG+ + Y R+P+TD+K+PK  DFD L   I+     T ++FNCQMG GRTTTG
Sbjct  185   VYEELQVEGYLVDYERVPVTDEKSPKEQDFDILVDKISQTDLNTEVIFNCQMGRGRTTTG  244

Query  1200  TVIACLVKL  1226
              VIA LV L
Sbjct  245   MVIATLVYL  253


 Score =   139 bits (350),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 130/245 (53%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT+SG
Sbjct  870   MEAIVRARNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDGYPVYSMATPTISG  928

Query  696   ILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  +      + V   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  929   AKEMLAYLGAKTKTEGSFSQKVILTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGITG  987

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G  M++H       +    +   WE++ +D V+TP EV
Sbjct  988   PVVEHMEARLKEDILTEV-RQSGGRMLLHREEYNPASNQSSVVGYWENIFADDVKTPAEV  1046

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T ++   +SD D  A+           +F    G G      
Sbjct  1047  YAALQDEGYNITYRRIPLTRERDALASDID--AIQYCKDDSAGCYLFVSHTGFGGVAYAM  1104

Query  1203  VIACL  1217
              I CL
Sbjct  1105  AIICL  1109


 Score = 55.8 bits (133),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 70/146 (48%), Gaps = 15/146 (10%)
 Frame = +2

Query  1313  VPPYAPLI----LKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSAL  1480
             V P+ PL     L +    + +H+ G  D   +  +TR+   G + +  +D II+RC+  
Sbjct  1126  VGPHLPLTYEENLPSWASDEEAHKMG--DYRDILNLTRVLVYGPQSKADVDTIIERCAGA  1183

Query  1481  QNIRQAVLQYRRLFNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQ  1657
              ++R  +L Y     +   E  E+R  L + G + L RYF LI F ++L       +C  
Sbjct  1184  GHLRDDILHYSEELKKFSNEYDEQRAYLMDIGIKALRRYFFLITFRSFL-------YC-T  1235

Query  1658  GESMTTFKHWLHQRPEVQAMKWSIRL  1735
               +   FK W+  RPE+  +  +IR+
Sbjct  1236  SPAEINFKSWMDGRPELGHLCNNIRI  1261


 Score = 82.0 bits (201),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  +TR+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R+ +L+  
Sbjct  295   VIRSLTRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-RQASLSFF  353

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ ++            ++F  W+  RPE+ + ++  +R  P   
Sbjct  354   VEYLERYYFLICFAVYIHTER-AALRSSSFGHSSFADWMKARPELYSIIRRLLRRDPMGA  412

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  413   LGYANVKPSLMKMAESADGRPHEMGVVAALRNGQVLGSQTVLKSDHCPGCQNQSLPERVE  472

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  473   GAPNFREV  480


 Score = 70.5 bits (171),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHLR+DI+++++ELKKF ++ DE RAYLMD+GI+ALR
Sbjct  1173  VDTIIERCAGAGHLRDDILHYSEELKKFSNEYDEQRAYLMDIGIKALR  1220


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 10/115 (9%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G   T+SI +V S G            A    +  ++  + R+ + GV+ ++ +D +IDR
Sbjct  706  GAASTSSISKVRSEGKGR---------AFGIDDILLLWKITRLFDNGVKCREALDAIIDR  756

Query  230  CASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            C+++QN+REA+  YR    +Q  E + R  ALS   EYLERY  LI FA YL +E
Sbjct  757  CSALQNIREAVLHYRKVFNQQHVEPRVRMVALSRGAEYLERYFRLIAFAAYLGSE  811



>ref|XP_007163266.1| hypothetical protein PHAVU_001G220000g [Phaseolus vulgaris]
 gb|ESW35260.1| hypothetical protein PHAVU_001G220000g [Phaseolus vulgaris]
Length=1247

 Score =   478 bits (1229),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 227/288 (79%), Positives = 256/288 (89%), Gaps = 0/288 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY+SLKPS     EST+GRPSEM  VAALR+GEVLGSQTVLKSD
Sbjct  386   YSIIRRLLRRDPMGALGYSSLKPSLKMIAESTDGRPSEMGVVAALRNGEVLGSQTVLKSD  445

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPG  +PSL E ++GA NFRE+PGFPVYGVANPT+ GI SVI+RIGSS+ GRP+ WHNM
Sbjct  446   HCPGSQNPSLLESVDGAPNFREVPGFPVYGVANPTIDGIRSVIRRIGSSEGGRPILWHNM  505

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVE+MEARLK+DI+REA+ Y GAIMV
Sbjct  506   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVEKMEARLKEDILREAKHYGGAIMV  565

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET D  IFD+WE V+ D +QTPLEVFK LEAEGFP+KYAR+PITD KAPKSSDFDTLA
Sbjct  566   IHETDDKHIFDAWEFVTPDVIQTPLEVFKSLEAEGFPVKYARVPITDGKAPKSSDFDTLA  625

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLND  1265
             +NIASA+K TA VFNCQMG GRTTTGTVIACLVKLR+DYGRPI++L D
Sbjct  626   INIASAAKDTAFVFNCQMGRGRTTTGTVIACLVKLRVDYGRPIKILGD  673


 Score =   371 bits (953),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE+  +        L  +  +  +  FGINDILLLWKIT LFDNGVECREALDAIIDR
Sbjct  686   SGDEAGAYATSLTSNDLSRKTDEKQNRAFGINDILLLWKITTLFDNGVECREALDAIIDR  745

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  746   CSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  805

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK WLHQRPEVQAMKWSIRLRPGRFFT+PEELR PHE +HGDAVMEAIVK 
Sbjct  806   CGQGESRMTFKVWLHQRPEVQAMKWSIRLRPGRFFTVPEELREPHESQHGDAVMEAIVKA  865

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHV+KV
Sbjct  866   RNGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVFKV  902


 Score =   199 bits (506),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR+NSIGR+     N  D +P+SE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  248  GFPRSNSIGRIFQSMTNGADHLPDSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  307

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+ER AL  
Sbjct  308  CASMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHSERAALRS  367

Query  410  TS  415
             +
Sbjct  368  NT  369


 Score =   254 bits (650),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 130/241 (54%), Positives = 170/241 (71%), Gaps = 5/241 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIP-GFPVYGVANP  683
             P E +QV  +R G VLG +T+LKSDH PGC +  L  ++EGA N+R+      V+GVA P
Sbjct  5     PKEPEQVMKMRGGGVLGKRTILKSDHFPGCQNKRLSPQIEGAPNYRQASDSLHVHGVAIP  64

Query  684   TVSGILSVIQRIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
             T+ GI +V+  IG+  +   V W ++REE + YING+PFVLR+VERP+ N LEYTGI+ E
Sbjct  65    TIDGIRNVLDHIGARLK---VLWISLREEPLAYINGRPFVLRDVERPFSN-LEYTGINRE  120

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAE  1043
             RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS +SV+TPLEV++ L+  
Sbjct  121   RVEQMEARLKEDILVEAARYGNKILVTDELPDGQMVDQWEPVSCNSVKTPLEVYEELQVA  180

Query  1044  GFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVK  1223
             G+ + Y R+PITD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV 
Sbjct  181   GYLVDYERVPITDEKSPKEMDFDILVNKISQADVDTEIIFNCQMGRGRTTTGMVIATLVY  240

Query  1224  L  1226
             L
Sbjct  241   L  241


 Score =   135 bits (339),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/252 (34%), Positives = 133/252 (53%), Gaps = 18/252 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  859   MEAIVKARNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVFKVDEYPVYCMATPTISG  917

Query  696   ILSVIQRIGSSKE----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  +G+  +     + V   ++REE V+YIN  PFVLRE+ +P  N L+Y GI   
Sbjct  918   AKEMLDYLGAKPKPSVIAQKVVLTDLREEAVVYINYTPFVLRELNKPV-NTLKYVGITGP  976

Query  864   RVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEVF  1025
              VE MEARLK+DI+ E  R  G  M++H       T    +   WE++ +D ++TP EV+
Sbjct  977   VVEHMEARLKEDILAEI-RQSGGRMLLHREEYNPSTNQSGVVGYWENIRADDLKTPAEVY  1035

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+ +G+ I Y RIP+T ++   +SD D  A+         + +F    G G       
Sbjct  1036  SALKDDGYDIVYQRIPLTRERDALASDID--AIQYCQDDSAGSYLFVSHTGFGGVAYAMA  1093

Query  1206  IACLVKLRIDYG  1241
             I C   +R+D G
Sbjct  1094  IIC---IRLDAG  1102


 Score = 60.5 bits (145),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 76/155 (49%), Gaps = 13/155 (8%)
 Frame = +2

Query  1277  GIKLSGDESDGHVPPYAPLILKTRPKKDSSHEFG-INDILLLWKITRLFDNGVECREALD  1453
             G KLS      H+       L +R   +++   G  +DIL    +TR+  +G + +  +D
Sbjct  1102  GSKLSQPLLGSHIHAVTEENLPSRASNETALSMGDYSDIL---NLTRVLIHGPQSKADVD  1158

Query  1454  AIIDRCSALQNIRQAVLQYRRLFNQ-QRTEPRERRVALNRGAEYLERYFRLIAFAAYLGS  1630
              +I+RC+   ++R+ +L Y R F +    +  ER   ++ G + L RYF LI F +YL  
Sbjct  1159  LVIERCAGAGHVREDILYYNRKFEKFTDDDDEERAYLMDMGIKALRRYFFLITFRSYL--  1216

Query  1631  DAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
                  +C    +M  F  W+  RPE+  +  ++R+
Sbjct  1217  -----YCTSPANM-KFAAWMDARPELGHLCNNLRI  1245


 Score = 83.2 bits (204),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 57/200 (29%), Positives = 101/200 (51%), Gaps = 8/200 (4%)
 Frame = +2

Query  1358  DSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRT  1537
             DS       +  ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  
Sbjct  271   DSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQPD  330

Query  1538  EPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-  1714
             E + R  +L+   EYLERY+ LI FA Y+ S+             +F  W+  RPE+ + 
Sbjct  331   EMK-REASLSFFVEYLERYYFLICFAVYIHSERA-ALRSNTADNCSFADWMRARPELYSI  388

Query  1715  MKWSIRLRPG---RFFTIPEELRTPHELKHG-DAVMEAIVKDRNGSVLGKGSILTMYFFP  1882
             ++  +R  P     + ++   L+   E   G  + M  +   RNG VLG  ++L     P
Sbjct  389   IRRLLRRDPMGALGYSSLKPSLKMIAESTDGRPSEMGVVAALRNGEVLGSQTVLKSDHCP  448

Query  1883  GQRTSSHIQ-IHGAPHVYKV  1939
             G +  S ++ + GAP+  +V
Sbjct  449   GSQNPSLLESVDGAPNFREV  468


 Score = 78.6 bits (192),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V L+  RCAGAGH+REDI+Y+ ++ +KF DDDDE RAYLMDMGI+ALR
Sbjct  1157  VDLVIERCAGAGHVREDILYYNRKFEKFTDDDDEERAYLMDMGIKALR  1204


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            +  + + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  725  ITTLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYL  784

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  785  ERYFRLIAFAAYLGSE  800


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD  298
             ++E A+  G+Y+ I +L RVL  G + K  VD VI+RCA   ++RE I  Y     +  D
Sbjct  1127  SNETALSMGDYSDILNLTRVLIHGPQSKADVDLVIERCAGAGHVREDILYYNRKFEKFTD  1186

Query  299   EMKREAA--LSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
             +   E A  +   ++ L RY FLI F  YL+    A    +   + RP+
Sbjct  1187  DDDEERAYLMDMGIKALRRYFFLITFRSYLYCTSPANMKFAAWMDARPE  1235



>ref|XP_003591287.1| Paladin [Medicago truncatula]
Length=1253

 Score =   484 bits (1247),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 229/293 (78%), Positives = 258/293 (88%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY+ LKPS     EST+ RPSEM  VAALR+GEVLGSQTVLKSD
Sbjct  389   YSIIRRLLRRDPMGALGYSGLKPSLKKIAESTDDRPSEMGVVAALRNGEVLGSQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +P LPER+EGA NFRE+PGFPVYGVANPT+ GI SV++RIGSSK GRPV WHNM
Sbjct  449   HCPGCQNPRLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVLRRIGSSKGGRPVLWHNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNM EYTGI  ERVE+MEARLK+DI+REAE+Y  AIMV
Sbjct  509   REEPVIYINGKPFVLREVERPYKNMREYTGIGRERVEKMEARLKEDILREAEQYDNAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQI+D+WE V+SD +QTPLEVFK LEA+GFPIKYAR+PITD KAPKSSDFDT+A
Sbjct  569   IHETDDGQIYDAWEQVTSDVIQTPLEVFKSLEADGFPIKYARVPITDGKAPKSSDFDTMA  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
              NIASA+K TA VFNCQMG GRTTTGTVIACLVKLRID GRPI++L D + +E
Sbjct  629   FNIASATKNTAFVFNCQMGRGRTTTGTVIACLVKLRIDSGRPIKILGDNVTQE  681


 Score =   365 bits (936),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 189/217 (87%), Gaps = 2/217 (1%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE  G+V   AP  L+ +  +   H FGINDILLLWKIT  FDNGVECREALD IIDR
Sbjct  689   SGDEVGGYVT--APNNLQIKTDEKQKHVFGINDILLLWKITAFFDNGVECREALDGIIDR  746

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVL+YR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  747   CSALQNIRQAVLEYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  806

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CG+GES  +FK+WLHQRPEVQAMKWSIRLRPGRFFT+PE+LR P E +HGDAVMEA VK 
Sbjct  807   CGEGESKVSFKNWLHQRPEVQAMKWSIRLRPGRFFTVPEKLRAPQESQHGDAVMEAFVKA  866

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             R+GSVLGKGSIL MYFFPGQRTSSHIQIHGAPHV+KV
Sbjct  867   RSGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVFKV  903


 Score =   197 bits (500),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 107/125 (86%), Gaps = 2/125 (2%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NS+G VS C  N  D MPNSE+AIRRGEYTVIRSLIRV  GGV+GK+QVDKVID+
Sbjct  252  GIPRSNSVGTVSQCLTNVPDHMPNSEEAIRRGEYTVIRSLIRV--GGVDGKRQVDKVIDK  309

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICF VY+H+E  AL  
Sbjct  310  CASMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFTVYIHSEMAALQA  369

Query  410  TSQVA  424
             S  +
Sbjct  370  RSAAS  374


 Score =   268 bits (686),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 173/243 (71%), Gaps = 4/243 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E ++V  LR G VLG +T+LKSDH PGC +  L   +EGA N+R+     V+GVA PT
Sbjct  4     PKEPEEVMKLRGGSVLGKKTILKSDHFPGCQNKRLRPNIEGAPNYRQADKLHVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRP---VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
             + GI +V++ IG+  EG     V W ++REE V+YING+PFVLR+VERP+ N LEYTGI+
Sbjct  64    IDGIRNVLKHIGAEIEGENKVHVLWISLREEPVVYINGRPFVLRDVERPFSN-LEYTGIN  122

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLE  1037
              ERVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS +SV+TPLEV++ L+
Sbjct  123   RERVEQMEARLKEDILNEAARYGNKILVTDELPDGQMVDQWESVSCNSVKTPLEVYQELQ  182

Query  1038  AEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACL  1217
              EG+ + Y R+P+TD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA L
Sbjct  183   VEGYLVDYERVPVTDEKSPKEQDFDILVHKISQADVNTEIIFNCQMGRGRTTTGMVIATL  242

Query  1218  VKL  1226
             + L
Sbjct  243   IYL  245


 Score =   130 bits (326),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/246 (34%), Positives = 131/246 (53%), Gaps = 18/246 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     RSG VLG  ++LK    PG    S   ++ GA +  ++  + VY +A PT+SG
Sbjct  860   MEAFVKARSGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVFKVDEYSVYSMATPTISG  918

Query  696   ILSVIQRIGSSKEGRP-----VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                +++ +G++ + +      V   ++REE V+YI G PFVLRE+ +PY + L++ GI  
Sbjct  919   AKEMLKYLGANPKAKASAAPKVILTDLREEAVVYIKGTPFVLRELNKPY-DTLKHVGITG  977

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G +M +H       T    +   WE++ ++ V+T +EV
Sbjct  978   PVVEHMEARLKEDIIAEI-RQSGGLMPLHREEYNPSTNQSNVVGYWENILAEDVKTTVEV  1036

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTL-ALNIASASKYTALVFNCQMGIGRTTTG  1199
             +  L+ EG+ I Y RIP+T ++   +SD D +      SA  Y   +F    G G     
Sbjct  1037  YSALKDEGYDIVYRRIPLTRERDALASDVDAIQCCKDDSAENY---LFVSHTGFGGVAYA  1093

Query  1200  TVIACL  1217
               I C+
Sbjct  1094  MAIICI  1099


 Score = 77.0 bits (188),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 87/177 (49%), Gaps = 7/177 (4%)
 Frame = +2

Query  1427  GVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLI  1606
             GV+ +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI
Sbjct  296   GVDGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-REASLSFFVEYLERYYFLI  354

Query  1607  AFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEEL  1771
              F  Y+ S+          S T+F  W+  RPE+ + ++  +R  P    G     P   
Sbjct  355   CFTVYIHSEMAALQARSAASHTSFADWMRARPELYSIIRRLLRRDPMGALGYSGLKPSLK  414

Query  1772  RTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIHGAPHVYKV  1939
             +         + M  +   RNG VLG  ++L     PG Q      ++ GAP+  +V
Sbjct  415   KIAESTDDRPSEMGVVAALRNGEVLGSQTVLKSDHCPGCQNPRLPERVEGAPNFREV  471


 Score = 74.3 bits (181),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGHLR+DI+Y+ KE +KF D DDE RA+LMDMG++ALR
Sbjct  1163  VDIVIDRCAGAGHLRDDILYYCKEFEKFTDGDDEERAHLMDMGVKALR  1210


 Score = 61.2 bits (147),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +2

Query  179  LEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*  355
             + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYLERY 
Sbjct  730  FDNGVECREALDGIIDRCSALQNIRQAVLEYRKVFNQQHVEPRVRRVALNRGAEYLERYF  789

Query  356  FLICFAVYLHTE  391
             LI FA YL +E
Sbjct  790  RLIAFAAYLGSE  801


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSI--LRQ  292
             ++E A++ G+Y  I SL RVL  G + K  VD VIDRCA   +LR+ I  Y         
Sbjct  1133  SNEAALKMGDYRDILSLTRVLIHGPQSKADVDIVIDRCAGAGHLRDDILYYCKEFEKFTD  1192

Query  293   PDEMKREAALSFFVEYLERY*FLICFAVYLH  385
              D+ +R   +   V+ L RY FLI F  YL+
Sbjct  1193  GDDEERAHLMDMGVKALRRYFFLITFRSYLY  1223


 Score = 55.1 bits (131),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 61/118 (52%), Gaps = 12/118 (10%)
 Frame = +2

Query  1385  DILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQ-QRTEPRERRVA  1561
             DIL L   TR+  +G + +  +D +IDRC+   ++R  +L Y + F +    +  ER   
Sbjct  1145  DILSL---TRVLIHGPQSKADVDIVIDRCAGAGHLRDDILYYCKEFEKFTDGDDEERAHL  1201

Query  1562  LNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
             ++ G + L RYF LI F +YL       +C    +M  F  W+  RPE+  +  ++R+
Sbjct  1202  MDMGVKALRRYFFLITFRSYL-------YCTSPSNM-EFAAWMDARPELGHLCNNLRI  1251



>ref|XP_010523868.1| PREDICTED: paladin-like isoform X2 [Tarenaya hassleriana]
Length=1198

 Score =   499 bits (1286),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/294 (80%), Positives = 262/294 (89%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA+ KPS     EST GRP EM  VAALR+GEVLGSQTVLKSD
Sbjct  391   YSILRRLLRRDPMGALGYATTKPSLTKIAESTGGRPHEMGVVAALRNGEVLGSQTVLKSD  450

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC  P LPER+EGA NFRE+PGFPVYGVANPT+ GI SVI R+GSS+ GRPVFWHNM
Sbjct  451   HCPGCQIPCLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIARVGSSRGGRPVFWHNM  510

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVERMEARLK+DI+REA+RY GAIMV
Sbjct  511   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVERMEARLKEDILREAKRYGGAIMV  570

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET +GQIFD+WEHV+SDSVQTPLEV+KCLE++GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  571   IHETKEGQIFDAWEHVNSDSVQTPLEVYKCLESDGFPIKYARVPITDGKAPKSSDFDTLA  630

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NI+SA K TA VFNCQMG GRTTTGTVIACLVKLRI+YGRP++VL D L  E+
Sbjct  631   TNISSALKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPVKVLYDVLTHEI  684


 Score =   346 bits (887),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  1346  RPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFN  1525
             R +++    FG++DILLLWKITRLFDNG E REALDA+IDRCSALQNIR+AVLQYR++FN
Sbjct  711   RTEEEHGRAFGMDDILLLWKITRLFDNGFESREALDAVIDRCSALQNIREAVLQYRKVFN  770

Query  1526  QQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPE  1705
             QQ  EPR R  AL RGAEYLERYFRLIAF+AYLGS+AFDGFCGQGES  TFK+WLHQRPE
Sbjct  771   QQHVEPRVRSAALKRGAEYLERYFRLIAFSAYLGSEAFDGFCGQGESKVTFKNWLHQRPE  830

Query  1706  VQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG  1885
             VQAMKWSIRLRPGRFFTIPEELRT HE +HGDAVME+IVKDR+GSVLGKGSIL MYFFPG
Sbjct  831   VQAMKWSIRLRPGRFFTIPEELRTQHESQHGDAVMESIVKDRSGSVLGKGSILKMYFFPG  890

Query  1886  QRTSSHIQIHGAPHVYKVCWCWTF  1957
             QRTSS +QIHGAP+++KV  C  +
Sbjct  891   QRTSSQMQIHGAPNLFKVDRCPVY  914


 Score =   192 bits (489),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR+NS+GR+ + G N T  +P+SE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  253  GFPRSNSLGRIYNAGQNITVSLPSSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  312

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E
Sbjct  313  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSE  366


 Score =   267 bits (682),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 177/243 (73%), Gaps = 3/243 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E + V  LR G VLG +T+LKSDH PGC +  L  ++EGA N+R+     V+GVA PT
Sbjct  4     PKEPEHVMKLRDGSVLGKKTILKSDHFPGCQNKRLSPQIEGAPNYRQADSLRVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRPV--FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+ V   W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  64    AIGIGNVLRHIGAHKDGKQVQVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             +RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VSS+S++TPLEV++ L+A
Sbjct  123   DRVEQMEARLKEDILVEAARYGNKILVTDELPDGQMVDQWEPVSSNSLKTPLEVYEELQA  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+P+TD+K+PK +DFD L   I+     T ++FNCQMG GRTTTG V+A LV
Sbjct  183   EGYLVDYERVPVTDEKSPKETDFDKLIQKISEVDINTEIIFNCQMGRGRTTTGMVVATLV  242

Query  1221  KLR  1229
              L+
Sbjct  243   YLQ  245


 Score =   135 bits (341),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/245 (34%), Positives = 133/245 (54%), Gaps = 15/245 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA N  ++   PVY +A PT+SG
Sbjct  865   MESIVKDRSGSVLGKGSILKMYFFPG-QRTSSQMQIHGAPNLFKVDRCPVYSMATPTISG  923

Query  696   ILSVIQRIGS--SKEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+  ++EG    + +   ++REE ++YING PFVLRE+ +P  + L++ GI 
Sbjct  924   ARKMLAYLGAKPAEEGGGTTKRIVVTDLREEAIVYINGTPFVLRELNKPV-DTLKHVGIT  982

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEV  1022
                VE MEARLK+DI+ E +   G +++  E     +   ++   WE++  D+V+TP EV
Sbjct  983   GPAVESMEARLKEDILSEVKETGGRMLLHREEYSPASNQSRVIGYWENIFPDNVKTPSEV  1042

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T ++   +SD D  A+         + +F    G G      
Sbjct  1043  YAALKDEGYNISYQRIPLTREREALASDVD--AIQYCKDDLAGSYLFVSHTGYGGVAYAM  1100

Query  1203  VIACL  1217
              I CL
Sbjct  1101  AITCL  1105


 Score = 81.6 bits (200),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 94/191 (49%), Gaps = 14/191 (7%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  288   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  346

Query  1574  AEYLERYFRLIAFAAYL---GSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP  1741
              EYLERY+ LI FA YL   GS       G      +F  W+  RPE+ + ++  +R  P
Sbjct  347   VEYLERYYFLICFAVYLHSEGSFLQSALLGH----VSFAEWMRARPELYSILRRLLRRDP  402

Query  1742  ----GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHI  1906
                 G   T P   +           M  +   RNG VLG  ++L     PG Q      
Sbjct  403   MGALGYATTKPSLTKIAESTGGRPHEMGVVAALRNGEVLGSQTVLKSDHCPGCQIPCLPE  462

Query  1907  QIHGAPHVYKV  1939
             ++ GAP+  +V
Sbjct  463   RVEGAPNFREV  473


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + G E ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  731  ITRLFDNGFESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI F+ YL +E
Sbjct  791  ERYFRLIAFSAYLGSE  806



>ref|XP_010679493.1| PREDICTED: paladin isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1251

 Score =   480 bits (1235),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 225/288 (78%), Positives = 252/288 (88%), Gaps = 0/288 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY + + S     ESTNGRP EM  VAALR+G VLGSQTVLKSD
Sbjct  389   YSILRRLLRRDPMGALGYRNAEKSLIKMAESTNGRPYEMSVVAALRNGAVLGSQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGF VYGVANPT+ GI SVIQRIGS + GRPVFWHNM
Sbjct  449   HCPGCQNLSLPERIEGAPNFREVPGFSVYGVANPTIDGIRSVIQRIGSLRAGRPVFWHNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNM+EYTGIDCERVERMEARLK+DI+RE+ER+ GAIMV
Sbjct  509   REEPVIYINGKPFVLREVERPYKNMMEYTGIDCERVERMEARLKEDILRESERFGGAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+ DS+QTP EVF CLEA G+P+ Y R+PITD KAPKSSDFDTLA
Sbjct  569   IHETDDGQIFDAWEHVNFDSIQTPREVFSCLEARGYPVMYERVPITDGKAPKSSDFDTLA  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLND  1265
              N+ASASK TA VFNCQMG GRTTTGTVIACL+KLRI+YG+PIR+  D
Sbjct  629   KNVASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIEYGKPIRIFRD  676


 Score =   352 bits (904),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = +2

Query  1364  SHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEP  1543
             +  FGINDILLLWKITRLFDNGVECREALDA+IDRCSALQNIR AVL+YR LFNQQR EP
Sbjct  713   TRTFGINDILLLWKITRLFDNGVECREALDAVIDRCSALQNIRDAVLRYRALFNQQRVEP  772

Query  1544  RERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKW  1723
             R RRVALNRGAEYLERYFRLIAF+AYLGS+ FDGFCGQGES  +FK WL +RPEVQ+MKW
Sbjct  773   RVRRVALNRGAEYLERYFRLIAFSAYLGSEGFDGFCGQGESKMSFKSWLQKRPEVQSMKW  832

Query  1724  SIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSH  1903
             SIRLRPGRFFT+PE+LR+P+E +HGDA+MEA++K RNGSVLG+GSIL MYFFPGQRTSSH
Sbjct  833   SIRLRPGRFFTVPEDLRSPYETQHGDALMEAVIKARNGSVLGRGSILKMYFFPGQRTSSH  892

Query  1904  IQIHGAPHVYKV  1939
             I+IHGAPHVYKV
Sbjct  893   IKIHGAPHVYKV  904


 Score =   205 bits (521),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 112/123 (91%), Gaps = 5/123 (4%)
 Frame = +2

Query  50   GIPRTNSIGRVS--SCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVI  223
            GIPR+NSIGRVS  SCGA   D + NSEDAIRRGEYTVIRSLIRVLEGGVEGK+QVDKVI
Sbjct  252  GIPRSNSIGRVSDLSCGA---DNLLNSEDAIRRGEYTVIRSLIRVLEGGVEGKRQVDKVI  308

Query  224  DRCASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDAL  403
            D+CASMQNLREAIATYRNSIL QPDEMKREA+LSFFVEYLERY FLICFAVYLHTE  A+
Sbjct  309  DKCASMQNLREAIATYRNSILHQPDEMKREASLSFFVEYLERYYFLICFAVYLHTEETAV  368

Query  404  HPT  412
            +P+
Sbjct  369  NPS  371


 Score =   261 bits (666),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 129/242 (53%), Positives = 170/242 (70%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  L   +EGA N+R+     V+GVA PT
Sbjct  4     PKEPEQVMKLRGGSVLGKKTILKSDHFPGCQNKRLSPSIEGAPNYRQADSLQVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V++ IG+  + +   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  64    IDGIRNVLKHIGARADIKRTHVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             +RVE ME+RLK+DI+ EA RY    +V  E  DGQ+ D WE ++ D V+TPLEV++ L+ 
Sbjct  123   DRVEDMESRLKEDILLEAARYGNKTLVTDELPDGQMVDQWEPMTCDFVKTPLEVYEELKM  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EGF + Y R+P+TD+K+PK SDFD L   I      TA++FNCQMG GRTTTG VIA L+
Sbjct  183   EGFLVNYERVPVTDEKSPKESDFDMLVNKITLVDLNTAVIFNCQMGRGRTTTGMVIATLI  242

Query  1221  KL  1226
              L
Sbjct  243   YL  244


 Score =   142 bits (357),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 130/242 (54%), Gaps = 12/242 (5%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ V   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT++G
Sbjct  861   MEAVIKARNGSVLGRGSILKMYFFPG-QRTSSHIKIHGAPHVYKVEGYPVYSMATPTIAG  919

Query  696   ---ILSVIQRIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
                +LS +   GS   GR +   ++REE V+YING PFVLRE+ +   + L++ GI    
Sbjct  920   AKQMLSFLAASGSVDGGRKLVITDLREEAVVYINGTPFVLRELNKAV-DTLKHVGITGPM  978

Query  867   VERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEVFKC  1031
             VE MEARLK+DI+ E  R  G +++  E          I   WE++ ++ ++TP EV++ 
Sbjct  979   VEHMEARLKEDIISEVTRTGGRMLLHREEYSPTVNQSSIVGYWENIFTEDIKTPAEVYEA  1038

Query  1032  LEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIA  1211
             L  EGF + Y RIP+T ++   SSD D  A+           +F    G G  +    I 
Sbjct  1039  LRDEGFDVSYKRIPLTREREALSSDVD--AIQYCKEESAGCYLFVSHTGFGGVSYAMAII  1096

Query  1212  CL  1217
             C+
Sbjct  1097  CV  1098


 Score = 80.5 bits (197),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 98/194 (51%), Gaps = 20/194 (10%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR     Q  E + R  +L+  
Sbjct  286   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILHQPDEMK-REASLSFF  344

Query  1574  AEYLERYFRLIAFAAYLGSD------AFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIR  1732
              EYLERY+ LI FA YL ++      +F   C       +F  W+  RPE+ + ++  +R
Sbjct  345   VEYLERYYFLICFAVYLHTEETAVNPSFPAQC-------SFSDWMRARPELYSILRRLLR  397

Query  1733  LRPG---RFFTIPEELRTPHELKHGDAV-MEAIVKDRNGSVLGKGSILTMYFFPG-QRTS  1897
               P     +    + L    E  +G    M  +   RNG+VLG  ++L     PG Q  S
Sbjct  398   RDPMGALGYRNAEKSLIKMAESTNGRPYEMSVVAALRNGAVLGSQTVLKSDHCPGCQNLS  457

Query  1898  SHIQIHGAPHVYKV  1939
                +I GAP+  +V
Sbjct  458   LPERIEGAPNFREV  471


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 70/130 (54%), Gaps = 17/130 (13%)
 Frame = +2

Query  53   IPRTNSIGRV---SSCGANATD-IMPNSEDAIRRG------------EYTVIRSLIRVLE  184
            I R  S+G V   SSCG    D +  +S   + +G            +  ++  + R+ +
Sbjct  673  IFRDESVGEVDDSSSCGEETMDDLSASSSSTVDQGTTRKPTRTFGINDILLLWKITRLFD  732

Query  185  GGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FL  361
             GVE ++ +D VIDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYLERY  L
Sbjct  733  NGVECREALDAVIDRCSALQNIRDAVLRYRALFNQQRVEPRVRRVALNRGAEYLERYFRL  792

Query  362  ICFAVYLHTE  391
            I F+ YL +E
Sbjct  793  IAFSAYLGSE  802


 Score = 64.3 bits (155),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 66/126 (52%), Gaps = 5/126 (4%)
 Frame = +2

Query  77    RVSSCGANATDIMP---NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQN  247
             RVSS   +  D M    + E A++ G+Y  I SLIRVL  G   K  VD +I+RCA   +
Sbjct  1114  RVSSSPLSVPDDMSCWASDEVALKLGDYRDILSLIRVLAQGPRSKADVDDIIERCAGAGH  1173

Query  248   LREAIATYRNSILRQP--DEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQV  421
             +R+ I +Y   + +    +E ++ + +   V+ L RY FLI F  YL++   A    S  
Sbjct  1174  IRDDIVSYTKELKQASHGNEEQQASLIDMGVKALRRYFFLITFRSYLYSASAAETTFSSW  1233

Query  422   AEKRPD  439
              E RP+
Sbjct  1234  MEARPE  1239


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +3

Query  1926  MFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             +  RCAGAGH+R+DI+ +TKELK+    ++E +A L+DMG++ALR
Sbjct  1164  IIERCAGAGHIRDDIVSYTKELKQASHGNEEQQASLIDMGVKALR  1208


 Score = 53.5 bits (127),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 56/114 (49%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVAL-NRG  1573
             +  + R+   G   +  +D II+RC+   +IR  ++ Y +   Q      E++ +L + G
Sbjct  1144  ILSLIRVLAQGPRSKADVDDIIERCAGAGHIRDDIVSYTKELKQASHGNEEQQASLIDMG  1203

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL S +         + TTF  W+  RPE+  +   +R+
Sbjct  1204  VKALRRYFFLITFRSYLYSAS--------AAETTFSSWMEARPELGYLCNHLRI  1249



>ref|XP_010679494.1| PREDICTED: paladin isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1250

 Score =   480 bits (1235),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 225/288 (78%), Positives = 252/288 (88%), Gaps = 0/288 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY + + S     ESTNGRP EM  VAALR+G VLGSQTVLKSD
Sbjct  388   YSILRRLLRRDPMGALGYRNAEKSLIKMAESTNGRPYEMSVVAALRNGAVLGSQTVLKSD  447

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGF VYGVANPT+ GI SVIQRIGS + GRPVFWHNM
Sbjct  448   HCPGCQNLSLPERIEGAPNFREVPGFSVYGVANPTIDGIRSVIQRIGSLRAGRPVFWHNM  507

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNM+EYTGIDCERVERMEARLK+DI+RE+ER+ GAIMV
Sbjct  508   REEPVIYINGKPFVLREVERPYKNMMEYTGIDCERVERMEARLKEDILRESERFGGAIMV  567

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+ DS+QTP EVF CLEA G+P+ Y R+PITD KAPKSSDFDTLA
Sbjct  568   IHETDDGQIFDAWEHVNFDSIQTPREVFSCLEARGYPVMYERVPITDGKAPKSSDFDTLA  627

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLND  1265
              N+ASASK TA VFNCQMG GRTTTGTVIACL+KLRI+YG+PIR+  D
Sbjct  628   KNVASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIEYGKPIRIFRD  675


 Score =   352 bits (904),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = +2

Query  1364  SHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEP  1543
             +  FGINDILLLWKITRLFDNGVECREALDA+IDRCSALQNIR AVL+YR LFNQQR EP
Sbjct  712   TRTFGINDILLLWKITRLFDNGVECREALDAVIDRCSALQNIRDAVLRYRALFNQQRVEP  771

Query  1544  RERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKW  1723
             R RRVALNRGAEYLERYFRLIAF+AYLGS+ FDGFCGQGES  +FK WL +RPEVQ+MKW
Sbjct  772   RVRRVALNRGAEYLERYFRLIAFSAYLGSEGFDGFCGQGESKMSFKSWLQKRPEVQSMKW  831

Query  1724  SIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSH  1903
             SIRLRPGRFFT+PE+LR+P+E +HGDA+MEA++K RNGSVLG+GSIL MYFFPGQRTSSH
Sbjct  832   SIRLRPGRFFTVPEDLRSPYETQHGDALMEAVIKARNGSVLGRGSILKMYFFPGQRTSSH  891

Query  1904  IQIHGAPHVYKV  1939
             I+IHGAPHVYKV
Sbjct  892   IKIHGAPHVYKV  903


 Score =   205 bits (521),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 112/123 (91%), Gaps = 5/123 (4%)
 Frame = +2

Query  50   GIPRTNSIGRVS--SCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVI  223
            GIPR+NSIGRVS  SCGA   D + NSEDAIRRGEYTVIRSLIRVLEGGVEGK+QVDKVI
Sbjct  251  GIPRSNSIGRVSDLSCGA---DNLLNSEDAIRRGEYTVIRSLIRVLEGGVEGKRQVDKVI  307

Query  224  DRCASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDAL  403
            D+CASMQNLREAIATYRNSIL QPDEMKREA+LSFFVEYLERY FLICFAVYLHTE  A+
Sbjct  308  DKCASMQNLREAIATYRNSILHQPDEMKREASLSFFVEYLERYYFLICFAVYLHTEETAV  367

Query  404  HPT  412
            +P+
Sbjct  368  NPS  370


 Score =   261 bits (666),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 129/242 (53%), Positives = 170/242 (70%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  L   +EGA N+R+     V+GVA PT
Sbjct  4     PKEPEQVMKLRGGSVLGKKTILKSDHFPGCQNKRLSPSIEGAPNYRQADSLQVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V++ IG+  + +   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  64    IDGIRNVLKHIGARADIKRTHVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             +RVE ME+RLK+DI+ EA RY    +V  E  DGQ+ D WE ++ D V+TPLEV++ L+ 
Sbjct  123   DRVEDMESRLKEDILLEAARYGNKTLVTDELPDGQMVDQWEPMTCDFVKTPLEVYEELKM  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EGF + Y R+P+TD+K+PK SDFD L   I      TA++FNCQMG GRTTTG VIA L+
Sbjct  183   EGFLVNYERVPVTDEKSPKESDFDMLVNKITLVDLNTAVIFNCQMGRGRTTTGMVIATLI  242

Query  1221  KL  1226
              L
Sbjct  243   YL  244


 Score =   142 bits (357),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 130/242 (54%), Gaps = 12/242 (5%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ V   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT++G
Sbjct  860   MEAVIKARNGSVLGRGSILKMYFFPG-QRTSSHIKIHGAPHVYKVEGYPVYSMATPTIAG  918

Query  696   ---ILSVIQRIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
                +LS +   GS   GR +   ++REE V+YING PFVLRE+ +   + L++ GI    
Sbjct  919   AKQMLSFLAASGSVDGGRKLVITDLREEAVVYINGTPFVLRELNKAV-DTLKHVGITGPM  977

Query  867   VERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEVFKC  1031
             VE MEARLK+DI+ E  R  G +++  E          I   WE++ ++ ++TP EV++ 
Sbjct  978   VEHMEARLKEDIISEVTRTGGRMLLHREEYSPTVNQSSIVGYWENIFTEDIKTPAEVYEA  1037

Query  1032  LEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIA  1211
             L  EGF + Y RIP+T ++   SSD D  A+           +F    G G  +    I 
Sbjct  1038  LRDEGFDVSYKRIPLTREREALSSDVD--AIQYCKEESAGCYLFVSHTGFGGVSYAMAII  1095

Query  1212  CL  1217
             C+
Sbjct  1096  CV  1097


 Score = 80.5 bits (197),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 98/194 (51%), Gaps = 20/194 (10%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR     Q  E + R  +L+  
Sbjct  285   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILHQPDEMK-REASLSFF  343

Query  1574  AEYLERYFRLIAFAAYLGSD------AFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIR  1732
              EYLERY+ LI FA YL ++      +F   C       +F  W+  RPE+ + ++  +R
Sbjct  344   VEYLERYYFLICFAVYLHTEETAVNPSFPAQC-------SFSDWMRARPELYSILRRLLR  396

Query  1733  LRPG---RFFTIPEELRTPHELKHGDAV-MEAIVKDRNGSVLGKGSILTMYFFPG-QRTS  1897
               P     +    + L    E  +G    M  +   RNG+VLG  ++L     PG Q  S
Sbjct  397   RDPMGALGYRNAEKSLIKMAESTNGRPYEMSVVAALRNGAVLGSQTVLKSDHCPGCQNLS  456

Query  1898  SHIQIHGAPHVYKV  1939
                +I GAP+  +V
Sbjct  457   LPERIEGAPNFREV  470


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 70/130 (54%), Gaps = 17/130 (13%)
 Frame = +2

Query  53   IPRTNSIGRV---SSCGANATD-IMPNSEDAIRRG------------EYTVIRSLIRVLE  184
            I R  S+G V   SSCG    D +  +S   + +G            +  ++  + R+ +
Sbjct  672  IFRDESVGEVDDSSSCGEETMDDLSASSSSTVDQGTTRKPTRTFGINDILLLWKITRLFD  731

Query  185  GGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FL  361
             GVE ++ +D VIDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYLERY  L
Sbjct  732  NGVECREALDAVIDRCSALQNIRDAVLRYRALFNQQRVEPRVRRVALNRGAEYLERYFRL  791

Query  362  ICFAVYLHTE  391
            I F+ YL +E
Sbjct  792  IAFSAYLGSE  801


 Score = 64.3 bits (155),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 66/126 (52%), Gaps = 5/126 (4%)
 Frame = +2

Query  77    RVSSCGANATDIMP---NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQN  247
             RVSS   +  D M    + E A++ G+Y  I SLIRVL  G   K  VD +I+RCA   +
Sbjct  1113  RVSSSPLSVPDDMSCWASDEVALKLGDYRDILSLIRVLAQGPRSKADVDDIIERCAGAGH  1172

Query  248   LREAIATYRNSILRQP--DEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQV  421
             +R+ I +Y   + +    +E ++ + +   V+ L RY FLI F  YL++   A    S  
Sbjct  1173  IRDDIVSYTKELKQASHGNEEQQASLIDMGVKALRRYFFLITFRSYLYSASAAETTFSSW  1232

Query  422   AEKRPD  439
              E RP+
Sbjct  1233  MEARPE  1238


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +3

Query  1926  MFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             +  RCAGAGH+R+DI+ +TKELK+    ++E +A L+DMG++ALR
Sbjct  1163  IIERCAGAGHIRDDIVSYTKELKQASHGNEEQQASLIDMGVKALR  1207


 Score = 53.5 bits (127),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 56/114 (49%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVAL-NRG  1573
             +  + R+   G   +  +D II+RC+   +IR  ++ Y +   Q      E++ +L + G
Sbjct  1143  ILSLIRVLAQGPRSKADVDDIIERCAGAGHIRDDIVSYTKELKQASHGNEEQQASLIDMG  1202

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL S +         + TTF  W+  RPE+  +   +R+
Sbjct  1203  VKALRRYFFLITFRSYLYSAS--------AAETTFSSWMEARPELGYLCNHLRI  1248



>gb|ABN05887.1| [2Fe-2S]-binding [Medicago truncatula]
Length=1168

 Score =   485 bits (1249),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 227/295 (77%), Positives = 260/295 (88%), Gaps = 0/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY+SLKPS     EST+GRPSEM  VAALR GEVLGSQTVLKSD
Sbjct  388   YSIIRRLLRRDPMGALGYSSLKPSLTKIAESTDGRPSEMGNVAALRKGEVLGSQTVLKSD  447

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +PSLPER++GA NFR++PGFPV+GVANPT+ GI SVI RI S+  G P+ WHNM
Sbjct  448   HCPGCQNPSLPERVDGAPNFRKVPGFPVFGVANPTIDGIRSVIHRICSTNGGCPILWHNM  507

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGIDCERVE+MEARLK+DI+REA++Y  AIMV
Sbjct  508   REEPVIYINGKPFVLREVERPYKNMLEYTGIDCERVEKMEARLKEDILREAKQYSSAIMV  567

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DG IFD+WEHV+SD +QTPLEVFK LEAEGFPIKYAR+PITD KAP+ SDFD LA
Sbjct  568   IHETDDGHIFDAWEHVTSDLIQTPLEVFKSLEAEGFPIKYARVPITDGKAPERSDFDILA  627

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEELS  1286
              NIASA+K TA VFNCQMG GRTTTGTVIACLVKLR+D+GRPI++L+D + +E S
Sbjct  628   NNIASAAKDTAFVFNCQMGRGRTTTGTVIACLVKLRVDFGRPIKILSDDITQEES  682


 Score =   354 bits (908),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE+ G V      I + R  +  +  FGINDILLLWKIT LFDNG ECREALDA+IDR
Sbjct  688   SGDEALGRVTALTSNISQIRIDEKQNRVFGINDILLLWKITTLFDNGAECREALDAVIDR  747

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQQ  EPR RRVAL+RGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  748   CSALQNIRQAVLQYRKVFNQQHVEPRVRRVALDRGAEYLERYFRLIAFAAYLGSEAFDGF  807

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQG S  TFK WLHQRPEVQAMKWSIR RPGRFFT+PEELR   E +HGDAVME+ V  
Sbjct  808   CGQGNSRMTFKVWLHQRPEVQAMKWSIRSRPGRFFTVPEELRESQESQHGDAVMESTVNA  867

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTS++IQIHGAPHVYKV
Sbjct  868   RNGSVLGKGSILKMYFFPGQRTSNNIQIHGAPHVYKV  904


 Score =   197 bits (501),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NS+GR+     NA D +PNSE+AIRRGEY VIRSL+RVLEGGV+GK+QVDKVID+
Sbjct  250  GIPRSNSMGRIFQSMTNAADHLPNSEEAIRRGEYAVIRSLVRVLEGGVDGKRQVDKVIDK  309

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDAL  403
            CASMQNLREAI TYRNSILRQPDEMK+EA+LSFFVEYLERY FLICFAVY+++ERD L
Sbjct  310  CASMQNLREAIGTYRNSILRQPDEMKKEASLSFFVEYLERYYFLICFAVYINSERDIL  367


 Score =   265 bits (678),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E ++V  +R G VLG +T+LKSDH PGC +  L  ++EGA N+R      V+GVA PTV 
Sbjct  7     EPEEVMRMRGGSVLGKKTILKSDHFPGCQNKRLSPQIEGAPNYRRADSLHVHGVAIPTVD  66

Query  693   GILSVIQRIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVE  872
             GI +V+  I + +  + V W ++REE ++YING+PFVLR+VERP+ N LEYTGI+ ERVE
Sbjct  67    GIRNVLNHIRNRQNKQQVLWISLREEPLVYINGRPFVLRDVERPFSN-LEYTGINRERVE  125

Query  873   RMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFP  1052
             +MEARLK+DI+ EAERY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ EG+ 
Sbjct  126   QMEARLKEDILSEAERYGYKILVTDELPDGQMVDQWEPVSCDSVKTPLEVYEELQVEGYL  185

Query  1053  IKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + Y R+PITD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV L
Sbjct  186   VDYERVPITDEKSPKELDFDILVHKISQADVNTEIIFNCQMGRGRTTTGMVIATLVYL  243


 Score =   123 bits (308),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/244 (34%), Positives = 126/244 (52%), Gaps = 15/244 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PV  +A PT+SG
Sbjct  861   MESTVNARNGSVLGKGSILKMYFFPG-QRTSNNIQIHGAPHVYKVDGYPVCCMATPTISG  919

Query  696   ILSVIQRI-GSSKEG---RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  +   SK G   R V   ++REE V+YIN  PFV RE+ +P  + L++ GI   
Sbjct  920   AKEMLNYLDAKSKPGFTARKVILTDVREEAVVYINCVPFVHRELNKPV-DTLKHVGITGP  978

Query  864   RVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEVF  1025
              VE MEARLK+D + E  R  G  M++H       T    +   WE++ +D V+TP EV+
Sbjct  979   VVEHMEARLKEDTLAEI-RQSGGRMLLHREEYDPSTNQSTVVGYWENILADDVKTPAEVY  1037

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+ +G+ I Y RIP+T ++   +SD D  A+         + +F    G G       
Sbjct  1038  SLLKDDGYDIVYRRIPLTRERDALASDVD--AIQYCQDDSAGSYLFVSHTGFGGVAYAMA  1095

Query  1206  IACL  1217
             I C+
Sbjct  1096  IICI  1099


 Score = 81.6 bits (200),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 95/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GV+ +  +D +ID+C+++QN+R+A+  YR    +Q  E + +  +L+  
Sbjct  285   VIRSLVRVLEGGVDGKRQVDKVIDKCASMQNLREAIGTYRNSILRQPDEMK-KEASLSFF  343

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ S+  D         ++F +W+  RPE+ + ++  +R  P   
Sbjct  344   VEYLERYYFLICFAVYINSER-DILLSSTAGQSSFSNWMRARPELYSIIRRLLRRDPMGA  402

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P   +         + M  +   R G VLG  ++L     PG Q  S   ++ 
Sbjct  403   LGYSSLKPSLTKIAESTDGRPSEMGNVAALRKGEVLGSQTVLKSDHCPGCQNPSLPERVD  462

Query  1916  GAPHVYKV  1939
             GAP+  KV
Sbjct  463   GAPNFRKV  470


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 64/111 (58%), Gaps = 3/111 (3%)
 Frame = +2

Query  68   SIGRVSSCGANATDIMPNSEDAIRRG--EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASM  241
            ++GRV++  +N + I  + +     G  +  ++  +  + + G E ++ +D VIDRC+++
Sbjct  692  ALGRVTALTSNISQIRIDEKQNRVFGINDILLLWKITTLFDNGAECREALDAVIDRCSAL  751

Query  242  QNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            QN+R+A+  YR    +Q  E + R  AL    EYLERY  LI FA YL +E
Sbjct  752  QNIRQAVLQYRKVFNQQHVEPRVRRVALDRGAEYLERYFRLIAFAAYLGSE  802



>ref|XP_010523869.1| PREDICTED: paladin-like isoform X3 [Tarenaya hassleriana]
Length=1097

 Score =   499 bits (1285),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/294 (80%), Positives = 262/294 (89%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA+ KPS     EST GRP EM  VAALR+GEVLGSQTVLKSD
Sbjct  234   YSILRRLLRRDPMGALGYATTKPSLTKIAESTGGRPHEMGVVAALRNGEVLGSQTVLKSD  293

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC  P LPER+EGA NFRE+PGFPVYGVANPT+ GI SVI R+GSS+ GRPVFWHNM
Sbjct  294   HCPGCQIPCLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIARVGSSRGGRPVFWHNM  353

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVERMEARLK+DI+REA+RY GAIMV
Sbjct  354   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVERMEARLKEDILREAKRYGGAIMV  413

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET +GQIFD+WEHV+SDSVQTPLEV+KCLE++GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  414   IHETKEGQIFDAWEHVNSDSVQTPLEVYKCLESDGFPIKYARVPITDGKAPKSSDFDTLA  473

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NI+SA K TA VFNCQMG GRTTTGTVIACLVKLRI+YGRP++VL D L  E+
Sbjct  474   TNISSALKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPVKVLYDVLTHEI  527


 Score =   345 bits (885),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  1346  RPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFN  1525
             R +++    FG++DILLLWKITRLFDNG E REALDA+IDRCSALQNIR+AVLQYR++FN
Sbjct  554   RTEEEHGRAFGMDDILLLWKITRLFDNGFESREALDAVIDRCSALQNIREAVLQYRKVFN  613

Query  1526  QQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPE  1705
             QQ  EPR R  AL RGAEYLERYFRLIAF+AYLGS+AFDGFCGQGES  TFK+WLHQRPE
Sbjct  614   QQHVEPRVRSAALKRGAEYLERYFRLIAFSAYLGSEAFDGFCGQGESKVTFKNWLHQRPE  673

Query  1706  VQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG  1885
             VQAMKWSIRLRPGRFFTIPEELRT HE +HGDAVME+IVKDR+GSVLGKGSIL MYFFPG
Sbjct  674   VQAMKWSIRLRPGRFFTIPEELRTQHESQHGDAVMESIVKDRSGSVLGKGSILKMYFFPG  733

Query  1886  QRTSSHIQIHGAPHVYKVCWCWTF  1957
             QRTSS +QIHGAP+++KV  C  +
Sbjct  734   QRTSSQMQIHGAPNLFKVDRCPVY  757


 Score =   192 bits (489),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR+NS+GR+ + G N T  +P+SE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  96   GFPRSNSLGRIYNAGQNITVSLPSSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  155

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E
Sbjct  156  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSE  209


 Score =   135 bits (341),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/245 (34%), Positives = 133/245 (54%), Gaps = 15/245 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA N  ++   PVY +A PT+SG
Sbjct  708   MESIVKDRSGSVLGKGSILKMYFFPG-QRTSSQMQIHGAPNLFKVDRCPVYSMATPTISG  766

Query  696   ILSVIQRIGS--SKEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+  ++EG    + +   ++REE ++YING PFVLRE+ +P  + L++ GI 
Sbjct  767   ARKMLAYLGAKPAEEGGGTTKRIVVTDLREEAIVYINGTPFVLRELNKPV-DTLKHVGIT  825

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEV  1022
                VE MEARLK+DI+ E +   G +++  E     +   ++   WE++  D+V+TP EV
Sbjct  826   GPAVESMEARLKEDILSEVKETGGRMLLHREEYSPASNQSRVIGYWENIFPDNVKTPSEV  885

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T ++   +SD D  A+         + +F    G G      
Sbjct  886   YAALKDEGYNISYQRIPLTREREALASDVD--AIQYCKDDLAGSYLFVSHTGYGGVAYAM  943

Query  1203  VIACL  1217
              I CL
Sbjct  944   AITCL  948


 Score =   106 bits (265),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = +3

Query  966   IFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASK  1145
             + D WE VSS+S++TPLEV++ L+AEG+ + Y R+P+TD+K+PK +DFD L   I+    
Sbjct  1     MVDQWEPVSSNSLKTPLEVYEELQAEGYLVDYERVPVTDEKSPKETDFDKLIQKISEVDI  60

Query  1146  YTALVFNCQMGIGRTTTGTVIACLVKLR  1229
              T ++FNCQMG GRTTTG V+A LV L+
Sbjct  61    NTEIIFNCQMGRGRTTTGMVVATLVYLQ  88


 Score = 81.3 bits (199),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 94/191 (49%), Gaps = 14/191 (7%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  131   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  189

Query  1574  AEYLERYFRLIAFAAYL---GSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP  1741
              EYLERY+ LI FA YL   GS       G      +F  W+  RPE+ + ++  +R  P
Sbjct  190   VEYLERYYFLICFAVYLHSEGSFLQSALLGH----VSFAEWMRARPELYSILRRLLRRDP  245

Query  1742  ----GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHI  1906
                 G   T P   +           M  +   RNG VLG  ++L     PG Q      
Sbjct  246   MGALGYATTKPSLTKIAESTGGRPHEMGVVAALRNGEVLGSQTVLKSDHCPGCQIPCLPE  305

Query  1907  QIHGAPHVYKV  1939
             ++ GAP+  +V
Sbjct  306   RVEGAPNFREV  316


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             C  AG L+EDI+Y+ KE+KK P+ DDE RAY+MDMG++ALR
Sbjct  1016  CGEAGDLKEDILYYAKEIKKLPNRDDEKRAYIMDMGVKALR  1056


 Score = 65.1 bits (157),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + G E ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  574  ITRLFDNGFESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  633

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI F+ YL +E
Sbjct  634  ERYFRLIAFSAYLGSE  649


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP-  295
             + E+A R  +Y+ I SLIRVL  G + K  VD +I  C    +L+E I  Y   I + P 
Sbjct  979   SEEEAWRMEDYSDILSLIRVLTHGPQSKADVDGIIQLCGEAGDLKEDILYYAKEIKKLPN  1038

Query  296   -DEMKREAALSFFVEYLERY*FLICFAVYLH  385
              D+ KR   +   V+ L RY +LI +  YL+
Sbjct  1039  RDDEKRAYIMDMGVKALRRYFYLITYRSYLY  1069



>ref|XP_010523867.1| PREDICTED: paladin-like isoform X1 [Tarenaya hassleriana]
Length=1254

 Score =   498 bits (1283),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/294 (80%), Positives = 262/294 (89%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA+ KPS     EST GRP EM  VAALR+GEVLGSQTVLKSD
Sbjct  391   YSILRRLLRRDPMGALGYATTKPSLTKIAESTGGRPHEMGVVAALRNGEVLGSQTVLKSD  450

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC  P LPER+EGA NFRE+PGFPVYGVANPT+ GI SVI R+GSS+ GRPVFWHNM
Sbjct  451   HCPGCQIPCLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIARVGSSRGGRPVFWHNM  510

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVERMEARLK+DI+REA+RY GAIMV
Sbjct  511   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVERMEARLKEDILREAKRYGGAIMV  570

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET +GQIFD+WEHV+SDSVQTPLEV+KCLE++GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  571   IHETKEGQIFDAWEHVNSDSVQTPLEVYKCLESDGFPIKYARVPITDGKAPKSSDFDTLA  630

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NI+SA K TA VFNCQMG GRTTTGTVIACLVKLRI+YGRP++VL D L  E+
Sbjct  631   TNISSALKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPVKVLYDVLTHEI  684


 Score =   345 bits (885),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  1346  RPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFN  1525
             R +++    FG++DILLLWKITRLFDNG E REALDA+IDRCSALQNIR+AVLQYR++FN
Sbjct  711   RTEEEHGRAFGMDDILLLWKITRLFDNGFESREALDAVIDRCSALQNIREAVLQYRKVFN  770

Query  1526  QQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPE  1705
             QQ  EPR R  AL RGAEYLERYFRLIAF+AYLGS+AFDGFCGQGES  TFK+WLHQRPE
Sbjct  771   QQHVEPRVRSAALKRGAEYLERYFRLIAFSAYLGSEAFDGFCGQGESKVTFKNWLHQRPE  830

Query  1706  VQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG  1885
             VQAMKWSIRLRPGRFFTIPEELRT HE +HGDAVME+IVKDR+GSVLGKGSIL MYFFPG
Sbjct  831   VQAMKWSIRLRPGRFFTIPEELRTQHESQHGDAVMESIVKDRSGSVLGKGSILKMYFFPG  890

Query  1886  QRTSSHIQIHGAPHVYKVCWCWTF  1957
             QRTSS +QIHGAP+++KV  C  +
Sbjct  891   QRTSSQMQIHGAPNLFKVDRCPVY  914


 Score =   192 bits (489),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR+NS+GR+ + G N T  +P+SE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  253  GFPRSNSLGRIYNAGQNITVSLPSSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  312

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E
Sbjct  313  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSE  366


 Score =   266 bits (681),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 177/243 (73%), Gaps = 3/243 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E + V  LR G VLG +T+LKSDH PGC +  L  ++EGA N+R+     V+GVA PT
Sbjct  4     PKEPEHVMKLRDGSVLGKKTILKSDHFPGCQNKRLSPQIEGAPNYRQADSLRVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRPV--FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+ V   W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  64    AIGIGNVLRHIGAHKDGKQVQVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             +RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VSS+S++TPLEV++ L+A
Sbjct  123   DRVEQMEARLKEDILVEAARYGNKILVTDELPDGQMVDQWEPVSSNSLKTPLEVYEELQA  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+P+TD+K+PK +DFD L   I+     T ++FNCQMG GRTTTG V+A LV
Sbjct  183   EGYLVDYERVPVTDEKSPKETDFDKLIQKISEVDINTEIIFNCQMGRGRTTTGMVVATLV  242

Query  1221  KLR  1229
              L+
Sbjct  243   YLQ  245


 Score =   135 bits (341),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/245 (34%), Positives = 133/245 (54%), Gaps = 15/245 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA N  ++   PVY +A PT+SG
Sbjct  865   MESIVKDRSGSVLGKGSILKMYFFPG-QRTSSQMQIHGAPNLFKVDRCPVYSMATPTISG  923

Query  696   ILSVIQRIGS--SKEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+  ++EG    + +   ++REE ++YING PFVLRE+ +P  + L++ GI 
Sbjct  924   ARKMLAYLGAKPAEEGGGTTKRIVVTDLREEAIVYINGTPFVLRELNKPV-DTLKHVGIT  982

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEV  1022
                VE MEARLK+DI+ E +   G +++  E     +   ++   WE++  D+V+TP EV
Sbjct  983   GPAVESMEARLKEDILSEVKETGGRMLLHREEYSPASNQSRVIGYWENIFPDNVKTPSEV  1042

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T ++   +SD D  A+         + +F    G G      
Sbjct  1043  YAALKDEGYNISYQRIPLTREREALASDVD--AIQYCKDDLAGSYLFVSHTGYGGVAYAM  1100

Query  1203  VIACL  1217
              I CL
Sbjct  1101  AITCL  1105


 Score = 81.6 bits (200),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 94/191 (49%), Gaps = 14/191 (7%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  288   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  346

Query  1574  AEYLERYFRLIAFAAYL---GSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP  1741
              EYLERY+ LI FA YL   GS       G      +F  W+  RPE+ + ++  +R  P
Sbjct  347   VEYLERYYFLICFAVYLHSEGSFLQSALLGH----VSFAEWMRARPELYSILRRLLRRDP  402

Query  1742  ----GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHI  1906
                 G   T P   +           M  +   RNG VLG  ++L     PG Q      
Sbjct  403   MGALGYATTKPSLTKIAESTGGRPHEMGVVAALRNGEVLGSQTVLKSDHCPGCQIPCLPE  462

Query  1907  QIHGAPHVYKV  1939
             ++ GAP+  +V
Sbjct  463   RVEGAPNFREV  473


 Score = 65.1 bits (157),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             C  AG L+EDI+Y+ KE+KK P+ DDE RAY+MDMG++ALR
Sbjct  1173  CGEAGDLKEDILYYAKEIKKLPNRDDEKRAYIMDMGVKALR  1213


 Score = 65.1 bits (157),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + G E ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  731  ITRLFDNGFESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI F+ YL +E
Sbjct  791  ERYFRLIAFSAYLGSE  806


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP-  295
             + E+A R  +Y+ I SLIRVL  G + K  VD +I  C    +L+E I  Y   I + P 
Sbjct  1136  SEEEAWRMEDYSDILSLIRVLTHGPQSKADVDGIIQLCGEAGDLKEDILYYAKEIKKLPN  1195

Query  296   -DEMKREAALSFFVEYLERY*FLICFAVYLH  385
              D+ KR   +   V+ L RY +LI +  YL+
Sbjct  1196  RDDEKRAYIMDMGVKALRRYFYLITYRSYLY  1226



>gb|AES82318.2| metal ion-binding protein [Medicago truncatula]
Length=1253

 Score =   485 bits (1248),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 227/295 (77%), Positives = 260/295 (88%), Gaps = 0/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY+SLKPS     EST+GRPSEM  VAALR GEVLGSQTVLKSD
Sbjct  388   YSIIRRLLRRDPMGALGYSSLKPSLTKIAESTDGRPSEMGNVAALRKGEVLGSQTVLKSD  447

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +PSLPER++GA NFR++PGFPV+GVANPT+ GI SVI RI S+  G P+ WHNM
Sbjct  448   HCPGCQNPSLPERVDGAPNFRKVPGFPVFGVANPTIDGIRSVIHRICSTNGGCPILWHNM  507

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGIDCERVE+MEARLK+DI+REA++Y  AIMV
Sbjct  508   REEPVIYINGKPFVLREVERPYKNMLEYTGIDCERVEKMEARLKEDILREAKQYSSAIMV  567

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DG IFD+WEHV+SD +QTPLEVFK LEAEGFPIKYAR+PITD KAP+ SDFD LA
Sbjct  568   IHETDDGHIFDAWEHVTSDLIQTPLEVFKSLEAEGFPIKYARVPITDGKAPERSDFDILA  627

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEELS  1286
              NIASA+K TA VFNCQMG GRTTTGTVIACLVKLR+D+GRPI++L+D + +E S
Sbjct  628   NNIASAAKDTAFVFNCQMGRGRTTTGTVIACLVKLRVDFGRPIKILSDDITQEES  682


 Score =   353 bits (906),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE+ G V      I + R  +  +  FGINDILLLWKIT LFDNG ECREALDA+IDR
Sbjct  688   SGDEALGRVTALTSNISQIRIDEKQNRVFGINDILLLWKITTLFDNGAECREALDAVIDR  747

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQQ  EPR RRVAL+RGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  748   CSALQNIRQAVLQYRKVFNQQHVEPRVRRVALDRGAEYLERYFRLIAFAAYLGSEAFDGF  807

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQG S  TFK WLHQRPEVQAMKWSIR RPGRFFT+PEELR   E +HGDAVME+ V  
Sbjct  808   CGQGNSRMTFKVWLHQRPEVQAMKWSIRSRPGRFFTVPEELRESQESQHGDAVMESTVNA  867

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTS++IQIHGAPHVYKV
Sbjct  868   RNGSVLGKGSILKMYFFPGQRTSNNIQIHGAPHVYKV  904


 Score =   197 bits (500),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NS+GR+     NA D +PNSE+AIRRGEY VIRSL+RVLEGGV+GK+QVDKVID+
Sbjct  250  GIPRSNSMGRIFQSMTNAADHLPNSEEAIRRGEYAVIRSLVRVLEGGVDGKRQVDKVIDK  309

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDAL  403
            CASMQNLREAI TYRNSILRQPDEMK+EA+LSFFVEYLERY FLICFAVY+++ERD L
Sbjct  310  CASMQNLREAIGTYRNSILRQPDEMKKEASLSFFVEYLERYYFLICFAVYINSERDIL  367


 Score =   265 bits (678),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E ++V  +R G VLG +T+LKSDH PGC +  L  ++EGA N+R      V+GVA PTV 
Sbjct  7     EPEEVMRMRGGSVLGKKTILKSDHFPGCQNKRLSPQIEGAPNYRRADSLHVHGVAIPTVD  66

Query  693   GILSVIQRIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVE  872
             GI +V+  I + +  + V W ++REE ++YING+PFVLR+VERP+ N LEYTGI+ ERVE
Sbjct  67    GIRNVLNHIRNRQNKQQVLWISLREEPLVYINGRPFVLRDVERPFSN-LEYTGINRERVE  125

Query  873   RMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFP  1052
             +MEARLK+DI+ EAERY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ EG+ 
Sbjct  126   QMEARLKEDILSEAERYGYKILVTDELPDGQMVDQWEPVSCDSVKTPLEVYEELQVEGYL  185

Query  1053  IKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + Y R+PITD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV L
Sbjct  186   VDYERVPITDEKSPKELDFDILVHKISQADVNTEIIFNCQMGRGRTTTGMVIATLVYL  243


 Score =   123 bits (308),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/244 (34%), Positives = 126/244 (52%), Gaps = 15/244 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PV  +A PT+SG
Sbjct  861   MESTVNARNGSVLGKGSILKMYFFPG-QRTSNNIQIHGAPHVYKVDGYPVCCMATPTISG  919

Query  696   ILSVIQRI-GSSKEG---RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  +   SK G   R V   ++REE V+YIN  PFV RE+ +P  + L++ GI   
Sbjct  920   AKEMLNYLDAKSKPGFTARKVILTDVREEAVVYINCVPFVHRELNKPV-DTLKHVGITGP  978

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEVF  1025
              VE MEARLK+D + E  R  G  M++H       T    +   WE++ +D V+TP EV+
Sbjct  979   VVEHMEARLKEDTLAEI-RQSGGRMLLHREEYDPSTNQSTVVGYWENILADDVKTPAEVY  1037

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+ +G+ I Y RIP+T ++   +SD D  A+         + +F    G G       
Sbjct  1038  SLLKDDGYDIVYRRIPLTRERDALASDVD--AIQYCQDDSAGSYLFVSHTGFGGVAYAMA  1095

Query  1206  IACL  1217
             I C+
Sbjct  1096  IICI  1099


 Score = 81.3 bits (199),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 95/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GV+ +  +D +ID+C+++QN+R+A+  YR    +Q  E + +  +L+  
Sbjct  285   VIRSLVRVLEGGVDGKRQVDKVIDKCASMQNLREAIGTYRNSILRQPDEMK-KEASLSFF  343

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ S+  D         ++F +W+  RPE+ + ++  +R  P   
Sbjct  344   VEYLERYYFLICFAVYINSER-DILLSSTAGQSSFSNWMRARPELYSIIRRLLRRDPMGA  402

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P   +         + M  +   R G VLG  ++L     PG Q  S   ++ 
Sbjct  403   LGYSSLKPSLTKIAESTDGRPSEMGNVAALRKGEVLGSQTVLKSDHCPGCQNPSLPERVD  462

Query  1916  GAPHVYKV  1939
             GAP+  KV
Sbjct  463   GAPNFRKV  470


 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGH+R+DI+Y+ +E +KF DDDDE RAYL DMGI+ALR
Sbjct  1163  VDIVIERCAGAGHIRDDILYYIREFEKFTDDDDEERAYLFDMGIKALR  1210


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 64/111 (58%), Gaps = 3/111 (3%)
 Frame = +2

Query  68   SIGRVSSCGANATDIMPNSEDAIRRG--EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASM  241
            ++GRV++  +N + I  + +     G  +  ++  +  + + G E ++ +D VIDRC+++
Sbjct  692  ALGRVTALTSNISQIRIDEKQNRVFGINDILLLWKITTLFDNGAECREALDAVIDRCSAL  751

Query  242  QNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            QN+R+A+  YR    +Q  E + R  AL    EYLERY  LI FA YL +E
Sbjct  752  QNIRQAVLQYRKVFNQQHVEPRVRRVALDRGAEYLERYFRLIAFAAYLGSE  802


 Score = 57.0 bits (136),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 59/114 (52%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVAL-NRG  1573
             +  +TR+  +G + +  +D +I+RC+   +IR  +L Y R F +   +  E R  L + G
Sbjct  1146  ILNLTRVLVHGPQSKADVDIVIERCAGAGHIRDDILYYIREFEKFTDDDDEERAYLFDMG  1205

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL       +C   +  T F  W+  RPE+  +  ++R+
Sbjct  1206  IKALRRYFFLITFRSYL-------YCNSPDD-TEFAGWMDARPELSHLCNNLRI  1251


 Score = 53.9 bits (128),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD  298
             ++E A+R G+Y  I +L RVL  G + K  VD VI+RCA   ++R+ I  Y     +  D
Sbjct  1133  SNETALRMGDYRDILNLTRVLVHGPQSKADVDIVIERCAGAGHIRDDILYYIREFEKFTD  1192

Query  299   EMKREAALSF--FVEYLERY*FLICFAVYLH  385
             +   E A  F   ++ L RY FLI F  YL+
Sbjct  1193  DDDEERAYLFDMGIKALRRYFFLITFRSYLY  1223



>ref|XP_004166079.1| PREDICTED: paladin-like, partial [Cucumis sativus]
Length=1216

 Score =   479 bits (1234),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 231/295 (78%), Positives = 259/295 (88%), Gaps = 10/295 (3%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA+         ES +GRPSEM  VAALR+GEVLGS TVLKSD
Sbjct  359   YSIIRRLLRRDPMGALGYAT---------ESADGRPSEMGVVAALRNGEVLGSLTVLKSD  409

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER++GA NFRE+PGFPVYGVANPT+ GI SVI+RIGSS+ GRP+FWHNM
Sbjct  410   HCPGCQNQSLPERVDGAPNFREVPGFPVYGVANPTIDGIRSVIRRIGSSEGGRPIFWHNM  469

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVERMEARLK+DI+REAERY GAIMV
Sbjct  470   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVERMEARLKEDILREAERYRGAIMV  529

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET + QI+D+WEHVSS+SVQTP EVFK LE +GFPIKYAR+PITD KAPKSSDFD LA
Sbjct  530   IHETDNRQIYDTWEHVSSESVQTPFEVFKRLECDGFPIKYARVPITDGKAPKSSDFDALA  589

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV-LNDALHEEL  1283
             LNI SASK TA VFNCQMGIGRTTTGTVIACL+KLR+DYGRPI+V LN   HEE+
Sbjct  590   LNIVSASKDTAFVFNCQMGIGRTTTGTVIACLLKLRMDYGRPIKVLLNKKTHEEV  644


 Score =   347 bits (891),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 185/218 (85%), Gaps = 3/218 (1%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             S DE        +P I   + +K+ S  FGINDILLLWKITRLFDNG+ECREALDAIIDR
Sbjct  649   SSDEDSETNAAVSPSIYTVK-QKNESRVFGINDILLLWKITRLFDNGMECREALDAIIDR  707

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQ   EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDG 
Sbjct  708   CSALQNIRQAVLQYRKVFNQH-VEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGI  766

Query  1649  CGQGESM-TTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVK  1825
             CGQGE    TFK+WLHQRPEVQAMKWSIRLRPGRFFT+PE LR  HE +HGDAVMEA+VK
Sbjct  767   CGQGERRGMTFKNWLHQRPEVQAMKWSIRLRPGRFFTVPEALRAQHESQHGDAVMEAVVK  826

Query  1826  DRNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
              R GSVLGKGSIL MYFFPGQRTSS+IQIHGAPHV+KV
Sbjct  827   ARCGSVLGKGSILKMYFFPGQRTSSYIQIHGAPHVFKV  864


 Score =   205 bits (521),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GI RTNSIG+VS C AN  D +PNSE+AIRRGEY VIRSL RVLEGG EGK+QVD+VID+
Sbjct  221  GIARTNSIGKVSDCSANVDDNLPNSEEAIRRGEYAVIRSLTRVLEGGAEGKRQVDEVIDK  280

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQ DEMKREAALSFFVEYLERY FLICFAVY+H+ER  L  
Sbjct  281  CASMQNLREAIATYRNSILRQADEMKREAALSFFVEYLERYYFLICFAVYIHSERSGLRS  340

Query  410  TS  415
            TS
Sbjct  341  TS  342


 Score =   227 bits (578),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 142/190 (75%), Gaps = 3/190 (2%)
 Frame = +3

Query  663   VYGVANPTVSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNM  836
             VYGVA PTV GI +V++ +G+ K+G+   V W N+REE V+YING+PFVLR+VERP+ N 
Sbjct  26    VYGVAIPTVLGIQNVLKHVGAQKDGQKAQVLWINLREEPVVYINGRPFVLRDVERPFSN-  84

Query  837   LEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPL  1016
             LEYTGID  RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DS++TPL
Sbjct  85    LEYTGIDRARVEQMEARLKEDILIEASRYGNKILVTDEMPDGQMVDQWELVSHDSIKTPL  144

Query  1017  EVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTT  1196
             EV++ L+ EG  + Y R+P+TD+K+PK SDFD L   I+     TA++FNCQMG GRTTT
Sbjct  145   EVYEELQVEGVHVDYERVPVTDEKSPKESDFDILVRKISQVDINTAIIFNCQMGRGRTTT  204

Query  1197  GTVIACLVKL  1226
             G VIA LV L
Sbjct  205   GMVIATLVYL  214


 Score =   126 bits (316),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/253 (32%), Positives = 133/253 (53%), Gaps = 15/253 (6%)
 Frame = +3

Query  489   ESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVY  668
             ES +G  + M+ V   R G VLG  ++LK    PG    S  + + GA +  ++ G+PVY
Sbjct  813   ESQHG-DAVMEAVVKARCGSVLGKGSILKMYFFPGQRTSSYIQ-IHGAPHVFKVDGYPVY  870

Query  669   GVANPTVSGILSVIQRIGSSKEGRP-----VFWHNMREEHVIYINGKPFVLREVERPYKN  833
              +  PT++G   ++  + +  E        V   ++REE V+YIN  PFVLRE+ +P+ +
Sbjct  871   SMGTPTITGAREMLAYLRTKLEVDASSTLNVTIIDLREEAVVYINDTPFVLRELNKPF-D  929

Query  834   MLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSD  998
              L++ GI    VE MEARLK+DI+ E ++  G +++  E     + +  +   WE++ +D
Sbjct  930   TLKHAGITGPVVEHMEARLKEDILSEIKQSGGRMLLHREEYNPSSNESNVIGYWENIFAD  989

Query  999   SVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMG  1178
              V+TP EV+  L+ EG  + Y R+P+T ++   +SD D  A+     +     +F    G
Sbjct  990   DVKTPAEVYAHLKDEGHNVAYKRVPLTREREALASDVD--AIQFCKDNSAGCYLFVSHTG  1047

Query  1179  IGRTTTGTVIACL  1217
              G       I C+
Sbjct  1048  FGGAAYAMAILCI  1060


 Score = 84.7 bits (208),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 94/186 (51%), Gaps = 13/186 (7%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  +TR+ + G E +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  AL+  
Sbjct  256   VIRSLTRVLEGGAEGKRQVDEVIDKCASMQNLREAIATYRNSILRQADEMK-REAALSFF  314

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRPGRF  1750
              EYLERY+ LI FA Y+ S+   G      S  +F  W+  RPE+ + ++  +R  P   
Sbjct  315   VEYLERYYFLICFAVYIHSER-SGLRSTSSSHCSFAEWMKARPELYSIIRRLLRRDPMGA  373

Query  1751  FTIPEELRT--PHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIHGA  1921
                  E     P E       M  +   RNG VLG  ++L     PG Q  S   ++ GA
Sbjct  374   LGYATESADGRPSE-------MGVVAALRNGEVLGSLTVLKSDHCPGCQNQSLPERVDGA  426

Query  1922  PHVYKV  1939
             P+  +V
Sbjct  427   PNFREV  432


 Score = 83.6 bits (205),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGHLR+DI+Y++KELKKFP  DDEHRAYLMDMGI+ALR
Sbjct  1125  VDIVIDRCAGAGHLRDDILYYSKELKKFPAYDDEHRAYLMDMGIKALR  1172


 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLE  346
            + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR    +  +   R  AL+   EYLE
Sbjct  687  ITRLFDNGMECREALDAIIDRCSALQNIRQAVLQYRKVFNQHVEPRVRRVALNRGAEYLE  746

Query  347  RY*FLICFAVYLHTE  391
            RY  LI FA YL +E
Sbjct  747  RYFRLIAFAAYLGSE  761



>ref|XP_004138513.1| PREDICTED: paladin-like [Cucumis sativus]
 gb|KGN45632.1| hypothetical protein Csa_6G001780 [Cucumis sativus]
Length=1246

 Score =   479 bits (1234),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 231/295 (78%), Positives = 259/295 (88%), Gaps = 10/295 (3%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA+         ES +GRPSEM  VAALR+GEVLGS TVLKSD
Sbjct  390   YSIIRRLLRRDPMGALGYAT---------ESADGRPSEMGVVAALRNGEVLGSLTVLKSD  440

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER++GA NFRE+PGFPVYGVANPT+ GI SVI+RIGSS+ GRP+FWHNM
Sbjct  441   HCPGCQNQSLPERVDGAPNFREVPGFPVYGVANPTIDGIRSVIRRIGSSEGGRPIFWHNM  500

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVERMEARLK+DI+REAERY GAIMV
Sbjct  501   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVERMEARLKEDILREAERYRGAIMV  560

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET + QI+D+WEHVSS+SVQTP EVFK LE +GFPIKYAR+PITD KAPKSSDFD LA
Sbjct  561   IHETDNRQIYDTWEHVSSESVQTPFEVFKRLECDGFPIKYARVPITDGKAPKSSDFDALA  620

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV-LNDALHEEL  1283
             LNI SASK TA VFNCQMGIGRTTTGTVIACL+KLR+DYGRPI+V LN   HEE+
Sbjct  621   LNIVSASKDTAFVFNCQMGIGRTTTGTVIACLLKLRMDYGRPIKVLLNKKTHEEV  675


 Score =   347 bits (891),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 185/218 (85%), Gaps = 3/218 (1%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             S DE        +P I   + +K+ S  FGINDILLLWKITRLFDNG+ECREALDAIIDR
Sbjct  680   SSDEDSETNAAVSPSIYTVK-QKNESRVFGINDILLLWKITRLFDNGMECREALDAIIDR  738

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQ   EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDG 
Sbjct  739   CSALQNIRQAVLQYRKVFNQH-VEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGI  797

Query  1649  CGQGESM-TTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVK  1825
             CGQGE    TFK+WLHQRPEVQAMKWSIRLRPGRFFT+PE LR  HE +HGDAVMEA+VK
Sbjct  798   CGQGERRGMTFKNWLHQRPEVQAMKWSIRLRPGRFFTVPEALRAQHESQHGDAVMEAVVK  857

Query  1826  DRNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
              R GSVLGKGSIL MYFFPGQRTSS+IQIHGAPHV+KV
Sbjct  858   ARCGSVLGKGSILKMYFFPGQRTSSYIQIHGAPHVFKV  895


 Score =   205 bits (521),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GI RTNSIG+VS C AN  D +PNSE+AIRRGEY VIRSL RVLEGG EGK+QVD+VID+
Sbjct  252  GIARTNSIGKVSDCSANVDDNLPNSEEAIRRGEYAVIRSLTRVLEGGAEGKRQVDEVIDK  311

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQ DEMKREAALSFFVEYLERY FLICFAVY+H+ER  L  
Sbjct  312  CASMQNLREAIATYRNSILRQADEMKREAALSFFVEYLERYYFLICFAVYIHSERSGLRS  371

Query  410  TS  415
            TS
Sbjct  372  TS  373


 Score =   274 bits (701),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/242 (55%), Positives = 173/242 (71%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E + V   R G VLG +T+LKSDH PGC +  L  +++GA N+R+     VYGVA PT
Sbjct  5     PKEPEHVMKFRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQANSLQVYGVAIPT  64

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             V GI +V++ +G+ K+G+   V W N+REE V+YING+PFVLR+VERP+ N LEYTGID 
Sbjct  65    VLGIQNVLKHVGAQKDGQKAQVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGIDR  123

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DS++TPLEV++ L+ 
Sbjct  124   ARVEQMEARLKEDILIEASRYGNKILVTDEMPDGQMVDQWELVSHDSIKTPLEVYEELQV  183

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG  + Y R+P+TD+K+PK SDFD L   I+     TA++FNCQMG GRTTTG VIA LV
Sbjct  184   EGVHVDYERVPVTDEKSPKESDFDILVRKISQVDINTAIIFNCQMGRGRTTTGMVIATLV  243

Query  1221  KL  1226
              L
Sbjct  244   YL  245


 Score =   126 bits (316),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/244 (32%), Positives = 128/244 (52%), Gaps = 14/244 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ V   R G VLG  ++LK    PG    S  + + GA +  ++ G+PVY +  PT++G
Sbjct  852   MEAVVKARCGSVLGKGSILKMYFFPGQRTSSYIQ-IHGAPHVFKVDGYPVYSMGTPTITG  910

Query  696   ILSVIQRIGSSKEGRP-----VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  + +  E        V   ++REE V+YIN  PFVLRE+ +P+ + L++ GI  
Sbjct  911   AREMLAYLRTKLEVDASSTLNVTIIDLREEAVVYINDTPFVLRELNKPF-DTLKHAGITG  969

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEVF  1025
               VE MEARLK+DI+ E ++  G +++  E     + +  +   WE++ +D V+TP EV+
Sbjct  970   PVVEHMEARLKEDILSEIKQSGGRMLLHREEYNPSSNESNVIGYWENIFADDVKTPAEVY  1029

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+ EG  + Y R+P+T ++   +SD D  A+     +     +F    G G       
Sbjct  1030  AHLKDEGHNVAYKRVPLTREREALASDVD--AIQFCKDNSAGCYLFVSHTGFGGAAYAMA  1087

Query  1206  IACL  1217
             I C+
Sbjct  1088  ILCI  1091


 Score = 84.7 bits (208),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 94/186 (51%), Gaps = 13/186 (7%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  +TR+ + G E +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  AL+  
Sbjct  287   VIRSLTRVLEGGAEGKRQVDEVIDKCASMQNLREAIATYRNSILRQADEMK-REAALSFF  345

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRPGRF  1750
              EYLERY+ LI FA Y+ S+   G      S  +F  W+  RPE+ + ++  +R  P   
Sbjct  346   VEYLERYYFLICFAVYIHSER-SGLRSTSSSHCSFAEWMKARPELYSIIRRLLRRDPMGA  404

Query  1751  FTIPEELRT--PHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIHGA  1921
                  E     P E       M  +   RNG VLG  ++L     PG Q  S   ++ GA
Sbjct  405   LGYATESADGRPSE-------MGVVAALRNGEVLGSLTVLKSDHCPGCQNQSLPERVDGA  457

Query  1922  PHVYKV  1939
             P+  +V
Sbjct  458   PNFREV  463


 Score = 83.6 bits (205),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGHLR+DI+Y++KELKKFP  DDEHRAYLMDMGI+ALR
Sbjct  1156  VDIVIDRCAGAGHLRDDILYYSKELKKFPAYDDEHRAYLMDMGIKALR  1203


 Score = 63.9 bits (154),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLE  346
            + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR    +  +   R  AL+   EYLE
Sbjct  718  ITRLFDNGMECREALDAIIDRCSALQNIRQAVLQYRKVFNQHVEPRVRRVALNRGAEYLE  777

Query  347  RY*FLICFAVYLHTE  391
            RY  LI FA YL +E
Sbjct  778  RYFRLIAFAAYLGSE  792


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 61/110 (55%), Gaps = 4/110 (4%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP-  295
             + E+A + G+Y  I SL RVL  G + K  VD VIDRCA   +LR+ I  Y   + + P 
Sbjct  1126  SEEEAFKIGDYRDILSLTRVLMYGPKSKADVDIVIDRCAGAGHLRDDILYYSKELKKFPA  1185

Query  296   -DEMKREAALSFFVEYLERY*FLICFAVYLH-TERDALHPTSQVAEKRPD  439
              D+  R   +   ++ L RY FLI F  YL+ T+ + +  TS + E RP+
Sbjct  1186  YDDEHRAYLMDMGIKALRRYFFLITFRSYLYCTKAEEMKFTSWMKE-RPE  1234


 Score = 58.5 bits (140),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 61/122 (50%), Gaps = 9/122 (7%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER  1552
             F I D   +  +TR+   G + +  +D +IDRC+   ++R  +L Y +   +      E 
Sbjct  1131  FKIGDYRDILSLTRVLMYGPKSKADVDIVIDRCAGAGHLRDDILYYSKELKKFPAYDDEH  1190

Query  1553  RVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSI  1729
             R  L + G + L RYF LI F +YL       +C + E M  F  W+ +RPE+  +  ++
Sbjct  1191  RAYLMDMGIKALRRYFFLITFRSYL-------YCTKAEEM-KFTSWMKERPELGHLCNNL  1242

Query  1730  RL  1735
             R+
Sbjct  1243  RI  1244



>ref|XP_010544901.1| PREDICTED: paladin-like isoform X3 [Tarenaya hassleriana]
Length=1060

 Score =   496 bits (1277),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/294 (80%), Positives = 262/294 (89%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA  KPS +   EST+GRP EM  VAALR+G VLGSQTVLKSD
Sbjct  194   YSILRRLLRRDPMGALGYAITKPSLSKIAESTDGRPHEMGVVAALRNGAVLGSQTVLKSD  253

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC   SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+R+GSS+ GRPVFWHNM
Sbjct  254   HCPGCQISSLPERVEGAPNFREVPGFPVYGVANPTIDGIQSVIERVGSSRGGRPVFWHNM  313

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYIN KPFVLREVERPYKNMLEYTGID +RV+RMEARLK+DI+REA+RY GAIMV
Sbjct  314   REEPVIYINRKPFVLREVERPYKNMLEYTGIDRDRVQRMEARLKEDILREAKRYGGAIMV  373

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV++DSVQTPLEV+KCLE +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  374   IHETKDGQIFDAWEHVNADSVQTPLEVYKCLEVDGFPIKYARVPITDGKAPKSSDFDTLA  433

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  434   TNIASASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  487


 Score =   342 bits (876),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  1346  RPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFN  1525
             R +++  H FG++DILLLWKITRLFDNG E REALDA+IDRCSALQNIR+AVLQYR++FN
Sbjct  514   RTEEEHGHAFGMDDILLLWKITRLFDNGAESREALDAVIDRCSALQNIREAVLQYRKVFN  573

Query  1526  QQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPE  1705
             QQ  EPR R  AL RGAEYLERYFRLIAF+AYLGS+AFDGFCGQG+S  TFK+WLHQRPE
Sbjct  574   QQHVEPRVRSAALKRGAEYLERYFRLIAFSAYLGSEAFDGFCGQGDSKVTFKNWLHQRPE  633

Query  1706  VQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG  1885
             VQAMKWSIRLRPGRFFTIPEELR+ HE +HGDAVME+IV DR+GSVLGKGSIL MYFFPG
Sbjct  634   VQAMKWSIRLRPGRFFTIPEELRSQHESQHGDAVMESIVNDRSGSVLGKGSILKMYFFPG  693

Query  1886  QRTSSHIQIHGAPHVYKV  1939
             QRTSS++QIHGAP++ KV
Sbjct  694   QRTSSNMQIHGAPNLCKV  711


 Score =   192 bits (489),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR+NS+GR+ + G N T  +P+SE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  56   GFPRSNSLGRIYNAGENITVSLPSSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  115

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E
Sbjct  116  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSE  169


 Score =   137 bits (345),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 133/245 (54%), Gaps = 15/245 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA N  ++  +PVY +A PT SG
Sbjct  668   MESIVNDRSGSVLGKGSILKMYFFPG-QRTSSNMQIHGAPNLCKVDRYPVYSMATPTSSG  726

Query  696   ILSVIQRIGSS--KEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+   +EG    + +   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  727   AKKMLAYLGAKPKEEGGDVTKRIVVTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGIT  785

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEV  1022
                VE MEARLK+DI+ E +   G +++  E     + + +I   WE++  D+V+TP E 
Sbjct  786   GPVVESMEARLKEDILSEVKETGGRMLLHREEYNPASKESRIIGYWENIFQDNVKTPAEE  845

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+AEG+ I Y RIP+T ++   +SD D  A+         + ++    G G      
Sbjct  846   YAALKAEGYNISYQRIPLTREREALASDVD--AIQYCKNDSAGSYLYISHTGFGGVAYAM  903

Query  1203  VIACL  1217
              I CL
Sbjct  904   AITCL  908


 Score = 46.6 bits (109),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 63/135 (47%), Gaps = 13/135 (10%)
 Frame = +2

Query  1337  LKTRPKKDSSHEFG-INDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR  1513
             L +R  ++ +   G   DIL L    R+  +G + +  +D II+ C+   ++R+ +L Y 
Sbjct  935   LPSRATEEEALRMGDYRDILSL---IRVLSHGPQSKADVDGIIELCAGAGHLREDILYYT  991

Query  1514  RLFNQQRTEPRERRVA-LNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWL  1690
             +   +      E R + ++ G + L RYF LI F +YL S               F  W+
Sbjct  992   KELKRFPNMDDENRASIMDMGVKALRRYFYLITFRSYLYSTT--------PKEMKFVDWM  1043

Query  1691  HQRPEVQAMKWSIRL  1735
               RPE+  +  ++R+
Sbjct  1044  EARPELGHLCHNLRI  1058


 Score = 88.6 bits (218),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 98/189 (52%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  91    VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  149

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA YL S+    F   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  150   VEYLERYYFLICFAVYLHSEG--AFLQSGSLGHDSFAEWMRARPELYSILRRLLRRDPMG  207

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQ-I  1912
               G   T P   +           M  +   RNG+VLG  ++L     PG + SS  + +
Sbjct  208   ALGYAITKPSLSKIAESTDGRPHEMGVVAALRNGAVLGSQTVLKSDHCPGCQISSLPERV  267

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  268   EGAPNFREV  276


 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             CAGAGHLREDI+Y+TKELK+FP+ DDE+RA +MDMG++ALR
Sbjct  977   CAGAGHLREDILYYTKELKRFPNMDDENRASIMDMGVKALR  1017


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + G E ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  534  ITRLFDNGAESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  593

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI F+ YL +E
Sbjct  594  ERYFRLIAFSAYLGSE  609


 Score = 63.5 bits (153),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 2/90 (2%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP--D  298
             E+A+R G+Y  I SLIRVL  G + K  VD +I+ CA   +LRE I  Y   + R P  D
Sbjct  942   EEALRMGDYRDILSLIRVLSHGPQSKADVDGIIELCAGAGHLREDILYYTKELKRFPNMD  1001

Query  299   EMKREAALSFFVEYLERY*FLICFAVYLHT  388
             +  R + +   V+ L RY +LI F  YL++
Sbjct  1002  DENRASIMDMGVKALRRYFYLITFRSYLYS  1031



>ref|XP_010544900.1| PREDICTED: paladin-like isoform X2 [Tarenaya hassleriana]
Length=1255

 Score =   496 bits (1277),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/294 (80%), Positives = 262/294 (89%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA  KPS +   EST+GRP EM  VAALR+G VLGSQTVLKSD
Sbjct  389   YSILRRLLRRDPMGALGYAITKPSLSKIAESTDGRPHEMGVVAALRNGAVLGSQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC   SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+R+GSS+ GRPVFWHNM
Sbjct  449   HCPGCQISSLPERVEGAPNFREVPGFPVYGVANPTIDGIQSVIERVGSSRGGRPVFWHNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYIN KPFVLREVERPYKNMLEYTGID +RV+RMEARLK+DI+REA+RY GAIMV
Sbjct  509   REEPVIYINRKPFVLREVERPYKNMLEYTGIDRDRVQRMEARLKEDILREAKRYGGAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV++DSVQTPLEV+KCLE +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  569   IHETKDGQIFDAWEHVNADSVQTPLEVYKCLEVDGFPIKYARVPITDGKAPKSSDFDTLA  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  629   TNIASASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  682


 Score =   342 bits (876),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  1346  RPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFN  1525
             R +++  H FG++DILLLWKITRLFDNG E REALDA+IDRCSALQNIR+AVLQYR++FN
Sbjct  709   RTEEEHGHAFGMDDILLLWKITRLFDNGAESREALDAVIDRCSALQNIREAVLQYRKVFN  768

Query  1526  QQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPE  1705
             QQ  EPR R  AL RGAEYLERYFRLIAF+AYLGS+AFDGFCGQG+S  TFK+WLHQRPE
Sbjct  769   QQHVEPRVRSAALKRGAEYLERYFRLIAFSAYLGSEAFDGFCGQGDSKVTFKNWLHQRPE  828

Query  1706  VQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG  1885
             VQAMKWSIRLRPGRFFTIPEELR+ HE +HGDAVME+IV DR+GSVLGKGSIL MYFFPG
Sbjct  829   VQAMKWSIRLRPGRFFTIPEELRSQHESQHGDAVMESIVNDRSGSVLGKGSILKMYFFPG  888

Query  1886  QRTSSHIQIHGAPHVYKV  1939
             QRTSS++QIHGAP++ KV
Sbjct  889   QRTSSNMQIHGAPNLCKV  906


 Score =   193 bits (490),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR+NS+GR+ + G N T  +P+SE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  251  GFPRSNSLGRIYNAGENITVSLPSSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  310

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E
Sbjct  311  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSE  364


 Score =   260 bits (665),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/241 (54%), Positives = 175/241 (73%), Gaps = 5/241 (2%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E +QV  +R G VLG +T+LKSDH PGC +  L  ++EGA N+R+     V+GVA PT  
Sbjct  6     EPEQVMKMRDGSVLGKKTILKSDHFPGCQNKRLSPQIEGAPNYRQADSLRVHGVAIPTAV  65

Query  693   GILSVIQRIGSSKEGRPV--FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             GI +V++ IG+ ++G  V   W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ +R
Sbjct  66    GIRNVLRHIGAHRDGNQVQVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINRDR  124

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VSSDS++T LEV+  L+AEG
Sbjct  125   VEQMEARLKEDILLEAARYGNKILVTDELPDGQMVDQWEPVSSDSLKTSLEVYDELQAEG  184

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + + Y R+P+TD+K+PK +DFD   L I+ A   T ++FNCQMG GRTTTG V+A LV L
Sbjct  185   YLVDYERVPVTDEKSPKETDFDI--LKISEADINTEIIFNCQMGRGRTTTGMVVATLVYL  242

Query  1227  R  1229
             +
Sbjct  243   K  243


 Score =   137 bits (345),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 133/245 (54%), Gaps = 15/245 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA N  ++  +PVY +A PT SG
Sbjct  863   MESIVNDRSGSVLGKGSILKMYFFPG-QRTSSNMQIHGAPNLCKVDRYPVYSMATPTSSG  921

Query  696   ILSVIQRIGSS--KEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+   +EG    + +   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  922   AKKMLAYLGAKPKEEGGDVTKRIVVTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGIT  980

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEV  1022
                VE MEARLK+DI+ E +   G +++  E     + + +I   WE++  D+V+TP E 
Sbjct  981   GPVVESMEARLKEDILSEVKETGGRMLLHREEYNPASKESRIIGYWENIFQDNVKTPAEE  1040

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+AEG+ I Y RIP+T ++   +SD D  A+         + ++    G G      
Sbjct  1041  YAALKAEGYNISYQRIPLTREREALASDVD--AIQYCKNDSAGSYLYISHTGFGGVAYAM  1098

Query  1203  VIACL  1217
              I CL
Sbjct  1099  AITCL  1103


 Score = 88.6 bits (218),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 98/189 (52%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  286   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  344

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA YL S+    F   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  345   VEYLERYYFLICFAVYLHSEG--AFLQSGSLGHDSFAEWMRARPELYSILRRLLRRDPMG  402

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQ-I  1912
               G   T P   +           M  +   RNG+VLG  ++L     PG + SS  + +
Sbjct  403   ALGYAITKPSLSKIAESTDGRPHEMGVVAALRNGAVLGSQTVLKSDHCPGCQISSLPERV  462

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  463   EGAPNFREV  471


 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             CAGAGHLREDI+Y+TKELK+FP+ DDE+RA +MDMG++ALR
Sbjct  1172  CAGAGHLREDILYYTKELKRFPNMDDENRASIMDMGVKALR  1212


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + G E ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  729  ITRLFDNGAESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  788

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI F+ YL +E
Sbjct  789  ERYFRLIAFSAYLGSE  804


 Score = 63.5 bits (153),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 2/90 (2%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP--D  298
             E+A+R G+Y  I SLIRVL  G + K  VD +I+ CA   +LRE I  Y   + R P  D
Sbjct  1137  EEALRMGDYRDILSLIRVLSHGPQSKADVDGIIELCAGAGHLREDILYYTKELKRFPNMD  1196

Query  299   EMKREAALSFFVEYLERY*FLICFAVYLHT  388
             +  R + +   V+ L RY +LI F  YL++
Sbjct  1197  DENRASIMDMGVKALRRYFYLITFRSYLYS  1226



>ref|XP_010544899.1| PREDICTED: paladin-like isoform X1 [Tarenaya hassleriana]
Length=1257

 Score =   496 bits (1277),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/294 (80%), Positives = 262/294 (89%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA  KPS +   EST+GRP EM  VAALR+G VLGSQTVLKSD
Sbjct  391   YSILRRLLRRDPMGALGYAITKPSLSKIAESTDGRPHEMGVVAALRNGAVLGSQTVLKSD  450

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC   SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+R+GSS+ GRPVFWHNM
Sbjct  451   HCPGCQISSLPERVEGAPNFREVPGFPVYGVANPTIDGIQSVIERVGSSRGGRPVFWHNM  510

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYIN KPFVLREVERPYKNMLEYTGID +RV+RMEARLK+DI+REA+RY GAIMV
Sbjct  511   REEPVIYINRKPFVLREVERPYKNMLEYTGIDRDRVQRMEARLKEDILREAKRYGGAIMV  570

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV++DSVQTPLEV+KCLE +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  571   IHETKDGQIFDAWEHVNADSVQTPLEVYKCLEVDGFPIKYARVPITDGKAPKSSDFDTLA  630

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  631   TNIASASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  684


 Score =   342 bits (876),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  1346  RPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFN  1525
             R +++  H FG++DILLLWKITRLFDNG E REALDA+IDRCSALQNIR+AVLQYR++FN
Sbjct  711   RTEEEHGHAFGMDDILLLWKITRLFDNGAESREALDAVIDRCSALQNIREAVLQYRKVFN  770

Query  1526  QQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPE  1705
             QQ  EPR R  AL RGAEYLERYFRLIAF+AYLGS+AFDGFCGQG+S  TFK+WLHQRPE
Sbjct  771   QQHVEPRVRSAALKRGAEYLERYFRLIAFSAYLGSEAFDGFCGQGDSKVTFKNWLHQRPE  830

Query  1706  VQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG  1885
             VQAMKWSIRLRPGRFFTIPEELR+ HE +HGDAVME+IV DR+GSVLGKGSIL MYFFPG
Sbjct  831   VQAMKWSIRLRPGRFFTIPEELRSQHESQHGDAVMESIVNDRSGSVLGKGSILKMYFFPG  890

Query  1886  QRTSSHIQIHGAPHVYKV  1939
             QRTSS++QIHGAP++ KV
Sbjct  891   QRTSSNMQIHGAPNLCKV  908


 Score =   193 bits (490),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR+NS+GR+ + G N T  +P+SE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  253  GFPRSNSLGRIYNAGENITVSLPSSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  312

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E
Sbjct  313  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSE  366


 Score =   264 bits (675),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 129/241 (54%), Positives = 175/241 (73%), Gaps = 3/241 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E +QV  +R G VLG +T+LKSDH PGC +  L  ++EGA N+R+     V+GVA PT  
Sbjct  6     EPEQVMKMRDGSVLGKKTILKSDHFPGCQNKRLSPQIEGAPNYRQADSLRVHGVAIPTAV  65

Query  693   GILSVIQRIGSSKEGRPV--FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             GI +V++ IG+ ++G  V   W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ +R
Sbjct  66    GIRNVLRHIGAHRDGNQVQVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINRDR  124

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VSSDS++T LEV+  L+AEG
Sbjct  125   VEQMEARLKEDILLEAARYGNKILVTDELPDGQMVDQWEPVSSDSLKTSLEVYDELQAEG  184

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + + Y R+P+TD+K+PK +DFD L   I+ A   T ++FNCQMG GRTTTG V+A LV L
Sbjct  185   YLVDYERVPVTDEKSPKETDFDILIQKISEADINTEIIFNCQMGRGRTTTGMVVATLVYL  244

Query  1227  R  1229
             +
Sbjct  245   K  245


 Score =   137 bits (345),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 133/245 (54%), Gaps = 15/245 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA N  ++  +PVY +A PT SG
Sbjct  865   MESIVNDRSGSVLGKGSILKMYFFPG-QRTSSNMQIHGAPNLCKVDRYPVYSMATPTSSG  923

Query  696   ILSVIQRIGSS--KEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+   +EG    + +   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  924   AKKMLAYLGAKPKEEGGDVTKRIVVTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGIT  982

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEV  1022
                VE MEARLK+DI+ E +   G +++  E     + + +I   WE++  D+V+TP E 
Sbjct  983   GPVVESMEARLKEDILSEVKETGGRMLLHREEYNPASKESRIIGYWENIFQDNVKTPAEE  1042

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+AEG+ I Y RIP+T ++   +SD D  A+         + ++    G G      
Sbjct  1043  YAALKAEGYNISYQRIPLTREREALASDVD--AIQYCKNDSAGSYLYISHTGFGGVAYAM  1100

Query  1203  VIACL  1217
              I CL
Sbjct  1101  AITCL  1105


 Score = 88.6 bits (218),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 98/189 (52%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  288   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  346

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA YL S+    F   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  347   VEYLERYYFLICFAVYLHSEG--AFLQSGSLGHDSFAEWMRARPELYSILRRLLRRDPMG  404

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQ-I  1912
               G   T P   +           M  +   RNG+VLG  ++L     PG + SS  + +
Sbjct  405   ALGYAITKPSLSKIAESTDGRPHEMGVVAALRNGAVLGSQTVLKSDHCPGCQISSLPERV  464

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  465   EGAPNFREV  473


 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             CAGAGHLREDI+Y+TKELK+FP+ DDE+RA +MDMG++ALR
Sbjct  1174  CAGAGHLREDILYYTKELKRFPNMDDENRASIMDMGVKALR  1214


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + G E ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  731  ITRLFDNGAESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI F+ YL +E
Sbjct  791  ERYFRLIAFSAYLGSE  806


 Score = 63.5 bits (153),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 2/90 (2%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP--D  298
             E+A+R G+Y  I SLIRVL  G + K  VD +I+ CA   +LRE I  Y   + R P  D
Sbjct  1139  EEALRMGDYRDILSLIRVLSHGPQSKADVDGIIELCAGAGHLREDILYYTKELKRFPNMD  1198

Query  299   EMKREAALSFFVEYLERY*FLICFAVYLHT  388
             +  R + +   V+ L RY +LI F  YL++
Sbjct  1199  DENRASIMDMGVKALRRYFYLITFRSYLYS  1228



>ref|XP_008227749.1| PREDICTED: LOW QUALITY PROTEIN: paladin [Prunus mume]
Length=1236

 Score =   492 bits (1266),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/293 (80%), Positives = 262/293 (89%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYASLKPS     ES +GRP EM  VAALR GEVLGSQTVLKSD
Sbjct  390   YSIIRRLLRRDPMGALGYASLKPSLKKIAESADGRPYEMGVVAALRKGEVLGSQTVLKSD  449

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + +LPE ++GA NFRE+PGFPVYGVANPT+ GI SVIQ+I SSK+GRPVFWHNM
Sbjct  450   HCPGCQNQNLPEGVDGAPNFREVPGFPVYGVANPTIDGIRSVIQKICSSKDGRPVFWHNM  509

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  510   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAERYGGAIMV  569

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+S+++QTPLEVFK LE +GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  570   IHETDDGQIFDAWEHVNSEAIQTPLEVFKGLETDGFPIKYARVPITDGKAPKSSDFDTLA  629

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRID+GRPI++L D +  E
Sbjct  630   INIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDHGRPIKILADNITLE  682


 Score =   318 bits (815),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 165/202 (82%), Gaps = 20/202 (10%)
 Frame = +2

Query  1334  ILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR  1513
             +   R +KD    FG+NDILLLWKITRLFDNGV                    QAVLQYR
Sbjct  705   VTAVRNEKDQGRVFGMNDILLLWKITRLFDNGV--------------------QAVLQYR  744

Query  1514  RLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLH  1693
             ++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGFCGQGES  TFK+WLH
Sbjct  745   KVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGFCGQGESRMTFKNWLH  804

Query  1694  QRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMY  1873
             QRPEVQAMKWSIRLRPGRFFT+PEELR P+E +HGDAVMEAIVK R+GSVLGKGSIL MY
Sbjct  805   QRPEVQAMKWSIRLRPGRFFTVPEELRAPYESQHGDAVMEAIVKTRSGSVLGKGSILKMY  864

Query  1874  FFPGQRTSSHIQIHGAPHVYKV  1939
             FFPGQRTSSHIQIHGAPHVYKV
Sbjct  865   FFPGQRTSSHIQIHGAPHVYKV  886


 Score =   210 bits (535),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIG+VS   A  TD  PNSEDAIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  252  GIPRTNSIGKVSDSSAIVTDNFPNSEDAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  311

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+ER AL  
Sbjct  312  CASMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHSERAALRS  371

Query  410  TS  415
            +S
Sbjct  372  SS  373


 Score =   262 bits (670),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 172/243 (71%), Gaps = 4/243 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT
Sbjct  4     PKEPEQVMKLRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQADSLHVHGVAIPT  63

Query  687   VSGILSVIQRIGSSK-EGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
             V GI +V+  IG+ + +G+   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+
Sbjct  64    VDGIQNVLNHIGAQQIDGKRTQVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGIN  122

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLE  1037
               R+E+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS DSV TPLEV++ L+
Sbjct  123   RARLEQMEARLKEDILIEAARYGNKILVTDELPDGQMVDQWEPVSRDSVTTPLEVYEELQ  182

Query  1038  AEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACL  1217
              +G+ + Y R+PITD+K+PK  DFD L   I+ A     ++FNCQMG GRTTTG VIA L
Sbjct  183   VQGYLVDYERVPITDEKSPKELDFDILVHKISQADINAEIIFNCQMGRGRTTTGMVIATL  242

Query  1218  VKL  1226
             + L
Sbjct  243   IYL  245


 Score = 77.0 bits (188),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 107/219 (49%), Gaps = 10/219 (5%)
 Frame = +2

Query  1301  SDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSAL  1480
             S G V   + ++    P  + +   G  +  ++  + R+ + GVE +  +D +ID+C+++
Sbjct  258   SIGKVSDSSAIVTDNFPNSEDAIRRG--EYAVIRSLIRVLEGGVEGKRQVDKVIDKCASM  315

Query  1481  QNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQG  1660
             QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI FA Y+ S+         
Sbjct  316   QNLREAIATYRNSILRQPDEMK-REASLSFFVEYLERYYFLICFAVYIHSERA-ALRSSS  373

Query  1661  ESMTTFKHWLHQRPEVQA-MKWSIRLRPG---RFFTIPEELRTPHELKHGDAV-MEAIVK  1825
                ++F  W+  RPE+ + ++  +R  P     + ++   L+   E   G    M  +  
Sbjct  374   IGYSSFADWMKARPELYSIIRRLLRRDPMGALGYASLKPSLKKIAESADGRPYEMGVVAA  433

Query  1826  DRNGSVLGKGSILTMYFFPGQRTSSHIQ-IHGAPHVYKV  1939
              R G VLG  ++L     PG +  +  + + GAP+  +V
Sbjct  434   LRKGEVLGSQTVLKSDHCPGCQNQNLPEGVDGAPNFREV  472


 Score =   134 bits (337),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 129/244 (53%), Gaps = 14/244 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT+ G
Sbjct  843   MEAIVKTRSGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDGYPVYSMATPTIPG  901

Query  696   ILSVIQRIGSSKEG-----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  +      + V   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  902   AKEMLAYLGAKPKAEGSAAQKVILTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGITG  960

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHET-----ADGQIFDSWEHVSSDSVQTPLEVF  1025
               VE MEARLK+DI+ E  R  G +++  E          +    E++ +D V+TP EV+
Sbjct  961   PVVEHMEARLKEDILSEVRRSGGRMLLHREEYSPALNQSSVIGYLENIFADDVKTPAEVY  1020

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+ EG+ I Y RIP+T ++   +SD D +   I  ++     +F    G G       
Sbjct  1021  AALKDEGYNITYRRIPLTREREALASDVDAIQYCIDDSA--GCYLFVSHTGFGGVAYAMA  1078

Query  1206  IACL  1217
             I C+
Sbjct  1079  IVCI  1082


 Score = 86.3 bits (212),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGHLR+DI+Y++KEL+KFPDDDDEH+AYLMDMGI+ALR
Sbjct  1146  VDVVIERCAGAGHLRDDILYYSKELEKFPDDDDEHQAYLMDMGIKALR  1193


 Score = 57.0 bits (136),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 57/109 (52%), Gaps = 3/109 (3%)
 Frame = +2

Query  122   SEDAIRR-GEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD  298
             S++ +RR G+Y  I SL RVL  G + K  VD VI+RCA   +LR+ I  Y   + + PD
Sbjct  1116  SDEEVRRMGDYRDILSLTRVLVYGPKSKADVDVVIERCAGAGHLRDDILYYSKELEKFPD  1175

Query  299   EMKREAA--LSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
             +     A  +   ++ L RY FLI F  YL+    A    +   + RP+
Sbjct  1176  DDDEHQAYLMDMGIKALRRYFFLITFRSYLYCTSAAEIKFASWMDARPE  1224



>ref|XP_010512582.1| PREDICTED: paladin [Camelina sativa]
Length=1257

 Score =   493 bits (1269),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/294 (80%), Positives = 260/294 (88%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA++KPS     EST+GRP EM  VAALRSG VLGSQTVLKSD
Sbjct  392   YSILRRLLRRDPMGALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+R+GSS+ GRPVFWHNM
Sbjct  452   HSPGCQILSLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIERVGSSRGGRPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVE MEARLK+DI+REA+RY GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVEGMEARLKEDILREAKRYDGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD WE+V +DSVQTPLEV+KCLEA+GFPIKYAR+PITD KAPKSSDFDTL 
Sbjct  572   IHETKDGQIFDLWENVDTDSVQTPLEVYKCLEADGFPIKYARVPITDGKAPKSSDFDTLT  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  632   SNIASASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  685


 Score =   335 bits (860),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +2

Query  1346  RPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFN  1525
             R +++    FG++DILLLWKITRLFDNGVE REALDA+IDRCSALQNIR+AVLQYR++FN
Sbjct  712   RSEEEQGRAFGMDDILLLWKITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFN  771

Query  1526  QQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPE  1705
             QQ  EPR R  AL RGAEYLERYFRLIAFAAYLGS AFDGF  +GES  TFK+WLHQRPE
Sbjct  772   QQHVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSKAFDGFFVEGESKVTFKNWLHQRPE  831

Query  1706  VQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG  1885
             VQAMKWSIRLRPGRFFTIPEELR  HE +HGDAVME+IV +R+GSVLGKGSIL MYFFPG
Sbjct  832   VQAMKWSIRLRPGRFFTIPEELRAQHESQHGDAVMESIVNERSGSVLGKGSILKMYFFPG  891

Query  1886  QRTSSHIQIHGAPHVYKV  1939
             QRTSS +QI+GAPHVYKV
Sbjct  892   QRTSSRLQINGAPHVYKV  909


 Score =   191 bits (486),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR NS GR+   G N T  +PNSE+AIRRGEY V+RSLIRVLEGGVEGK+QVDKVID+
Sbjct  254  GFPRNNSFGRIFKAGENITVNLPNSEEAIRRGEYAVVRSLIRVLEGGVEGKRQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVY+H+E
Sbjct  314  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYIHSE  367


 Score =   267 bits (682),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 176/243 (72%), Gaps = 3/243 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  +  ++EGA N+R+     V+GVA PT
Sbjct  5     PKEPEQVMKLRDGSVLGKKTILKSDHFPGCQNKRMTPQIEGAPNYRQADSLRVHGVAIPT  64

Query  687   VSGILSVIQRIGSSKEGRPV--FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+ V   W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  65    AVGIRNVLRHIGAHKDGKQVQVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  123

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS+DS++T LEV++ L+A
Sbjct  124   VRVEQMEARLKEDILMEASRYGNKILVTDELPDGQMVDQWEPVSTDSLKTLLEVYEELQA  183

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK +DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  184   EGYLVDYERVPITDEKSPKETDFDLLIRKISQADINTEIIFNCQMGRGRTTTGMVIATLV  243

Query  1221  KLR  1229
               +
Sbjct  244   YFK  246


 Score =   135 bits (340),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 133/247 (54%), Gaps = 17/247 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  866   MESIVNERSGSVLGKGSILKMYFFPG-QRTSSRLQINGAPHVYKVDRYPVYSMATPTISG  924

Query  696   ILSVIQRIGSS--KEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+   +EG      +   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  925   AKKMLAYLGTKLKEEGGVSTERIVITDLREEAVVYINGTPFVLRELSKPV-DTLKHVGIT  983

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLE  1019
                VE +E RLK+DI+ E  R  G  M++H       + + ++   WE++  D+V+TP E
Sbjct  984   GAVVESIETRLKEDILSEV-RETGGRMLLHREEYSPASNESRVIGYWENIQPDNVKTPAE  1042

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTG  1199
             V+  L+ E F I Y RIP+T +K   +SD D  A+         + +F    G G  +  
Sbjct  1043  VYAALKDENFNISYQRIPLTREKDALASDVD--AIQYCKDDSAGSYLFVSHTGFGGVSYA  1100

Query  1200  TVIACLV  1220
               I CL+
Sbjct  1101  MAITCLL  1107


 Score = 82.0 bits (201),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 96/189 (51%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  289   VVRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA Y+ S+    F   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  348   VEYLERYYFLICFAVYIHSEG--AFLQSGSFGHVSFADWMRARPELYSILRRLLRRDPMG  405

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQI  1912
               G     P   +           M  +   R+G+VLG  ++L     PG Q  S   ++
Sbjct  406   ALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSDHSPGCQILSLPERV  465

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  466   EGAPNFREV  474


 Score = 69.7 bits (169),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             CAGAGHLREDI+Y++KEL K P   DE+R+Y+MDMG++ALR
Sbjct  1174  CAGAGHLREDIVYYSKELNKLPITKDENRSYIMDMGVKALR  1214


 Score = 66.6 bits (161),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  732  ITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  791

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL ++
Sbjct  792  ERYFRLIAFAAYLGSK  807


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP--D  298
             E+A+  G+Y  I SLIRVL  G + K  VD +++ CA   +LRE I  Y   + + P   
Sbjct  1139  EEALSMGDYRDILSLIRVLSHGPQSKSDVDGIVELCAGAGHLREDIVYYSKELNKLPITK  1198

Query  299   EMKREAALSFFVEYLERY*FLICFAVYLH  385
             +  R   +   V+ L RY +LI F  YL+
Sbjct  1199  DENRSYIMDMGVKALRRYFYLITFRSYLY  1227


 Score = 53.9 bits (128),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 60/122 (49%), Gaps = 9/122 (7%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQ-QRTEPRE  1549
               + D   +  + R+  +G + +  +D I++ C+   ++R+ ++ Y +  N+   T+   
Sbjct  1142  LSMGDYRDILSLIRVLSHGPQSKSDVDGIVELCAGAGHLREDIVYYSKELNKLPITKDEN  1201

Query  1550  RRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSI  1729
             R   ++ G + L RYF LI F +YL       +C   E M  F  W+  RPE+  +  ++
Sbjct  1202  RSYIMDMGVKALRRYFYLITFRSYL-------YCTSPEEM-KFLDWMKSRPELGHLCHNL  1253

Query  1730  RL  1735
             R+
Sbjct  1254  RI  1255



>ref|XP_010413320.1| PREDICTED: paladin-like isoform X2 [Camelina sativa]
Length=1252

 Score =   493 bits (1268),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/294 (80%), Positives = 260/294 (88%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA++KPS     EST+GRP EM  VAALRSG VLGSQTVLKSD
Sbjct  392   YSILRRLLRRDPMGALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+R+GSS+ GRPVFWHNM
Sbjct  452   HSPGCQILSLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIERVGSSRGGRPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVE MEARLK+DI+REA+RY GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVEGMEARLKEDILREAKRYDGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD WE+V +DSVQTPLEV+KCLEA+GFPIKYAR+PITD KAPKSSDFDTL 
Sbjct  572   IHETKDGQIFDLWENVDNDSVQTPLEVYKCLEADGFPIKYARVPITDGKAPKSSDFDTLT  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  632   SNIASASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  685


 Score =   335 bits (860),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +2

Query  1346  RPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFN  1525
             R +++    FG++DILLLWKITRLFDNGVE REALDA+IDRCSALQNIR+AVLQYR++FN
Sbjct  712   RSEEEQGRAFGMDDILLLWKITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFN  771

Query  1526  QQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPE  1705
             QQ  EPR R  AL RGAEYLERYFRLIAFAAYLGS AFDGF  +GES  TFK+WLHQRPE
Sbjct  772   QQHVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSKAFDGFFVEGESKVTFKNWLHQRPE  831

Query  1706  VQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG  1885
             VQAMKWSIRLRPGRFFTIPEELR  HE +HGDAVME+IV +R+GSVLGKGSIL MYFFPG
Sbjct  832   VQAMKWSIRLRPGRFFTIPEELRAQHESQHGDAVMESIVNERSGSVLGKGSILKMYFFPG  891

Query  1886  QRTSSHIQIHGAPHVYKV  1939
             QRTSS +QI+GAPHVYKV
Sbjct  892   QRTSSRLQINGAPHVYKV  909


 Score =   191 bits (486),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR NS GR+   G N T  +PNSE+AIRRGEY V+RSLIRVLEGGVEGK+QVDKVID+
Sbjct  254  GFPRNNSFGRIFKAGENITVNLPNSEEAIRRGEYAVVRSLIRVLEGGVEGKRQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVY+H+E
Sbjct  314  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYIHSE  367


 Score =   267 bits (682),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 176/243 (72%), Gaps = 3/243 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  +  ++EGA N+R+     V+GVA PT
Sbjct  5     PKEPEQVMKLRDGSVLGKKTILKSDHFPGCQNKRMTPQIEGAPNYRQADSLRVHGVAIPT  64

Query  687   VSGILSVIQRIGSSKEGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+   V W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  65    AVGIRNVLRHIGAHKDGKQVKVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  123

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS+DS++T LEV++ L+A
Sbjct  124   VRVEQMEARLKEDILMEASRYGNKILVTDELPDGQMVDQWEPVSTDSLKTLLEVYEELQA  183

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK +DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  184   EGYLVDYERVPITDEKSPKETDFDLLIRKISQADINTEIIFNCQMGRGRTTTGMVIATLV  243

Query  1221  KLR  1229
               +
Sbjct  244   YFK  246


 Score =   135 bits (339),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 133/247 (54%), Gaps = 17/247 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  866   MESIVNERSGSVLGKGSILKMYFFPG-QRTSSRLQINGAPHVYKVDRYPVYSMATPTISG  924

Query  696   ILSVIQRIGSS--KEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+   +EG      +   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  925   AKKMLAYLGTKLKEEGGVSTERIVITDLREEAVVYINGTPFVLRELSKPV-DTLKHVGIT  983

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLE  1019
                VE +E RLK+DI+ E  R  G  M++H       + + ++   WE++  D+V+TP E
Sbjct  984   GAVVESIETRLKEDILSEV-RETGGRMLLHREEYSPASNESRVIGYWENIQPDNVKTPAE  1042

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTG  1199
             V+  L+ E F I Y RIP+T +K   +SD D  A+         + +F    G G  +  
Sbjct  1043  VYAALKDENFNISYQRIPLTREKDALASDVD--AIQYCKDDSAGSYLFVSHTGFGGVSYA  1100

Query  1200  TVIACLV  1220
               I CL+
Sbjct  1101  MAITCLL  1107


 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 96/189 (51%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  289   VVRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA Y+ S+    F   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  348   VEYLERYYFLICFAVYIHSEG--AFLQSGSFGHVSFADWMRARPELYSILRRLLRRDPMG  405

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQI  1912
               G     P   +           M  +   R+G+VLG  ++L     PG Q  S   ++
Sbjct  406   ALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSDHSPGCQILSLPERV  465

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  466   EGAPNFREV  474


 Score = 69.7 bits (169),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             CAGAGHLREDI+Y++KEL K P   DE+R+Y+MDMG++ALR
Sbjct  1169  CAGAGHLREDIVYYSKELNKLPITKDENRSYIMDMGVKALR  1209


 Score = 67.0 bits (162),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 63/111 (57%), Gaps = 10/111 (9%)
 Frame = +2

Query  89   CGANATDIMPN-----SEDAIRRG----EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASM  241
            CG+N  +  P      SE+   R     +  ++  + R+ + GVE ++ +D VIDRC+++
Sbjct  697  CGSNNAEERPRNSGRRSEEEQGRAFGMDDILLLWKITRLFDNGVESREALDAVIDRCSAL  756

Query  242  QNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            QN+REA+  YR    +Q  E + R AAL    EYLERY  LI FA YL ++
Sbjct  757  QNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSK  807


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP--D  298
             E+A+  G+Y  I SLIRVL  G + K  VD +++ CA   +LRE I  Y   + + P   
Sbjct  1134  EEALSMGDYRDILSLIRVLSHGPQSKSDVDGIVELCAGAGHLREDIVYYSKELNKLPITK  1193

Query  299   EMKREAALSFFVEYLERY*FLICFAVYLH  385
             +  R   +   V+ L RY +LI F  YL+
Sbjct  1194  DENRSYIMDMGVKALRRYFYLITFRSYLY  1222


 Score = 53.9 bits (128),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 60/122 (49%), Gaps = 9/122 (7%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQ-QRTEPRE  1549
               + D   +  + R+  +G + +  +D I++ C+   ++R+ ++ Y +  N+   T+   
Sbjct  1137  LSMGDYRDILSLIRVLSHGPQSKSDVDGIVELCAGAGHLREDIVYYSKELNKLPITKDEN  1196

Query  1550  RRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSI  1729
             R   ++ G + L RYF LI F +YL       +C   E M  F  W+  RPE+  +  ++
Sbjct  1197  RSYIMDMGVKALRRYFYLITFRSYL-------YCTSPEEM-KFLDWMKSRPELGHLCHNL  1248

Query  1730  RL  1735
             R+
Sbjct  1249  RI  1250



>ref|XP_010413319.1| PREDICTED: paladin-like isoform X1 [Camelina sativa]
Length=1252

 Score =   493 bits (1268),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/294 (80%), Positives = 260/294 (88%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA++KPS     EST+GRP EM  VAALRSG VLGSQTVLKSD
Sbjct  392   YSILRRLLRRDPMGALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+R+GSS+ GRPVFWHNM
Sbjct  452   HSPGCQILSLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIERVGSSRGGRPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVE MEARLK+DI+REA+RY GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVEGMEARLKEDILREAKRYDGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD WE+V +DSVQTPLEV+KCLEA+GFPIKYAR+PITD KAPKSSDFDTL 
Sbjct  572   IHETKDGQIFDLWENVDNDSVQTPLEVYKCLEADGFPIKYARVPITDGKAPKSSDFDTLT  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  632   SNIASASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  685


 Score =   335 bits (859),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = +2

Query  1346  RPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFN  1525
             R + +    FG++DILLLWKITRLFDNGVE REALDA+IDRCSALQNIR+AVLQYR++FN
Sbjct  712   RSEDEQGRAFGMDDILLLWKITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFN  771

Query  1526  QQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPE  1705
             QQ  EPR R  AL RGAEYLERYFRLIAFAAYLGS AFDGF  +GES  TFK+WLHQRPE
Sbjct  772   QQHVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSKAFDGFFVEGESKVTFKNWLHQRPE  831

Query  1706  VQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG  1885
             VQAMKWSIRLRPGRFFTIPEELR  HE +HGDAVME+IV +R+GSVLGKGSIL MYFFPG
Sbjct  832   VQAMKWSIRLRPGRFFTIPEELRAQHESQHGDAVMESIVNERSGSVLGKGSILKMYFFPG  891

Query  1886  QRTSSHIQIHGAPHVYKV  1939
             QRTSS +QI+GAPHVYKV
Sbjct  892   QRTSSRLQINGAPHVYKV  909


 Score =   191 bits (486),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR NS GR+   G N T  +PNSE+AIRRGEY V+RSLIRVLEGGVEGK+QVDKVID+
Sbjct  254  GFPRNNSFGRIFKAGENITVNLPNSEEAIRRGEYAVVRSLIRVLEGGVEGKRQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVY+H+E
Sbjct  314  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYIHSE  367


 Score =   267 bits (682),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 176/243 (72%), Gaps = 3/243 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  +  ++EGA N+R+     V+GVA PT
Sbjct  5     PKEPEQVMKLRDGSVLGKKTILKSDHFPGCQNKRMTPQIEGAPNYRQADSLRVHGVAIPT  64

Query  687   VSGILSVIQRIGSSKEGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+   V W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  65    AVGIRNVLRHIGAHKDGKQVKVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  123

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS+DS++T LEV++ L+A
Sbjct  124   VRVEQMEARLKEDILMEASRYGNKILVTDELPDGQMVDQWEPVSTDSLKTLLEVYEELQA  183

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK +DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  184   EGYLVDYERVPITDEKSPKETDFDLLIRKISQADINTEIIFNCQMGRGRTTTGMVIATLV  243

Query  1221  KLR  1229
               +
Sbjct  244   YFK  246


 Score =   135 bits (339),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 133/247 (54%), Gaps = 17/247 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  866   MESIVNERSGSVLGKGSILKMYFFPG-QRTSSRLQINGAPHVYKVDRYPVYSMATPTISG  924

Query  696   ILSVIQRIGSS--KEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+   +EG      +   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  925   AKKMLAYLGTKLKEEGGVSTERIVITDLREEAVVYINGTPFVLRELSKPV-DTLKHVGIT  983

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLE  1019
                VE +E RLK+DI+ E  R  G  M++H       + + ++   WE++  D+V+TP E
Sbjct  984   GAVVESIETRLKEDILSEV-RETGGRMLLHREEYSPASNESRVIGYWENIQPDNVKTPAE  1042

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTG  1199
             V+  L+ E F I Y RIP+T +K   +SD D  A+         + +F    G G  +  
Sbjct  1043  VYAALKDENFNISYQRIPLTREKDALASDVD--AIQYCKDDSAGSYLFVSHTGFGGVSYA  1100

Query  1200  TVIACLV  1220
               I CL+
Sbjct  1101  MAITCLL  1107


 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 96/189 (51%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  289   VVRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA Y+ S+    F   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  348   VEYLERYYFLICFAVYIHSEG--AFLQSGSFGHVSFADWMRARPELYSILRRLLRRDPMG  405

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQI  1912
               G     P   +           M  +   R+G+VLG  ++L     PG Q  S   ++
Sbjct  406   ALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSDHSPGCQILSLPERV  465

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  466   EGAPNFREV  474


 Score = 69.7 bits (169),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             CAGAGHLREDI+Y++KEL K P   DE+R+Y+MDMG++ALR
Sbjct  1169  CAGAGHLREDIVYYSKELNKLPITKDENRSYIMDMGVKALR  1209


 Score = 68.9 bits (167),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 63/111 (57%), Gaps = 10/111 (9%)
 Frame = +2

Query  89   CGANATDIMPN-----SEDAIRRG----EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASM  241
            CG+N  +  P      SED   R     +  ++  + R+ + GVE ++ +D VIDRC+++
Sbjct  697  CGSNNAEERPRNSGRRSEDEQGRAFGMDDILLLWKITRLFDNGVESREALDAVIDRCSAL  756

Query  242  QNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            QN+REA+  YR    +Q  E + R AAL    EYLERY  LI FA YL ++
Sbjct  757  QNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSK  807


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP--D  298
             E+A+  G+Y  I SLIRVL  G + K  VD +++ CA   +LRE I  Y   + + P   
Sbjct  1134  EEALSMGDYRDILSLIRVLSHGPQSKSDVDGIVELCAGAGHLREDIVYYSKELNKLPITK  1193

Query  299   EMKREAALSFFVEYLERY*FLICFAVYLH  385
             +  R   +   V+ L RY +LI F  YL+
Sbjct  1194  DENRSYIMDMGVKALRRYFYLITFRSYLY  1222


 Score = 53.9 bits (128),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 60/122 (49%), Gaps = 9/122 (7%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQ-QRTEPRE  1549
               + D   +  + R+  +G + +  +D I++ C+   ++R+ ++ Y +  N+   T+   
Sbjct  1137  LSMGDYRDILSLIRVLSHGPQSKSDVDGIVELCAGAGHLREDIVYYSKELNKLPITKDEN  1196

Query  1550  RRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSI  1729
             R   ++ G + L RYF LI F +YL       +C   E M  F  W+  RPE+  +  ++
Sbjct  1197  RSYIMDMGVKALRRYFYLITFRSYL-------YCTSPEEM-KFLDWMKSRPELGHLCHNL  1248

Query  1730  RL  1735
             R+
Sbjct  1249  RI  1250



>ref|XP_006290508.1| hypothetical protein CARUB_v10016586mg [Capsella rubella]
 gb|EOA23406.1| hypothetical protein CARUB_v10016586mg [Capsella rubella]
Length=1257

 Score =   491 bits (1265),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 235/294 (80%), Positives = 259/294 (88%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA++KPS     EST+GRP EM  VAALRSG VLGSQTVLKSD
Sbjct  392   YSILRRLLRRDPMGALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+R+GSS+ GRPVFWHNM
Sbjct  452   HSPGCQILSLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIERVGSSRGGRPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVE MEARLK+DI+REA+RY GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVEGMEARLKEDILREAKRYDGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD WE+V +DSVQTPLEV+KCLEA+GFPIKYAR+PITD KAPKSSDFDTL 
Sbjct  572   IHETKDGQIFDLWENVDADSVQTPLEVYKCLEADGFPIKYARVPITDGKAPKSSDFDTLT  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NI SASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  632   SNITSASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  685


 Score =   334 bits (857),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +2

Query  1352  KKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQ  1531
             +++    FG++DILLLWKITRLFDNGVE REALDA+IDRCSALQNIR+AVLQYR++FNQQ
Sbjct  715   EEEQGRAFGMDDILLLWKITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFNQQ  774

Query  1532  RTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQ  1711
               EPR R  AL RGAEYLERYFRLIAFAAYLGS AFDGF  +GES  TFK+WLHQRPEVQ
Sbjct  775   HVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSKAFDGFFVEGESKVTFKNWLHQRPEVQ  834

Query  1712  AMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQR  1891
             AMKWSIRLRPGRFFTIPEELR  HE +HGDAVME+IV +R+GSVLGKGSIL MYFFPGQR
Sbjct  835   AMKWSIRLRPGRFFTIPEELRAQHESQHGDAVMESIVNERSGSVLGKGSILKMYFFPGQR  894

Query  1892  TSSHIQIHGAPHVYKV  1939
             TSS +QI+GAPHVYKV
Sbjct  895   TSSRLQINGAPHVYKV  910


 Score =   192 bits (489),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR NS GR+   G N T  +PNSE+AIRRGEY V+RSLIRVLEGGVEGK+QVDKVID+
Sbjct  254  GFPRNNSFGRIFKAGENITVNLPNSEEAIRRGEYAVVRSLIRVLEGGVEGKRQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E
Sbjct  314  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSE  367


 Score =   267 bits (683),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 176/243 (72%), Gaps = 3/243 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  +  ++EGA N+R+     V+GVA PT
Sbjct  5     PKEPEQVMKLRDGSVLGKKTILKSDHFPGCQNKRMTPQIEGAPNYRQADSLRVHGVAIPT  64

Query  687   VSGILSVIQRIGSSKEGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+   V W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  65    AVGIRNVLRHIGAHKDGKQVKVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  123

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS+DS++T LEV++ L+A
Sbjct  124   VRVEQMEARLKEDILMEASRYGNKILVTDELPDGQMVDQWEPVSTDSLKTLLEVYEELQA  183

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK +DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  184   EGYLVDYERVPITDEKSPKETDFDLLIRKISQADINTEIIFNCQMGRGRTTTGMVIATLV  243

Query  1221  KLR  1229
               +
Sbjct  244   YFK  246


 Score =   134 bits (338),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 84/246 (34%), Positives = 132/246 (54%), Gaps = 16/246 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  867   MESIVNERSGSVLGKGSILKMYFFPG-QRTSSRLQINGAPHVYKVDRYPVYSMATPTISG  925

Query  696   ILSVIQRIGSS--KEG---RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+   +EG     +   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  926   AKKMLAYLGTKLKEEGGVSERIVVTDLREEAVVYINGTPFVLRELSKPV-DTLKHVGITG  984

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEV  1022
               VE +E RLK+DI+ E  R  G  M++H       +   ++   WE++  D+V+TP EV
Sbjct  985   AVVESIETRLKEDILSEV-RETGGRMLLHREEYSPASNQSRVIGYWENIQPDNVKTPAEV  1043

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ E F I Y RIP+T +K   +SD D  A+         + +F    G G  +   
Sbjct  1044  YAALKDENFNISYRRIPLTREKDALASDVD--AIQYCKDDSAGSYLFVSHTGFGGVSYAM  1101

Query  1203  VIACLV  1220
              I CL+
Sbjct  1102  AITCLL  1107


 Score = 83.2 bits (204),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 94/185 (51%), Gaps = 10/185 (5%)
 Frame = +2

Query  1406  ITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYL  1585
             + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+   EYL
Sbjct  293   LIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFFVEYL  351

Query  1586  ERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP----GR  1747
             ERY+ LI FA YL S+    F   G     +F  W+  RPE+ + ++  +R  P    G 
Sbjct  352   ERYYFLICFAVYLHSEG--AFLQSGSFGHVSFADWMRARPELYSILRRLLRRDPMGALGY  409

Query  1748  FFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIHGAP  1924
                 P   +           M  +   R+G+VLG  ++L     PG Q  S   ++ GAP
Sbjct  410   AAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSDHSPGCQILSLPERVEGAP  469

Query  1925  HVYKV  1939
             +  +V
Sbjct  470   NFREV  474


 Score = 67.4 bits (163),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             CAGAGHLREDI+Y++KEL K P   DE+R+++MDMG++ALR
Sbjct  1174  CAGAGHLREDIVYYSKELNKLPITKDENRSHIMDMGVKALR  1214


 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  733  ITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  792

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL ++
Sbjct  793  ERYFRLIAFAAYLGSK  808


 Score = 56.6 bits (135),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP--D  298
             E+A+  G+Y  I SLIRVL  G + K  VD +++ CA   +LRE I  Y   + + P   
Sbjct  1139  EEALSMGDYRDILSLIRVLSHGPQSKSDVDGIVELCAGAGHLREDIVYYSKELNKLPITK  1198

Query  299   EMKREAALSFFVEYLERY*FLICFAVYLH  385
             +  R   +   V+ L RY +LI F  YL+
Sbjct  1199  DENRSHIMDMGVKALRRYFYLITFRSYLY  1227



>emb|CAB71908.1| putative protein [Arabidopsis thaliana]
Length=1232

 Score =   492 bits (1266),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 235/294 (80%), Positives = 260/294 (88%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA++KPS     EST+GRP EM  VAALRSG VLGSQTVLKSD
Sbjct  391   YSILRRLLRRDPMGALGYAAMKPSLIKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSD  450

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   +LPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+R+GSS+ GRPVFWHNM
Sbjct  451   HSPGCQILNLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIERVGSSRGGRPVFWHNM  510

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVE MEARLK+DI+REA+RY GAIMV
Sbjct  511   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVEGMEARLKEDILREAKRYDGAIMV  570

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD WE+V +DSVQTPLEV+KCLEA+GFPIKYAR+PITD KAPKSSDFDTL 
Sbjct  571   IHETKDGQIFDLWENVDADSVQTPLEVYKCLEADGFPIKYARVPITDGKAPKSSDFDTLT  630

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  631   SNIASASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  684


 Score =   334 bits (856),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 180/216 (83%), Gaps = 0/216 (0%)
 Frame = +2

Query  1292  GDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRC  1471
             G+E+  +     P     R +++    FG++DILLLWKITRLFDNGVE REALDA+IDRC
Sbjct  693   GEETGSNNAEARPRNSGRRTEEEQGRAFGMDDILLLWKITRLFDNGVESREALDAVIDRC  752

Query  1472  SALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFC  1651
             SALQNIR+AVLQYR++FNQQ  EPR R  AL RGAEYLERYFRLIAFAAYLGS AFDGF 
Sbjct  753   SALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSKAFDGFF  812

Query  1652  GQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDR  1831
              +GES  TFK+WLHQRPEVQAMKWSIRLRPGRFFTIPEELR  HE +HGDAVME+IV +R
Sbjct  813   VEGESKVTFKNWLHQRPEVQAMKWSIRLRPGRFFTIPEELRAQHESQHGDAVMESIVNER  872

Query  1832  NGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             +GSVL KGSIL MYFFPGQRTSS +QI+GAPHVYKV
Sbjct  873   SGSVLSKGSILKMYFFPGQRTSSRLQINGAPHVYKV  908


 Score =   192 bits (489),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR NS GR+   G N T  +PNSE+AIRRGEY V+RSLIRVLEGGVEGK+QVDKVID+
Sbjct  253  GFPRNNSFGRIFKAGENITVNLPNSEEAIRRGEYAVVRSLIRVLEGGVEGKRQVDKVIDK  312

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E
Sbjct  313  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSE  366


 Score =   267 bits (682),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 176/243 (72%), Gaps = 3/243 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  +R G VLG +T+LKSDH PGC +  +  ++EGA N+R+     V+GVA PT
Sbjct  4     PKEPEQVMKMRDGSVLGKKTILKSDHFPGCQNKRMTPQIEGAPNYRQADSLRVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+   V W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  64    AVGIRNVLRHIGAHKDGKQVKVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS+DS++T LEV++ L+A
Sbjct  123   VRVEQMEARLKEDILMEASRYGNKILVTDELPDGQMVDQWEPVSTDSLKTLLEVYEELQA  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK +DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  183   EGYLVDYERVPITDEKSPKETDFDLLIRKISQADINTEIIFNCQMGRGRTTTGMVIATLV  242

Query  1221  KLR  1229
               +
Sbjct  243   YFK  245


 Score =   128 bits (322),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 131/247 (53%), Gaps = 17/247 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VL   ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  865   MESIVNERSGSVLSKGSILKMYFFPG-QRTSSRLQINGAPHVYKVDRYPVYSMATPTISG  923

Query  696   ILSVIQRIGSS--KEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+   +EG      +   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  924   AKKMLAYLGTKLKEEGGGSTERIVVTDLREEAVVYINGTPFVLRELSKPV-DTLKHVGIT  982

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLE  1019
                VE +E RLK+DI+ E  R  G  M++H       +   ++   WE++  ++V+TP E
Sbjct  983   GAVVESLETRLKEDILAEV-RETGGRMLLHREEYSPASNQSRVIGYWENIQPENVKTPAE  1041

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTG  1199
             V+  L+ E + I Y RIP+T +K   +SD D  A+         + +F    G G  +  
Sbjct  1042  VYAALKDENYNISYRRIPLTREKDALASDVD--AIQYCKDDSAGSYLFVSHTGFGGVSYA  1099

Query  1200  TVIACLV  1220
               I CL+
Sbjct  1100  MAITCLL  1106


 Score = 82.8 bits (203),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 97/189 (51%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  288   VVRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  346

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA YL S+    F   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  347   VEYLERYYFLICFAVYLHSEG--AFLQSGSLGHVSFADWMRARPELYSILRRLLRRDPMG  404

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQI  1912
               G     P  ++           M  +   R+G+VLG  ++L     PG Q  +   ++
Sbjct  405   ALGYAAMKPSLIKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSDHSPGCQILNLPERV  464

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  465   EGAPNFREV  473


 Score = 72.0 bits (175),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALRPVT  2069
             CAGAGHLREDI+Y++KEL K P   DE+R+Y+MDMG++ALR VT
Sbjct  1171  CAGAGHLREDIVYYSKELNKLPITKDENRSYIMDMGVKALRLVT  1214


 Score = 66.6 bits (161),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  731  ITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL ++
Sbjct  791  ERYFRLIAFAAYLGSK  806



>ref|XP_008798514.1| PREDICTED: paladin isoform X2 [Phoenix dactylifera]
Length=1229

 Score =   485 bits (1248),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/297 (79%), Positives = 261/297 (88%), Gaps = 3/297 (1%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+SLKPS     ES +GRP EM  VAA+R+GEVLGSQTVLKSD
Sbjct  404   YSILRRLLRRDPMGALGYSSLKPSLMKIAESADGRPYEMGVVAAMRNGEVLGSQTVLKSD  463

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI +VIQ I   K  RPV WHNM
Sbjct  464   HCPGCQNLSLPERVEGAPNFREVPGFPVYGVANPTIDGIRAVIQNISRKKGRRPVLWHNM  523

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  524   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAERYSGAIMV  583

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+++S+QTPLEV+KCLEAEG P+KYAR+PITD KAPKSSDFDT+A
Sbjct  584   IHETNDGQIFDAWEHVNAESIQTPLEVYKCLEAEGLPVKYARVPITDGKAPKSSDFDTIA  643

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV-LND--ALHEEL  1283
             L IA ASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIR+ L+D  + HEEL
Sbjct  644   LKIAFASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRMQLDDVSSYHEEL  700


 Score =   328 bits (842),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +2

Query  1334  ILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR  1513
             ++K+   K+  H FGINDILLL KITRLFDNG+ECRE LDAII+RCSALQNIRQAVL YR
Sbjct  721   VVKSGSSKEPQHTFGINDILLLRKITRLFDNGIECREVLDAIINRCSALQNIRQAVLHYR  780

Query  1514  RLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLH  1693
             ++ NQQ  EPR RRVALNRGAEYLERYF+LIAF+AYLGS+AFDGFCGQGE+  +FK WLH
Sbjct  781   KVINQQHVEPRVRRVALNRGAEYLERYFKLIAFSAYLGSEAFDGFCGQGETKISFKTWLH  840

Query  1694  QRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMY  1873
             +RPE+Q MKWSIRLRPG+FFTIPEE +  +E +HGD VMEAI+K R+GSVLGKGSIL MY
Sbjct  841   RRPEIQTMKWSIRLRPGKFFTIPEEPKLLYESQHGDVVMEAIIKARHGSVLGKGSILKMY  900

Query  1874  FFPGQRTSSHIQIHGAPHVYKV  1939
             FFPGQRTSS I+  G PHVYKV
Sbjct  901   FFPGQRTSSRIRFQGTPHVYKV  922


 Score =   205 bits (521),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIG+V   G + TD +PNSE+A+RRGEY VIRSLIRVLEGGVEGKKQVDKVID+
Sbjct  266  GIPRTNSIGKVFGAGNDVTDNIPNSEEAVRRGEYAVIRSLIRVLEGGVEGKKQVDKVIDQ  325

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C SMQNLREAIATYR+SILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+ER AL  
Sbjct  326  CDSMQNLREAIATYRSSILRQPDEMKREASLSFFVEYLERYYFLICFAVYVHSERAALRN  385

Query  410  TS  415
            TS
Sbjct  386  TS  387


 Score =   259 bits (661),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 167/240 (70%), Gaps = 3/240 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E + V   R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT+ 
Sbjct  21    EPEHVMNYRGGSVLGKKTILKSDHFPGCQNKRLTPQIDGAPNYRQAGSLHVHGVAIPTID  80

Query  693   GILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             GI +V+  IG+ + G+   V WHN+REE V+YING+PFVLR+VERP+ N LEYTGI+  R
Sbjct  81    GIRNVLNHIGAKRNGKQKRVLWHNLREEPVVYINGRPFVLRDVERPFSN-LEYTGINRAR  139

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE+ME RLK+DI+ E+ RY   I+V  E  DGQ+ D WE V  DSV+TPLEV++ L+ EG
Sbjct  140   VEQMEFRLKEDILLESTRYGNKILVTDELPDGQMVDQWEPVMHDSVKTPLEVYEELQEEG  199

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + + Y R+PITD+K+PK  DFD L   I+       +VFNCQMG GRTTTG VIA LV L
Sbjct  200   YLVDYERVPITDEKSPKEGDFDDLVHRISQVDLDIEIVFNCQMGRGRTTTGMVIATLVYL  259


 Score =   135 bits (340),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/244 (33%), Positives = 126/244 (52%), Gaps = 14/244 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R G VLG  ++LK    PG    S   R +G  +  ++  +PVY +A PT+ G
Sbjct  879   MEAIIKARHGSVLGKGSILKMYFFPG-QRTSSRIRFQGTPHVYKVDAYPVYSMATPTIDG  937

Query  696   ILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                V+  +G+         R V   ++REE V+YI G PFVLRE+++P  + L++ GI  
Sbjct  938   AREVLSYLGAKDTTNTNIARKVMVIDLREEAVVYIKGTPFVLRELDQPV-DTLKHVGITG  996

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEVF  1025
               VE MEAR+K+DI  E  +  G +++  E     T    +   WE+++ D VQTP EV+
Sbjct  997   PLVEHMEARMKEDIFAEVTQSGGRMLLHREEFNLTTNQSSVIGYWENITLDDVQTPTEVY  1056

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+  G+ I+Y RIP T ++   ++D D +      +++Y   +F    G G       
Sbjct  1057  AALKGGGYDIEYKRIPFTREREALATDVDAIQYCRDESARY--YLFVSHTGFGGVAYAMA  1114

Query  1206  IACL  1217
             I CL
Sbjct  1115  ITCL  1118


 Score = 80.5 bits (197),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 93/188 (49%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE ++ +D +ID+C ++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  301   VIRSLIRVLEGGVEGKKQVDKVIDQCDSMQNLREAIATYRSSILRQPDEMK-REASLSFF  359

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ S+             +F  W+  RPE+ + ++  +R  P   
Sbjct  360   VEYLERYYFLICFAVYVHSERA-ALRNTSSDRISFSDWMRARPELYSILRRLLRRDPMGA  418

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  419   LGYSSLKPSLMKIAESADGRPYEMGVVAAMRNGEVLGSQTVLKSDHCPGCQNLSLPERVE  478

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  479   GAPNFREV  486


 Score = 63.9 bits (154),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + G+E ++ +D +I+RC+++QN+R+A+  YR  I +Q  E + R  AL+  
Sbjct  741  LLRKITRLFDNGIECREVLDAIINRCSALQNIRQAVLHYRKVINQQHVEPRVRRVALNRG  800

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI F+ YL +E
Sbjct  801  AEYLERYFKLIAFSAYLGSE  820



>ref|XP_010473779.1| PREDICTED: uncharacterized protein LOC104753188 [Camelina sativa]
Length=1618

 Score =   491 bits (1265),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 235/294 (80%), Positives = 259/294 (88%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA++KPS     EST+GRP EM  VAALRSG VLGSQTVLKSD
Sbjct  753   YSILRRLLRRDPMGALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSD  812

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   +LPER+EGA NFRE+PGFPVYGVANPT+ GI SVI R+GSS+ GRPVFWHNM
Sbjct  813   HSPGCQILNLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIDRVGSSRGGRPVFWHNM  872

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVE MEARLK+DI+REA+RY GAIMV
Sbjct  873   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVEGMEARLKEDILREAKRYDGAIMV  932

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD WE+V +DSVQTPLEV+KCLEA+GFPIKYAR+PITD KAPKSSDFDTL 
Sbjct  933   IHETKDGQIFDLWENVDTDSVQTPLEVYKCLEADGFPIKYARVPITDGKAPKSSDFDTLT  992

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  993   SNIASASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  1046


 Score =   335 bits (860),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = +2

Query  1346  RPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFN  1525
             R +++    FG++DILLLWKITRLFDNGVE REALDA+IDRCSALQNIR+AVLQYR++FN
Sbjct  1073  RSEEEQGRAFGMDDILLLWKITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFN  1132

Query  1526  QQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPE  1705
             QQ  EPR R  AL RGAEYLERYFRLIAFAAYLGS AFDGF  +GES  TFK+WLHQRPE
Sbjct  1133  QQHVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSKAFDGFFVEGESKVTFKNWLHQRPE  1192

Query  1706  VQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG  1885
             VQAMKWSIRLRPGRFFTIPEELR  HE +HGDAVME+IV +R+GSVLGKGSIL MYFFPG
Sbjct  1193  VQAMKWSIRLRPGRFFTIPEELRAQHESQHGDAVMESIVNERSGSVLGKGSILKMYFFPG  1252

Query  1886  QRTSSHIQIHGAPHVYKV  1939
             QRTSS +QI+GAPHVYKV
Sbjct  1253  QRTSSRLQINGAPHVYKV  1270


 Score =   191 bits (486),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR NS GR+   G N T  +PNSE+AIRRGEY V+RSLIRVLEGGVEGK+QVDKVID+
Sbjct  615  GFPRNNSFGRIFKAGENITVNLPNSEEAIRRGEYAVVRSLIRVLEGGVEGKRQVDKVIDK  674

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVY+H+E
Sbjct  675  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYIHSE  728


 Score =   207 bits (528),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 124/276 (45%), Positives = 154/276 (56%), Gaps = 60/276 (22%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA++KPS     EST+GRP EM  VAALRSG VLGSQTVLKSD
Sbjct  392   YSILRRLLRRDPMGALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   +LPER+EGA NFRE+PGFPVYGVANPT+ GI SVI  +              
Sbjct  452   HSPGCQILNLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIXCVS-------------  498

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
               +H+ Y  G   ++ + E P          D + V++ E    D +    E Y      
Sbjct  499   --DHLPYRYGNKILVTD-ELP----------DGQMVDQWEPVSTDSLKTLLEVYE-----  540

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
                 A+G + D                            Y R+PITD+K+PK +DFD L 
Sbjct  541   -ELQAEGYLVD----------------------------YERVPITDEKSPKETDFDLLI  571

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLR  1229
               I+ A   T ++FNCQMG GRTTTG VIA LV  +
Sbjct  572   RKISQADINTEIIFNCQMGRGRTTTGMVIATLVYFK  607


 Score =   191 bits (486),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR NS GR+   G N T  +PNSE+AIRRGEY V+RSLIRVLEGGVEGK+QVDKVID+
Sbjct  254  GFPRNNSFGRIFKAGENITVNLPNSEEAIRRGEYAVVRSLIRVLEGGVEGKRQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVY+H+E
Sbjct  314  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYIHSE  367


 Score =   267 bits (683),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 176/243 (72%), Gaps = 3/243 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  +  ++EGA N+R+     V+GVA PT
Sbjct  5     PKEPEQVMKLRDGSVLGKKTILKSDHFPGCQNKRMTPQIEGAPNYRQADSLRVHGVAIPT  64

Query  687   VSGILSVIQRIGSSKEGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+   V W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  65    AVGIRNVLRHIGAHKDGKQVKVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  123

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS+DS++T LEV++ L+A
Sbjct  124   VRVEQMEARLKEDILMEASRYGNKILVTDELPDGQMVDQWEPVSTDSLKTLLEVYEELQA  183

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK +DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  184   EGYLVDYERVPITDEKSPKETDFDLLIRKISQADINTEIIFNCQMGRGRTTTGMVIATLV  243

Query  1221  KLR  1229
               +
Sbjct  244   YFK  246


 Score =   134 bits (338),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 133/247 (54%), Gaps = 17/247 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  1227  MESIVNERSGSVLGKGSILKMYFFPG-QRTSSRLQINGAPHVYKVDRYPVYSMATPTISG  1285

Query  696   ILSVIQRIGSS--KEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+   +EG      +   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  1286  AKKMLAYLGTKLKEEGGVSTERIVITDLREEAVVYINGTPFVLRELSKPV-DTLKHVGIT  1344

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLE  1019
                VE +E RLK+DI+ E  R  G  M++H       + + ++   WE++  D+V+TP E
Sbjct  1345  GAVVESIEIRLKEDILSEV-RETGGRMLLHREEYSPASNESRVIGYWENIQPDNVKTPAE  1403

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTG  1199
             V+  L+ E F I Y RIP+T +K   +SD D  A+         + +F    G G  +  
Sbjct  1404  VYAALKDENFNITYQRIPLTREKDALASDVD--AIQYCKDDSAGSYLFVSHTGFGGVSYA  1461

Query  1200  TVIACLV  1220
               I CL+
Sbjct  1462  MAITCLL  1468


 Score = 80.9 bits (198),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 96/189 (51%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  289   VVRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  347

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA Y+ S+    F   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  348   VEYLERYYFLICFAVYIHSEG--AFLQSGSFGHVSFADWMRARPELYSILRRLLRRDPMG  405

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQI  1912
               G     P   +           M  +   R+G+VLG  ++L     PG Q  +   ++
Sbjct  406   ALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSDHSPGCQILNLPERV  465

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  466   EGAPNFREV  474


 Score = 80.9 bits (198),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 96/189 (51%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  650   VVRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  708

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA Y+ S+    F   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  709   VEYLERYYFLICFAVYIHSEG--AFLQSGSFGHVSFADWMRARPELYSILRRLLRRDPMG  766

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQI  1912
               G     P   +           M  +   R+G+VLG  ++L     PG Q  +   ++
Sbjct  767   ALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSDHSPGCQILNLPERV  826

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  827   EGAPNFREV  835


 Score = 69.7 bits (169),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             CAGAGHLREDI+Y++KEL K P   DE+R+Y+MDMG++ALR
Sbjct  1535  CAGAGHLREDIVYYSKELNKLPITKDENRSYIMDMGVKALR  1575


 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167   LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
             + R+ + GVE ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  1093  ITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  1152

Query  344   ERY*FLICFAVYLHTE  391
             ERY  LI FA YL ++
Sbjct  1153  ERYFRLIAFAAYLGSK  1168


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP--D  298
             E+A+  G+Y  I SLIRVL  G + K  VD +++ CA   +LRE I  Y   + + P   
Sbjct  1500  EEALSMGDYRDILSLIRVLSHGPQSKSDVDGIVELCAGAGHLREDIVYYSKELNKLPITK  1559

Query  299   EMKREAALSFFVEYLERY*FLICFAVYLH  385
             +  R   +   V+ L RY +LI F  YL+
Sbjct  1560  DENRSYIMDMGVKALRRYFYLITFRSYLY  1588


 Score = 53.9 bits (128),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 60/122 (49%), Gaps = 9/122 (7%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQ-QRTEPRE  1549
               + D   +  + R+  +G + +  +D I++ C+   ++R+ ++ Y +  N+   T+   
Sbjct  1503  LSMGDYRDILSLIRVLSHGPQSKSDVDGIVELCAGAGHLREDIVYYSKELNKLPITKDEN  1562

Query  1550  RRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSI  1729
             R   ++ G + L RYF LI F +YL       +C   E M  F  W+  RPE+  +  ++
Sbjct  1563  RSYIMDMGVKALRRYFYLITFRSYL-------YCTSPEEM-KFLDWMKSRPELGHLCHNL  1614

Query  1730  RL  1735
             R+
Sbjct  1615  RI  1616



>ref|XP_002876651.1| metal ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52910.1| metal ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=1254

 Score =   492 bits (1266),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 235/294 (80%), Positives = 260/294 (88%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA++KPS     EST+GRP EM  VAALRSG VLGSQTVLKSD
Sbjct  391   YSILRRLLRRDPMGALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSD  450

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+R+GSS+ GRPVFWHNM
Sbjct  451   HSPGCQILSLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIERVGSSRGGRPVFWHNM  510

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVE MEARLK+DI+REA+RY GAIMV
Sbjct  511   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVEGMEARLKEDILREAKRYDGAIMV  570

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD WE+V +DSVQTPLEV+KCLEA+GFPIKYAR+PITD KAPKSSDFDTL 
Sbjct  571   IHETKDGQIFDLWENVDADSVQTPLEVYKCLEADGFPIKYARVPITDGKAPKSSDFDTLT  630

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  ++
Sbjct  631   SNIASASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHDI  684


 Score =   333 bits (855),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 181/216 (84%), Gaps = 0/216 (0%)
 Frame = +2

Query  1292  GDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRC  1471
             G+E+  +     P     R +++    FG++DILLLWKITRLFDNGVE REALDA+IDRC
Sbjct  693   GEETGSNNAEARPRNSGRRTEEEQGRAFGMDDILLLWKITRLFDNGVESREALDAVIDRC  752

Query  1472  SALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFC  1651
             SALQNIR+AVLQYR++FNQQ  EPR R  AL RGAEYLERYFRLIAFAAYLGS AFDGF 
Sbjct  753   SALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSKAFDGFF  812

Query  1652  GQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDR  1831
              +GES  TFK+WL+QRPEVQAMKWSIRLRPGRFFTIPEELR  HE +HGDAVME+IV +R
Sbjct  813   VEGESKVTFKNWLNQRPEVQAMKWSIRLRPGRFFTIPEELRAQHESQHGDAVMESIVNER  872

Query  1832  NGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             +GSVLGKGSIL MYFFPGQRTSS +QI+GAPHVYKV
Sbjct  873   SGSVLGKGSILKMYFFPGQRTSSRLQINGAPHVYKV  908


 Score =   192 bits (489),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR NS GR+   G N T  +PNSE+AIRRGEY V+RSLIRVLEGGVEGK+QVDKVID+
Sbjct  253  GFPRNNSFGRIFKAGENITVNLPNSEEAIRRGEYAVVRSLIRVLEGGVEGKRQVDKVIDK  312

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E
Sbjct  313  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSE  366


 Score =   267 bits (682),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 176/243 (72%), Gaps = 3/243 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  +  ++EGA N+R+     V+GVA PT
Sbjct  4     PKEPEQVMKLRDGSVLGKKTILKSDHFPGCQNKRMTPQIEGAPNYRQADSLRVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+   V W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  64    AVGIRNVLRHIGAHKDGKQAKVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS+DS++T LEV++ L+A
Sbjct  123   VRVEQMEARLKEDILMEASRYGNKILVTDELPDGQMVDQWEPVSTDSLKTLLEVYEELQA  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK +DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  183   EGYLLDYERVPITDEKSPKETDFDLLIRKISQADINTEIIFNCQMGRGRTTTGMVIATLV  242

Query  1221  KLR  1229
               +
Sbjct  243   YFK  245


 Score =   133 bits (334),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/247 (34%), Positives = 133/247 (54%), Gaps = 17/247 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  865   MESIVNERSGSVLGKGSILKMYFFPG-QRTSSRLQINGAPHVYKVDRYPVYSMATPTISG  923

Query  696   ILSVIQRIGSS--KEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+   +EG      +   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  924   AKKMLAYLGTKLKEEGGVSTERIVVTDLREEAVVYINGTPFVLRELSKPV-DTLKHVGIT  982

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLE  1019
                VE +E+RLK+DI+ E  R  G  M++H       +   ++   WE++  D+V+TP E
Sbjct  983   GAVVESIESRLKEDILAEV-RETGGRMLLHREEYSPASNQSRVIGYWENIQPDNVKTPAE  1041

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTG  1199
             V+  L+ E + I Y RIP+T +K   +SD D  A+         + +F    G G  +  
Sbjct  1042  VYAALKDENYNISYRRIPLTREKDALASDVD--AIQYCKDDSAGSYLFVSHTGFGGVSYA  1099

Query  1200  TVIACLV  1220
               I CL+
Sbjct  1100  MAITCLL  1106


 Score = 82.8 bits (203),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 96/189 (51%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  288   VVRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  346

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA YL S+    F   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  347   VEYLERYYFLICFAVYLHSEG--AFLQSGSLGHVSFADWMRARPELYSILRRLLRRDPMG  404

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQI  1912
               G     P   +           M  +   R+G+VLG  ++L     PG Q  S   ++
Sbjct  405   ALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSDHSPGCQILSLPERV  464

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  465   EGAPNFREV  473


 Score = 69.7 bits (169),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             CAGAGHLREDI+Y++KEL K P   DE+R+Y+MDMG++ALR
Sbjct  1171  CAGAGHLREDIVYYSKELNKLPITKDENRSYIMDMGVKALR  1211


 Score = 66.6 bits (161),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  731  ITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL ++
Sbjct  791  ERYFRLIAFAAYLGSK  806


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP--D  298
             E+A+  G+Y  I SLIRVL  G + K  VD +++ CA   +LRE I  Y   + + P   
Sbjct  1136  EEALSMGDYRDILSLIRVLSHGPQSKSDVDGIVELCAGAGHLREDIVYYSKELNKLPITK  1195

Query  299   EMKREAALSFFVEYLERY*FLICFAVYLH  385
             +  R   +   V+ L RY +LI F  YL+
Sbjct  1196  DENRSYIMDMGVKALRRYFYLITFRSYLY  1224


 Score = 53.9 bits (128),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 60/122 (49%), Gaps = 9/122 (7%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQ-QRTEPRE  1549
               + D   +  + R+  +G + +  +D I++ C+   ++R+ ++ Y +  N+   T+   
Sbjct  1139  LSMGDYRDILSLIRVLSHGPQSKSDVDGIVELCAGAGHLREDIVYYSKELNKLPITKDEN  1198

Query  1550  RRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSI  1729
             R   ++ G + L RYF LI F +YL       +C   E M  F  W+  RPE+  +  ++
Sbjct  1199  RSYIMDMGVKALRRYFYLITFRSYL-------YCTSPEEM-KFLDWMKSRPELGHLCNNL  1250

Query  1730  RL  1735
             R+
Sbjct  1251  RI  1252



>ref|XP_008798513.1| PREDICTED: paladin isoform X1 [Phoenix dactylifera]
Length=1270

 Score =   485 bits (1248),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/297 (79%), Positives = 261/297 (88%), Gaps = 3/297 (1%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+SLKPS     ES +GRP EM  VAA+R+GEVLGSQTVLKSD
Sbjct  404   YSILRRLLRRDPMGALGYSSLKPSLMKIAESADGRPYEMGVVAAMRNGEVLGSQTVLKSD  463

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI +VIQ I   K  RPV WHNM
Sbjct  464   HCPGCQNLSLPERVEGAPNFREVPGFPVYGVANPTIDGIRAVIQNISRKKGRRPVLWHNM  523

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  524   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAERYSGAIMV  583

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+++S+QTPLEV+KCLEAEG P+KYAR+PITD KAPKSSDFDT+A
Sbjct  584   IHETNDGQIFDAWEHVNAESIQTPLEVYKCLEAEGLPVKYARVPITDGKAPKSSDFDTIA  643

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV-LND--ALHEEL  1283
             L IA ASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIR+ L+D  + HEEL
Sbjct  644   LKIAFASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRMQLDDVSSYHEEL  700


 Score =   328 bits (841),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +2

Query  1334  ILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR  1513
             ++K+   K+  H FGINDILLL KITRLFDNG+ECRE LDAII+RCSALQNIRQAVL YR
Sbjct  721   VVKSGSSKEPQHTFGINDILLLRKITRLFDNGIECREVLDAIINRCSALQNIRQAVLHYR  780

Query  1514  RLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLH  1693
             ++ NQQ  EPR RRVALNRGAEYLERYF+LIAF+AYLGS+AFDGFCGQGE+  +FK WLH
Sbjct  781   KVINQQHVEPRVRRVALNRGAEYLERYFKLIAFSAYLGSEAFDGFCGQGETKISFKTWLH  840

Query  1694  QRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMY  1873
             +RPE+Q MKWSIRLRPG+FFTIPEE +  +E +HGD VMEAI+K R+GSVLGKGSIL MY
Sbjct  841   RRPEIQTMKWSIRLRPGKFFTIPEEPKLLYESQHGDVVMEAIIKARHGSVLGKGSILKMY  900

Query  1874  FFPGQRTSSHIQIHGAPHVYKV  1939
             FFPGQRTSS I+  G PHVYKV
Sbjct  901   FFPGQRTSSRIRFQGTPHVYKV  922


 Score =   204 bits (520),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIG+V   G + TD +PNSE+A+RRGEY VIRSLIRVLEGGVEGKKQVDKVID+
Sbjct  266  GIPRTNSIGKVFGAGNDVTDNIPNSEEAVRRGEYAVIRSLIRVLEGGVEGKKQVDKVIDQ  325

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C SMQNLREAIATYR+SILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+ER AL  
Sbjct  326  CDSMQNLREAIATYRSSILRQPDEMKREASLSFFVEYLERYYFLICFAVYVHSERAALRN  385

Query  410  TS  415
            TS
Sbjct  386  TS  387


 Score =   259 bits (661),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 167/240 (70%), Gaps = 3/240 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E + V   R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT+ 
Sbjct  21    EPEHVMNYRGGSVLGKKTILKSDHFPGCQNKRLTPQIDGAPNYRQAGSLHVHGVAIPTID  80

Query  693   GILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             GI +V+  IG+ + G+   V WHN+REE V+YING+PFVLR+VERP+ N LEYTGI+  R
Sbjct  81    GIRNVLNHIGAKRNGKQKRVLWHNLREEPVVYINGRPFVLRDVERPFSN-LEYTGINRAR  139

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE+ME RLK+DI+ E+ RY   I+V  E  DGQ+ D WE V  DSV+TPLEV++ L+ EG
Sbjct  140   VEQMEFRLKEDILLESTRYGNKILVTDELPDGQMVDQWEPVMHDSVKTPLEVYEELQEEG  199

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + + Y R+PITD+K+PK  DFD L   I+       +VFNCQMG GRTTTG VIA LV L
Sbjct  200   YLVDYERVPITDEKSPKEGDFDDLVHRISQVDLDIEIVFNCQMGRGRTTTGMVIATLVYL  259


 Score =   135 bits (340),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/244 (33%), Positives = 126/244 (52%), Gaps = 14/244 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R G VLG  ++LK    PG    S   R +G  +  ++  +PVY +A PT+ G
Sbjct  879   MEAIIKARHGSVLGKGSILKMYFFPG-QRTSSRIRFQGTPHVYKVDAYPVYSMATPTIDG  937

Query  696   ILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                V+  +G+         R V   ++REE V+YI G PFVLRE+++P  + L++ GI  
Sbjct  938   AREVLSYLGAKDTTNTNIARKVMVIDLREEAVVYIKGTPFVLRELDQPV-DTLKHVGITG  996

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEVF  1025
               VE MEAR+K+DI  E  +  G +++  E     T    +   WE+++ D VQTP EV+
Sbjct  997   PLVEHMEARMKEDIFAEVTQSGGRMLLHREEFNLTTNQSSVIGYWENITLDDVQTPTEVY  1056

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+  G+ I+Y RIP T ++   ++D D +      +++Y   +F    G G       
Sbjct  1057  AALKGGGYDIEYKRIPFTREREALATDVDAIQYCRDESARY--YLFVSHTGFGGVAYAMA  1114

Query  1206  IACL  1217
             I CL
Sbjct  1115  ITCL  1118


 Score = 80.5 bits (197),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 93/188 (49%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE ++ +D +ID+C ++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  301   VIRSLIRVLEGGVEGKKQVDKVIDQCDSMQNLREAIATYRSSILRQPDEMK-REASLSFF  359

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ S+             +F  W+  RPE+ + ++  +R  P   
Sbjct  360   VEYLERYYFLICFAVYVHSERA-ALRNTSSDRISFSDWMRARPELYSILRRLLRRDPMGA  418

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  419   LGYSSLKPSLMKIAESADGRPYEMGVVAAMRNGEVLGSQTVLKSDHCPGCQNLSLPERVE  478

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  479   GAPNFREV  486


 Score = 70.9 bits (172),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHLR+DI+Y+ KEL+K P +DDE  +YLMDMGI+ALR
Sbjct  1180  VDTVIERCAGAGHLRDDILYYRKELEKCPSEDDERWSYLMDMGIKALR  1227


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 64/122 (52%), Gaps = 2/122 (2%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             VS+  A       + ED IR+G+Y  I SL RVL  G + K++VD VI+RCA   +LR+ 
Sbjct  1137  VSTSPAGRFPYQASHEDEIRQGDYRDILSLTRVLVYGPKSKEEVDTVIERCAGAGHLRDD  1196

Query  260   IATYRNSILRQP--DEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKR  433
             I  YR  + + P  D+ +    +   ++ L RY FLI F  YL+    +    +   E R
Sbjct  1197  ILYYRKELEKCPSEDDERWSYLMDMGIKALRRYFFLITFRSYLYCTCPSETGFASWMEAR  1256

Query  434   PD  439
             P+
Sbjct  1257  PE  1258


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + G+E ++ +D +I+RC+++QN+R+A+  YR  I +Q  E + R  AL+  
Sbjct  741  LLRKITRLFDNGIECREVLDAIINRCSALQNIRQAVLHYRKVINQQHVEPRVRRVALNRG  800

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI F+ YL +E
Sbjct  801  AEYLERYFKLIAFSAYLGSE  820


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 66/128 (52%), Gaps = 11/128 (9%)
 Frame = +2

Query  1361  SSHEFGI--NDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQR  1534
             +SHE  I   D   +  +TR+   G + +E +D +I+RC+   ++R  +L YR+   +  
Sbjct  1149  ASHEDEIRQGDYRDILSLTRVLVYGPKSKEEVDTVIERCAGAGHLRDDILYYRKELEKCP  1208

Query  1535  TEPRER-RVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQ  1711
             +E  ER    ++ G + L RYF LI F +YL       +C    S T F  W+  RPE+ 
Sbjct  1209  SEDDERWSYLMDMGIKALRRYFFLITFRSYL-------YC-TCPSETGFASWMEARPELG  1260

Query  1712  AMKWSIRL  1735
              +  ++RL
Sbjct  1261  HLCDNLRL  1268



>ref|XP_010035361.1| PREDICTED: paladin isoform X3 [Eucalyptus grandis]
Length=1129

 Score =   483 bits (1244),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 260/295 (88%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY SL+PS     ES +GRP EM  VAA R+GEVLGSQTVLKSD
Sbjct  265   YSIIRRLLRRDPMGALGYTSLEPSLMKMAESADGRPYEMGVVAARRTGEVLGSQTVLKSD  324

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVIQRIGS   GRPVFWHNM
Sbjct  325   HCPGCQNQSLPERVEGAPNFREVPGFPVYGVANPTIDGIKSVIQRIGSGICGRPVFWHNM  384

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERP+KNMLEY+GID ERVE+MEARLK+DI+REAE Y GAIMV
Sbjct  385   REEPVIYINGKPFVLREVERPFKNMLEYSGIDRERVEKMEARLKEDILREAETYVGAIMV  444

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET  GQIFD+WEHV+S SVQTPLEVF+ LE++GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  445   IHETEKGQIFDAWEHVNSSSVQTPLEVFENLESDGFPIKYARVPITDGKAPKSSDFDTLA  504

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEEL  1283
             +NI+SASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPI++L  DA  EE+
Sbjct  505   MNISSASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIKILFADAKQEEV  559


 Score =   349 bits (896),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             +G+E +G+       + K +  ++    FGINDI+LL KITRLFDNG+ECREALDAIIDR
Sbjct  565   NGEEINGNGAASTSPVSKEKLSEEQGRAFGINDIVLLGKITRLFDNGLECREALDAIIDR  624

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVL+YR++FNQQ  EPR R+VALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  625   CSALQNIRQAVLEYRKVFNQQHAEPRVRQVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  684

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGE   TFK W HQRPEVQAMKWSIRLRPGRFF+IPEELR   E +HGDAVMEAIVK 
Sbjct  685   CGQGEMRMTFKTWQHQRPEVQAMKWSIRLRPGRFFSIPEELRVSQESQHGDAVMEAIVKS  744

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL  YFFPGQRTSSHIQI GAPHVYKV
Sbjct  745   RNGSVLGKGSILKKYFFPGQRTSSHIQIDGAPHVYKV  781


 Score =   185 bits (469),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGRV   G++ T  +PNSE+AI RGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  127  GIPRTNSIGRVLDSGSDVTVNLPNSEEAIPRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  186

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLH  385
            CASMQNLREAIAT RN+IL QPDEMKREA+LS FVEYLERY +LICFAVY+H
Sbjct  187  CASMQNLREAIATNRNNILHQPDEMKREASLSTFVEYLERYYYLICFAVYIH  238


 Score =   137 bits (346),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 136/247 (55%), Gaps = 14/247 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   +++GA +  ++ G+PV+ +A PT+ G
Sbjct  738   MEAIVKSRNGSVLGKGSILKKYFFPG-QRTSSHIQIDGAPHVYKVDGYPVFSMATPTIDG  796

Query  696   ILSVIQRIGSSKEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  +G+        R V   ++REE V+YING PFVLRE+ +P  + L++ GI   
Sbjct  797   AKEMLAYLGAKPAAGVTSRKVIITDLREEAVVYINGMPFVLRELNKPV-DTLKHAGITGS  855

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDS-----WEHVSSDSVQTPLEVFK  1028
              VE MEARLK+DI+ E  +  G +++ HE  +     S     W+++ +D ++TP EV+ 
Sbjct  856   VVEHMEARLKEDILFEVRQSSGQMLLHHEEYNATSHQSSVTGYWKNILTDDIKTPAEVYA  915

Query  1029  CLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVI  1208
              L+ EG+ I Y RIP+T ++   +SD D+L  +   ++     ++    G G       I
Sbjct  916   SLKDEGYNIAYRRIPLTREREALASDVDSLQYHKDDSA--GCYLYVSHTGFGGVAYAMAI  973

Query  1209  ACLVKLR  1229
              C +KL+
Sbjct  974   TC-IKLK  979


 Score =   124 bits (310),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = +3

Query  876   MEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEV---FKCLEAEG  1046
             ME RLK+DIM EA RY   I+V  E  D QI D WE VS DSV+TPLEV   ++ L  EG
Sbjct  1     MEDRLKEDIMMEAARYGNKILVTDELPDYQIVDQWEPVSRDSVKTPLEVSYVYQELHDEG  60

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + + Y R+P+TD+K+P+  D D L   I+     T ++FNCQMG GRTTTG VIA L+ L
Sbjct  61    YLVDYERVPLTDEKSPEEQDIDDLVEKISRVDVNTEIIFNCQMGRGRTTTGMVIATLIYL  120


 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 92/195 (47%), Gaps = 22/195 (11%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+   R     Q  E + R  +L+  
Sbjct  162   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATNRNNILHQPDEMK-REASLSTF  220

Query  1574  AEYLERYFRLIAFAAYL------GSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              EYLERY+ LI FA Y+         +  G C       TF  W+  RPE+ ++   + L
Sbjct  221   VEYLERYYYLICFAVYIHSERESLRSSSLGRC-------TFAEWMKARPELYSIIRRL-L  272

Query  1736  RPGRFFTIPEELRTPHELKHGDAV------MEAIVKDRNGSVLGKGSILTMYFFPG-QRT  1894
             R      +      P  +K  ++       M  +   R G VLG  ++L     PG Q  
Sbjct  273   RRDPMGALGYTSLEPSLMKMAESADGRPYEMGVVAARRTGEVLGSQTVLKSDHCPGCQNQ  332

Query  1895  SSHIQIHGAPHVYKV  1939
             S   ++ GAP+  +V
Sbjct  333   SLPERVEGAPNFREV  347


 Score = 71.6 bits (174),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHL++DI+Y+ KEL+K  D DDE R+YLMDMGI+ALR
Sbjct  1039  VDTIINRCAGAGHLQDDILYYRKELEKLSDCDDEKRSYLMDMGIKALR  1086


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +2

Query  146  EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAAL  322
            +  ++  + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R+ AL
Sbjct  597  DIVLLGKITRLFDNGLECREALDAIIDRCSALQNIRQAVLEYRKVFNQQHAEPRVRQVAL  656

Query  323  SFFVEYLERY*FLICFAVYLHTE  391
            +   EYLERY  LI FA YL +E
Sbjct  657  NRGAEYLERYFRLIAFAAYLGSE  679


 Score = 58.5 bits (140),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 63/120 (53%), Gaps = 9/120 (8%)
 Frame = +2

Query  1379  INDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRV  1558
             ++D   +  +TR+ + G + +  +D II+RC+   +++  +L YR+   +      E+R 
Sbjct  1016  MDDYGDILNLTRVLEYGPKSKADVDTIINRCAGAGHLQDDILYYRKELEKLSDCDDEKRS  1075

Query  1559  AL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              L + G + L RYF LI F +YL       +C    + TTF  W+  RPE+  +  ++R+
Sbjct  1076  YLMDMGIKALRRYFYLITFQSYL-------YCASAPA-TTFTAWMDARPELGHLCNNLRI  1127


 Score = 57.4 bits (137),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = +2

Query  83    SSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAI  262
             S+ G N +    + ++A++  +Y  I +L RVLE G + K  VD +I+RCA   +L++ I
Sbjct  999   SAAGENLS--RTSDDEALKMDDYGDILNLTRVLEYGPKSKADVDTIINRCAGAGHLQDDI  1056

Query  263   ATYRNSI--LRQPDEMKREAALSFFVEYLERY*FLICFAVYLH  385
               YR  +  L   D+ KR   +   ++ L RY +LI F  YL+
Sbjct  1057  LYYRKELEKLSDCDDEKRSYLMDMGIKALRRYFYLITFQSYLY  1099



>ref|NP_191760.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE80293.1| uncharacterized protein AT3G62010 [Arabidopsis thaliana]
Length=1254

 Score =   491 bits (1265),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 235/294 (80%), Positives = 260/294 (88%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA++KPS     EST+GRP EM  VAALRSG VLGSQTVLKSD
Sbjct  391   YSILRRLLRRDPMGALGYAAMKPSLIKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSD  450

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   +LPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+R+GSS+ GRPVFWHNM
Sbjct  451   HSPGCQILNLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIERVGSSRGGRPVFWHNM  510

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVE MEARLK+DI+REA+RY GAIMV
Sbjct  511   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVEGMEARLKEDILREAKRYDGAIMV  570

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD WE+V +DSVQTPLEV+KCLEA+GFPIKYAR+PITD KAPKSSDFDTL 
Sbjct  571   IHETKDGQIFDLWENVDADSVQTPLEVYKCLEADGFPIKYARVPITDGKAPKSSDFDTLT  630

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  631   SNIASASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  684


 Score =   333 bits (855),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 180/216 (83%), Gaps = 0/216 (0%)
 Frame = +2

Query  1292  GDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRC  1471
             G+E+  +     P     R +++    FG++DILLLWKITRLFDNGVE REALDA+IDRC
Sbjct  693   GEETGSNNAEARPRNSGRRTEEEQGRAFGMDDILLLWKITRLFDNGVESREALDAVIDRC  752

Query  1472  SALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFC  1651
             SALQNIR+AVLQYR++FNQQ  EPR R  AL RGAEYLERYFRLIAFAAYLGS AFDGF 
Sbjct  753   SALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSKAFDGFF  812

Query  1652  GQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDR  1831
              +GES  TFK+WLHQRPEVQAMKWSIRLRPGRFFTIPEELR  HE +HGDAVME+IV +R
Sbjct  813   VEGESKVTFKNWLHQRPEVQAMKWSIRLRPGRFFTIPEELRAQHESQHGDAVMESIVNER  872

Query  1832  NGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             +GSVL KGSIL MYFFPGQRTSS +QI+GAPHVYKV
Sbjct  873   SGSVLSKGSILKMYFFPGQRTSSRLQINGAPHVYKV  908


 Score =   192 bits (489),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR NS GR+   G N T  +PNSE+AIRRGEY V+RSLIRVLEGGVEGK+QVDKVID+
Sbjct  253  GFPRNNSFGRIFKAGENITVNLPNSEEAIRRGEYAVVRSLIRVLEGGVEGKRQVDKVIDK  312

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E
Sbjct  313  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSE  366


 Score =   266 bits (681),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 176/243 (72%), Gaps = 3/243 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  +R G VLG +T+LKSDH PGC +  +  ++EGA N+R+     V+GVA PT
Sbjct  4     PKEPEQVMKMRDGSVLGKKTILKSDHFPGCQNKRMTPQIEGAPNYRQADSLRVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+   V W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  64    AVGIRNVLRHIGAHKDGKQVKVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS+DS++T LEV++ L+A
Sbjct  123   VRVEQMEARLKEDILMEASRYGNKILVTDELPDGQMVDQWEPVSTDSLKTLLEVYEELQA  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK +DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  183   EGYLVDYERVPITDEKSPKETDFDLLIRKISQADINTEIIFNCQMGRGRTTTGMVIATLV  242

Query  1221  KLR  1229
               +
Sbjct  243   YFK  245


 Score =   128 bits (322),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 131/247 (53%), Gaps = 17/247 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VL   ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  865   MESIVNERSGSVLSKGSILKMYFFPG-QRTSSRLQINGAPHVYKVDRYPVYSMATPTISG  923

Query  696   ILSVIQRIGSS--KEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+   +EG      +   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  924   AKKMLAYLGTKLKEEGGGSTERIVVTDLREEAVVYINGTPFVLRELSKPV-DTLKHVGIT  982

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLE  1019
                VE +E RLK+DI+ E  R  G  M++H       +   ++   WE++  ++V+TP E
Sbjct  983   GAVVESLETRLKEDILAEV-RETGGRMLLHREEYSPASNQSRVIGYWENIQPENVKTPAE  1041

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTG  1199
             V+  L+ E + I Y RIP+T +K   +SD D  A+         + +F    G G  +  
Sbjct  1042  VYAALKDENYNISYRRIPLTREKDALASDVD--AIQYCKDDSAGSYLFVSHTGFGGVSYA  1099

Query  1200  TVIACLV  1220
               I CL+
Sbjct  1100  MAITCLL  1106


 Score = 82.8 bits (203),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 97/189 (51%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  288   VVRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  346

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA YL S+    F   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  347   VEYLERYYFLICFAVYLHSEG--AFLQSGSLGHVSFADWMRARPELYSILRRLLRRDPMG  404

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQI  1912
               G     P  ++           M  +   R+G+VLG  ++L     PG Q  +   ++
Sbjct  405   ALGYAAMKPSLIKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSDHSPGCQILNLPERV  464

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  465   EGAPNFREV  473


 Score = 69.7 bits (169),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             CAGAGHLREDI+Y++KEL K P   DE+R+Y+MDMG++ALR
Sbjct  1171  CAGAGHLREDIVYYSKELNKLPITKDENRSYIMDMGVKALR  1211


 Score = 66.6 bits (161),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  731  ITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL ++
Sbjct  791  ERYFRLIAFAAYLGSK  806


 Score = 57.0 bits (136),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 49/90 (54%), Gaps = 2/90 (2%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP--D  298
             E+A+  G+Y  I SLIRVL  G + K  VD +++ CA   +LRE I  Y   + + P   
Sbjct  1136  EEALSMGDYRDILSLIRVLSHGPQSKSDVDGIVELCAGAGHLREDIVYYSKELNKLPITK  1195

Query  299   EMKREAALSFFVEYLERY*FLICFAVYLHT  388
             +  R   +   V+ L RY +LI F  YL++
Sbjct  1196  DENRSYIMDMGVKALRRYFYLITFRSYLYS  1225



>ref|XP_010035359.1| PREDICTED: paladin isoform X1 [Eucalyptus grandis]
Length=1256

 Score =   483 bits (1242),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 260/295 (88%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY SL+PS     ES +GRP EM  VAA R+GEVLGSQTVLKSD
Sbjct  392   YSIIRRLLRRDPMGALGYTSLEPSLMKMAESADGRPYEMGVVAARRTGEVLGSQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVIQRIGS   GRPVFWHNM
Sbjct  452   HCPGCQNQSLPERVEGAPNFREVPGFPVYGVANPTIDGIKSVIQRIGSGICGRPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERP+KNMLEY+GID ERVE+MEARLK+DI+REAE Y GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPFKNMLEYSGIDRERVEKMEARLKEDILREAETYVGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET  GQIFD+WEHV+S SVQTPLEVF+ LE++GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  572   IHETEKGQIFDAWEHVNSSSVQTPLEVFENLESDGFPIKYARVPITDGKAPKSSDFDTLA  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEEL  1283
             +NI+SASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPI++L  DA  EE+
Sbjct  632   MNISSASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIKILFADAKQEEV  686


 Score =   349 bits (895),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             +G+E +G+       + K +  ++    FGINDI+LL KITRLFDNG+ECREALDAIIDR
Sbjct  692   NGEEINGNGAASTSPVSKEKLSEEQGRAFGINDIVLLGKITRLFDNGLECREALDAIIDR  751

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVL+YR++FNQQ  EPR R+VALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  752   CSALQNIRQAVLEYRKVFNQQHAEPRVRQVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  811

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGE   TFK W HQRPEVQAMKWSIRLRPGRFF+IPEELR   E +HGDAVMEAIVK 
Sbjct  812   CGQGEMRMTFKTWQHQRPEVQAMKWSIRLRPGRFFSIPEELRVSQESQHGDAVMEAIVKS  871

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL  YFFPGQRTSSHIQI GAPHVYKV
Sbjct  872   RNGSVLGKGSILKKYFFPGQRTSSHIQIDGAPHVYKV  908


 Score =   185 bits (469),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGRV   G++ T  +PNSE+AI RGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  254  GIPRTNSIGRVLDSGSDVTVNLPNSEEAIPRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLH  385
            CASMQNLREAIAT RN+IL QPDEMKREA+LS FVEYLERY +LICFAVY+H
Sbjct  314  CASMQNLREAIATNRNNILHQPDEMKREASLSTFVEYLERYYYLICFAVYIH  365


 Score =   242 bits (617),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 166/245 (68%), Gaps = 6/245 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E + V  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT
Sbjct  4     PKEPELVMKLRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQADSLHVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V++ IG+  +G+   V W ++REE VIYING+PFVLR+ E+P  N LE TGI+ 
Sbjct  64    IDGIRNVLKHIGAQIDGKGVRVLWISLREEPVIYINGRPFVLRDEEQPLSN-LELTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLE---VFKC  1031
             +RVE+ME RLK+DIM EA RY   I+V  E  D QI D WE VS DSV+TPLE   V++ 
Sbjct  123   DRVEQMEDRLKEDIMMEAARYGNKILVTDELPDYQIVDQWEPVSRDSVKTPLEVSYVYQE  182

Query  1032  LEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIA  1211
             L  EG+ + Y R+P+TD+K+P+  D D L   I+     T ++FNCQMG GRTTTG VIA
Sbjct  183   LHDEGYLVDYERVPLTDEKSPEEQDIDDLVEKISRVDVNTEIIFNCQMGRGRTTTGMVIA  242

Query  1212  CLVKL  1226
              L+ L
Sbjct  243   TLIYL  247


 Score =   138 bits (347),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 136/247 (55%), Gaps = 14/247 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   +++GA +  ++ G+PV+ +A PT+ G
Sbjct  865   MEAIVKSRNGSVLGKGSILKKYFFPG-QRTSSHIQIDGAPHVYKVDGYPVFSMATPTIDG  923

Query  696   ILSVIQRIGSSKEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  +G+        R V   ++REE V+YING PFVLRE+ +P  + L++ GI   
Sbjct  924   AKEMLAYLGAKPAAGVTSRKVIITDLREEAVVYINGMPFVLRELNKPV-DTLKHAGITGS  982

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDS-----WEHVSSDSVQTPLEVFK  1028
              VE MEARLK+DI+ E  +  G +++ HE  +     S     W+++ +D ++TP EV+ 
Sbjct  983   VVEHMEARLKEDILFEVRQSSGQMLLHHEEYNATSHQSSVTGYWKNILTDDIKTPAEVYA  1042

Query  1029  CLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVI  1208
              L+ EG+ I Y RIP+T ++   +SD D+L  +   ++     ++    G G       I
Sbjct  1043  SLKDEGYNIAYRRIPLTREREALASDVDSLQYHKDDSA--GCYLYVSHTGFGGVAYAMAI  1100

Query  1209  ACLVKLR  1229
              C +KL+
Sbjct  1101  TC-IKLK  1106


 Score = 75.5 bits (184),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 92/195 (47%), Gaps = 22/195 (11%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+   R     Q  E + R  +L+  
Sbjct  289   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATNRNNILHQPDEMK-REASLSTF  347

Query  1574  AEYLERYFRLIAFAAYL------GSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              EYLERY+ LI FA Y+         +  G C       TF  W+  RPE+ ++   + L
Sbjct  348   VEYLERYYYLICFAVYIHSERESLRSSSLGRC-------TFAEWMKARPELYSIIRRL-L  399

Query  1736  RPGRFFTIPEELRTPHELKHGDAV------MEAIVKDRNGSVLGKGSILTMYFFPG-QRT  1894
             R      +      P  +K  ++       M  +   R G VLG  ++L     PG Q  
Sbjct  400   RRDPMGALGYTSLEPSLMKMAESADGRPYEMGVVAARRTGEVLGSQTVLKSDHCPGCQNQ  459

Query  1895  SSHIQIHGAPHVYKV  1939
             S   ++ GAP+  +V
Sbjct  460   SLPERVEGAPNFREV  474


 Score = 71.6 bits (174),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHL++DI+Y+ KEL+K  D DDE R+YLMDMGI+ALR
Sbjct  1166  VDTIINRCAGAGHLQDDILYYRKELEKLSDCDDEKRSYLMDMGIKALR  1213


 Score = 64.7 bits (156),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +2

Query  146  EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAAL  322
            +  ++  + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R+ AL
Sbjct  724  DIVLLGKITRLFDNGLECREALDAIIDRCSALQNIRQAVLEYRKVFNQQHAEPRVRQVAL  783

Query  323  SFFVEYLERY*FLICFAVYLHTE  391
            +   EYLERY  LI FA YL +E
Sbjct  784  NRGAEYLERYFRLIAFAAYLGSE  806


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 63/120 (53%), Gaps = 9/120 (8%)
 Frame = +2

Query  1379  INDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRV  1558
             ++D   +  +TR+ + G + +  +D II+RC+   +++  +L YR+   +      E+R 
Sbjct  1143  MDDYGDILNLTRVLEYGPKSKADVDTIINRCAGAGHLQDDILYYRKELEKLSDCDDEKRS  1202

Query  1559  AL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              L + G + L RYF LI F +YL       +C    + TTF  W+  RPE+  +  ++R+
Sbjct  1203  YLMDMGIKALRRYFYLITFQSYL-------YCASAPA-TTFTAWMDARPELGHLCNNLRI  1254


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = +2

Query  83    SSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAI  262
             S+ G N +    + ++A++  +Y  I +L RVLE G + K  VD +I+RCA   +L++ I
Sbjct  1126  SAAGENLS--RTSDDEALKMDDYGDILNLTRVLEYGPKSKADVDTIINRCAGAGHLQDDI  1183

Query  263   ATYRNSI--LRQPDEMKREAALSFFVEYLERY*FLICFAVYLH  385
               YR  +  L   D+ KR   +   ++ L RY +LI F  YL+
Sbjct  1184  LYYRKELEKLSDCDDEKRSYLMDMGIKALRRYFYLITFQSYLY  1226



>ref|XP_010035360.1| PREDICTED: paladin isoform X2 [Eucalyptus grandis]
 gb|KCW46723.1| hypothetical protein EUGRSUZ_K00546 [Eucalyptus grandis]
Length=1253

 Score =   483 bits (1242),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 260/295 (88%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY SL+PS     ES +GRP EM  VAA R+GEVLGSQTVLKSD
Sbjct  389   YSIIRRLLRRDPMGALGYTSLEPSLMKMAESADGRPYEMGVVAARRTGEVLGSQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVIQRIGS   GRPVFWHNM
Sbjct  449   HCPGCQNQSLPERVEGAPNFREVPGFPVYGVANPTIDGIKSVIQRIGSGICGRPVFWHNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERP+KNMLEY+GID ERVE+MEARLK+DI+REAE Y GAIMV
Sbjct  509   REEPVIYINGKPFVLREVERPFKNMLEYSGIDRERVEKMEARLKEDILREAETYVGAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET  GQIFD+WEHV+S SVQTPLEVF+ LE++GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  569   IHETEKGQIFDAWEHVNSSSVQTPLEVFENLESDGFPIKYARVPITDGKAPKSSDFDTLA  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEEL  1283
             +NI+SASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPI++L  DA  EE+
Sbjct  629   MNISSASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIKILFADAKQEEV  683


 Score =   348 bits (894),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             +G+E +G+       + K +  ++    FGINDI+LL KITRLFDNG+ECREALDAIIDR
Sbjct  689   NGEEINGNGAASTSPVSKEKLSEEQGRAFGINDIVLLGKITRLFDNGLECREALDAIIDR  748

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVL+YR++FNQQ  EPR R+VALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  749   CSALQNIRQAVLEYRKVFNQQHAEPRVRQVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  808

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGE   TFK W HQRPEVQAMKWSIRLRPGRFF+IPEELR   E +HGDAVMEAIVK 
Sbjct  809   CGQGEMRMTFKTWQHQRPEVQAMKWSIRLRPGRFFSIPEELRVSQESQHGDAVMEAIVKS  868

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL  YFFPGQRTSSHIQI GAPHVYKV
Sbjct  869   RNGSVLGKGSILKKYFFPGQRTSSHIQIDGAPHVYKV  905


 Score =   184 bits (468),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGRV   G++ T  +PNSE+AI RGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  251  GIPRTNSIGRVLDSGSDVTVNLPNSEEAIPRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  310

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLH  385
            CASMQNLREAIAT RN+IL QPDEMKREA+LS FVEYLERY +LICFAVY+H
Sbjct  311  CASMQNLREAIATNRNNILHQPDEMKREASLSTFVEYLERYYYLICFAVYIH  362


 Score =   247 bits (631),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 166/242 (69%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E + V  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT
Sbjct  4     PKEPELVMKLRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQADSLHVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRPV--FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V++ IG+  +G+ V   W ++REE VIYING+PFVLR+ E+P  N LE TGI+ 
Sbjct  64    IDGIRNVLKHIGAQIDGKGVRVLWISLREEPVIYINGRPFVLRDEEQPLSN-LELTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             +RVE+ME RLK+DIM EA RY   I+V  E  D QI D WE VS DSV+TPLEV++ L  
Sbjct  123   DRVEQMEDRLKEDIMMEAARYGNKILVTDELPDYQIVDQWEPVSRDSVKTPLEVYQELHD  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+P+TD+K+P+  D D L   I+     T ++FNCQMG GRTTTG VIA L+
Sbjct  183   EGYLVDYERVPLTDEKSPEEQDIDDLVEKISRVDVNTEIIFNCQMGRGRTTTGMVIATLI  242

Query  1221  KL  1226
              L
Sbjct  243   YL  244


 Score =   138 bits (347),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 136/247 (55%), Gaps = 14/247 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   +++GA +  ++ G+PV+ +A PT+ G
Sbjct  862   MEAIVKSRNGSVLGKGSILKKYFFPG-QRTSSHIQIDGAPHVYKVDGYPVFSMATPTIDG  920

Query  696   ILSVIQRIGSSKEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  +G+        R V   ++REE V+YING PFVLRE+ +P  + L++ GI   
Sbjct  921   AKEMLAYLGAKPAAGVTSRKVIITDLREEAVVYINGMPFVLRELNKPV-DTLKHAGITGS  979

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDS-----WEHVSSDSVQTPLEVFK  1028
              VE MEARLK+DI+ E  +  G +++ HE  +     S     W+++ +D ++TP EV+ 
Sbjct  980   VVEHMEARLKEDILFEVRQSSGQMLLHHEEYNATSHQSSVTGYWKNILTDDIKTPAEVYA  1039

Query  1029  CLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVI  1208
              L+ EG+ I Y RIP+T ++   +SD D+L  +   ++     ++    G G       I
Sbjct  1040  SLKDEGYNIAYRRIPLTREREALASDVDSLQYHKDDSA--GCYLYVSHTGFGGVAYAMAI  1097

Query  1209  ACLVKLR  1229
              C +KL+
Sbjct  1098  TC-IKLK  1103


 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 92/195 (47%), Gaps = 22/195 (11%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+   R     Q  E + R  +L+  
Sbjct  286   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATNRNNILHQPDEMK-REASLSTF  344

Query  1574  AEYLERYFRLIAFAAYL------GSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              EYLERY+ LI FA Y+         +  G C       TF  W+  RPE+ ++   + L
Sbjct  345   VEYLERYYYLICFAVYIHSERESLRSSSLGRC-------TFAEWMKARPELYSIIRRL-L  396

Query  1736  RPGRFFTIPEELRTPHELKHGDAV------MEAIVKDRNGSVLGKGSILTMYFFPG-QRT  1894
             R      +      P  +K  ++       M  +   R G VLG  ++L     PG Q  
Sbjct  397   RRDPMGALGYTSLEPSLMKMAESADGRPYEMGVVAARRTGEVLGSQTVLKSDHCPGCQNQ  456

Query  1895  SSHIQIHGAPHVYKV  1939
             S   ++ GAP+  +V
Sbjct  457   SLPERVEGAPNFREV  471


 Score = 71.6 bits (174),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHL++DI+Y+ KEL+K  D DDE R+YLMDMGI+ALR
Sbjct  1163  VDTIINRCAGAGHLQDDILYYRKELEKLSDCDDEKRSYLMDMGIKALR  1210


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +2

Query  146  EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAAL  322
            +  ++  + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R+ AL
Sbjct  721  DIVLLGKITRLFDNGLECREALDAIIDRCSALQNIRQAVLEYRKVFNQQHAEPRVRQVAL  780

Query  323  SFFVEYLERY*FLICFAVYLHTE  391
            +   EYLERY  LI FA YL +E
Sbjct  781  NRGAEYLERYFRLIAFAAYLGSE  803


 Score = 58.5 bits (140),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 63/120 (53%), Gaps = 9/120 (8%)
 Frame = +2

Query  1379  INDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRV  1558
             ++D   +  +TR+ + G + +  +D II+RC+   +++  +L YR+   +      E+R 
Sbjct  1140  MDDYGDILNLTRVLEYGPKSKADVDTIINRCAGAGHLQDDILYYRKELEKLSDCDDEKRS  1199

Query  1559  AL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              L + G + L RYF LI F +YL       +C    + TTF  W+  RPE+  +  ++R+
Sbjct  1200  YLMDMGIKALRRYFYLITFQSYL-------YCASAPA-TTFTAWMDARPELGHLCNNLRI  1251


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = +2

Query  83    SSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAI  262
             S+ G N +    + ++A++  +Y  I +L RVLE G + K  VD +I+RCA   +L++ I
Sbjct  1123  SAAGENLS--RTSDDEALKMDDYGDILNLTRVLEYGPKSKADVDTIINRCAGAGHLQDDI  1180

Query  263   ATYRNSI--LRQPDEMKREAALSFFVEYLERY*FLICFAVYLH  385
               YR  +  L   D+ KR   +   ++ L RY +LI F  YL+
Sbjct  1181  LYYRKELEKLSDCDDEKRSYLMDMGIKALRRYFYLITFQSYLY  1223



>gb|KCW46724.1| hypothetical protein EUGRSUZ_K00546 [Eucalyptus grandis]
Length=1088

 Score =   483 bits (1242),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 260/295 (88%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY SL+PS     ES +GRP EM  VAA R+GEVLGSQTVLKSD
Sbjct  389   YSIIRRLLRRDPMGALGYTSLEPSLMKMAESADGRPYEMGVVAARRTGEVLGSQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVIQRIGS   GRPVFWHNM
Sbjct  449   HCPGCQNQSLPERVEGAPNFREVPGFPVYGVANPTIDGIKSVIQRIGSGICGRPVFWHNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERP+KNMLEY+GID ERVE+MEARLK+DI+REAE Y GAIMV
Sbjct  509   REEPVIYINGKPFVLREVERPFKNMLEYSGIDRERVEKMEARLKEDILREAETYVGAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET  GQIFD+WEHV+S SVQTPLEVF+ LE++GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  569   IHETEKGQIFDAWEHVNSSSVQTPLEVFENLESDGFPIKYARVPITDGKAPKSSDFDTLA  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEEL  1283
             +NI+SASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPI++L  DA  EE+
Sbjct  629   MNISSASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIKILFADAKQEEV  683


 Score =   349 bits (895),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             +G+E +G+       + K +  ++    FGINDI+LL KITRLFDNG+ECREALDAIIDR
Sbjct  689   NGEEINGNGAASTSPVSKEKLSEEQGRAFGINDIVLLGKITRLFDNGLECREALDAIIDR  748

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVL+YR++FNQQ  EPR R+VALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  749   CSALQNIRQAVLEYRKVFNQQHAEPRVRQVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  808

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGE   TFK W HQRPEVQAMKWSIRLRPGRFF+IPEELR   E +HGDAVMEAIVK 
Sbjct  809   CGQGEMRMTFKTWQHQRPEVQAMKWSIRLRPGRFFSIPEELRVSQESQHGDAVMEAIVKS  868

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL  YFFPGQRTSSHIQI GAPHVYKV
Sbjct  869   RNGSVLGKGSILKKYFFPGQRTSSHIQIDGAPHVYKV  905


 Score =   185 bits (469),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGRV   G++ T  +PNSE+AI RGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  251  GIPRTNSIGRVLDSGSDVTVNLPNSEEAIPRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  310

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLH  385
            CASMQNLREAIAT RN+IL QPDEMKREA+LS FVEYLERY +LICFAVY+H
Sbjct  311  CASMQNLREAIATNRNNILHQPDEMKREASLSTFVEYLERYYYLICFAVYIH  362


 Score =   247 bits (630),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 166/242 (69%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E + V  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT
Sbjct  4     PKEPELVMKLRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQADSLHVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRPV--FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V++ IG+  +G+ V   W ++REE VIYING+PFVLR+ E+P  N LE TGI+ 
Sbjct  64    IDGIRNVLKHIGAQIDGKGVRVLWISLREEPVIYINGRPFVLRDEEQPLSN-LELTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             +RVE+ME RLK+DIM EA RY   I+V  E  D QI D WE VS DSV+TPLEV++ L  
Sbjct  123   DRVEQMEDRLKEDIMMEAARYGNKILVTDELPDYQIVDQWEPVSRDSVKTPLEVYQELHD  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+P+TD+K+P+  D D L   I+     T ++FNCQMG GRTTTG VIA L+
Sbjct  183   EGYLVDYERVPLTDEKSPEEQDIDDLVEKISRVDVNTEIIFNCQMGRGRTTTGMVIATLI  242

Query  1221  KL  1226
              L
Sbjct  243   YL  244


 Score =   135 bits (339),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/210 (36%), Positives = 123/210 (59%), Gaps = 11/210 (5%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   +++GA +  ++ G+PV+ +A PT+ G
Sbjct  862   MEAIVKSRNGSVLGKGSILKKYFFPG-QRTSSHIQIDGAPHVYKVDGYPVFSMATPTIDG  920

Query  696   ILSVIQRIGSSKEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  +G+        R V   ++REE V+YING PFVLRE+ +P  + L++ GI   
Sbjct  921   AKEMLAYLGAKPAAGVTSRKVIITDLREEAVVYINGMPFVLRELNKPV-DTLKHAGITGS  979

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDS-----WEHVSSDSVQTPLEVFK  1028
              VE MEARLK+DI+ E  +  G +++ HE  +     S     W+++ +D ++TP EV+ 
Sbjct  980   VVEHMEARLKEDILFEVRQSSGQMLLHHEEYNATSHQSSVTGYWKNILTDDIKTPAEVYA  1039

Query  1029  CLEAEGFPIKYARIPITDDKAPKSSDFDTL  1118
              L+ EG+ I Y RIP+T ++   +SD D+L
Sbjct  1040  SLKDEGYNIAYRRIPLTREREALASDVDSL  1069


 Score = 75.5 bits (184),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 92/195 (47%), Gaps = 22/195 (11%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+   R     Q  E + R  +L+  
Sbjct  286   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATNRNNILHQPDEMK-REASLSTF  344

Query  1574  AEYLERYFRLIAFAAYL------GSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              EYLERY+ LI FA Y+         +  G C       TF  W+  RPE+ ++   + L
Sbjct  345   VEYLERYYYLICFAVYIHSERESLRSSSLGRC-------TFAEWMKARPELYSIIRRL-L  396

Query  1736  RPGRFFTIPEELRTPHELKHGDAV------MEAIVKDRNGSVLGKGSILTMYFFPG-QRT  1894
             R      +      P  +K  ++       M  +   R G VLG  ++L     PG Q  
Sbjct  397   RRDPMGALGYTSLEPSLMKMAESADGRPYEMGVVAARRTGEVLGSQTVLKSDHCPGCQNQ  456

Query  1895  SSHIQIHGAPHVYKV  1939
             S   ++ GAP+  +V
Sbjct  457   SLPERVEGAPNFREV  471


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +2

Query  146  EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAAL  322
            +  ++  + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R+ AL
Sbjct  721  DIVLLGKITRLFDNGLECREALDAIIDRCSALQNIRQAVLEYRKVFNQQHAEPRVRQVAL  780

Query  323  SFFVEYLERY*FLICFAVYLHTE  391
            +   EYLERY  LI FA YL +E
Sbjct  781  NRGAEYLERYFRLIAFAAYLGSE  803



>emb|CDY11391.1| BnaA09g39570D [Brassica napus]
Length=1258

 Score =   494 bits (1271),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 237/294 (81%), Positives = 259/294 (88%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA++KPS     EST+GRP EM  VAALRSGEVLGSQTVLKSD
Sbjct  395   YSILRRLLRRDPMGALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGEVLGSQTVLKSD  454

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+R+GSS+ GRPVFWHNM
Sbjct  455   HSPGCQILSLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIERVGSSRGGRPVFWHNM  514

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVE MEARLK+DI+REA RY GAIMV
Sbjct  515   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVEGMEARLKEDILREARRYDGAIMV  574

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD WEHV +DSVQTPLEV+K LEA+GFPIKYAR+PITD KAPKSSDFDTL 
Sbjct  575   IHETKDGQIFDIWEHVDADSVQTPLEVYKSLEADGFPIKYARVPITDGKAPKSSDFDTLT  634

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  635   SNIASASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  688


 Score =   330 bits (845),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 177/216 (82%), Gaps = 0/216 (0%)
 Frame = +2

Query  1292  GDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRC  1471
             G+E+  +     P I + R +      FG++DILLLWKITRLFDNGVE REALDA+IDRC
Sbjct  697   GEETGSNTADTRPRISERRTEDQHGRTFGMDDILLLWKITRLFDNGVESREALDAVIDRC  756

Query  1472  SALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFC  1651
             SALQNIR+AVLQYR++FNQQ  EPR R  AL RGAEYLERYFRLIAFAAYLGS+  D F 
Sbjct  757   SALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSETLDDFF  816

Query  1652  GQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDR  1831
              +G S  TFK+WLHQRPEVQAMKWSIRLRPGRFFTIPEELR  HE +HGDAVME+IV +R
Sbjct  817   VKGGSKVTFKNWLHQRPEVQAMKWSIRLRPGRFFTIPEELRAQHESQHGDAVMESIVNER  876

Query  1832  NGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             +GSVLGKGSIL MYFFPGQRTSS +QI GAPHVYKV
Sbjct  877   SGSVLGKGSILKMYFFPGQRTSSRVQITGAPHVYKV  912


 Score =   192 bits (489),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR NS GR+   G N T  +PNSE+AIRRGEY V+RSLIRVLEGGVEGK+QVDKVID+
Sbjct  257  GFPRNNSFGRIFKAGENITINLPNSEEAIRRGEYAVVRSLIRVLEGGVEGKRQVDKVIDK  316

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E   L  
Sbjct  317  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSEGGYLQS  376

Query  410  TS  415
             S
Sbjct  377  GS  378


 Score =   265 bits (677),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 180/253 (71%), Gaps = 7/253 (3%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  +  +++GA N+R+     V+GVA PT
Sbjct  8     PKEPEQVMKLRDGSVLGKKTILKSDHFPGCQNKRMTPQIDGAPNYRQAESLRVHGVAIPT  67

Query  687   VSGILSVIQRIGSSKEGRPV--FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+ V   W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  68    AVGIRNVLRHIGAHKDGKQVQVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  126

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS+DS++T +EV++ L+A
Sbjct  127   VRVEQMEARLKEDILMEASRYGNKILVTDELPDGQMVDQWEPVSTDSLKTLIEVYEELQA  186

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+P+TD+K+PK +DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  187   EGYLVDYERVPVTDEKSPKETDFDALIKKISQADINTEIIFNCQMGRGRTTTGMVIATLV  246

Query  1221  KLR----IDYGRP  1247
               +     D+G P
Sbjct  247   YFKRTGASDHGFP  259


 Score =   131 bits (330),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 83/247 (34%), Positives = 132/247 (53%), Gaps = 17/247 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  869   MESIVNERSGSVLGKGSILKMYFFPG-QRTSSRVQITGAPHVYKVDRYPVYSMATPTISG  927

Query  696   ILSVIQRIGSS--KEGRP----VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+   +EG      V   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  928   AKKMLAYLGTKLKEEGGDSAARVVVTDLREEAVVYINGTPFVLRELSKPV-DTLKHVGIT  986

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLE  1019
                VE +E RLK+DI+ E  R  G  M++H       + + ++   WE++  ++V+TP E
Sbjct  987   GAVVESIETRLKEDILSEV-RETGGRMLLHREEYSPASNESRVIGYWENIQPENVKTPAE  1045

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTG  1199
             V+  L+ E + I Y RIP+T ++   +SD D  A+           +F    G G  +  
Sbjct  1046  VYAALKDENYNISYRRIPLTRERDALASDVD--AIQYCKDDSAGGYLFVSHTGFGGASYA  1103

Query  1200  TVIACLV  1220
               I CLV
Sbjct  1104  MAITCLV  1110


 Score = 83.6 bits (205),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 96/189 (51%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  292   VVRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  350

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA YL S+   G+   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  351   VEYLERYYFLICFAVYLHSEG--GYLQSGSLGHVSFSDWMRARPELYSILRRLLRRDPMG  408

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQI  1912
               G     P   +           M  +   R+G VLG  ++L     PG Q  S   ++
Sbjct  409   ALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGEVLGSQTVLKSDHSPGCQILSLPERV  468

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  469   EGAPNFREV  477


 Score = 68.6 bits (166),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  735  ITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  794

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  795  ERYFRLIAFAAYLGSE  810


 Score = 67.8 bits (164),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  1926  MFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRAL  2057
             +  +CAGAGHL+EDI Y+TKEL K P+  DE R+Y+MDMG++AL
Sbjct  1170  IIQQCAGAGHLKEDICYYTKELNKLPNTKDEDRSYIMDMGVKAL  1213



>ref|XP_006402420.1| hypothetical protein EUTSA_v10005753mg [Eutrema salsugineum]
 gb|ESQ43873.1| hypothetical protein EUTSA_v10005753mg [Eutrema salsugineum]
Length=1254

 Score =   493 bits (1269),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/294 (80%), Positives = 258/294 (88%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA++KPS     EST+GRP EM  VAALRSG VLGSQTVLKSD
Sbjct  391   YSILRRLLRRDPMGALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSD  450

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI R+GSS+ GRPVFWHNM
Sbjct  451   HSPGCQISSLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIDRVGSSRGGRPVFWHNM  510

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVE MEARLK+DI+REA+RY GAIMV
Sbjct  511   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVEGMEARLKEDILREAKRYEGAIMV  570

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD WE V +DSVQTPLEV+KCLEA+GFPIKYAR+PITD KAPKSSDFDTL 
Sbjct  571   IHETKDGQIFDLWEQVDADSVQTPLEVYKCLEADGFPIKYARVPITDGKAPKSSDFDTLT  630

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  631   SNIASASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  684


 Score =   330 bits (846),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 179/216 (83%), Gaps = 0/216 (0%)
 Frame = +2

Query  1292  GDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRC  1471
             G+E+  +     P   + R + +    FG++DILLLWKITRLFDNGVE REALDA+IDRC
Sbjct  693   GEETGSNNAETRPRNSERRTEDEHGRTFGMDDILLLWKITRLFDNGVESREALDAVIDRC  752

Query  1472  SALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFC  1651
             SALQNIR+AVLQYR++FNQQ  EPR R  AL RGAEYLERYFRLIAFAAYLGS+  D F 
Sbjct  753   SALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSETLDEFF  812

Query  1652  GQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDR  1831
              +GES  TFK+WLHQRPEVQAMKWSIRLRPGRFFTIPEELR  HEL+HGDAVME+IV +R
Sbjct  813   VKGESKMTFKNWLHQRPEVQAMKWSIRLRPGRFFTIPEELRAQHELQHGDAVMESIVNER  872

Query  1832  NGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             +GSVLG GSIL MYFFPGQRTSS +QI+GAPHVYKV
Sbjct  873   SGSVLGNGSILKMYFFPGQRTSSRMQINGAPHVYKV  908


 Score =   192 bits (489),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR NS GR+   G N T  +PNSE+AIRRGEY V+RSLIRVLEGGVEGK+QVDKVID+
Sbjct  253  GFPRNNSFGRIFKAGENITINLPNSEEAIRRGEYAVVRSLIRVLEGGVEGKRQVDKVIDK  312

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E
Sbjct  313  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSE  366


 Score =   268 bits (684),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 176/243 (72%), Gaps = 3/243 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  +  ++EGA N+R+     V+GVA PT
Sbjct  4     PKEPEQVMKLRDGSVLGKKTILKSDHFPGCQNKRMSPQIEGAPNYRQADSLRVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRPV--FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K G+ V   W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  64    AVGIRNVLRHIGAHKGGKQVQVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS+DS++T LEV++ L+A
Sbjct  123   VRVEQMEARLKEDILMEASRYGNKILVTDELPDGQMVDQWEPVSTDSLKTLLEVYEELQA  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+P+TD+K+PK +DFDTL   I+ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  183   EGYLVDYERVPVTDEKSPKETDFDTLIRKISQADINTEIIFNCQMGRGRTTTGMVIATLV  242

Query  1221  KLR  1229
               +
Sbjct  243   YFK  245


 Score =   131 bits (330),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 82/250 (33%), Positives = 134/250 (54%), Gaps = 17/250 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG+ ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  865   MESIVNERSGSVLGNGSILKMYFFPG-QRTSSRMQINGAPHVYKVDRYPVYSMATPTISG  923

Query  696   ILSVIQRIGSSK--EG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+ +  EG      +   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  924   AKKMLAYLGAKRKEEGGDSRERIVVTDLREEAVVYINGTPFVLRELSKPV-DTLKHVGIT  982

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLE  1019
                VE +E RLK+DI+ E  R  G  M++H       +   ++   WE++  ++V+TP E
Sbjct  983   GAVVESIETRLKEDILSEV-RETGGRMLLHREEYSPASNQSRVIGYWENIQPENVKTPAE  1041

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTG  1199
             V+  L+ E + I Y RIP+T ++   +SD D  A+         + +F    G G  +  
Sbjct  1042  VYAALKNENYNISYRRIPLTRERDALASDVD--AIQYCKDDSAGSYLFVSHTGFGGVSYA  1099

Query  1200  TVIACLVKLR  1229
               I CL+  R
Sbjct  1100  MAITCLLLQR  1109


 Score = 84.3 bits (207),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 97/189 (51%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  288   VVRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  346

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA YL S+    F   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  347   VEYLERYYFLICFAVYLHSEG--AFLRSGSLGHVSFTDWMRARPELYSILRRLLRRDPMG  404

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQ-I  1912
               G     P   +           M  +   R+G+VLG  ++L     PG + SS  + +
Sbjct  405   ALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSDHSPGCQISSLPERV  464

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  465   EGAPNFREV  473


 Score = 74.7 bits (182),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             CAGAGHLREDI+Y+TKELKK P+  DE+R+Y+MDMG++ALR
Sbjct  1171  CAGAGHLREDIVYYTKELKKLPNTKDENRSYMMDMGVKALR  1211


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  731  ITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  791  ERYFRLIAFAAYLGSE  806


 Score = 58.2 bits (139),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 2/89 (2%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD--  298
             E+A+  G+Y  I SLIRVL  G + K  VD +I+ CA   +LRE I  Y   + + P+  
Sbjct  1136  EEALSMGDYRDILSLIRVLSHGPQSKSDVDGIIELCAGAGHLREDIVYYTKELKKLPNTK  1195

Query  299   EMKREAALSFFVEYLERY*FLICFAVYLH  385
             +  R   +   V+ L RY +LI F  YL+
Sbjct  1196  DENRSYMMDMGVKALRRYFYLITFRSYLY  1224



>ref|XP_010905896.1| PREDICTED: paladin [Elaeis guineensis]
Length=1274

 Score =   491 bits (1265),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/297 (79%), Positives = 264/297 (89%), Gaps = 3/297 (1%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+SLKPS     ES +GRP EM  VAA+R+GEVLGSQTVLKSD
Sbjct  408   YSILRRLLRRDPMGALGYSSLKPSLMKIAESADGRPYEMGVVAAMRNGEVLGSQTVLKSD  467

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI +VIQ I S K GRPV WHNM
Sbjct  468   HCPGCQNHSLPERVEGAPNFREVPGFPVYGVANPTIDGIRAVIQNISSKKGGRPVLWHNM  527

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REA+RY GAIMV
Sbjct  528   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREADRYSGAIMV  587

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+++S+QTPLEV+KCLEAEG P+KYAR+PITD KAPKSSDFDT+A
Sbjct  588   IHETDDGQIFDAWEHVNAESIQTPLEVYKCLEAEGLPVKYARVPITDGKAPKSSDFDTIA  647

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV-LND--ALHEEL  1283
             L IASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIR+ L+D  + HEEL
Sbjct  648   LKIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRMQLDDVSSYHEEL  704


 Score =   322 bits (825),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = +2

Query  1334  ILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR  1513
             ++K+   ++  H FGINDILLL KITRLFDNG+ECRE LDAII+RCSALQNIRQAVL YR
Sbjct  725   VVKSGNSEEPQHIFGINDILLLRKITRLFDNGIECREVLDAIINRCSALQNIRQAVLHYR  784

Query  1514  RLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLH  1693
             ++ NQQ  EPR RRVALNRGAEYLERYF+LIAF+AYLGS+AF+GFCGQGE+  +FK WLH
Sbjct  785   KVINQQHVEPRVRRVALNRGAEYLERYFKLIAFSAYLGSEAFNGFCGQGETKISFKTWLH  844

Query  1694  QRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMY  1873
             +RPE+Q MKWSIRLRPGRFFTIPEE +  +E +H D VMEAI+K R+GSVLGKGSIL MY
Sbjct  845   RRPEIQTMKWSIRLRPGRFFTIPEEPKLLYESQHDDVVMEAIIKARHGSVLGKGSILKMY  904

Query  1874  FFPGQRTSSHIQIHGAPHVYKV  1939
             FFPGQRTSS I+  G PHVYKV
Sbjct  905   FFPGQRTSSCIRFQGTPHVYKV  926


 Score =   201 bits (512),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIG++   G + TD +PNSE+A+RRGEY VIRSLIRVLEGG EGKKQVD+VID+
Sbjct  270  GIPRTNSIGKIFGSGHDVTDNIPNSEEAVRRGEYAVIRSLIRVLEGGAEGKKQVDEVIDK  329

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C SMQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+HT+R AL  
Sbjct  330  CDSMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYVHTDRAALRD  389

Query  410  TS  415
             S
Sbjct  390  MS  391


 Score =   264 bits (675),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 176/263 (67%), Gaps = 3/263 (1%)
 Frame = +3

Query  444   ALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERL  623
             A+  A    SP +          E D V   R G VLG +T+LKSDH PGC +  L  ++
Sbjct  2     AMAMAMSSNSPPSAEAGAAAVSLEPDHVMNYRGGSVLGKKTILKSDHFPGCQNKRLTPQI  61

Query  624   EGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGR--PVFWHNMREEHVIYINGKP  797
             +GA N+R+     V+GVA PT+ GI +V+  IG+ K G+   V WHN+REE V+YING+P
Sbjct  62    DGAPNYRQAGSLHVHGVAIPTIDGIRNVLNHIGAKKNGKQKKVLWHNLREEPVVYINGRP  121

Query  798   FVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDS  977
             FVLR+VERP+ N LEYTGI+ +RVE+ME RL++DI++E+ RY   I+V  E  DGQ+ D 
Sbjct  122   FVLRDVERPFSN-LEYTGINRDRVEQMEFRLEEDILQESVRYGNKILVTDELPDGQMVDQ  180

Query  978   WEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTAL  1157
             WE V  DSV+TPLEV++ L+ EG+ + Y R+PITD+K+PK  DFD L   I+     T +
Sbjct  181   WEPVMHDSVKTPLEVYEELQKEGYLVDYERVPITDEKSPKEGDFDDLVHRISQVDLDTEI  240

Query  1158  VFNCQMGIGRTTTGTVIACLVKL  1226
             VFNCQMG GRTTTG VIA LV L
Sbjct  241   VFNCQMGRGRTTTGMVIATLVYL  263


 Score =   138 bits (348),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/244 (34%), Positives = 127/244 (52%), Gaps = 14/244 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R G VLG  ++LK    PG    S   R +G  +  ++  +PVY +A PT+ G
Sbjct  883   MEAIIKARHGSVLGKGSILKMYFFPGQRTSSCI-RFQGTPHVYKVDAYPVYSMATPTIDG  941

Query  696   ILSVIQRIGSSKEGRPVFWH-----NMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                V+  +G+         H     ++REE V+YI G PFVLRE+++P  + L++ GI  
Sbjct  942   AREVLSYLGAKDTTNTNITHKVVVTDLREEAVVYIKGTPFVLRELDQPV-DTLKHVGITG  1000

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEVF  1025
               VE MEAR+K+DI  E  +  G +++  E     T    +   WE++S D VQTP EV+
Sbjct  1001  PLVEHMEARMKEDIFAEVTQSGGRMLLHREEFNPSTNQLSVIGYWENISLDDVQTPTEVY  1060

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+AEG+ I+Y RIP T ++   ++D D +      +++Y   +F    G G       
Sbjct  1061  TALKAEGYNIEYKRIPFTREREALATDVDAIQYCRDESARY--YLFVSHTGFGSVAYAMA  1118

Query  1206  IACL  1217
             I CL
Sbjct  1119  ITCL  1122


 Score = 80.1 bits (196),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 92/188 (49%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + G E ++ +D +ID+C ++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  305   VIRSLIRVLEGGAEGKKQVDEVIDKCDSMQNLREAIATYRNSILRQPDEMK-REASLSFF  363

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ +D             +F  W+  RPE+ + ++  +R  P   
Sbjct  364   VEYLERYYFLICFAVYVHTDRA-ALRDMSSDRISFSDWMRARPELYSILRRLLRRDPMGA  422

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  423   LGYSSLKPSLMKIAESADGRPYEMGVVAAMRNGEVLGSQTVLKSDHCPGCQNHSLPERVE  482

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  483   GAPNFREV  490


 Score = 73.2 bits (178),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 66/122 (54%), Gaps = 2/122 (2%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             VS+  A       + ED IR+G+Y  I SL RVL  G + K++VD VI+RCA   +LRE 
Sbjct  1141  VSTSPAGRFPYQASHEDEIRQGDYRDILSLTRVLVCGPKSKEEVDTVIERCAGAGHLREE  1200

Query  260   IATYRNSILRQP--DEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKR  433
             I  YRN + + P  D+ +R   +   ++ L RY FLI F  YL+    +    +   E R
Sbjct  1201  ILQYRNELEKCPGEDDERRSYLMELGIKALRRYFFLITFRSYLYCTSPSETGFASWMEAR  1260

Query  434   PD  439
             P+
Sbjct  1261  PE  1262


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHLRE+I+ +  EL+K P +DDE R+YLM++GI+ALR
Sbjct  1184  VDTVIERCAGAGHLREEILQYRNELEKCPGEDDERRSYLMELGIKALR  1231


 Score = 64.3 bits (155),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 66/128 (52%), Gaps = 11/128 (9%)
 Frame = +2

Query  1361  SSHEFGI--NDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQR  1534
             +SHE  I   D   +  +TR+   G + +E +D +I+RC+   ++R+ +LQYR    +  
Sbjct  1153  ASHEDEIRQGDYRDILSLTRVLVCGPKSKEEVDTVIERCAGAGHLREEILQYRNELEKCP  1212

Query  1535  TEPRERRVALNR-GAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQ  1711
              E  ERR  L   G + L RYF LI F +YL       +C    S T F  W+  RPE+ 
Sbjct  1213  GEDDERRSYLMELGIKALRRYFFLITFRSYL-------YC-TSPSETGFASWMEARPELG  1264

Query  1712  AMKWSIRL  1735
              +  ++RL
Sbjct  1265  HLCDNLRL  1272


 Score = 63.9 bits (154),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + G+E ++ +D +I+RC+++QN+R+A+  YR  I +Q  E + R  AL+  
Sbjct  745  LLRKITRLFDNGIECREVLDAIINRCSALQNIRQAVLHYRKVINQQHVEPRVRRVALNRG  804

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI F+ YL +E
Sbjct  805  AEYLERYFKLIAFSAYLGSE  824



>gb|KFK35385.1| hypothetical protein AALP_AA5G278400 [Arabis alpina]
Length=1255

 Score =   496 bits (1277),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 237/294 (81%), Positives = 259/294 (88%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA++KPS     EST+GRP EM  VAALRSG VLGSQTVLKSD
Sbjct  391   YSILRRLLRRDPMGALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSD  450

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+R+GSS+ GRPVFWHNM
Sbjct  451   HSPGCQISSLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIERVGSSRGGRPVFWHNM  510

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVE MEARLK+DI+REA RY GAIMV
Sbjct  511   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVEGMEARLKEDILREARRYDGAIMV  570

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD WEHV +DSVQTPLEV+KCLEA+GFPIKYAR+PITD KAPKSSDFDTL 
Sbjct  571   IHETKDGQIFDLWEHVDADSVQTPLEVYKCLEADGFPIKYARVPITDGKAPKSSDFDTLT  630

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  631   SNIASASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  684


 Score =   326 bits (836),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 177/216 (82%), Gaps = 0/216 (0%)
 Frame = +2

Query  1292  GDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRC  1471
             G+E+  +     P     R +++    FG++DILLLWKITRLFDNGVE REALDA+IDRC
Sbjct  693   GEETGSNNAETRPRNSGRRSEEEHGRAFGMDDILLLWKITRLFDNGVESREALDAVIDRC  752

Query  1472  SALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFC  1651
             SALQNIR+AVLQYR++FNQQ  EPR R  AL RGAEYLERYFRLIAFAAYLGS+  D F 
Sbjct  753   SALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSETLDEFF  812

Query  1652  GQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDR  1831
              +GE   TFK WLHQRPEVQAMKWSIRLRPGRFFTIPEELR  HE +HGDAVME+IV +R
Sbjct  813   VKGEPKMTFKSWLHQRPEVQAMKWSIRLRPGRFFTIPEELRAQHESQHGDAVMESIVNER  872

Query  1832  NGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             +GSVLGKGSIL MYFFPGQRTSS +QI+GAPHVYKV
Sbjct  873   SGSVLGKGSILKMYFFPGQRTSSRMQINGAPHVYKV  908


 Score =   191 bits (486),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR NS GR+   G N T  +PNSE+AIRRGEY V+RSLIRVLEGGVEGK+QVDKVID+
Sbjct  253  GFPRNNSFGRIFKAGENITINLPNSEEAIRRGEYAVVRSLIRVLEGGVEGKRQVDKVIDK  312

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            C+SMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E
Sbjct  313  CSSMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSE  366


 Score =   269 bits (688),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 178/243 (73%), Gaps = 3/243 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  +  ++EGA N+R+     V+GVA PT
Sbjct  4     PKEPEQVMKLRDGSVLGKKTILKSDHFPGCQNKRMSPQIEGAPNYRQADSLRVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRPV--FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+ V   W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  64    AVGIRNVLRHIGAHKDGKQVQVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS+DS++T LEV++ L+A
Sbjct  123   VRVEQMEARLKEDILMEASRYGNKILVTDELPDGQMVDQWEPVSTDSLKTLLEVYEELQA  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+P+TD+K+PK +DFDTL   I+ A+  T ++FNCQMG GRTTTG VIA LV
Sbjct  183   EGYLVDYERVPVTDEKSPKETDFDTLIRKISQANINTEIIFNCQMGRGRTTTGMVIATLV  242

Query  1221  KLR  1229
               +
Sbjct  243   YFK  245


 Score =   131 bits (330),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 133/247 (54%), Gaps = 17/247 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  865   MESIVNERSGSVLGKGSILKMYFFPG-QRTSSRMQINGAPHVYKVDRYPVYSMATPTISG  923

Query  696   ILSVIQRIGS--SKEGRP----VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+   +EGR     +   ++REE ++YING PFVLRE+ +P  + L++ GI 
Sbjct  924   AKKMLAYLGTKLQEEGRDSTDRIVVTDLREEALVYINGTPFVLRELSKPV-DTLKHVGIT  982

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLE  1019
                VE +E RLK+DI+ E  R  G  M++H       +   ++   WE++  ++V+TP E
Sbjct  983   GAVVESIETRLKEDILSEV-RETGGRMLLHREEYSPASNQSRVIGYWENIHPENVKTPAE  1041

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTG  1199
             V+  L+ E + I Y RIP+T ++   +SD D  A+         + +F    G G  +  
Sbjct  1042  VYAALKNENYNISYRRIPLTRERDALASDVD--AIQYCKDDSAGSYLFVSHTGFGGVSYA  1099

Query  1200  TVIACLV  1220
               I CL+
Sbjct  1100  MAITCLL  1106


 Score = 86.3 bits (212),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+CS++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  288   VVRSLIRVLEGGVEGKRQVDKVIDKCSSMQNLREAIATYRSSILRQPDE-KKREAALSFF  346

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA YL S+    F   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  347   VEYLERYYFLICFAVYLHSEG--AFLQSGSLGHVSFTDWMRARPELYSILRRLLRRDPMG  404

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQ-I  1912
               G     P   +           M  +   R+G+VLG  ++L     PG + SS  + +
Sbjct  405   ALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSDHSPGCQISSLPERV  464

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  465   EGAPNFREV  473


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  731  ITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  790

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  791  ERYFRLIAFAAYLGSE  806


 Score = 63.2 bits (152),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +3

Query  1926  MFTRCAGAGHLREDIIYFTKELKKFP-DDDDEHRAYLMDMGIRALR  2060
             +  +CA AGHLREDI+Y+TKELKK P +  D++ +Y+MDMG++ALR
Sbjct  1167  IIEQCAEAGHLREDIVYYTKELKKLPTNTKDDNLSYIMDMGVKALR  1212


 Score = 57.4 bits (137),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 51/91 (56%), Gaps = 5/91 (5%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEM  304
             E+A+  G+Y  I SLIRV+  G + K  VD +I++CA   +LRE I  Y   + + P   
Sbjct  1136  EEALNMGDYRDILSLIRVISHGPQSKSDVDGIIEQCAEAGHLREDIVYYTKELKKLPTNT  1195

Query  305   KREAALSFF----VEYLERY*FLICFAVYLH  385
             K +  LS+     V+ L RY +LI F  YL+
Sbjct  1196  K-DDNLSYIMDMGVKALRRYFYLITFRSYLY  1225


 Score = 53.5 bits (127),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/123 (24%), Positives = 62/123 (50%), Gaps = 10/123 (8%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER  1552
               + D   +  + R+  +G + +  +D II++C+   ++R+ ++ Y +   +  T  ++ 
Sbjct  1139  LNMGDYRDILSLIRVISHGPQSKSDVDGIIEQCAEAGHLREDIVYYTKELKKLPTNTKDD  1198

Query  1553  RVA--LNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWS  1726
              ++  ++ G + L RYF LI F +YL       +C   E M  F  W+  RPE+  +  +
Sbjct  1199  NLSYIMDMGVKALRRYFYLITFRSYL-------YCTSPEEM-KFVDWMQSRPELGHLCHN  1250

Query  1727  IRL  1735
             +R+
Sbjct  1251  LRI  1253



>ref|XP_010035529.1| PREDICTED: paladin-like [Eucalyptus grandis]
Length=1253

 Score =   476 bits (1225),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 231/295 (78%), Positives = 257/295 (87%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++ RLLRRDPMGALGYASL+PS     ES +GRP EM  VAA R GEVLGSQTVLKSD
Sbjct  389   YSIICRLLRRDPMGALGYASLEPSLMKMAESADGRPYEMGVVAASRIGEVLGSQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI SV QRIGS   GRPVFWHNM
Sbjct  449   HCPGCQNQSLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVKQRIGSGICGRPVFWHNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERP+KNMLEY+GID ERVE+MEARLK+DI+REAERY GAIMV
Sbjct  509   REEPVIYINGKPFVLREVERPFKNMLEYSGIDRERVEKMEARLKEDILREAERYGGAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET  GQIFD+WE V S SVQTPLEVF+ LE++GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  569   IHETEKGQIFDAWEQVDSSSVQTPLEVFENLESDGFPIKYARVPITDGKAPKSSDFDTLA  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEEL  1283
             +NI+SASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPI++L  DA  EE+
Sbjct  629   MNISSASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIKILFADAKQEEV  683


 Score =   348 bits (892),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             +G+E +G+       + K +  ++    FGINDI+LL KITRLFDNG+ECREALDAIIDR
Sbjct  689   NGEEINGNGAASTSPVSKEKLSEEQGRAFGINDIVLLGKITRLFDNGLECREALDAIIDR  748

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVL+YR++FNQQ  EPR R+VALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  749   CSALQNIRQAVLEYRKVFNQQHVEPRVRQVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  808

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGE   TFK W HQRPEVQAMKWSIRLRPGRFF++PEELR   E +HGDAVMEAIVK 
Sbjct  809   CGQGEMRMTFKTWQHQRPEVQAMKWSIRLRPGRFFSVPEELRVSQESQHGDAVMEAIVKS  868

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGS+LGKGSIL  YFFPGQRTSSHIQI GAPHVYKV
Sbjct  869   RNGSILGKGSILKKYFFPGQRTSSHIQIDGAPHVYKV  905


 Score =   187 bits (474),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT+SIGRV   G+N T  +PNSE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  251  GIPRTDSIGRVLDSGSNVTVNLPNSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  310

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLH  385
            CASMQNLREAIAT RN+ILRQPDEMKREA LS FVEYLERY +LICFA Y+H
Sbjct  311  CASMQNLREAIATNRNNILRQPDEMKREATLSTFVEYLERYYYLICFAKYIH  362


 Score =   246 bits (629),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 165/242 (68%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E + V  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT
Sbjct  4     PKEPELVMKLRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQADSLHVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRPV--FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V++ IG+  +G+ V   W ++REE VIYING+PFVL + E+P  N LE TGI+ 
Sbjct  64    IDGIRNVLKHIGAQIDGKGVRVLWISLREEPVIYINGRPFVLCDEEKPLSN-LELTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             +RVE+ME RLK+DIM EA RY   I+V  E  D QI D WE VS DSV+TPLEV++ L  
Sbjct  123   DRVEQMEGRLKEDIMMEAARYGNKILVTDELPDYQIVDQWEPVSRDSVKTPLEVYQELHD  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+P+TD+KAP+  D D L   I+     T ++FNCQMG GRTTTG VIA L+
Sbjct  183   EGYLVDYERVPLTDEKAPEEQDIDDLVEKISRVDVNTEIIFNCQMGCGRTTTGMVIATLI  242

Query  1221  KL  1226
              L
Sbjct  243   YL  244


 Score =   135 bits (341),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 133/247 (54%), Gaps = 14/247 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G +LG  ++LK    PG    S   +++GA +  ++ G+PV+ +A PT++G
Sbjct  862   MEAIVKSRNGSILGKGSILKKYFFPG-QRTSSHIQIDGAPHVYKVDGYPVFSMATPTING  920

Query  696   ILSVIQRIGSSKEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  +G+        R V   ++REE V+YING PFVLRE+ +P  + L++ GI   
Sbjct  921   AKEMLAYLGAKPAAGVTSRKVIITDLREEAVVYINGMPFVLRELNKPV-DTLKHAGITGP  979

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDS-----WEHVSSDSVQTPLEVFK  1028
              VE MEARLK+DI+ E  +  G +++ HE  +     S     W ++ +D ++TP EV+ 
Sbjct  980   VVEHMEARLKEDILFEVRQSSGQMLLHHEEYNATSHQSSVTGYWMNILTDDIKTPAEVYA  1039

Query  1029  CLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVI  1208
              L+ EG+ I Y RIP+T ++   +SD D  AL           ++    G G       I
Sbjct  1040  SLKDEGYNITYRRIPLTREREALASDVD--ALQYCKDDSAGCYLYVSHTGFGGVAYAMAI  1097

Query  1209  ACLVKLR  1229
              C +KL+
Sbjct  1098  TC-IKLK  1103


 Score = 74.7 bits (182),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 92/195 (47%), Gaps = 22/195 (11%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+   R    +Q  E + R   L+  
Sbjct  286   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATNRNNILRQPDEMK-REATLSTF  344

Query  1574  AEYLERYFRLIAFAAYL------GSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              EYLERY+ LI FA Y+         +  G C       TF  W+  RPE+ ++   + L
Sbjct  345   VEYLERYYYLICFAKYIHSERESLRSSSLGRC-------TFAEWMKARPELYSIICRL-L  396

Query  1736  RPGRFFTIPEELRTPHELKHGDAV------MEAIVKDRNGSVLGKGSILTMYFFPG-QRT  1894
             R      +      P  +K  ++       M  +   R G VLG  ++L     PG Q  
Sbjct  397   RRDPMGALGYASLEPSLMKMAESADGRPYEMGVVAASRIGEVLGSQTVLKSDHCPGCQNQ  456

Query  1895  SSHIQIHGAPHVYKV  1939
             S   ++ GAP+  +V
Sbjct  457   SLPERVEGAPNFREV  471


 Score = 71.6 bits (174),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHL++DI+Y+ KEL+K  D DDE R+YLMDMGI+ALR
Sbjct  1163  VDTIINRCAGAGHLQDDILYYRKELEKLSDCDDEKRSYLMDMGIKALR  1210


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +2

Query  146  EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAAL  322
            +  ++  + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R+ AL
Sbjct  721  DIVLLGKITRLFDNGLECREALDAIIDRCSALQNIRQAVLEYRKVFNQQHVEPRVRQVAL  780

Query  323  SFFVEYLERY*FLICFAVYLHTE  391
            +   EYLERY  LI FA YL +E
Sbjct  781  NRGAEYLERYFRLIAFAAYLGSE  803


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSI--LRQ  292
             + +DA++  +Y  I +L RVLE G + K  VD +I+RCA   +L++ I  YR  +  L  
Sbjct  1133  SGDDALKMDDYGDILNLTRVLEYGPKSKADVDTIINRCAGAGHLQDDILYYRKELEKLSD  1192

Query  293   PDEMKREAALSFFVEYLERY*FLICFAVYLH  385
              D+ KR   +   ++ L RY +LI F  YL+
Sbjct  1193  CDDEKRSYLMDMGIKALRRYSYLITFQSYLY  1223



>gb|KCW46950.1| hypothetical protein EUGRSUZ_K00763 [Eucalyptus grandis]
Length=1256

 Score =   476 bits (1225),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 231/295 (78%), Positives = 257/295 (87%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++ RLLRRDPMGALGYASL+PS     ES +GRP EM  VAA R GEVLGSQTVLKSD
Sbjct  392   YSIICRLLRRDPMGALGYASLEPSLMKMAESADGRPYEMGVVAASRIGEVLGSQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI SV QRIGS   GRPVFWHNM
Sbjct  452   HCPGCQNQSLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVKQRIGSGICGRPVFWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERP+KNMLEY+GID ERVE+MEARLK+DI+REAERY GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPFKNMLEYSGIDRERVEKMEARLKEDILREAERYGGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET  GQIFD+WE V S SVQTPLEVF+ LE++GFPIKYAR+PITD KAPKSSDFDTLA
Sbjct  572   IHETEKGQIFDAWEQVDSSSVQTPLEVFENLESDGFPIKYARVPITDGKAPKSSDFDTLA  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVL-NDALHEEL  1283
             +NI+SASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPI++L  DA  EE+
Sbjct  632   MNISSASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIKILFADAKQEEV  686


 Score =   348 bits (892),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             +G+E +G+       + K +  ++    FGINDI+LL KITRLFDNG+ECREALDAIIDR
Sbjct  692   NGEEINGNGAASTSPVSKEKLSEEQGRAFGINDIVLLGKITRLFDNGLECREALDAIIDR  751

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVL+YR++FNQQ  EPR R+VALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  752   CSALQNIRQAVLEYRKVFNQQHVEPRVRQVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  811

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGE   TFK W HQRPEVQAMKWSIRLRPGRFF++PEELR   E +HGDAVMEAIVK 
Sbjct  812   CGQGEMRMTFKTWQHQRPEVQAMKWSIRLRPGRFFSVPEELRVSQESQHGDAVMEAIVKS  871

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGS+LGKGSIL  YFFPGQRTSSHIQI GAPHVYKV
Sbjct  872   RNGSILGKGSILKKYFFPGQRTSSHIQIDGAPHVYKV  908


 Score =   187 bits (474),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT+SIGRV   G+N T  +PNSE+AIRRGEY VIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  254  GIPRTDSIGRVLDSGSNVTVNLPNSEEAIRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLH  385
            CASMQNLREAIAT RN+ILRQPDEMKREA LS FVEYLERY +LICFA Y+H
Sbjct  314  CASMQNLREAIATNRNNILRQPDEMKREATLSTFVEYLERYYYLICFAKYIH  365


 Score =   241 bits (615),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 165/245 (67%), Gaps = 6/245 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E + V  LR G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT
Sbjct  4     PKEPELVMKLRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQADSLHVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V++ IG+  +G+   V W ++REE VIYING+PFVL + E+P  N LE TGI+ 
Sbjct  64    IDGIRNVLKHIGAQIDGKGVRVLWISLREEPVIYINGRPFVLCDEEKPLSN-LELTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLE---VFKC  1031
             +RVE+ME RLK+DIM EA RY   I+V  E  D QI D WE VS DSV+TPLE   V++ 
Sbjct  123   DRVEQMEGRLKEDIMMEAARYGNKILVTDELPDYQIVDQWEPVSRDSVKTPLEVSYVYQE  182

Query  1032  LEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIA  1211
             L  EG+ + Y R+P+TD+KAP+  D D L   I+     T ++FNCQMG GRTTTG VIA
Sbjct  183   LHDEGYLVDYERVPLTDEKAPEEQDIDDLVEKISRVDVNTEIIFNCQMGCGRTTTGMVIA  242

Query  1212  CLVKL  1226
              L+ L
Sbjct  243   TLIYL  247


 Score =   135 bits (341),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 133/247 (54%), Gaps = 14/247 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G +LG  ++LK    PG    S   +++GA +  ++ G+PV+ +A PT++G
Sbjct  865   MEAIVKSRNGSILGKGSILKKYFFPG-QRTSSHIQIDGAPHVYKVDGYPVFSMATPTING  923

Query  696   ILSVIQRIGSSKEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  +G+        R V   ++REE V+YING PFVLRE+ +P  + L++ GI   
Sbjct  924   AKEMLAYLGAKPAAGVTSRKVIITDLREEAVVYINGMPFVLRELNKPV-DTLKHAGITGP  982

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDS-----WEHVSSDSVQTPLEVFK  1028
              VE MEARLK+DI+ E  +  G +++ HE  +     S     W ++ +D ++TP EV+ 
Sbjct  983   VVEHMEARLKEDILFEVRQSSGQMLLHHEEYNATSHQSSVTGYWMNILTDDIKTPAEVYA  1042

Query  1029  CLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVI  1208
              L+ EG+ I Y RIP+T ++   +SD D  AL           ++    G G       I
Sbjct  1043  SLKDEGYNITYRRIPLTREREALASDVD--ALQYCKDDSAGCYLYVSHTGFGGVAYAMAI  1100

Query  1209  ACLVKLR  1229
              C +KL+
Sbjct  1101  TC-IKLK  1106


 Score = 74.7 bits (182),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 92/195 (47%), Gaps = 22/195 (11%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+   R    +Q  E + R   L+  
Sbjct  289   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATNRNNILRQPDEMK-REATLSTF  347

Query  1574  AEYLERYFRLIAFAAYL------GSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              EYLERY+ LI FA Y+         +  G C       TF  W+  RPE+ ++   + L
Sbjct  348   VEYLERYYYLICFAKYIHSERESLRSSSLGRC-------TFAEWMKARPELYSIICRL-L  399

Query  1736  RPGRFFTIPEELRTPHELKHGDAV------MEAIVKDRNGSVLGKGSILTMYFFPG-QRT  1894
             R      +      P  +K  ++       M  +   R G VLG  ++L     PG Q  
Sbjct  400   RRDPMGALGYASLEPSLMKMAESADGRPYEMGVVAASRIGEVLGSQTVLKSDHCPGCQNQ  459

Query  1895  SSHIQIHGAPHVYKV  1939
             S   ++ GAP+  +V
Sbjct  460   SLPERVEGAPNFREV  474


 Score = 71.6 bits (174),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHL++DI+Y+ KEL+K  D DDE R+YLMDMGI+ALR
Sbjct  1166  VDTIINRCAGAGHLQDDILYYRKELEKLSDCDDEKRSYLMDMGIKALR  1213


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +2

Query  146  EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAAL  322
            +  ++  + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R+ AL
Sbjct  724  DIVLLGKITRLFDNGLECREALDAIIDRCSALQNIRQAVLEYRKVFNQQHVEPRVRQVAL  783

Query  323  SFFVEYLERY*FLICFAVYLHTE  391
            +   EYLERY  LI FA YL +E
Sbjct  784  NRGAEYLERYFRLIAFAAYLGSE  806


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSI--LRQ  292
             + +DA++  +Y  I +L RVLE G + K  VD +I+RCA   +L++ I  YR  +  L  
Sbjct  1136  SGDDALKMDDYGDILNLTRVLEYGPKSKADVDTIINRCAGAGHLQDDILYYRKELEKLSD  1195

Query  293   PDEMKREAALSFFVEYLERY*FLICFAVYLH  385
              D+ KR   +   ++ L RY +LI F  YL+
Sbjct  1196  CDDEKRSYLMDMGIKALRRYSYLITFQSYLY  1226



>ref|XP_010245397.1| PREDICTED: paladin isoform X2 [Nelumbo nucifera]
Length=1273

 Score =   493 bits (1269),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/293 (80%), Positives = 262/293 (89%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRR+PMGALGYASLKPS     ES +GRP EM  VAALR+GEVLGSQTVLKSD
Sbjct  371   YSILRRLLRRNPMGALGYASLKPSLMKIAESADGRPCEMGVVAALRNGEVLGSQTVLKSD  430

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+PGFPVYGVANPT+ GI +VIQRIGSSK GRPVFWHNM
Sbjct  431   HCPGCQNLSLPERVEGAPNFREVPGFPVYGVANPTIDGIQAVIQRIGSSKGGRPVFWHNM  490

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE V+YINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  491   REEPVVYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAERYGGAIMV  550

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV+S +VQTP+EV++CLEA G PIKYAR+PITD KAPKSS FDTLA
Sbjct  551   IHETNDGQIFDAWEHVNSQAVQTPVEVYRCLEASGLPIKYARVPITDGKAPKSSGFDTLA  610

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
             +NIASASK TA VFNCQMG GRTTTGTVIACL++LRIDYGRPIR+  +++  E
Sbjct  611   MNIASASKDTAFVFNCQMGRGRTTTGTVIACLLRLRIDYGRPIRMHLESMSSE  663


 Score =   353 bits (907),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG E  G+         K R +K+ +  FGINDI LL KITRLFDNGVECRE LDAIIDR
Sbjct  670   SGGEEAGNGTVSISYSEKARKEKEPNRAFGINDIPLLRKITRLFDNGVECREVLDAIIDR  729

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIR+AVL+YR++FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  730   CSALQNIREAVLRYRKVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  789

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQG+S TTFK WL+QRPEVQAMKWSIRLRPGRFFT+PEELR P E +HGDAVMEA+VK 
Sbjct  790   CGQGDSKTTFKVWLNQRPEVQAMKWSIRLRPGRFFTVPEELRVPRESQHGDAVMEALVKA  849

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             R+GS+LGKGSIL MYFFPGQRTS+HIQIHGAPHVYKV
Sbjct  850   RSGSILGKGSILKMYFFPGQRTSNHIQIHGAPHVYKV  886


 Score =   164 bits (414),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 92/120 (77%), Gaps = 20/120 (17%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIG+VS  G++ TD  PNSE+AIRRGEY VIRSLIRVLE               
Sbjct  253  GIPRTNSIGKVSDAGSDITDNFPNSEEAIRRGEYAVIRSLIRVLE---------------  297

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
                 NLREAIATYR+SILRQPDEMKREA+LSFFVEYLERY FLICFAVY+HTER ALHP
Sbjct  298  -----NLREAIATYRSSILRQPDEMKREASLSFFVEYLERYYFLICFAVYIHTERAALHP  352


 Score =   273 bits (699),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 135/242 (56%), Positives = 173/242 (71%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV   R G VLG +T+LKSDH PGC +  L  +++G+ N+R+     V+GVA PT
Sbjct  6     PKEPEQVMKQRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGSPNYRQADSSRVHGVAMPT  65

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V+  IG+ K G+   V WHN+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  66    IDGIRNVLDHIGAQKNGKKTQVLWHNLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  124

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLKDDI+ EA RY   I+V  E  DGQ+ D WE V+ DSV+TPLEV++ L+ 
Sbjct  125   ARVEQMEARLKDDILVEAARYGNKILVTDELPDGQMVDQWELVTHDSVKTPLEVYEELQM  184

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK  DFD L   I+ A   T +VFNCQMG GRTTTG VIA LV
Sbjct  185   EGYLVDYERVPITDEKSPKEQDFDILVHKISQADIDTEIVFNCQMGRGRTTTGMVIATLV  244

Query  1221  KL  1226
              L
Sbjct  245   YL  246


 Score =   133 bits (334),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/246 (36%), Positives = 132/246 (54%), Gaps = 18/246 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG +LG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT++G
Sbjct  843   MEALVKARSGSILGKGSILKMYFFPG-QRTSNHIQIHGAPHVYKVDGYPVYSMATPTITG  901

Query  696   ILSVIQRIG--SSKEGR---PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G  S+  G     V   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  902   AREMLSFLGARSTMGGNIAPKVIVTDLREEAVVYINGTPFVLRELNQPV-DTLKHVGITG  960

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E   + G  M++H      E     +   WE+V  + V+TP EV
Sbjct  961   PLVEHMEARLKEDILAEIS-HSGGQMLLHREEYCPELNQSSVIGYWENVLLEDVKTPAEV  1019

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTL-ALNIASASKYTALVFNCQMGIGRTTTG  1199
             F  L+ EG+ + Y RIP+T ++   +SD D +  L   SA  Y   +F    G G     
Sbjct  1020  FASLKDEGYILDYRRIPLTREREALASDVDAIQCLKDDSAGCY---LFVSHTGFGGVAYA  1076

Query  1200  TVIACL  1217
               I CL
Sbjct  1077  MAITCL  1082


 Score = 67.8 bits (164),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + GVE ++ +D +IDRC+++QN+REA+  YR    +Q  E + R  AL+  
Sbjct  705  LLRKITRLFDNGVECREVLDAIIDRCSALQNIREAVLRYRKVFNQQHVEPRVRRVALNRG  764

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI FA YL +E
Sbjct  765  AEYLERYFRLIAFAAYLGSE  784


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = +3

Query  1908  KFMVRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALRP--VTNVN  2078
             K  V ++  RCAGAG+LR+DI+Y+ +EL+   D DD+ +  L+DMGI+ALR    T VN
Sbjct  1143  KAEVDIVIERCAGAGNLRDDILYYRRELENCHDCDDDKKGNLLDMGIKALRKSLTTQVN  1201


 Score = 53.9 bits (128),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 75/161 (47%), Gaps = 8/161 (5%)
 Frame = +2

Query  1475  ALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCG  1654
              L+N+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI FA Y+ ++       
Sbjct  295   VLENLREAIATYRSSILRQPDEMK-REASLSFFVEYLERYYFLICFAVYIHTERA-ALHP  352

Query  1655  QGESMTTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEELRTPHELKHGDAVMEAI  1819
                  ++F  W+  RPE+ + ++  +R  P    G     P  ++           M  +
Sbjct  353   SSSCQSSFSDWMRARPELYSILRRLLRRNPMGALGYASLKPSLMKIAESADGRPCEMGVV  412

Query  1820  VKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIHGAPHVYKV  1939
                RNG VLG  ++L     PG Q  S   ++ GAP+  +V
Sbjct  413   AALRNGEVLGSQTVLKSDHCPGCQNLSLPERVEGAPNFREV  453



>ref|XP_009116873.1| PREDICTED: LOW QUALITY PROTEIN: paladin [Brassica rapa]
Length=1257

 Score =   488 bits (1256),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 235/294 (80%), Positives = 258/294 (88%), Gaps = 0/294 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYA++KPS     EST+GRP EM  VAALRSGEVLGSQTVLKSD
Sbjct  395   YSILRRLLRRDPMGALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGEVLGSQTVLKSD  454

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+R+GSS+ GRPVFWHNM
Sbjct  455   HSPGCQILSLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIERVGSSRGGRPVFWHNM  514

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVE MEARLK+DI+REA RY GAIMV
Sbjct  515   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVEGMEARLKEDILREARRYDGAIMV  574

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD WEHV +DSVQTPLEV+K LEA+GFPIKYAR+PITD KAPKSSDFDTL 
Sbjct  575   IHETKDGQIFDLWEHVDADSVQTPLEVYKSLEADGFPIKYARVPITDGKAPKSSDFDTLT  634

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASA+K TA VFN QMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  635   SNIASAAKDTAFVFNXQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  688


 Score =   330 bits (845),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 177/216 (82%), Gaps = 0/216 (0%)
 Frame = +2

Query  1292  GDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRC  1471
             G+E+  +     P I + R +      FG++DILLLWKITRLFDNGVE REALDA+IDRC
Sbjct  697   GEETGSNTAETRPRISERRTEDQHGRTFGMDDILLLWKITRLFDNGVESREALDAVIDRC  756

Query  1472  SALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFC  1651
             SALQNIR+AVLQYR++FNQQ  EPR R  AL RGAEYLERYFRLIAFAAYLGS+  D F 
Sbjct  757   SALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSETLDDFF  816

Query  1652  GQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDR  1831
              +G S  TFK+WLHQRPEVQAMKWSIRLRPGRFFTIPEELR  HE +HGDAVME+IV +R
Sbjct  817   VKGGSKVTFKNWLHQRPEVQAMKWSIRLRPGRFFTIPEELRAQHESQHGDAVMESIVNER  876

Query  1832  NGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             +GSVLGKGSIL MYFFPGQRTSS +QI GAPHVYKV
Sbjct  877   SGSVLGKGSILKMYFFPGQRTSSRVQITGAPHVYKV  912


 Score =   192 bits (489),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR NS GR+   G N T  +PNSE+AIRRGEY V+RSLIRVLEGGVEGK+QVDKVID+
Sbjct  257  GFPRNNSFGRIFKAGENITINLPNSEEAIRRGEYAVVRSLIRVLEGGVEGKRQVDKVIDK  316

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E   L  
Sbjct  317  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSEGGYLQS  376

Query  410  TS  415
             S
Sbjct  377  GS  378


 Score =   266 bits (679),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 180/253 (71%), Gaps = 7/253 (3%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  LR G VLG +T+LKSDH PGC +  +  +++GA N+R+     V+GVA PT
Sbjct  8     PKEPEQVMKLRDGSVLGKKTILKSDHFPGCQNKRMTPQIDGAPNYRQAESLRVHGVAIPT  67

Query  687   VSGILSVIQRIGSSKEGRPV--FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+ V   W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  68    AVGIRNVLRHIGAHKDGKQVQVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  126

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS+DS++T LEV++ L+A
Sbjct  127   VRVEQMEARLKEDILMEASRYGNKILVTDELPDGQMVDQWEPVSTDSLKTLLEVYEELQA  186

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+P+TD+K+PK +DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  187   EGYLVDYERVPVTDEKSPKETDFDALIKKISQADINTEIIFNCQMGRGRTTTGMVIATLV  246

Query  1221  KLR----IDYGRP  1247
               +     D+G P
Sbjct  247   YFKRTGASDHGFP  259


 Score =   132 bits (331),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 83/247 (34%), Positives = 132/247 (53%), Gaps = 17/247 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VLG  ++LK    PG    S  + + GA +  ++  +PVY +A PT+SG
Sbjct  869   MESIVNERSGSVLGKGSILKMYFFPGQRTSSRVQ-ITGAPHVYKVDRYPVYSMATPTISG  927

Query  696   ILSVIQRIGSS--KEGRP----VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+   +EG      V   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  928   AKKMLAYLGTKLKEEGGDSAARVVVTDLREEAVVYINGTPFVLRELSKPV-DTLKHVGIT  986

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLE  1019
                VE +E RLK+DI+ E  R  G  M++H       + + ++   WE++  ++V+TP E
Sbjct  987   GAVVESIETRLKEDILSEV-RETGGRMLLHREEYSPASNESRVIGYWENIQPENVKTPAE  1045

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTG  1199
             V+  L+ E + I Y RIP+T ++   +SD D  A+           +F    G G  +  
Sbjct  1046  VYAALKDENYNISYRRIPLTRERDALASDLD--AIQYCKDDSAGGYLFVSHTGFGGASYA  1103

Query  1200  TVIACLV  1220
               I CLV
Sbjct  1104  MAITCLV  1110


 Score = 83.6 bits (205),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 96/189 (51%), Gaps = 10/189 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  292   VVRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  350

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQA-MKWSIRLRP--  1741
              EYLERY+ LI FA YL S+   G+   G     +F  W+  RPE+ + ++  +R  P  
Sbjct  351   VEYLERYYFLICFAVYLHSEG--GYLQSGSLGHVSFSDWMRARPELYSILRRLLRRDPMG  408

Query  1742  --GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQI  1912
               G     P   +           M  +   R+G VLG  ++L     PG Q  S   ++
Sbjct  409   ALGYAAMKPSLTKIAESTDGRPHEMSVVAALRSGEVLGSQTVLKSDHSPGCQILSLPERV  468

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  469   EGAPNFREV  477


 Score = 69.7 bits (169),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +3

Query  1926  MFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             +  +CAGAGHL+EDI Y+TKEL K P+  DE R+Y+MDMG++ALR
Sbjct  1170  IIQQCAGAGHLKEDICYYTKELNKLPNTKDEDRSYIMDMGVKALR  1214


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  735  ITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  794

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  795  ERYFRLIAFAAYLGSE  810


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 2/89 (2%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD--  298
             E+A+  G+Y  I SLIRVL  G + K  VD +I +CA   +L+E I  Y   + + P+  
Sbjct  1139  EEALSMGDYRDILSLIRVLSHGPQSKADVDGIIQQCAGAGHLKEDICYYTKELNKLPNTK  1198

Query  299   EMKREAALSFFVEYLERY*FLICFAVYLH  385
             +  R   +   V+ L RY +LI F  YL+
Sbjct  1199  DEDRSYIMDMGVKALRRYFYLITFRSYLY  1227



>ref|XP_003626100.1| Paladin [Medicago truncatula]
Length=1305

 Score =   465 bits (1197),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 227/337 (67%), Positives = 260/337 (77%), Gaps = 42/337 (12%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGY+SLKPS     EST+GRPSEM  VAALR GEVLGSQTVLKSD
Sbjct  398   YSIIRRLLRRDPMGALGYSSLKPSLTKIAESTDGRPSEMGNVAALRKGEVLGSQTVLKSD  457

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +PSLPER++GA NFR++PGFPV+GVANPT+ GI SVI RI S+  G P+ WHNM
Sbjct  458   HCPGCQNPSLPERVDGAPNFRKVPGFPVFGVANPTIDGIRSVIHRICSTNGGCPILWHNM  517

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGIDCERVE+MEARLK+DI+REA++Y  AIMV
Sbjct  518   REEPVIYINGKPFVLREVERPYKNMLEYTGIDCERVEKMEARLKEDILREAKQYSSAIMV  577

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DG IFD+WEHV+SD +QTPLEVFK LEAEGFPIKYAR+PITD KAP+ SDFD LA
Sbjct  578   IHETDDGHIFDAWEHVTSDLIQTPLEVFKSLEAEGFPIKYARVPITDGKAPERSDFDILA  637

Query  1122  LNIASASKYTALVFNC------------------------------------------QM  1175
              NIASA+K TA VFNC                                          QM
Sbjct  638   NNIASAAKDTAFVFNCQVISYSFISYALSVMNAFIICSSLVLVFLSFSFLAANISLISQM  697

Query  1176  GIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEELS  1286
             G GRTTTGTVIACLVKLR+D+GRPI++L+D + +E S
Sbjct  698   GRGRTTTGTVIACLVKLRVDFGRPIKILSDDITQEES  734


 Score =   353 bits (907),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE+ G V      I + R  +  +  FGINDILLLWKIT LFDNG ECREALDA+IDR
Sbjct  740   SGDEALGRVTALTSNISQIRIDEKQNRVFGINDILLLWKITTLFDNGAECREALDAVIDR  799

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++FNQQ  EPR RRVAL+RGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  800   CSALQNIRQAVLQYRKVFNQQHVEPRVRRVALDRGAEYLERYFRLIAFAAYLGSEAFDGF  859

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQG S  TFK WLHQRPEVQAMKWSIR RPGRFFT+PEELR   E +HGDAVME+ V  
Sbjct  860   CGQGNSRMTFKVWLHQRPEVQAMKWSIRSRPGRFFTVPEELRESQESQHGDAVMESTVNA  919

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTS++IQIHGAPHVYKV
Sbjct  920   RNGSVLGKGSILKMYFFPGQRTSNNIQIHGAPHVYKV  956


 Score =   189 bits (479),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 107/128 (84%), Gaps = 10/128 (8%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NS+GR+     NA D +PNSE+AIRRGEY VIRSL+RVLEGGV+GK+QVDKVID+
Sbjct  250  GIPRSNSMGRIFQSMTNAADHLPNSEEAIRRGEYAVIRSLVRVLEGGVDGKRQVDKVIDK  309

Query  230  CASMQ----------NLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVY  379
            CASMQ          NLREAI TYRNSILRQPDEMK+EA+LSFFVEYLERY FLICFAVY
Sbjct  310  CASMQVSVFNDSNLVNLREAIGTYRNSILRQPDEMKKEASLSFFVEYLERYYFLICFAVY  369

Query  380  LHTERDAL  403
            +++ERD L
Sbjct  370  INSERDIL  377


 Score =   266 bits (679),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E ++V  +R G VLG +T+LKSDH PGC +  L  ++EGA N+R      V+GVA PTV 
Sbjct  7     EPEEVMRMRGGSVLGKKTILKSDHFPGCQNKRLSPQIEGAPNYRRADSLHVHGVAIPTVD  66

Query  693   GILSVIQRIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVE  872
             GI +V+  I + +  + V W ++REE ++YING+PFVLR+VERP+ N LEYTGI+ ERVE
Sbjct  67    GIRNVLNHIRNRQNKQQVLWISLREEPLVYINGRPFVLRDVERPFSN-LEYTGINRERVE  125

Query  873   RMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFP  1052
             +MEARLK+DI+ EAERY   I+V  E  DGQ+ D WE VS DSV+TPLEV++ L+ EG+ 
Sbjct  126   QMEARLKEDILSEAERYGYKILVTDELPDGQMVDQWEPVSCDSVKTPLEVYEELQVEGYL  185

Query  1053  IKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + Y R+PITD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV L
Sbjct  186   VDYERVPITDEKSPKELDFDILVHKISQADVNTEIIFNCQMGRGRTTTGMVIATLVYL  243


 Score =   123 bits (308),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/244 (34%), Positives = 126/244 (52%), Gaps = 15/244 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PV  +A PT+SG
Sbjct  913   MESTVNARNGSVLGKGSILKMYFFPG-QRTSNNIQIHGAPHVYKVDGYPVCCMATPTISG  971

Query  696   ILSVIQRI-GSSKEG---RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                ++  +   SK G   R V   ++REE V+YIN  PFV RE+ +P  + L++ GI   
Sbjct  972   AKEMLNYLDAKSKPGFTARKVILTDVREEAVVYINCVPFVHRELNKPV-DTLKHVGITGP  1030

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEVF  1025
              VE MEARLK+D + E  R  G  M++H       T    +   WE++ +D V+TP EV+
Sbjct  1031  VVEHMEARLKEDTLAEI-RQSGGRMLLHREEYDPSTNQSTVVGYWENILADDVKTPAEVY  1089

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+ +G+ I Y RIP+T ++   +SD D  A+         + +F    G G       
Sbjct  1090  SLLKDDGYDIVYRRIPLTRERDALASDVD--AIQYCQDDSAGSYLFVSHTGFGGVAYAMA  1147

Query  1206  IACL  1217
             I C+
Sbjct  1148  IICI  1151


 Score = 76.3 bits (186),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGH+R+DI+Y+ +E +KF DDDDE RAYL DMGI+ALR
Sbjct  1215  VDIVIERCAGAGHIRDDILYYIREFEKFTDDDDEERAYLFDMGIKALR  1262


 Score = 73.2 bits (178),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 95/198 (48%), Gaps = 18/198 (9%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQ----------NIRQAVLQYRRLFNQQRTEP  1543
             ++  + R+ + GV+ +  +D +ID+C+++Q          N+R+A+  YR    +Q  E 
Sbjct  285   VIRSLVRVLEGGVDGKRQVDKVIDKCASMQVSVFNDSNLVNLREAIGTYRNSILRQPDEM  344

Query  1544  RERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MK  1720
             + +  +L+   EYLERY+ LI FA Y+ S+  D         ++F +W+  RPE+ + ++
Sbjct  345   K-KEASLSFFVEYLERYYFLICFAVYINSER-DILLSSTAGQSSFSNWMRARPELYSIIR  402

Query  1721  WSIRLRP----GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-  1885
               +R  P    G     P   +         + M  +   R G VLG  ++L     PG 
Sbjct  403   RLLRRDPMGALGYSSLKPSLTKIAESTDGRPSEMGNVAALRKGEVLGSQTVLKSDHCPGC  462

Query  1886  QRTSSHIQIHGAPHVYKV  1939
             Q  S   ++ GAP+  KV
Sbjct  463   QNPSLPERVDGAPNFRKV  480


 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 64/111 (58%), Gaps = 3/111 (3%)
 Frame = +2

Query  68   SIGRVSSCGANATDIMPNSEDAIRRG--EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASM  241
            ++GRV++  +N + I  + +     G  +  ++  +  + + G E ++ +D VIDRC+++
Sbjct  744  ALGRVTALTSNISQIRIDEKQNRVFGINDILLLWKITTLFDNGAECREALDAVIDRCSAL  803

Query  242  QNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            QN+R+A+  YR    +Q  E + R  AL    EYLERY  LI FA YL +E
Sbjct  804  QNIRQAVLQYRKVFNQQHVEPRVRRVALDRGAEYLERYFRLIAFAAYLGSE  854


 Score = 57.0 bits (136),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 59/114 (52%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVAL-NRG  1573
             +  +TR+  +G + +  +D +I+RC+   +IR  +L Y R F +   +  E R  L + G
Sbjct  1198  ILNLTRVLVHGPQSKADVDIVIERCAGAGHIRDDILYYIREFEKFTDDDDEERAYLFDMG  1257

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL       +C   +  T F  W+  RPE+  +  ++R+
Sbjct  1258  IKALRRYFFLITFRSYL-------YCNSPDD-TEFAGWMDARPELSHLCNNLRI  1303


 Score = 53.5 bits (127),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD  298
             ++E A+R G+Y  I +L RVL  G + K  VD VI+RCA   ++R+ I  Y     +  D
Sbjct  1185  SNETALRMGDYRDILNLTRVLVHGPQSKADVDIVIERCAGAGHIRDDILYYIREFEKFTD  1244

Query  299   EMKREAALSF--FVEYLERY*FLICFAVYLH  385
             +   E A  F   ++ L RY FLI F  YL+
Sbjct  1245  DDDEERAYLFDMGIKALRRYFFLITFRSYLY  1275



>ref|NP_001190158.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE80294.1| uncharacterized protein AT3G62010 [Arabidopsis thaliana]
Length=1251

 Score =   481 bits (1238),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/294 (79%), Positives = 257/294 (87%), Gaps = 3/294 (1%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRR   RDPMGALGYA++KPS     EST+GRP EM  VAALRSG VLGSQTVLKSD
Sbjct  391   YSILRR---RDPMGALGYAAMKPSLIKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSD  447

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   +LPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+R+GSS+ GRPVFWHNM
Sbjct  448   HSPGCQILNLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIERVGSSRGGRPVFWHNM  507

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVE MEARLK+DI+REA+RY GAIMV
Sbjct  508   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVEGMEARLKEDILREAKRYDGAIMV  567

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD WE+V +DSVQTPLEV+KCLEA+GFPIKYAR+PITD KAPKSSDFDTL 
Sbjct  568   IHETKDGQIFDLWENVDADSVQTPLEVYKCLEADGFPIKYARVPITDGKAPKSSDFDTLT  627

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEEL  1283
              NIASASK TA VFNCQMG GRTTTGTVIACLVKLRI+YGRPI+VL D L  E+
Sbjct  628   SNIASASKDTAFVFNCQMGRGRTTTGTVIACLVKLRINYGRPIKVLYDVLTHEI  681


 Score =   333 bits (855),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 180/216 (83%), Gaps = 0/216 (0%)
 Frame = +2

Query  1292  GDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRC  1471
             G+E+  +     P     R +++    FG++DILLLWKITRLFDNGVE REALDA+IDRC
Sbjct  690   GEETGSNNAEARPRNSGRRTEEEQGRAFGMDDILLLWKITRLFDNGVESREALDAVIDRC  749

Query  1472  SALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFC  1651
             SALQNIR+AVLQYR++FNQQ  EPR R  AL RGAEYLERYFRLIAFAAYLGS AFDGF 
Sbjct  750   SALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYLERYFRLIAFAAYLGSKAFDGFF  809

Query  1652  GQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDR  1831
              +GES  TFK+WLHQRPEVQAMKWSIRLRPGRFFTIPEELR  HE +HGDAVME+IV +R
Sbjct  810   VEGESKVTFKNWLHQRPEVQAMKWSIRLRPGRFFTIPEELRAQHESQHGDAVMESIVNER  869

Query  1832  NGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             +GSVL KGSIL MYFFPGQRTSS +QI+GAPHVYKV
Sbjct  870   SGSVLSKGSILKMYFFPGQRTSSRLQINGAPHVYKV  905


 Score =   192 bits (489),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G PR NS GR+   G N T  +PNSE+AIRRGEY V+RSLIRVLEGGVEGK+QVDKVID+
Sbjct  253  GFPRNNSFGRIFKAGENITVNLPNSEEAIRRGEYAVVRSLIRVLEGGVEGKRQVDKVIDK  312

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            CASMQNLREAIATYR+SILRQPDE KREAALSFFVEYLERY FLICFAVYLH+E
Sbjct  313  CASMQNLREAIATYRSSILRQPDEKKREAALSFFVEYLERYYFLICFAVYLHSE  366


 Score =   266 bits (681),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 176/243 (72%), Gaps = 3/243 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV  +R G VLG +T+LKSDH PGC +  +  ++EGA N+R+     V+GVA PT
Sbjct  4     PKEPEQVMKMRDGSVLGKKTILKSDHFPGCQNKRMTPQIEGAPNYRQADSLRVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+ K+G+   V W ++REE V+YING+PFVLR+VE+P+ N LEYTGI+ 
Sbjct  64    AVGIRNVLRHIGAHKDGKQVKVLWISLREEPVVYINGRPFVLRDVEKPFTN-LEYTGINR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS+DS++T LEV++ L+A
Sbjct  123   VRVEQMEARLKEDILMEASRYGNKILVTDELPDGQMVDQWEPVSTDSLKTLLEVYEELQA  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK +DFD L   I+ A   T ++FNCQMG GRTTTG VIA LV
Sbjct  183   EGYLVDYERVPITDEKSPKETDFDLLIRKISQADINTEIIFNCQMGRGRTTTGMVIATLV  242

Query  1221  KLR  1229
               +
Sbjct  243   YFK  245


 Score =   129 bits (323),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 131/247 (53%), Gaps = 17/247 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   RSG VL   ++LK    PG    S   ++ GA +  ++  +PVY +A PT+SG
Sbjct  862   MESIVNERSGSVLSKGSILKMYFFPG-QRTSSRLQINGAPHVYKVDRYPVYSMATPTISG  920

Query  696   ILSVIQRIGSS--KEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
                ++  +G+   +EG      +   ++REE V+YING PFVLRE+ +P  + L++ GI 
Sbjct  921   AKKMLAYLGTKLKEEGGGSTERIVVTDLREEAVVYINGTPFVLRELSKPV-DTLKHVGIT  979

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLE  1019
                VE +E RLK+DI+ E  R  G  M++H       +   ++   WE++  ++V+TP E
Sbjct  980   GAVVESLETRLKEDILAEV-RETGGRMLLHREEYSPASNQSRVIGYWENIQPENVKTPAE  1038

Query  1020  VFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTG  1199
             V+  L+ E + I Y RIP+T +K   +SD D  A+         + +F    G G  +  
Sbjct  1039  VYAALKDENYNISYRRIPLTREKDALASDVD--AIQYCKDDSAGSYLFVSHTGFGGVSYA  1096

Query  1200  TVIACLV  1220
               I CL+
Sbjct  1097  MAITCLL  1103


 Score = 84.0 bits (206),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 97/190 (51%), Gaps = 15/190 (8%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E ++R  AL+  
Sbjct  288   VVRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRSSILRQPDE-KKREAALSFF  346

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQAMKWSIRLRPGRF  1750
              EYLERY+ LI FA YL S+    F   G     +F  W+  RPE+    +SI  R    
Sbjct  347   VEYLERYYFLICFAVYLHSEG--AFLQSGSLGHVSFADWMRARPEL----YSILRRRDPM  400

Query  1751  FTIPEELRTPHELKHGDAV------MEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQ  1909
               +      P  +K  ++       M  +   R+G+VLG  ++L     PG Q  +   +
Sbjct  401   GALGYAAMKPSLIKIAESTDGRPHEMSVVAALRSGAVLGSQTVLKSDHSPGCQILNLPER  460

Query  1910  IHGAPHVYKV  1939
             + GAP+  +V
Sbjct  461   VEGAPNFREV  470


 Score = 69.7 bits (169),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  1938  CAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             CAGAGHLREDI+Y++KEL K P   DE+R+Y+MDMG++ALR
Sbjct  1168  CAGAGHLREDIVYYSKELNKLPITKDENRSYIMDMGVKALR  1208


 Score = 66.6 bits (161),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL    EYL
Sbjct  728  ITRLFDNGVESREALDAVIDRCSALQNIREAVLQYRKVFNQQHVEPRVRSAALKRGAEYL  787

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL ++
Sbjct  788  ERYFRLIAFAAYLGSK  803


 Score = 57.0 bits (136),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 49/90 (54%), Gaps = 2/90 (2%)
 Frame = +2

Query  125   EDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP--D  298
             E+A+  G+Y  I SLIRVL  G + K  VD +++ CA   +LRE I  Y   + + P   
Sbjct  1133  EEALSMGDYRDILSLIRVLSHGPQSKSDVDGIVELCAGAGHLREDIVYYSKELNKLPITK  1192

Query  299   EMKREAALSFFVEYLERY*FLICFAVYLHT  388
             +  R   +   V+ L RY +LI F  YL++
Sbjct  1193  DENRSYIMDMGVKALRRYFYLITFRSYLYS  1222



>ref|XP_006589082.1| PREDICTED: paladin-like isoform X2 [Glycine max]
Length=1236

 Score =   492 bits (1266),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/293 (79%), Positives = 261/293 (89%), Gaps = 0/293 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRR+PMGALGY++LKPS     EST+GRPSEM  VAALR+GEVLGSQTVLKSD
Sbjct  370   YSIIRRLLRRNPMGALGYSNLKPSLKKIAESTDGRPSEMSVVAALRNGEVLGSQTVLKSD  429

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC HP LPER+EGA NFRE+PGFPVYGVANPT+ GI SVI+RIGSSK GRPV WHNM
Sbjct  430   HCPGCQHPRLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIRRIGSSKGGRPVLWHNM  489

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGI  ERVE+MEARLK+DI+REAE+Y  AIMV
Sbjct  490   REEPVIYINGKPFVLREVERPYKNMLEYTGIGRERVEKMEARLKEDILREAEQYGNAIMV  549

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DG I+D+WEHV+S+ +QTPLEVFK LEA+GFPIKYAR+PITD KAPKSSDFDT+A
Sbjct  550   IHETDDGHIYDAWEHVTSEMIQTPLEVFKSLEADGFPIKYARVPITDGKAPKSSDFDTVA  609

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
              NIASA+K TA VFNCQMG GRTTTGTVIACLVKLRIDYGRPI++L D +  E
Sbjct  610   FNIASAAKDTAFVFNCQMGRGRTTTGTVIACLVKLRIDYGRPIKILRDDMTRE  662


 Score =   360 bits (924),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 183/216 (85%), Gaps = 0/216 (0%)
 Frame = +2

Query  1292  GDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRC  1471
             GDE  G+V    P  L+  P +  SH FGINDILLLWKIT  FDNGVECREALDAIIDRC
Sbjct  671   GDEVGGYVTALTPDTLQIMPDEKQSHAFGINDILLLWKITAFFDNGVECREALDAIIDRC  730

Query  1472  SALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFC  1651
             SALQNIRQAVL+YR++FNQQ  EPR RRVAL RGAEYLERYFRLIAFAAYLGS+AFDGFC
Sbjct  731   SALQNIRQAVLEYRKVFNQQHVEPRVRRVALYRGAEYLERYFRLIAFAAYLGSEAFDGFC  790

Query  1652  GQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDR  1831
             GQ E    FK+W+H+RPEVQAMKWSIRLRPGRFFT+PEELR P E +HGDAVMEA VK R
Sbjct  791   GQAEYKMAFKNWMHERPEVQAMKWSIRLRPGRFFTVPEELRAPQESQHGDAVMEAFVKAR  850

Query  1832  NGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             +GSVLGKG IL  YFFPGQRTSSHIQIHGAPHVYKV
Sbjct  851   SGSVLGKGYILKTYFFPGQRTSSHIQIHGAPHVYKV  886


 Score =   153 bits (386),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 88/122 (72%), Gaps = 20/122 (16%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NS+GRVS C  N  D +PNSE+AIRRGEYTVIRSLIRVLE               
Sbjct  252  GIPRSNSVGRVSQCLTNVADYIPNSEEAIRRGEYTVIRSLIRVLE---------------  296

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
                 NLREAI TYRNSIL QPDEMKREA+LSFFVEYLERY FLICFAVY+H+E   L  
Sbjct  297  -----NLREAIGTYRNSILWQPDEMKREASLSFFVEYLERYYFLICFAVYIHSEMATLCS  351

Query  410  TS  415
            +S
Sbjct  352  SS  353


 Score =   267 bits (682),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 171/242 (71%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E ++V   R G VLG +T+LKSDH PGCH+  L   ++GA N+R+     V+GVA PT
Sbjct  5     PKEPEEVMKRRGGSVLGKKTILKSDHFPGCHNKRLHPHIDGAPNYRQAESLLVHGVAIPT  64

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+  EG+   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  65    TDGIRNVLKHIGARAEGKKAQVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  123

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             ERVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS +SV+TPLEV++ L+ 
Sbjct  124   ERVEQMEARLKEDILMEAARYENKILVTDELPDGQMVDQWESVSCNSVKTPLEVYQELQV  183

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
              G+ + Y R+PITD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA L 
Sbjct  184   AGYLVDYERVPITDEKSPKEWDFDILVHKISQADVNTEIIFNCQMGRGRTTTGMVIATLF  243

Query  1221  KL  1226
              L
Sbjct  244   YL  245


 Score =   138 bits (348),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 128/245 (52%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     RSG VLG   +LK+   PG    S   ++ GA +  ++  FPVY +A PT+SG
Sbjct  843   MEAFVKARSGSVLGKGYILKTYFFPG-QRTSSHIQIHGAPHVYKVDEFPVYSMATPTISG  901

Query  696   ILSVIQRIGSS-----KEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+         + V   ++REE V+YI G PFVLRE+ +P  + L++ GI  
Sbjct  902   AKEILSYLGAKPKANVSSAQKVILTDLREEAVVYIKGTPFVLRELNKPV-DTLKHVGITG  960

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G +M+ H       T    +   WE++ +D V+TP EV
Sbjct  961   PAVEHMEARLKEDILAEI-RQSGGLMLFHREEYDPSTNKSSVVGYWENILADDVKTPAEV  1019

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y+RIP+T ++   +SD D  A+         + +F    G G      
Sbjct  1020  YSTLKDEGYDIIYSRIPLTRERDALASDID--AIQYCKDDSAESYLFVSHTGFGGVAYAM  1077

Query  1203  VIACL  1217
              I C+
Sbjct  1078  AIICI  1082


 Score = 54.7 bits (130),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 67/135 (50%), Gaps = 13/135 (10%)
 Frame = +2

Query  1337  LKTRPKKDSSHEFG-INDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR  1513
             L +R   +++ + G   DIL L   TR+   G + +   D +I+RC+   ++R  +L Y 
Sbjct  1111  LASRASNEAALKMGDYRDILSL---TRVLIRGPQSKADADIVIERCAGAGHLRDDILYYH  1167

Query  1514  RLFNQ-QRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWL  1690
             + F +    +  ER   ++ G + L RYF LI F +YL       +C    +M  F  W+
Sbjct  1168  KEFEKFTDGDDEERAYLMDMGVKALRRYFFLITFRSYL-------YCTSPANM-KFSAWM  1219

Query  1691  HQRPEVQAMKWSIRL  1735
               RPE+  +  ++R+
Sbjct  1220  DARPELGHLCNNLRI  1234


 Score = 75.5 bits (184),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +3

Query  1863  LRCTSFLVRELQVTFKFMVRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDM  2042
             L  T  L+R  Q   K    ++  RCAGAGHLR+DI+Y+ KE +KF D DDE RAYLMDM
Sbjct  1130  LSLTRVLIRGPQS--KADADIVIERCAGAGHLRDDILYYHKEFEKFTDGDDEERAYLMDM  1187

Query  2043  GIRALR  2060
             G++ALR
Sbjct  1188  GVKALR  1193


 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 62/109 (57%), Gaps = 3/109 (3%)
 Frame = +2

Query  74   GRVSSCGANATDIMPNSEDAIRRG--EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQN  247
            G V++   +   IMP+ + +   G  +  ++  +    + GVE ++ +D +IDRC+++QN
Sbjct  676  GYVTALTPDTLQIMPDEKQSHAFGINDILLLWKITAFFDNGVECREALDAIIDRCSALQN  735

Query  248  LREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            +R+A+  YR    +Q  E + R  AL    EYLERY  LI FA YL +E
Sbjct  736  IRQAVLEYRKVFNQQHVEPRVRRVALYRGAEYLERYFRLIAFAAYLGSE  784


 Score = 60.8 bits (146),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 77/161 (48%), Gaps = 8/161 (5%)
 Frame = +2

Query  1475  ALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCG  1654
              L+N+R+A+  YR     Q  E + R  +L+   EYLERY+ LI FA Y+ S+     C 
Sbjct  294   VLENLREAIGTYRNSILWQPDEMK-REASLSFFVEYLERYYFLICFAVYIHSE-MATLCS  351

Query  1655  QGESMTTFKHWLHQRPEVQA-MKWSIRLRPG---RFFTIPEELRTPHELKHG-DAVMEAI  1819
                  ++F  W+  RPE+ + ++  +R  P     +  +   L+   E   G  + M  +
Sbjct  352   SSVDRSSFTDWMRDRPELYSIIRRLLRRNPMGALGYSNLKPSLKKIAESTDGRPSEMSVV  411

Query  1820  VKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIHGAPHVYKV  1939
                RNG VLG  ++L     PG Q      ++ GAP+  +V
Sbjct  412   AALRNGEVLGSQTVLKSDHCPGCQHPRLPERVEGAPNFREV  452


 Score = 56.6 bits (135),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (48%), Gaps = 4/121 (3%)
 Frame = +2

Query  89    CGANATDIM--PNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAI  262
             C A   ++    ++E A++ G+Y  I SL RVL  G + K   D VI+RCA   +LR+ I
Sbjct  1104  CAATEENLASRASNEAALKMGDYRDILSLTRVLIRGPQSKADADIVIERCAGAGHLRDDI  1163

Query  263   ATYRNSI--LRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRP  436
               Y          D+ +R   +   V+ L RY FLI F  YL+    A    S   + RP
Sbjct  1164  LYYHKEFEKFTDGDDEERAYLMDMGVKALRRYFFLITFRSYLYCTSPANMKFSAWMDARP  1223

Query  437   D  439
             +
Sbjct  1224  E  1224



>ref|XP_006605769.1| PREDICTED: paladin-like isoform X2 [Glycine max]
Length=1236

 Score =   484 bits (1246),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 230/290 (79%), Positives = 257/290 (89%), Gaps = 0/290 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRR+PMGALGY+SLKPS     EST+GRPSEM  VAALR+GEVLGSQTVLKSD
Sbjct  370   YSIIRRLLRRNPMGALGYSSLKPSLKKIAESTDGRPSEMSVVAALRNGEVLGSQTVLKSD  429

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC HP LPER+EGA NFRE+ GFPVYGVANPT+ GI SVI RIGSSK G PV WHNM
Sbjct  430   HCPGCQHPRLPERVEGAPNFREVSGFPVYGVANPTIDGIRSVICRIGSSKGGSPVLWHNM  489

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGI  ERVE+MEARLK+DI+REAE+Y  AIMV
Sbjct  490   REEPVIYINGKPFVLREVERPYKNMLEYTGIGRERVEKMEARLKEDILREAEQYGNAIMV  549

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DG I+D+WEHV+S+ +QTPLEVFK LEA+GFPIKYAR+PITD KAPKSSDFDT+A
Sbjct  550   IHETDDGHIYDAWEHVTSEMIQTPLEVFKSLEADGFPIKYARVPITDGKAPKSSDFDTVA  609

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDAL  1271
              NIASA+K TA VFNCQMG GRTTTGTVIACLVKLRIDYGRPI++L D +
Sbjct  610   FNIASAAKDTAFVFNCQMGRGRTTTGTVIACLVKLRIDYGRPIKILRDDM  659


 Score =   364 bits (935),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDE  G+V    P  L+ +P +  SH FGINDILLLWKIT  FDNGVECREALDAIIDR
Sbjct  670   SGDEVGGYVTALTPNTLQIKPDEKQSHAFGINDILLLWKITTFFDNGVECREALDAIIDR  729

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVL+YR++FNQQ  EPR RRVAL RGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  730   CSALQNIRQAVLEYRKVFNQQHVEPRVRRVALYRGAEYLERYFRLIAFAAYLGSEAFDGF  789

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGE    FK+W+H+RPEVQAMKWSIRLRPGRFFT+PEELR P E +HGDAVMEA VK 
Sbjct  790   CGQGEYKMAFKNWMHERPEVQAMKWSIRLRPGRFFTVPEELRAPRESQHGDAVMEAFVKA  849

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             R+GSVLGKG IL MYFFPGQRTSS++QIHGAPH+YKV
Sbjct  850   RSGSVLGKGYILKMYFFPGQRTSSYMQIHGAPHIYKV  886


 Score =   154 bits (390),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 88/122 (72%), Gaps = 20/122 (16%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPR+NS+GRVS C  N  D +PNSE+AIRRGEYTVIRSLIRVLE               
Sbjct  252  GIPRSNSVGRVSQCLTNVADYIPNSEEAIRRGEYTVIRSLIRVLE---------------  296

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
                 NLREAI TYRNSILRQPDEMK+EA+LSFFVEYLERY FLICFAVY+H+E   L  
Sbjct  297  -----NLREAIGTYRNSILRQPDEMKKEASLSFFVEYLERYYFLICFAVYIHSEMATLCS  351

Query  410  TS  415
             S
Sbjct  352  CS  353


 Score =   267 bits (683),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 171/242 (71%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E ++V   R G VLG +T+LKSDH PGCH+  L   ++GA N+R+     V+GVA PT
Sbjct  5     PKEPEEVMKRRGGSVLGKKTILKSDHFPGCHNKRLHPHIDGAPNYRQAESLHVHGVAIPT  64

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
               GI +V++ IG+  EG+   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  65    TDGIRNVLKHIGARAEGKKAQVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  123

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             ERVE+MEARLK+DI+ EA RY   I+V  E  DGQ+ D WE VS +SV+ PLEV++ L+ 
Sbjct  124   ERVEQMEARLKEDILMEAARYGNKILVTDELPDGQMVDQWESVSCNSVKAPLEVYQELQV  183

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + Y R+PITD+K+PK  DFD L   I+ A   T ++FNCQMG GRTTTG VIA L 
Sbjct  184   EGYLVDYERVPITDEKSPKERDFDILVHKISQADVNTEIIFNCQMGRGRTTTGMVIATLF  243

Query  1221  KL  1226
              L
Sbjct  244   YL  245


 Score =   135 bits (341),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 129/246 (52%), Gaps = 18/246 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+     RSG VLG   +LK    PG    S  + + GA +  ++  +PVY +A PT+SG
Sbjct  843   MEAFVKARSGSVLGKGYILKMYFFPGQRTSSYMQ-IHGAPHIYKVDEYPVYSMATPTISG  901

Query  696   ILSVIQRIGSSKEG-----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  +      + V   ++REE V+YI G PFVLRE+ +P  + L++ GI  
Sbjct  902   AKEMLSYLGAKPKANVSSSQKVILTDLREEAVVYIKGTPFVLRELNKPV-DTLKHVGITG  960

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G +M+ H       T    +   WE+V +D V+TP EV
Sbjct  961   LAVEHMEARLKEDILAEI-RQSGGLMLFHREEYNPSTNQSSVVGYWENVLADDVKTPAEV  1019

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLAL-NIASASKYTALVFNCQMGIGRTTTG  1199
             +  L+ EG+ I Y RIP+T ++   +SD DT+      SA  Y   +F    G G     
Sbjct  1020  YSTLKDEGYDIIYLRIPLTRERDALASDIDTIQYCKDDSAESY---LFVSHTGFGGVAYA  1076

Query  1200  TVIACL  1217
               I C+
Sbjct  1077  MAIICV  1082


 Score = 55.8 bits (133),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 68/135 (50%), Gaps = 13/135 (10%)
 Frame = +2

Query  1337  LKTRPKKDSSHEFG-INDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR  1513
             L +R   +++ + G   DIL L   TR+   G + +  +D +I+RC+   ++R  +L Y 
Sbjct  1111  LPSRASNEAALKMGDYRDILSL---TRVLIRGPQSKSDVDIVIERCAGAGHLRDDILYYH  1167

Query  1514  RLFNQ-QRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWL  1690
             + F +    +  ER   ++ G + L RYF LI F +YL       +C    +M  F  W+
Sbjct  1168  KEFEKFTDGDDEERAYLMDMGVKALRRYFFLITFRSYL-------YCTSPANM-KFAAWM  1219

Query  1691  HQRPEVQAMKWSIRL  1735
               RPE+  +  ++R+
Sbjct  1220  DARPELGHLCNNLRI  1234


 Score = 76.6 bits (187),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = +3

Query  1863  LRCTSFLVRELQVTFKFMVRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDM  2042
             L  T  L+R  Q   K  V ++  RCAGAGHLR+DI+Y+ KE +KF D DDE RAYLMDM
Sbjct  1130  LSLTRVLIRGPQS--KSDVDIVIERCAGAGHLRDDILYYHKEFEKFTDGDDEERAYLMDM  1187

Query  2043  GIRALR  2060
             G++ALR
Sbjct  1188  GVKALR  1193


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 61/109 (56%), Gaps = 3/109 (3%)
 Frame = +2

Query  74   GRVSSCGANATDIMPNSEDAIRRG--EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQN  247
            G V++   N   I P+ + +   G  +  ++  +    + GVE ++ +D +IDRC+++QN
Sbjct  676  GYVTALTPNTLQIKPDEKQSHAFGINDILLLWKITTFFDNGVECREALDAIIDRCSALQN  735

Query  248  LREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            +R+A+  YR    +Q  E + R  AL    EYLERY  LI FA YL +E
Sbjct  736  IRQAVLEYRKVFNQQHVEPRVRRVALYRGAEYLERYFRLIAFAAYLGSE  784


 Score = 61.2 bits (147),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 79/161 (49%), Gaps = 8/161 (5%)
 Frame = +2

Query  1475  ALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCG  1654
              L+N+R+A+  YR    +Q  E + +  +L+   EYLERY+ LI FA Y+ S+     C 
Sbjct  294   VLENLREAIGTYRNSILRQPDEMK-KEASLSFFVEYLERYYFLICFAVYIHSE-MATLCS  351

Query  1655  QGESMTTFKHWLHQRPEVQA-MKWSIRLRPG---RFFTIPEELRTPHELKHG-DAVMEAI  1819
                  ++F  W+  RPE+ + ++  +R  P     + ++   L+   E   G  + M  +
Sbjct  352   CSADHSSFTDWMRNRPELYSIIRRLLRRNPMGALGYSSLKPSLKKIAESTDGRPSEMSVV  411

Query  1820  VKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIHGAPHVYKV  1939
                RNG VLG  ++L     PG Q      ++ GAP+  +V
Sbjct  412   AALRNGEVLGSQTVLKSDHCPGCQHPRLPERVEGAPNFREV  452


 Score = 56.6 bits (135),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSI--LRQ  292
             ++E A++ G+Y  I SL RVL  G + K  VD VI+RCA   +LR+ I  Y         
Sbjct  1116  SNEAALKMGDYRDILSLTRVLIRGPQSKSDVDIVIERCAGAGHLRDDILYYHKEFEKFTD  1175

Query  293   PDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
              D+ +R   +   V+ L RY FLI F  YL+    A    +   + RP+
Sbjct  1176  GDDEERAYLMDMGVKALRRYFFLITFRSYLYCTSPANMKFAAWMDARPE  1224



>ref|XP_006841555.1| hypothetical protein AMTR_s00003p00177190 [Amborella trichopoda]
 gb|ERN03230.1| hypothetical protein AMTR_s00003p00177190 [Amborella trichopoda]
Length=1262

 Score =   476 bits (1224),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 251/283 (89%), Gaps = 0/283 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGYAS +PS      S +GRP +MD VAA+R+GEVLG QTVLKSD
Sbjct  389   YSILRRLLRRDPMGALGYASAEPSLMKIAASVDGRPLDMDTVAAMRNGEVLGRQTVLKSD  448

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC   +LPER++GA NFRE+PGFPVYGVANP + GI +V+QRIG S+ GRPV W NM
Sbjct  449   HCPGCQSATLPERVDGAPNFREVPGFPVYGVANPAIDGIHAVLQRIGGSQGGRPVLWQNM  508

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE V+YINGKPFVLREVERPYKNMLEYTGIDCERVE+MEARLK+DI+REAERY GAIMV
Sbjct  509   REEPVVYINGKPFVLREVERPYKNMLEYTGIDCERVEKMEARLKEDILREAERYSGAIMV  568

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHV++  VQTPLEV++CLE+EGFP+KYARIP+TD KAP+SSDFD+LA
Sbjct  569   IHETNDGQIFDAWEHVNAGGVQTPLEVYRCLESEGFPLKYARIPVTDGKAPQSSDFDSLA  628

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPI  1250
             LNIASAS  TA VFNCQMG GRTTTGTVIACLVKLRID+GRP+
Sbjct  629   LNIASASSNTAFVFNCQMGRGRTTTGTVIACLVKLRIDHGRPL  671


 Score =   315 bits (806),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = +2

Query  1355  KDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQR  1534
             +++ H +GI+DILLL K+TRLFDNGVE REALDAIIDRCSA+QNIR+AVLQYR++FNQQ 
Sbjct  711   QEAHHTYGIDDILLLRKVTRLFDNGVESREALDAIIDRCSAMQNIREAVLQYRKVFNQQH  770

Query  1535  TEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA  1714
              EPR RR+ALNRGAEYLERYFRLIAFAAYLGS+AFDGFCGQGE+  TFK WLH+RPEV+ 
Sbjct  771   VEPRVRRLALNRGAEYLERYFRLIAFAAYLGSEAFDGFCGQGETRVTFKTWLHRRPEVKE  830

Query  1715  MKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRT  1894
             MKWSIRLRPGRFFT   E + P E  HGDAVMEAIVK RNGSVLGK SIL MYFFPGQ T
Sbjct  831   MKWSIRLRPGRFFT-ARESKMPSESYHGDAVMEAIVKARNGSVLGKRSILKMYFFPGQIT  889

Query  1895  SSHIQIHGAPHVYKV  1939
             SS   + GAPHVYKV
Sbjct  890   SSFFHVPGAPHVYKV  904


 Score =   203 bits (517),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
             IPRTNSIG+V    A+ +D MPNSE+A+RRGEYTVIRSLIRVLEGGVEGK+QVDKVID+
Sbjct  251  AIPRTNSIGKVLDAKADVSDEMPNSEEAMRRGEYTVIRSLIRVLEGGVEGKRQVDKVIDK  310

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C++MQNLREAIATYRN+ILRQ DEMKREA+LSFFVEYLERY FLICFAVY+HTER AL P
Sbjct  311  CSTMQNLREAIATYRNNILRQADEMKREASLSFFVEYLERYYFLICFAVYIHTERAALRP  370

Query  410  T  412
            +
Sbjct  371  S  371


 Score =   277 bits (708),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/242 (55%), Positives = 174/242 (72%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E + V   R G VLG +T+LKSDH PGC +  L   +EGA N+R+    PV+GVA PT
Sbjct  4     PKEPEHVMNYRGGLVLGKKTILKSDHFPGCQNKRLQPHIEGAPNYRQAGSLPVHGVAIPT  63

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V+  IG+ K+G+   V WHN+REE V+YING+PFVLR++ERP+ N LEYTGID 
Sbjct  64    IDGIRNVLDHIGAQKDGKKTRVLWHNLREEPVVYINGRPFVLRDIERPFSN-LEYTGIDR  122

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
              RVE+MEARLK+DI++EA RY   I+V  E  DGQ+ D WE V+ DSV+TPLEV++ L+ 
Sbjct  123   VRVEQMEARLKEDIIQEAARYGNKILVTDELLDGQMVDQWEPVAQDSVKTPLEVYEELQV  182

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
             EG+ + + R+PITD+K+PK  DFD L   I+ +   T ++FNCQMG GRTTTG VIA LV
Sbjct  183   EGYHVDFGRVPITDEKSPKERDFDILVYKISQSDLNTEIIFNCQMGRGRTTTGMVIATLV  242

Query  1221  KL  1226
              L
Sbjct  243   YL  244


 Score =   132 bits (331),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/244 (33%), Positives = 130/244 (53%), Gaps = 14/244 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG +++LK    PG    S    + GA +  ++ G+ VY +A PTV G
Sbjct  861   MEAIVKARNGSVLGKRSILKMYFFPGQITSSFFH-VPGAPHVYKVDGYLVYSMATPTVDG  919

Query  696   ILSVIQR-----IGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++       +G     + V   ++REE V+YI G PFVLRE+++P  + L++ GI  
Sbjct  920   AKEMLMHLHAIPVGVDTIAQKVILTDLREEAVVYIKGTPFVLRELDQPV-DTLKHVGITG  978

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEVF  1025
               VE MEARLK+DI+ E  +  G +++  E     + +  I   WE++S D V+TP EV+
Sbjct  979   PAVEHMEARLKEDILAEVTQSVGKMLLHREEFNPVSNESNIIGYWENISVDDVKTPAEVY  1038

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L  EG+ I Y RIP+T ++   ++D D +     +++++   +F    G G       
Sbjct  1039  TALRNEGYNIDYRRIPLTREREALATDIDAIQFRKNNSAEH--YLFVSHTGFGGVAYAMG  1096

Query  1206  IACL  1217
             I CL
Sbjct  1097  ITCL  1100


 Score = 58.9 bits (141),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 70/140 (50%), Gaps = 8/140 (6%)
 Frame = +2

Query  1322  YAPLILKTRPKKDSSHEFG-INDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQA  1498
             Y  + + + P ++ + + G   DIL L    R+   G +C+E +D +IDRC+   ++R  
Sbjct  1127  YDDVSISSVPDEEEAFKQGEYRDILSL---IRVLIYGPKCKEEVDTVIDRCAGAGHLRND  1183

Query  1499  VLQY-RRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTT  1675
             +L Y ++L      +   R   ++ G + L RYF LI F +YL S    G     ++   
Sbjct  1184  ILYYKKKLEKSAHLDEESRSYLMDMGIKALRRYFYLITFRSYLYS-TLSGNTNTNDA--G  1240

Query  1676  FKHWLHQRPEVQAMKWSIRL  1735
             F  W+  RPE+  +  ++RL
Sbjct  1241  FAAWMEARPELGHLCDNLRL  1260


 Score = 85.1 bits (209),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 98/188 (52%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+CS +QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  286   VIRSLIRVLEGGVEGKRQVDKVIDKCSTMQNLREAIATYRNNILRQADEMK-REASLSFF  344

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ ++          S  TF  W+  RPE+ + ++  +R  P   
Sbjct  345   VEYLERYYFLICFAVYIHTERA-ALRPSPSSQGTFADWMRARPELYSILRRLLRRDPMGA  403

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQ-IH  1915
              G     P  ++    +      M+ +   RNG VLG+ ++L     PG ++++  + + 
Sbjct  404   LGYASAEPSLMKIAASVDGRPLDMDTVAAMRNGEVLGRQTVLKSDHCPGCQSATLPERVD  463

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  464   GAPNFREV  471


 Score = 69.3 bits (168),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + GVE ++ +D +IDRC++MQN+REA+  YR    +Q  E + R  AL+  
Sbjct  724  LLRKVTRLFDNGVESREALDAIIDRCSAMQNIREAVLQYRKVFNQQHVEPRVRRLALNRG  783

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI FA YL +E
Sbjct  784  AEYLERYFRLIAFAAYLGSE  803


 Score = 67.4 bits (163),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +2

Query  113   MPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQ  292
             +P+ E+A ++GEY  I SLIRVL  G + K++VD VIDRCA   +LR  I  Y+  + + 
Sbjct  1135  VPDEEEAFKQGEYRDILSLIRVLIYGPKCKEEVDTVIDRCAGAGHLRNDILYYKKKLEKS  1194

Query  293   P--DEMKREAALSFFVEYLERY*FLICFAVYLHT  388
                DE  R   +   ++ L RY +LI F  YL++
Sbjct  1195  AHLDEESRSYLMDMGIKALRRYFYLITFRSYLYS  1228


 Score = 64.7 bits (156),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHLR DI+Y+ K+L+K    D+E R+YLMDMGI+ALR
Sbjct  1167  VDTVIDRCAGAGHLRNDILYYKKKLEKSAHLDEESRSYLMDMGIKALR  1214



>ref|XP_009386586.1| PREDICTED: paladin [Musa acuminata subsp. malaccensis]
Length=1262

 Score =   450 bits (1158),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 219/295 (74%), Positives = 251/295 (85%), Gaps = 2/295 (1%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+SLKPS     EST+  P ++  VAA+R+G+VLGSQTVLKSD
Sbjct  400   YSILRRLLRRDPMGALGYSSLKPSSTKISESTDHSPYDVGVVAAMRNGDVLGSQTVLKSD  459

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER++GA NFR+  GFPVYGVANPTV GI  V+QRI  SK GR V WHNM
Sbjct  460   HCPGCQNLSLPERVDGAPNFRDATGFPVYGVANPTVDGIRVVVQRI-RSKGGRSVLWHNM  518

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYING+PFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAE Y G IMV
Sbjct  519   REEPVIYINGRPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAEFYGGTIMV  578

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEH+ ++S+QTPL+V+K LEAEG PIKYAR+PITD KAPKSSDFD +A
Sbjct  579   IHETDDGQIFDAWEHIDAESIQTPLDVYKHLEAEGLPIKYARVPITDGKAPKSSDFDEIA  638

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV-LNDALHEEL  1283
              NIASA K TA VFNCQMG GRTTTGTVIACLVKLRID+G+PI++  +D  HE L
Sbjct  639   SNIASAPKDTAFVFNCQMGRGRTTTGTVIACLVKLRIDHGKPIKMQQDDTYHEHL  693


 Score =   326 bits (836),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 179/217 (82%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+ES G   P    +LK+   K+    FGI+DILLL KITRLFDNG+ECRE LDAIIDR
Sbjct  699   SGEESIGDNGPPISDLLKSVDGKEPRCTFGIDDILLLRKITRLFDNGIECREVLDAIIDR  758

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR++ NQQ  EPR +RVALNRGAEYLERYF+LIAF+AYLGS+AFDGF
Sbjct  759   CSALQNIRQAVLQYRKVINQQHVEPRVKRVALNRGAEYLERYFKLIAFSAYLGSEAFDGF  818

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGE+   FK WLH+RPE+Q MKWSIRLRPGRFFT+P++ +  +E + GD VM+A+VK 
Sbjct  819   CGQGETKILFKTWLHRRPEIQTMKWSIRLRPGRFFTVPDDSKAFYEAQDGDVVMDAVVKS  878

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQRTSS +Q  G PH+YKV
Sbjct  879   RNGSVLGKGSILKMYFFPGQRTSSCMQFKGTPHIYKV  915


 Score =   202 bits (515),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT SIG+V +   + TD  PNSE++IRRGEYTVIRSLIRVLEGG E KKQVDKVID+
Sbjct  262  GIPRTTSIGKVFASDGDVTDYQPNSEESIRRGEYTVIRSLIRVLEGGAEAKKQVDKVIDK  321

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C SMQNLREAIATYRNSILRQPDEMKREA LSFFVEYLERY FLICFAVY+HTER ALH 
Sbjct  322  CDSMQNLREAIATYRNSILRQPDEMKREALLSFFVEYLERYYFLICFAVYVHTERAALHS  381

Query  410  TS  415
             S
Sbjct  382  VS  383


 Score =   259 bits (663),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 169/240 (70%), Gaps = 3/240 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E + V   R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT+ 
Sbjct  17    ESEHVMNYRGGSVLGKKTILKSDHFPGCQNKRLTPQIDGAPNYRQAGSLHVHGVAIPTID  76

Query  693   GILSVIQRIGSSKE--GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             GI +V+  IG+ ++   + V WHN+REE V+YING+PFVLR+VERP+ N LEYTGI+  R
Sbjct  77    GIQNVLNHIGAKQDLKKKGVLWHNLREEPVVYINGRPFVLRDVERPFSN-LEYTGINRAR  135

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             +E+ME RLK+DI+REA RY   I+V  E  DGQ+ D WE V  +SV+ PLEV++ L+ EG
Sbjct  136   LEQMEFRLKEDILREAARYGNKILVTDELPDGQMVDQWEPVMHNSVKAPLEVYEELQEEG  195

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + + Y RIPITD+K+PK  DFD L   I+  +  T +VFNCQMG GRTTTG VIA LV L
Sbjct  196   YLVNYERIPITDEKSPKEGDFDDLVHTISQVNLDTEIVFNCQMGRGRTTTGMVIATLVYL  255


 Score = 84.0 bits (206),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 98/215 (46%), Gaps = 17/215 (8%)
 Frame = +2

Query  1301  SDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSAL  1480
             SDG V  Y P         +S       +  ++  + R+ + G E ++ +D +ID+C ++
Sbjct  275   SDGDVTDYQP---------NSEESIRRGEYTVIRSLIRVLEGGAEAKKQVDKVIDKCDSM  325

Query  1481  QNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQG  1660
             QN+R+A+  YR    +Q  E + R   L+   EYLERY+ LI FA Y+ ++         
Sbjct  326   QNLREAIATYRNSILRQPDEMK-REALLSFFVEYLERYYFLICFAVYVHTERA-ALHSVS  383

Query  1661  ESMTTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEELRTPHELKHGDAVMEAIVK  1825
                 +F  W+  RPE+ + ++  +R  P    G     P   +      H    +  +  
Sbjct  384   SDQISFSEWMRARPELYSILRRLLRRDPMGALGYSSLKPSSTKISESTDHSPYDVGVVAA  443

Query  1826  DRNGSVLGKGSILTMYFFPG-QRTSSHIQIHGAPH  1927
              RNG VLG  ++L     PG Q  S   ++ GAP+
Sbjct  444   MRNGDVLGSQTVLKSDHCPGCQNLSLPERVDGAPN  478


 Score =   144 bits (363),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 131/244 (54%), Gaps = 14/244 (6%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             MD V   R+G VLG  ++LK    PG    S  +  +G  +  ++  +PVY +A PT+ G
Sbjct  872   MDAVVKSRNGSVLGKGSILKMYFFPGQRTSSCMQ-FKGTPHIYKVDAYPVYSMATPTIDG  930

Query  696   ILSVIQRIG-----SSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                V+  +G     S   G+ V   ++REE V+YING PFVLRE++RP  + L++ GI  
Sbjct  931   AREVLSYLGAGDPASMNHGQKVIITDLREEAVVYINGSPFVLRELDRPV-DTLKHVGISG  989

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADG-----QIFDSWEHVSSDSVQTPLEVF  1025
               VE MEARLK+DI  E  +  G +++  E  +       +   WE +S D+V+TP EVF
Sbjct  990   PLVEHMEARLKEDIFAEVTQSGGQMLLHREEYNPVSNQISVIGYWEEISLDNVKTPAEVF  1049

Query  1026  KCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTV  1205
               L+A+G+ I+Y RIP+T ++   + D D +       ++Y+  +F    G G       
Sbjct  1050  AALKADGYRIEYKRIPLTREREALAVDVDAIQYCKDEFARYS--LFISHTGFGGVAYAMA  1107

Query  1206  IACL  1217
             I CL
Sbjct  1108  ITCL  1111


 Score = 73.2 bits (178),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGHLR+DI+++ KE  K P DDDE R+YLMDMGI+ALR
Sbjct  1173  VDMIIERCAGAGHLRDDILHYKKEFDKCPSDDDESRSYLMDMGIKALR  1220


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR  I +Q  E + +  AL+  
Sbjct  734  LLRKITRLFDNGIECREVLDAIIDRCSALQNIRQAVLQYRKVINQQHVEPRVKRVALNRG  793

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI F+ YL +E
Sbjct  794  AEYLERYFKLIAFSAYLGSE  813


 Score = 64.3 bits (155),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP-  295
             + EDA+++G+Y  I SL RVL  G + K +VD +I+RCA   +LR+ I  Y+    + P 
Sbjct  1143  SGEDALKQGDYRDILSLTRVLVYGPKSKDEVDMIIERCAGAGHLRDDILHYKKEFDKCPS  1202

Query  296   -DEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
              D+  R   +   ++ L RY FL+ F  YL+         S   E RP+
Sbjct  1203  DDDESRSYLMDMGIKALRRYFFLVTFRSYLYCSSPTETSFSAWMEARPE  1251


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 63/114 (55%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVAL-NRG  1573
             +  +TR+   G + ++ +D II+RC+   ++R  +L Y++ F++  ++  E R  L + G
Sbjct  1156  ILSLTRVLVYGPKSKDEVDMIIERCAGAGHLRDDILHYKKEFDKCPSDDDESRSYLMDMG  1215

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF L+ F +YL       +C    + T+F  W+  RPE+  +  +++L
Sbjct  1216  IKALRRYFFLVTFRSYL-------YC-SSPTETSFSAWMEARPELGHLCDNLKL  1261



>ref|XP_004982503.1| PREDICTED: paladin-like [Setaria italica]
Length=1265

 Score =   470 bits (1210),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 223/285 (78%), Positives = 253/285 (89%), Gaps = 0/285 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+S KP     VES +GRP +MD VAA+R+GEVLG QTVLKSD
Sbjct  397   YSILRRLLRRDPMGALGYSSSKPPLTKIVESADGRPQDMDVVAAMRNGEVLGRQTVLKSD  456

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGCH+ +LPER+EGA NFREIPGFPVYGVANPTV GI +VIQRI +SK GRP+ WHNM
Sbjct  457   HCPGCHNLNLPERVEGAPNFREIPGFPVYGVANPTVDGIRAVIQRISTSKGGRPILWHNM  516

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERP KNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  517   REEPVIYINGKPFVLREVERPCKNMLEYTGIDRERVERMEARLKEDILREAERYGGAIMV  576

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET +G+IFD+WE+V +++V TPLEV+K LE EG  IKYAR+PITD KAPKSSDFDT+A
Sbjct  577   IHETDNGEIFDTWENVDNEAVLTPLEVYKHLECEGLQIKYARVPITDGKAPKSSDFDTIA  636

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV  1256
             LN+ASASK TA VFNCQMG GRTTTGTVIACL+KLRID+GRPIR+
Sbjct  637   LNVASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDHGRPIRI  681


 Score =   302 bits (773),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 159/200 (80%), Gaps = 0/200 (0%)
 Frame = +2

Query  1340  KTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRL  1519
             KTR     +  FGI DILLL KITRLFDNG+ECR+ LD +IDRCSALQNIRQAVL+Y ++
Sbjct  715   KTRTLTKLNSGFGIKDILLLRKITRLFDNGIECRQTLDTVIDRCSALQNIRQAVLKYTKV  774

Query  1520  FNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQR  1699
              NQQ  EPR RRVALNRGAEYLERY +LIAF+AYLGS+AFDGFCGQGE   +FK WL QR
Sbjct  775   INQQHVEPRVRRVALNRGAEYLERYLKLIAFSAYLGSEAFDGFCGQGEVKISFKGWLQQR  834

Query  1700  PEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFF  1879
             PE+Q MKWS+RLRPGRFFT+P E +  +    GD  ME +VK RNGSVLGKGSIL MYFF
Sbjct  835   PEIQTMKWSVRLRPGRFFTVPHEQKATYPPPQGDVTMETVVKARNGSVLGKGSILKMYFF  894

Query  1880  PGQRTSSHIQIHGAPHVYKV  1939
             PGQ+ SS +   GAPHV+KV
Sbjct  895   PGQKRSSSVNFRGAPHVFKV  914


 Score =   188 bits (477),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT SIG+V   G +  D MP+SE+AI RGEY VIRSL+RVLEGGVEGK+QVDKVID+
Sbjct  259  GIPRTGSIGKVFYAGNDVDDYMPSSEEAILRGEYAVIRSLVRVLEGGVEGKRQVDKVIDK  318

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C SMQNLREAIATYRNSILRQ DEMKREA+LSFFVEYLERY FLICFAVY+H+   A   
Sbjct  319  CDSMQNLREAIATYRNSILRQSDEMKREASLSFFVEYLERYYFLICFAVYVHSVSSAHQT  378

Query  410  TSQV  421
            T  V
Sbjct  379  TFSV  382


 Score =   267 bits (682),  Expect(2) = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 172/238 (72%), Gaps = 3/238 (1%)
 Frame = +3

Query  519   DQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGI  698
             +QV + R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT+ GI
Sbjct  16    EQVISSRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQAGSLRVHGVAMPTMEGI  75

Query  699   LSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVE  872
              +V+  IG+ K+G+   + WH++REE VIYING+PFVLR+VE+P+ N LEYTGI+ ERVE
Sbjct  76    ANVLNHIGAKKKGKQTRILWHSLREEPVIYINGRPFVLRDVEKPFSN-LEYTGINRERVE  134

Query  873   RMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFP  1052
             +ME RLK+DI++EA RY   I+V  E   GQ+ D WE V SD+V+TPLEV++ L+ +G+ 
Sbjct  135   QMEFRLKEDILQEASRYGNKILVTDELPSGQMVDQWESVVSDTVKTPLEVYEELQHQGYL  194

Query  1053  IKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + Y R+PITD+KAPK  DFD L   I+     T +VFNCQMG GRTTTG VIA LV L
Sbjct  195   VDYERVPITDEKAPKEGDFDNLVRRISQVDLETEIVFNCQMGRGRTTTGMVIATLVYL  252


 Score = 77.8 bits (190),  Expect(2) = 7e-85, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 102/219 (47%), Gaps = 21/219 (10%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             +G++ D ++P     IL+              +  ++  + R+ + GVE +  +D +ID+
Sbjct  272   AGNDVDDYMPSSEEAILR-------------GEYAVIRSLVRVLEGGVEGKRQVDKVIDK  318

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             C ++QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI FA Y+ S      
Sbjct  319   CDSMQNLREAIATYRNSILRQSDEMK-REASLSFFVEYLERYYFLICFAVYVHS-VSSAH  376

Query  1649  CGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEELRTPHELKHGDAVME  1813
                     +F  W+  RPE+ + ++  +R  P    G   + P   +           M+
Sbjct  377   QTTFSVEVSFSDWMRARPELYSILRRLLRRDPMGALGYSSSKPPLTKIVESADGRPQDMD  436

Query  1814  AIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIHGAPH  1927
              +   RNG VLG+ ++L     PG    +   ++ GAP+
Sbjct  437   VVAAMRNGEVLGRQTVLKSDHCPGCHNLNLPERVEGAPN  475


 Score =   133 bits (335),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 130/260 (50%), Gaps = 22/260 (8%)
 Frame = +3

Query  468   PSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFRE  647
             P P  DV         M+ V   R+G VLG  ++LK    PG    S      GA +  +
Sbjct  863   PPPQGDVT--------METVVKARNGSVLGKGSILKMYFFPGQKRSS-SVNFRGAPHVFK  913

Query  648   IPGFPVYGVANPTVSGILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGKPFVLRE  812
             + G+PVY +A PT+ G   V+  +GS         + V   ++REE V+YI G PFVLRE
Sbjct  914   VDGYPVYSMATPTIDGASDVLSYLGSKDTTGRSIAQKVVVTDLREEVVVYIKGTPFVLRE  973

Query  813   VERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDS  977
             +++P  + L++ GI    VE +E RLK+DI+ E ++  G +++  E     T    +   
Sbjct  974   LDQPV-DTLKHVGISGPMVESIETRLKEDILAEVKQLGGRLLLHQEEFNADTNQCNVVGY  1032

Query  978   WEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTAL  1157
             WE +  + V TP EV+  L  +G+ I Y RIP+T ++   ++D D +   I  +++Y   
Sbjct  1033  WERIDLEDVMTPAEVYGTLRGKGYDINYKRIPLTREREALAADVDAIQSLIDESARY--Y  1090

Query  1158  VFNCQMGIGRTTTGTVIACL  1217
             +F    G G       I CL
Sbjct  1091  LFISHTGYGGVAYAMAITCL  1110


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + G+E ++ +D VIDRC+++QN+R+A+  Y   I +Q  E + R  AL+  
Sbjct  733  LLRKITRLFDNGIECRQTLDTVIDRCSALQNIRQAVLKYTKVINQQHVEPRVRRVALNRG  792

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI F+ YL +E
Sbjct  793  AEYLERYLKLIAFSAYLGSE  812


 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 59/117 (50%), Gaps = 12/117 (10%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQ----QRTEPRERRVAL  1564
             +  + R+  +G + +E +DA+IDRCS   N+R+ +LQYR+           +  E     
Sbjct  1155  ILNLIRVLVHGPKSKEEVDAVIDRCSGAGNLREDILQYRKALQDFSHDDDDDDEELSYLT  1214

Query  1565  NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
             + G + L RYF LI F +YL       +C       TF+ W+  RPE+  +  +++L
Sbjct  1215  DMGTKALRRYFFLITFRSYL-------YCATPRE-ATFRSWMKARPELGHLCDNLKL  1263


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 63/114 (55%), Gaps = 7/114 (6%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             VS+       I  +++ A+R+ +Y  I +LIRVL  G + K++VD VIDRC+   NLRE 
Sbjct  1129  VSTSLTKNVSIKTSTDIALRQVDYRDILNLIRVLVHGPKSKEEVDAVIDRCSGAGNLRED  1188

Query  260   IATYRNSILR-QPDEMKREAALSFFVEY----LERY*FLICFAVYLH--TERDA  400
             I  YR ++     D+   +  LS+  +     L RY FLI F  YL+  T R+A
Sbjct  1189  ILQYRKALQDFSHDDDDDDEELSYLTDMGTKALRRYFFLITFRSYLYCATPREA  1242



>ref|XP_009363139.1| PREDICTED: LOW QUALITY PROTEIN: paladin [Pyrus x bretschneideri]
Length=1259

 Score =   467 bits (1202),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 227/298 (76%), Positives = 255/298 (86%), Gaps = 8/298 (3%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYASLKPS     ES +GRP EM  VAALR GEVLGSQTVLKSD
Sbjct  385   YSIVRRLLRRDPMGALGYASLKPSLKKIAESADGRPCEMGVVAALRKGEVLGSQTVLKSD  444

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + +LPER++GA NFRE+ GF VYGVANPT  GI SVIQRIG+SK+G PVFWHNM
Sbjct  445   HCPGCQNQNLPERVDGAPNFREVRGFSVYGVANPTTDGIRSVIQRIGNSKDGHPVFWHNM  504

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYT--------GIDCERVERMEARLKDDIMREAE  917
             REE VIYIN KPFVLREVERPYKNMLEYT        GID ERVERMEARLK+DI+REAE
Sbjct  505   REEPVIYINRKPFVLREVERPYKNMLEYTTTRXYFFLGIDRERVERMEARLKEDILREAE  564

Query  918   RYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPK  1097
              Y GAIMVIHE  DGQI D+WEHV+S+++QTP+EVFK LE +GFPIKYAR+PITD KAPK
Sbjct  565   HYGGAIMVIHEMDDGQIVDAWEHVNSEAIQTPVEVFKGLEEDGFPIKYARVPITDGKAPK  624

Query  1098  SSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDAL  1271
             SSDFDTLA+NIASASK TA VFNCQMG GRTTTGTVIACL+KL+IDYGRPI++L D +
Sbjct  625   SSDFDTLAINIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLQIDYGRPIKILVDNI  682


 Score =   355 bits (912),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG+E+ G        +   R +K+ S  FG+N ILLLWKITRLFDNG+ECREALDAIIDR
Sbjct  693   SGEETGGSSAASTSSVTNFRNEKEQSCVFGMNGILLLWKITRLFDNGLECREALDAIIDR  752

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYRR+FNQQ  EPR RRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  753   CSALQNIRQAVLQYRRVFNQQHVEPRVRRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  812

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             CGQGES  TFK+WLHQRPEVQ MKW+IRLRPGRF T+PEELR P E +HGDAVMEAIVK 
Sbjct  813   CGQGESNMTFKNWLHQRPEVQTMKWNIRLRPGRFLTVPEELRAPLESQHGDAVMEAIVKA  872

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             R+GSVLGK SIL MYFFPGQRTSSHIQIHGAPHV+KV
Sbjct  873   RSGSVLGKVSILKMYFFPGQRTSSHIQIHGAPHVFKV  909


 Score =   137 bits (345),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  185  GGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLI  364
            GGVEGK+QVDKVID+CASMQNLREAI TYRNSI+RQPDEMKREA+LSFFVEYLERY FLI
Sbjct  292  GGVEGKRQVDKVIDKCASMQNLREAIPTYRNSIMRQPDEMKREASLSFFVEYLERYYFLI  351

Query  365  CFAVYLHTERDALHPTS  415
            CF VY+H+E  ALH +S
Sbjct  352  CFTVYIHSEGAALHSSS  368


 Score =   230 bits (587),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/243 (50%), Positives = 163/243 (67%), Gaps = 4/243 (2%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E + V  LR G VL  +T+LKSDH PGC    L   ++GA N+R+     V+GVA PT
Sbjct  4     PKEPEXVMKLRGGSVLCKKTILKSDHFPGCQSKRLSPHIDGAPNYRQADSQHVHGVAIPT  63

Query  687   VSGILSVIQRIGSSK-EGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGID  857
             +SGI +V+  IG+   +G+   V W N+ EE V+YING PFVLR++ERP+ N LEYTGI+
Sbjct  64    ISGIQNVLNNIGAQHIDGKRAQVLWINLCEEPVVYINGCPFVLRDLERPFSN-LEYTGIN  122

Query  858   CERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLE  1037
               RVE+MEAR+K+DI+ E+ RY   I++  E  DGQ+ D WE VS  SV+TPLEV++ L+
Sbjct  123   RARVEQMEARIKEDILIESARYGNKILLTDELPDGQMVDQWEPVSRHSVKTPLEVYEELQ  182

Query  1038  AEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACL  1217
              +G+ + Y R+PITD+K+PK  +FD L   I+ A     + FN QMG G TTTG VIA L
Sbjct  183   EQGYLVAYERVPITDEKSPKELNFDILVHKISQADINAEINFNRQMGRGXTTTGMVIANL  242

Query  1218  VKL  1226
             + L
Sbjct  243   IYL  245


 Score =   123 bits (308),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 84/263 (32%), Positives = 136/263 (52%), Gaps = 22/263 (8%)
 Frame = +3

Query  486   VESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPV  665
             +ES +G  + M+ +   RSG VLG  ++LK    PG    S   ++ GA +  ++ G+PV
Sbjct  857   LESQHG-DAVMEAIVKARSGSVLGKVSILKMYFFPG-QRTSSHIQIHGAPHVFKVDGYPV  914

Query  666   YGVANPTVSGILSVIQRIGSSKEG-----RPVFWHNMREEHVIYINGKPFVLREVERPYK  830
             Y +A PT+ G   ++  +G+  +      + V   ++REE V+YING PFVLRE+ +P  
Sbjct  915   YSMATPTIHGAKEMLAYLGAKPKAEGSAAQKVILTDLREEVVVYINGTPFVLRELNKPV-  973

Query  831   NMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSW------EHVS  992
             + L++ GI    VE MEA LK+DI+ E  R  G  M++H        + +      E + 
Sbjct  974   DTLKHVGITGPVVEHMEAPLKEDILSEV-RQSGGRMLLHREEYSPALNQFSVIGYLESIF  1032

Query  993   SDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQ  1172
             +D V+TP +V+  L+ EG+   Y RIP+T ++   SSD D +   I  ++        C 
Sbjct  1033  ADDVKTPAKVYTALKDEGYNFAYRRIPLTRERXALSSDVDAIQYCIDDSA-------GCY  1085

Query  1173  MGIGRTTTGTVIACLVKLRIDYG  1241
             + +  T  G V   +  + I  G
Sbjct  1086  LFVSHTRFGGVAYAMAIICIRTG  1108


 Score = 53.9 bits (128),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 34/131 (26%), Positives = 64/131 (49%), Gaps = 10/131 (8%)
 Frame = +2

Query  1349  PKKDSSHE-FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFN  1525
             P + S  E  G+ D   +  +TR+   G + +  +D +I+RC+   ++R  +L Y +   
Sbjct  1135  PSRASDEEALGMGDYRDILSLTRVLVYGPKSKADVDIVIERCAGAGHLRDDILYYSKELK  1194

Query  1526  Q-QRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRP  1702
             +    E  +R   ++ G + L RYF LI F +YL       +C     +  F  W++ RP
Sbjct  1195  KFPDAEDEQRAYLMDMGIKALRRYFFLITFRSYL-------YCTSVADI-KFTSWMYARP  1246

Query  1703  EVQAMKWSIRL  1735
             E+  +  ++R+
Sbjct  1247  ELGHLCNNLRV  1257


 Score = 82.4 bits (202),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGHLR+DI+Y++KELKKFPD +DE RAYLMDMGI+ALR
Sbjct  1169  VDIVIERCAGAGHLRDDILYYSKELKKFPDAEDEQRAYLMDMGIKALR  1216


 Score = 72.8 bits (177),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 87/177 (49%), Gaps = 8/177 (5%)
 Frame = +2

Query  1427  GVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLI  1606
             GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI
Sbjct  293   GVEGKRQVDKVIDKCASMQNLREAIPTYRNSIMRQPDEMK-REASLSFFVEYLERYYFLI  351

Query  1607  AFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGR----FFTIPEELR  1774
              F  Y+ S+            ++F  W+  RPE+ ++   +  R       + ++   L+
Sbjct  352   CFTVYIHSEG-AALHSSSIDYSSFADWMKARPELYSIVRRLLRRDPMGALGYASLKPSLK  410

Query  1775  TPHELKHGDAV-MEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIHGAPHVYKV  1939
                E   G    M  +   R G VLG  ++L     PG Q  +   ++ GAP+  +V
Sbjct  411   KIAESADGRPCEMGVVAALRKGEVLGSQTVLKSDHCPGCQNQNLPERVDGAPNFREV  467


 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + G+E ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  732  ITRLFDNGLECREALDAIIDRCSALQNIRQAVLQYRRVFNQQHVEPRVRRVALNRGAEYL  791

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  792  ERYFRLIAFAAYLGSE  807


 Score = 57.0 bits (136),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD  298
             + E+A+  G+Y  I SL RVL  G + K  VD VI+RCA   +LR+ I  Y   + + PD
Sbjct  1139  SDEEALGMGDYRDILSLTRVLVYGPKSKADVDIVIERCAGAGHLRDDILYYSKELKKFPD  1198

Query  299   --EMKREAALSFFVEYLERY*FLICFAVYLH  385
               + +R   +   ++ L RY FLI F  YL+
Sbjct  1199  AEDEQRAYLMDMGIKALRRYFFLITFRSYLY  1229



>ref|NP_001050571.1| Os03g0586700 [Oryza sativa Japonica Group]
 gb|AAT76336.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF97354.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12485.1| Os03g0586700 [Oryza sativa Japonica Group]
Length=1256

 Score =   469 bits (1206),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 221/285 (78%), Positives = 254/285 (89%), Gaps = 0/285 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+S KPS A  VE  +GRP EMD VAA+R+GEVLG QTVLKSD
Sbjct  392   YSILRRLLRRDPMGALGYSSSKPSLAKIVEYADGRPHEMDIVAAMRNGEVLGRQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGCH+  LPER+EGA NFREIP FPVYGVANPTV GI +VIQRI +SK GRP+ WHNM
Sbjct  452   HCPGCHNLHLPERVEGAPNFREIPEFPVYGVANPTVDGIRAVIQRISTSKGGRPILWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVERMEARLK+DI+REAERY GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVERMEARLKEDILREAERYSGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET +G+IFD+WE+V++++V TPLEV+K LE+EG PIKYAR+PITD KAPKSSDFDT+ 
Sbjct  572   IHETDNGEIFDAWENVNNEAVLTPLEVYKLLESEGLPIKYARVPITDGKAPKSSDFDTIT  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV  1256
             LN+A+A K TA VFNCQMG GRTTTGTVIACL++LRID+GRPIR+
Sbjct  632   LNVAAAHKDTAFVFNCQMGRGRTTTGTVIACLLRLRIDHGRPIRL  676


 Score =   292 bits (748),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 172/222 (77%), Gaps = 10/222 (5%)
 Frame = +2

Query  1289  SGDES---DGHVPPYAPLILKTRPKKDSSH--EFGINDILLLWKITRLFDNGVECREALD  1453
             SG+E+   +GH+   +P     RP   +     FGI+DIL+L KITRLFDNG+ECR+ LD
Sbjct  693   SGEETTDHNGHLNSSSP-----RPHTVTEQHPRFGIDDILVLRKITRLFDNGIECRQTLD  747

Query  1454  AIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSD  1633
              +ID+CSALQNIRQAVLQY ++ NQQ  E R +RVALNRGAEYLERY +L+AF+AYL S+
Sbjct  748   NVIDKCSALQNIRQAVLQYTKVINQQHVEQRVKRVALNRGAEYLERYLKLVAFSAYLWSE  807

Query  1634  AFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVME  1813
             AFDGFCGQGE+  +FK W+HQRPE+Q+MKWSIRLRPGRFFT+ +E +   +   GD +ME
Sbjct  808   AFDGFCGQGEAKMSFKAWIHQRPEIQSMKWSIRLRPGRFFTVNDESKASFQPSQGDVMME  867

Query  1814  AIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             AIVK RNGSVLGKGSIL MYFFPGQ+ SS I   GAP V+KV
Sbjct  868   AIVKARNGSVLGKGSILKMYFFPGQKRSSTINFCGAPQVFKV  909


 Score =   189 bits (481),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT+SIG+V   G +  D MP+SE+AI RGEY+VIRSL+RVLEGGVEGK+QVDKVID+
Sbjct  254  GIPRTSSIGKVFHSGNDVDDYMPSSEEAILRGEYSVIRSLVRVLEGGVEGKRQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHT  388
            C +MQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+
Sbjct  314  CDTMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYVHS  366


 Score =   268 bits (685),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 174/238 (73%), Gaps = 3/238 (1%)
 Frame = +3

Query  519   DQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGI  698
             +QV + R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT+ GI
Sbjct  11    EQVISTRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQAGSLRVHGVAMPTMKGI  70

Query  699   LSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVE  872
             ++V+  IG+ K+G+   V WH++REE VIYING+PFVLR+VERP+ N LEYTGI+ ERVE
Sbjct  71    VNVLNHIGAQKKGKQTQVLWHSLREEPVIYINGRPFVLRDVERPFSN-LEYTGINRERVE  129

Query  873   RMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFP  1052
             +ME RLK+DI++EA RY   I+V  E  +GQ+ D WE V +D+V+TPLEV++ L+ +G+ 
Sbjct  130   QMEFRLKEDILQEASRYGNKILVTDELPNGQMVDQWESVVTDTVKTPLEVYEELQHQGYL  189

Query  1053  IKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + Y R+PITD+KAPK  DFD L   I+     T ++FNCQMG GRTTTG VIA L+ L
Sbjct  190   VDYERVPITDEKAPKEGDFDNLVRRISQVDIETEIIFNCQMGRGRTTTGMVIATLIYL  247


 Score = 79.3 bits (194),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 111/235 (47%), Gaps = 45/235 (19%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG++ D ++P     IL+              +  ++  + R+ + GVE +  +D +ID+
Sbjct  267   SGNDVDDYMPSSEEAILR-------------GEYSVIRSLVRVLEGGVEGKRQVDKVIDK  313

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             C  +QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI FA Y+ S      
Sbjct  314   CDTMQNLREAIATYRNSILRQPDEMK-REASLSFFVEYLERYYFLICFAVYVHS-----V  367

Query  1649  CGQGESM----TTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEELRT-------P  1780
             C   +S      +F  W+  RPE+ + ++  +R  P    G   + P   +        P
Sbjct  368   CSAQQSNFSEEVSFSDWMRARPELYSILRRLLRRDPMGALGYSSSKPSLAKIVEYADGRP  427

Query  1781  HELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHI--QIHGAPHVYKV  1939
             HE       M+ +   RNG VLG+ ++L     PG   + H+  ++ GAP+  ++
Sbjct  428   HE-------MDIVAAMRNGEVLGRQTVLKSDHCPGCH-NLHLPERVEGAPNFREI  474


 Score =   145 bits (366),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 88/259 (34%), Positives = 136/259 (53%), Gaps = 17/259 (7%)
 Frame = +3

Query  480   NDVESTNGRPSE----MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFRE  647
             ND    + +PS+    M+ +   R+G VLG  ++LK    PG    S      GA    +
Sbjct  850   NDESKASFQPSQGDVMMEAIVKARNGSVLGKGSILKMYFFPGQKRSSTIN-FCGAPQVFK  908

Query  648   IPGFPVYGVANPTVSGILSVIQRIGSSKEGRP----VFWHNMREEHVIYINGKPFVLREV  815
             + G+PVY +A PTV G   V+  +GS   GR     V   ++REE V+YI G PFVLRE+
Sbjct  909   VDGYPVYSMATPTVDGAKEVLSYLGSKDTGRSIPQKVVVTDLREEVVVYIKGTPFVLREL  968

Query  816   ERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSW  980
             ++P  + L++ GI    VE +EARLK+DI+ E ++  G +++  E     T    +   W
Sbjct  969   DQPV-DTLKHVGISGPMVENIEARLKEDILSEVKQQGGRLLLHQEEFNSSTGQSSVVGFW  1027

Query  981   EHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALV  1160
             EH+ ++ V TP EV+  L  +G+ I Y RIP+T ++   +SD D +  ++   ++Y   +
Sbjct  1028  EHIGTEDVMTPAEVYSVLRNQGYCIDYKRIPLTREREALASDVDAIQSSVDENARY--YL  1085

Query  1161  FNCQMGIGRTTTGTVIACL  1217
             F    G G       I CL
Sbjct  1086  FISHTGYGGVAYAMAITCL  1104


 Score = 65.1 bits (157),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            V+R + R+ + G+E ++ +D VID+C+++QN+R+A+  Y   I +Q  E + +  AL+  
Sbjct  728  VLRKITRLFDNGIECRQTLDNVIDKCSALQNIRQAVLQYTKVINQQHVEQRVKRVALNRG  787

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  L+ F+ YL +E
Sbjct  788  AEYLERYLKLVAFSAYLWSE  807


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RC GAGHLREDI+++ K L+    DDDE  +YLMDMG +ALR
Sbjct  1166  VDTVIDRCVGAGHLREDIMHYRKALQDCSLDDDETWSYLMDMGTKALR  1213


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 58/114 (51%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER-RVALNRG  1573
             +  +TR+  +G +C+E +D +IDRC    ++R+ ++ YR+       +  E     ++ G
Sbjct  1149  ILNLTRVLVHGPKCKEEVDTVIDRCVGAGHLREDIMHYRKALQDCSLDDDETWSYLMDMG  1208

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL       +C       TF  W+  RPE+  +  +++L
Sbjct  1209  TKALRRYFFLITFRSYL-------YCSSLRE-PTFASWMEARPELGHLCDNLKL  1254


 Score = 58.2 bits (139),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 59/106 (56%), Gaps = 6/106 (6%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             +S+    +  I  +++ A+++G+Y  I +L RVL  G + K++VD VIDRC    +LRE 
Sbjct  1123  ISTSLTKSVSIKTSADIALKQGDYRDILNLTRVLVHGPKCKEEVDTVIDRCVGAGHLRED  1182

Query  260   IATYRNSILRQPDEMKREAALSFFVEY----LERY*FLICFAVYLH  385
             I  YR ++  Q   +  +   S+ ++     L RY FLI F  YL+
Sbjct  1183  IMHYRKAL--QDCSLDDDETWSYLMDMGTKALRRYFFLITFRSYLY  1226



>gb|EEE59421.1| hypothetical protein OsJ_11578 [Oryza sativa Japonica Group]
Length=1252

 Score =   469 bits (1206),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 221/285 (78%), Positives = 254/285 (89%), Gaps = 0/285 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+S KPS A  VE  +GRP EMD VAA+R+GEVLG QTVLKSD
Sbjct  388   YSILRRLLRRDPMGALGYSSSKPSLAKIVEYADGRPHEMDIVAAMRNGEVLGRQTVLKSD  447

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGCH+  LPER+EGA NFREIP FPVYGVANPTV GI +VIQRI +SK GRP+ WHNM
Sbjct  448   HCPGCHNLHLPERVEGAPNFREIPEFPVYGVANPTVDGIRAVIQRISTSKGGRPILWHNM  507

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVERMEARLK+DI+REAERY GAIMV
Sbjct  508   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVERMEARLKEDILREAERYSGAIMV  567

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET +G+IFD+WE+V++++V TPLEV+K LE+EG PIKYAR+PITD KAPKSSDFDT+ 
Sbjct  568   IHETDNGEIFDAWENVNNEAVLTPLEVYKLLESEGLPIKYARVPITDGKAPKSSDFDTIT  627

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV  1256
             LN+A+A K TA VFNCQMG GRTTTGTVIACL++LRID+GRPIR+
Sbjct  628   LNVAAAHKDTAFVFNCQMGRGRTTTGTVIACLLRLRIDHGRPIRL  672


 Score =   292 bits (748),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 172/222 (77%), Gaps = 10/222 (5%)
 Frame = +2

Query  1289  SGDES---DGHVPPYAPLILKTRPKKDSSH--EFGINDILLLWKITRLFDNGVECREALD  1453
             SG+E+   +GH+   +P     RP   +     FGI+DIL+L KITRLFDNG+ECR+ LD
Sbjct  689   SGEETTDHNGHLNSSSP-----RPHTVTEQHPRFGIDDILVLRKITRLFDNGIECRQTLD  743

Query  1454  AIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSD  1633
              +ID+CSALQNIRQAVLQY ++ NQQ  E R +RVALNRGAEYLERY +L+AF+AYL S+
Sbjct  744   NVIDKCSALQNIRQAVLQYTKVINQQHVEQRVKRVALNRGAEYLERYLKLVAFSAYLWSE  803

Query  1634  AFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVME  1813
             AFDGFCGQGE+  +FK W+HQRPE+Q+MKWSIRLRPGRFFT+ +E +   +   GD +ME
Sbjct  804   AFDGFCGQGEAKMSFKAWIHQRPEIQSMKWSIRLRPGRFFTVNDESKASFQPSQGDVMME  863

Query  1814  AIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             AIVK RNGSVLGKGSIL MYFFPGQ+ SS I   GAP V+KV
Sbjct  864   AIVKARNGSVLGKGSILKMYFFPGQKRSSTINFCGAPQVFKV  905


 Score =   189 bits (480),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT+SIG+V   G +  D MP+SE+AI RGEY+VIRSL+RVLEGGVEGK+QVDKVID+
Sbjct  250  GIPRTSSIGKVFHSGNDVDDYMPSSEEAILRGEYSVIRSLVRVLEGGVEGKRQVDKVIDK  309

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHT  388
            C +MQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+
Sbjct  310  CDTMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYVHS  362


 Score =   261 bits (666),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 173/238 (73%), Gaps = 7/238 (3%)
 Frame = +3

Query  519   DQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGI  698
             +QV + R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT+ GI
Sbjct  11    EQVISTRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQAGSLRVHGVAMPTMKGI  70

Query  699   LSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVE  872
             ++V+  IG+ K+G+   V WH++REE VIYING+PFVLR+VERP+ N LEYTGI+ ERVE
Sbjct  71    VNVLNHIGAQKKGKQTQVLWHSLREEPVIYINGRPFVLRDVERPFSN-LEYTGINRERVE  129

Query  873   RMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFP  1052
             +ME RLK+DI++EA R    I+V  E  +GQ+ D WE V +D+V+TPLEV++ L+ +G+ 
Sbjct  130   QMEFRLKEDILQEASR----ILVTDELPNGQMVDQWESVVTDTVKTPLEVYEELQHQGYL  185

Query  1053  IKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + Y R+PITD+KAPK  DFD L   I+     T ++FNCQMG GRTTTG VIA L+ L
Sbjct  186   VDYERVPITDEKAPKEGDFDNLVRRISQVDIETEIIFNCQMGRGRTTTGMVIATLIYL  243


 Score = 79.3 bits (194),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 111/235 (47%), Gaps = 45/235 (19%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG++ D ++P     IL+              +  ++  + R+ + GVE +  +D +ID+
Sbjct  263   SGNDVDDYMPSSEEAILR-------------GEYSVIRSLVRVLEGGVEGKRQVDKVIDK  309

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             C  +QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI FA Y+ S      
Sbjct  310   CDTMQNLREAIATYRNSILRQPDEMK-REASLSFFVEYLERYYFLICFAVYVHS-----V  363

Query  1649  CGQGESM----TTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEELRT-------P  1780
             C   +S      +F  W+  RPE+ + ++  +R  P    G   + P   +        P
Sbjct  364   CSAQQSNFSEEVSFSDWMRARPELYSILRRLLRRDPMGALGYSSSKPSLAKIVEYADGRP  423

Query  1781  HELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHI--QIHGAPHVYKV  1939
             HE       M+ +   RNG VLG+ ++L     PG   + H+  ++ GAP+  ++
Sbjct  424   HE-------MDIVAAMRNGEVLGRQTVLKSDHCPGCH-NLHLPERVEGAPNFREI  470


 Score =   145 bits (367),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 88/259 (34%), Positives = 136/259 (53%), Gaps = 17/259 (7%)
 Frame = +3

Query  480   NDVESTNGRPSE----MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFRE  647
             ND    + +PS+    M+ +   R+G VLG  ++LK    PG    S      GA    +
Sbjct  846   NDESKASFQPSQGDVMMEAIVKARNGSVLGKGSILKMYFFPGQKRSSTIN-FCGAPQVFK  904

Query  648   IPGFPVYGVANPTVSGILSVIQRIGSSKEGRP----VFWHNMREEHVIYINGKPFVLREV  815
             + G+PVY +A PTV G   V+  +GS   GR     V   ++REE V+YI G PFVLRE+
Sbjct  905   VDGYPVYSMATPTVDGAKEVLSYLGSKDTGRSIPQKVVVTDLREEVVVYIKGTPFVLREL  964

Query  816   ERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSW  980
             ++P  + L++ GI    VE +EARLK+DI+ E ++  G +++  E     T    +   W
Sbjct  965   DQPV-DTLKHVGISGPMVENIEARLKEDILSEVKQQGGRLLLHQEEFNSSTGQSSVVGFW  1023

Query  981   EHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALV  1160
             EH+ ++ V TP EV+  L  +G+ I Y RIP+T ++   +SD D +  ++   ++Y   +
Sbjct  1024  EHIGTEDVMTPAEVYSVLRNQGYCIDYKRIPLTREREALASDVDAIQSSVDENARY--YL  1081

Query  1161  FNCQMGIGRTTTGTVIACL  1217
             F    G G       I CL
Sbjct  1082  FISHTGYGGVAYAMAITCL  1100


 Score = 65.1 bits (157),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            V+R + R+ + G+E ++ +D VID+C+++QN+R+A+  Y   I +Q  E + +  AL+  
Sbjct  724  VLRKITRLFDNGIECRQTLDNVIDKCSALQNIRQAVLQYTKVINQQHVEQRVKRVALNRG  783

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  L+ F+ YL +E
Sbjct  784  AEYLERYLKLVAFSAYLWSE  803


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RC GAGHLREDI+++ K L+    DDDE  +YLMDMG +ALR
Sbjct  1162  VDTVIDRCVGAGHLREDIMHYRKALQDCSLDDDETWSYLMDMGTKALR  1209


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 58/114 (51%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER-RVALNRG  1573
             +  +TR+  +G +C+E +D +IDRC    ++R+ ++ YR+       +  E     ++ G
Sbjct  1145  ILNLTRVLVHGPKCKEEVDTVIDRCVGAGHLREDIMHYRKALQDCSLDDDETWSYLMDMG  1204

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL       +C       TF  W+  RPE+  +  +++L
Sbjct  1205  TKALRRYFFLITFRSYL-------YCSSLRE-PTFASWMEARPELGHLCDNLKL  1250


 Score = 58.2 bits (139),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 59/106 (56%), Gaps = 6/106 (6%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             +S+    +  I  +++ A+++G+Y  I +L RVL  G + K++VD VIDRC    +LRE 
Sbjct  1119  ISTSLTKSVSIKTSADIALKQGDYRDILNLTRVLVHGPKCKEEVDTVIDRCVGAGHLRED  1178

Query  260   IATYRNSILRQPDEMKREAALSFFVEY----LERY*FLICFAVYLH  385
             I  YR ++  Q   +  +   S+ ++     L RY FLI F  YL+
Sbjct  1179  IMHYRKAL--QDCSLDDDETWSYLMDMGTKALRRYFFLITFRSYLY  1222



>gb|EEC75650.1| hypothetical protein OsI_12405 [Oryza sativa Indica Group]
Length=1256

 Score =   469 bits (1206),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 221/285 (78%), Positives = 254/285 (89%), Gaps = 0/285 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+S KPS A  VE  +GRP EMD VAA+R+GEVLG QTVLKSD
Sbjct  392   YSILRRLLRRDPMGALGYSSSKPSLAKIVEYADGRPHEMDIVAAMRNGEVLGRQTVLKSD  451

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGCH+  LPER+EGA NFREIP FPVYGVANPTV GI +VIQRI +SK GRP+ WHNM
Sbjct  452   HCPGCHNLHLPERVEGAPNFREIPEFPVYGVANPTVDGIRAVIQRISTSKGGRPILWHNM  511

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVERMEARLK+DI+REAERY GAIMV
Sbjct  512   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVERMEARLKEDILREAERYSGAIMV  571

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET +G+IFD+WE+V++++V TPLEV+K LE+EG PIKYAR+PITD KAPKSSDFDT+ 
Sbjct  572   IHETDNGEIFDAWENVNNEAVLTPLEVYKLLESEGLPIKYARVPITDGKAPKSSDFDTIT  631

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV  1256
             LN+A+A K TA VFNCQMG GRTTTGTVIACL++LRID+GRPIR+
Sbjct  632   LNVAAAHKDTAFVFNCQMGRGRTTTGTVIACLLRLRIDHGRPIRL  676


 Score =   292 bits (748),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 172/222 (77%), Gaps = 10/222 (5%)
 Frame = +2

Query  1289  SGDES---DGHVPPYAPLILKTRPKKDSSHE--FGINDILLLWKITRLFDNGVECREALD  1453
             SG+E+   +GH+   +P     RP   +     FGI+DIL+L KITRLFDNG+ECR+ LD
Sbjct  693   SGEETTDHNGHLNSSSP-----RPHTVTEQHPRFGIDDILVLRKITRLFDNGIECRQTLD  747

Query  1454  AIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSD  1633
              +ID+CSALQNIRQAVLQY ++ NQQ  E R +RVALNRGAEYLERY +L+AF+AYL S+
Sbjct  748   NVIDKCSALQNIRQAVLQYTKVINQQHVEQRVKRVALNRGAEYLERYLKLVAFSAYLWSE  807

Query  1634  AFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVME  1813
             AFDGFCGQGE+  +FK W+HQRPE+Q+MKWSIRLRPGRFFT+ +E +   +   GD +ME
Sbjct  808   AFDGFCGQGEAKMSFKAWIHQRPEIQSMKWSIRLRPGRFFTVNDESKASFQPSQGDVMME  867

Query  1814  AIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             AIVK RNGSVLGKGSIL MYFFPGQ+ SS I   GAP V+KV
Sbjct  868   AIVKARNGSVLGKGSILKMYFFPGQKRSSTINFCGAPQVFKV  909


 Score =   189 bits (480),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT+SIG+V   G +  D MP+SE+AI RGEY+VIRSL+RVLEGGVEGK+QVDKVID+
Sbjct  254  GIPRTSSIGKVFHSGNDVDDYMPSSEEAILRGEYSVIRSLVRVLEGGVEGKRQVDKVIDK  313

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHT  388
            C +MQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+
Sbjct  314  CDTMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYVHS  366


 Score =   268 bits (685),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 174/238 (73%), Gaps = 3/238 (1%)
 Frame = +3

Query  519   DQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGI  698
             +QV + R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT+ GI
Sbjct  11    EQVISTRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQAGSLRVHGVAMPTMKGI  70

Query  699   LSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVE  872
             ++V+  IG+ K+G+   V WH++REE VIYING+PFVLR+VERP+ N LEYTGI+ ERVE
Sbjct  71    VNVLNHIGAKKKGKQTQVLWHSLREEPVIYINGRPFVLRDVERPFSN-LEYTGINRERVE  129

Query  873   RMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFP  1052
             +ME RLK+DI++EA RY   I+V  E  +GQ+ D WE V +D+V+TPLEV++ L+ +G+ 
Sbjct  130   QMEFRLKEDILQEASRYGNKILVTDELPNGQMVDQWESVVTDTVKTPLEVYEELQHQGYL  189

Query  1053  IKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + Y R+PITD+KAPK  DFD L   I+     T ++FNCQMG GRTTTG VIA L+ L
Sbjct  190   VDYERVPITDEKAPKEGDFDNLVRRISQVDIETEIIFNCQMGRGRTTTGMVIATLIYL  247


 Score = 79.3 bits (194),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 111/235 (47%), Gaps = 45/235 (19%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG++ D ++P     IL+              +  ++  + R+ + GVE +  +D +ID+
Sbjct  267   SGNDVDDYMPSSEEAILR-------------GEYSVIRSLVRVLEGGVEGKRQVDKVIDK  313

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             C  +QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI FA Y+ S      
Sbjct  314   CDTMQNLREAIATYRNSILRQPDEMK-REASLSFFVEYLERYYFLICFAVYVHS-----V  367

Query  1649  CGQGESM----TTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEELRT-------P  1780
             C   +S      +F  W+  RPE+ + ++  +R  P    G   + P   +        P
Sbjct  368   CSAQQSNFSEEVSFSDWMRARPELYSILRRLLRRDPMGALGYSSSKPSLAKIVEYADGRP  427

Query  1781  HELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHI--QIHGAPHVYKV  1939
             HE       M+ +   RNG VLG+ ++L     PG   + H+  ++ GAP+  ++
Sbjct  428   HE-------MDIVAAMRNGEVLGRQTVLKSDHCPGCH-NLHLPERVEGAPNFREI  474


 Score =   145 bits (366),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 88/259 (34%), Positives = 136/259 (53%), Gaps = 17/259 (7%)
 Frame = +3

Query  480   NDVESTNGRPSE----MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFRE  647
             ND    + +PS+    M+ +   R+G VLG  ++LK    PG    S      GA    +
Sbjct  850   NDESKASFQPSQGDVMMEAIVKARNGSVLGKGSILKMYFFPGQKRSSTIN-FCGAPQVFK  908

Query  648   IPGFPVYGVANPTVSGILSVIQRIGSSKEGRP----VFWHNMREEHVIYINGKPFVLREV  815
             + G+PVY +A PTV G   V+  +GS   GR     V   ++REE V+YI G PFVLRE+
Sbjct  909   VDGYPVYSMATPTVDGAKEVLSYLGSKDTGRSIPQKVVVTDLREEVVVYIKGTPFVLREL  968

Query  816   ERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSW  980
             ++P  + L++ GI    VE +EARLK+DI+ E ++  G +++  E     T    +   W
Sbjct  969   DQPV-DTLKHVGISGPMVENIEARLKEDILSEVKQQGGRLLLHQEEFNSSTGQSSVVGFW  1027

Query  981   EHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALV  1160
             EH+ ++ V TP EV+  L  +G+ I Y RIP+T ++   +SD D +  ++   ++Y   +
Sbjct  1028  EHIGTEDVMTPAEVYSVLRNQGYCIDYKRIPLTREREALASDVDAIQSSVDENARY--YL  1085

Query  1161  FNCQMGIGRTTTGTVIACL  1217
             F    G G       I CL
Sbjct  1086  FISHTGYGGVAYAMAITCL  1104


 Score = 65.1 bits (157),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            V+R + R+ + G+E ++ +D VID+C+++QN+R+A+  Y   I +Q  E + +  AL+  
Sbjct  728  VLRKITRLFDNGIECRQTLDNVIDKCSALQNIRQAVLQYTKVINQQHVEQRVKRVALNRG  787

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  L+ F+ YL +E
Sbjct  788  AEYLERYLKLVAFSAYLWSE  807


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RC GAGHLREDI+++ K L+    DDDE  +YLMDMG +ALR
Sbjct  1166  VDTVIDRCVGAGHLREDIMHYRKALQDCSLDDDETWSYLMDMGTKALR  1213


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 58/114 (51%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER-RVALNRG  1573
             +  +TR+  +G +C+E +D +IDRC    ++R+ ++ YR+       +  E     ++ G
Sbjct  1149  ILNLTRVLVHGPKCKEEVDTVIDRCVGAGHLREDIMHYRKALQDCSLDDDETWSYLMDMG  1208

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL       +C       TF  W+  RPE+  +  +++L
Sbjct  1209  TKALRRYFFLITFRSYL-------YCSSLRE-PTFASWMEARPELGHLCDNLKL  1254


 Score = 58.2 bits (139),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 59/106 (56%), Gaps = 6/106 (6%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             +S+    +  I  +++ A+++G+Y  I +L RVL  G + K++VD VIDRC    +LRE 
Sbjct  1123  ISTSLTKSVSIKTSADIALKQGDYRDILNLTRVLVHGPKCKEEVDTVIDRCVGAGHLRED  1182

Query  260   IATYRNSILRQPDEMKREAALSFFVEY----LERY*FLICFAVYLH  385
             I  YR ++  Q   +  +   S+ ++     L RY FLI F  YL+
Sbjct  1183  IMHYRKAL--QDCSLDDDETWSYLMDMGTKALRRYFFLITFRSYLY  1226



>ref|XP_006651575.1| PREDICTED: paladin-like [Oryza brachyantha]
Length=1257

 Score =   467 bits (1202),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 220/285 (77%), Positives = 254/285 (89%), Gaps = 0/285 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+S KP  A  VES +GRP EMD VAA+R+GEVLG QTVLKSD
Sbjct  393   YSILRRLLRRDPMGALGYSSSKPPLAKIVESADGRPHEMDIVAAMRNGEVLGRQTVLKSD  452

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC +  LPER+EGA NFREIP FPVYGVANPTV GI +VIQR+ +SK GRP+ WHNM
Sbjct  453   HCPGCQNLHLPERVEGAPNFREIPEFPVYGVANPTVDGIRAVIQRVSTSKGGRPILWHNM  512

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID +RVERMEARLK+DI+REAERY GAIMV
Sbjct  513   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVERMEARLKEDILREAERYSGAIMV  572

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET +G+IFD+WE+V++++V TPLEV+K LE+EG PIKYAR+PITD KAPKSSDFDT+A
Sbjct  573   IHETDNGEIFDAWENVNNEAVLTPLEVYKLLESEGLPIKYARVPITDGKAPKSSDFDTIA  632

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV  1256
             LN+A+A K TA VFNCQMG GRTTTGTVIACL++LRID+GRPIR+
Sbjct  633   LNVAAACKDTAFVFNCQMGRGRTTTGTVIACLLRLRIDHGRPIRL  677


 Score =   294 bits (753),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 171/220 (78%), Gaps = 6/220 (3%)
 Frame = +2

Query  1289  SGDES---DGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAI  1459
             SG+E+   +GH+    P   +     +    FGI+DIL+L KITRLFDNG ECR+ LD +
Sbjct  694   SGEETTDHNGHLNSSPP---RPHTVTEQHSRFGIDDILVLRKITRLFDNGTECRQILDNV  750

Query  1460  IDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAF  1639
             ID+CSALQNIRQAVLQY ++ NQQ  E R +RVALNRGAEYLERY +L+AF+AYL S+AF
Sbjct  751   IDKCSALQNIRQAVLQYTKVINQQHVEQRVKRVALNRGAEYLERYLKLVAFSAYLWSEAF  810

Query  1640  DGFCGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAI  1819
             +GFCGQGE+  +FK W+HQRPE+Q+MKWSIRLRPGRFFT+ +E +   +   GD +MEAI
Sbjct  811   NGFCGQGEAKMSFKAWIHQRPEIQSMKWSIRLRPGRFFTVHDESKASQQSSQGDVMMEAI  870

Query  1820  VKDRNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             VK RNGSVLGKGSIL MYFFPGQ+ SS I I GAPHV+KV
Sbjct  871   VKARNGSVLGKGSILKMYFFPGQKRSSSINISGAPHVFKV  910


 Score =   186 bits (472),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT+SIG+V   G +  D MP+SE+AI RGEY+VIRSL+RVLEGGVEGK+QVDKVID+
Sbjct  255  GIPRTSSIGKVFHSGNDVDDYMPSSEEAILRGEYSVIRSLVRVLEGGVEGKRQVDKVIDK  314

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHT  388
            C +MQNLREAIATYRNSILRQ DEMKREA+LSFFVEYLERY FLICFAVY+H+
Sbjct  315  CDTMQNLREAIATYRNSILRQADEMKREASLSFFVEYLERYYFLICFAVYVHS  367


 Score =   269 bits (687),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 174/238 (73%), Gaps = 3/238 (1%)
 Frame = +3

Query  519   DQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGI  698
             +QV + R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT+ GI
Sbjct  12    EQVISTRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQAGSLRVHGVAMPTMKGI  71

Query  699   LSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVE  872
             ++V+  IG+ K+G+   V WH++REE VIYING+PFVLR+VERP+ N LEYTGI+ ERVE
Sbjct  72    VNVLNHIGAQKKGKQTQVLWHSLREEPVIYINGRPFVLRDVERPFSN-LEYTGINRERVE  130

Query  873   RMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFP  1052
             +ME RLK+DI++EA RY   I+V  E  +GQ+ D WE V SD+V+TPLEV++ L+ +G+ 
Sbjct  131   QMEFRLKEDILQEASRYGNKILVTDELPNGQMVDQWESVISDTVKTPLEVYEELQCQGYL  190

Query  1053  IKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + Y R+PITD+KAPK  DFD L   I+     T ++FNCQMG GRTTTG VIA L+ L
Sbjct  191   VDYERVPITDEKAPKEGDFDNLVHRISQVGIETEIIFNCQMGRGRTTTGMVIATLIYL  248


 Score = 80.5 bits (197),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 61/227 (27%), Positives = 106/227 (47%), Gaps = 29/227 (13%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SG++ D ++P     IL+              +  ++  + R+ + GVE +  +D +ID+
Sbjct  268   SGNDVDDYMPSSEEAILR-------------GEYSVIRSLVRVLEGGVEGKRQVDKVIDK  314

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             C  +QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI FA Y+ S      
Sbjct  315   CDTMQNLREAIATYRNSILRQADEMK-REASLSFFVEYLERYYFLICFAVYVHS-----V  368

Query  1649  CGQGESM----TTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEELRTPHELKHGD  1801
             C   +S      +F  W+  RPE+ + ++  +R  P    G   + P   +         
Sbjct  369   CSAQQSNFSEEVSFSDWMRARPELYSILRRLLRRDPMGALGYSSSKPPLAKIVESADGRP  428

Query  1802  AVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIHGAPHVYKV  1939
               M+ +   RNG VLG+ ++L     PG Q      ++ GAP+  ++
Sbjct  429   HEMDIVAAMRNGEVLGRQTVLKSDHCPGCQNLHLPERVEGAPNFREI  475


 Score =   138 bits (347),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 82/243 (34%), Positives = 130/243 (53%), Gaps = 13/243 (5%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S    + GA +  ++ G+PVY +A PTV G
Sbjct  867   MEAIVKARNGSVLGKGSILKMYFFPGQKRSS-SINISGAPHVFKVNGYPVYSMATPTVDG  925

Query  696   ILSVIQRIGSSKEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCE  863
                V+  + S   G    + V   ++REE V+YI G PFVLRE+++P  + L++ GI   
Sbjct  926   AKEVLSYLSSKDTGTNTAQKVVVTDVREEVVVYIKGTPFVLRELDQPV-DTLKHVGISGP  984

Query  864   RVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEVFK  1028
              VE +E RLK+DI+ E ++  G +++  E     T    I   WEH+ S+ V TP EV+ 
Sbjct  985   MVESIETRLKEDILYEVKQQGGRLLLHQEEFNSSTCQSSIVGFWEHIGSEDVMTPAEVYS  1044

Query  1029  CLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVI  1208
              L+ +G+ I Y RIP+T ++   ++D D +  ++   ++Y   +F    G G       I
Sbjct  1045  LLKDQGYCIDYKRIPLTREREALAADVDAIKSSVDENARY--YLFISHTGYGGVAYAMAI  1102

Query  1209  ACL  1217
              CL
Sbjct  1103  TCL  1105


 Score = 63.2 bits (152),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            V+R + R+ + G E ++ +D VID+C+++QN+R+A+  Y   I +Q  E + +  AL+  
Sbjct  729  VLRKITRLFDNGTECRQILDNVIDKCSALQNIRQAVLQYTKVINQQHVEQRVKRVALNRG  788

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  L+ F+ YL +E
Sbjct  789  AEYLERYLKLVAFSAYLWSE  808


 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RC GAGHLREDII++ K L+    DDDE  +YLMDMG +ALR
Sbjct  1167  VDTVIDRCVGAGHLREDIIHYRKALQDCSPDDDEAWSYLMDMGTKALR  1214


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 59/107 (55%), Gaps = 8/107 (7%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             VS+       I  ++E A R+G+Y  I +L RVL  G + K++VD VIDRC    +LRE 
Sbjct  1124  VSTSLTKNLSIKTSAEIAFRQGDYRDILNLTRVLVHGPKCKEEVDTVIDRCVGAGHLRED  1183

Query  260   IATYRNSILR-QPDEMKREAALSFFVEY----LERY*FLICFAVYLH  385
             I  YR ++    PD+   + A S+ ++     L RY FLI F  YL+
Sbjct  1184  IIHYRKALQDCSPDD---DEAWSYLMDMGTKALRRYFFLITFRSYLY  1227


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 58/114 (51%), Gaps = 9/114 (8%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER-RVALNRG  1573
             +  +TR+  +G +C+E +D +IDRC    ++R+ ++ YR+       +  E     ++ G
Sbjct  1150  ILNLTRVLVHGPKCKEEVDTVIDRCVGAGHLREDIIHYRKALQDCSPDDDEAWSYLMDMG  1209

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + L RYF LI F +YL       +C       TF  W+  RPE+  +  +++L
Sbjct  1210  TKALRRYFFLITFRSYL-------YCSSLRE-PTFASWMDARPELGHLCDNLKL  1255



>emb|CDP17042.1| unnamed protein product [Coffea canephora]
Length=1262

 Score =   493 bits (1270),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/288 (81%), Positives = 256/288 (89%), Gaps = 0/288 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALG+  LKPS     ES +GRP EM QVAA+R+GEVLGSQT+LKSD
Sbjct  394   YSIIRRLLRRDPMGALGHTILKPSLTKIAESADGRPCEMGQVAAMRNGEVLGSQTILKSD  453

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC   SL ER++GA NFREIPGFPVYGVANPTV GI SVIQRIGS K GRPVFWHNM
Sbjct  454   HYPGCQDSSLSERVDGAPNFREIPGFPVYGVANPTVDGIRSVIQRIGSCKGGRPVFWHNM  513

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDI+REA+ YHGA+MV
Sbjct  514   REEPVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDILREADLYHGAVMV  573

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WE+V   +VQTPLEVF CLEA+GFPIKYAR+PITD KAPKSSDFD L+
Sbjct  574   IHETDDGQIFDAWENVRPGAVQTPLEVFSCLEADGFPIKYARVPITDGKAPKSSDFDLLS  633

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLND  1265
             +NIASASK TA VFNCQMGIGRTTTGTVIACL+KLRIDYGRPIRVL D
Sbjct  634   MNIASASKDTAFVFNCQMGIGRTTTGTVIACLLKLRIDYGRPIRVLTD  681


 Score =   380 bits (976),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 197/217 (91%), Gaps = 2/217 (1%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             SGDES+ H        + T+P++ +S+ FGINDILLLWKITRLFDNGVECR+ALDA+IDR
Sbjct  694   SGDESECHAS--TSTAMTTKPQRYTSYAFGINDILLLWKITRLFDNGVECRDALDAVIDR  751

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             CSALQNIRQAVLQYR+LFNQQ+ EPRERRVALNRGAEYLERYFRLIAFAAYLGS+AFDGF
Sbjct  752   CSALQNIRQAVLQYRKLFNQQQVEPRERRVALNRGAEYLERYFRLIAFAAYLGSEAFDGF  811

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
             C QG+S  TFK+WL QRPEVQAMKWSIRLRPGRFFT+PEELR PHE +HGDAVMEAIVKD
Sbjct  812   CRQGDSNITFKNWLLQRPEVQAMKWSIRLRPGRFFTVPEELRAPHESQHGDAVMEAIVKD  871

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGKGSIL MYFFPGQ+TSSHIQIHGAPHVY+V
Sbjct  872   RNGSVLGKGSILKMYFFPGQKTSSHIQIHGAPHVYQV  908


 Score =   249 bits (636),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 167/242 (69%), Gaps = 3/242 (1%)
 Frame = +3

Query  507   PSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPT  686
             P E +QV   R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT
Sbjct  8     PKEPEQVMKQRDGSVLGKKTILKSDHFPGCQNKRLIPQIDGAPNYRKADLLHVHGVAIPT  67

Query  687   VSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
             + GI +V+  I +   G+   V W N+REE V+YING+PFVLR+VERP+ N LEYTGI+ 
Sbjct  68    IHGIRNVLDHIRAQMPGKQTHVLWINLREEPVVYINGRPFVLRDVERPFSN-LEYTGINR  126

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEA  1040
             +R+E+ME RLK+DI+ EA RY   I+V  E  DGQ+ D WE V+  SV+TPLEV++ L+ 
Sbjct  127   QRLEQMEDRLKEDILLEAARYGNKILVTDELPDGQMVDQWEPVTIASVKTPLEVYEELQK  186

Query  1041  EGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLV  1220
               + + Y R+PITD+K+PK  DFD L   I+ A   T +VFNCQMG GRTTTG VIA L+
Sbjct  187   LKYLVDYERVPITDEKSPKEQDFDILVQKISQADMKTEIVFNCQMGRGRTTTGMVIATLI  246

Query  1221  KL  1226
              L
Sbjct  247   YL  248


 Score =   216 bits (549),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 117/132 (89%), Gaps = 6/132 (5%)
 Frame = +2

Query  53   IPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRC  232
            IPRTNSIG+VS C ++ TD +PNSE+AI RGEY VIRSLIRVLEGGVEGK+QVDKVID+C
Sbjct  257  IPRTNSIGKVSDCSSSITDNLPNSEEAILRGEYAVIRSLIRVLEGGVEGKRQVDKVIDKC  316

Query  233  ASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPT  412
            ASMQNLREAIATYRNSILRQPDEMKREA+LSFFVEYLERY FLICFAVYLHTER+AL+  
Sbjct  317  ASMQNLREAIATYRNSILRQPDEMKREASLSFFVEYLERYYFLICFAVYLHTEREALNA-  375

Query  413  SQVAEKRPDGCT  448
                 K PDGC+
Sbjct  376  -----KLPDGCS  382


 Score =   131 bits (330),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/302 (31%), Positives = 151/302 (50%), Gaps = 25/302 (8%)
 Frame = +3

Query  387   QNEMHFTLLRRLLRRDPMGALGYA-SLKPSPANDVESTNGRPSE-------MDQVAALRS  542
             Q + + T    LL+R  + A+ ++  L+P     V      P E       M+ +   R+
Sbjct  814   QGDSNITFKNWLLQRPEVQAMKWSIRLRPGRFFTVPEELRAPHESQHGDAVMEAIVKDRN  873

Query  543   GEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIG  722
             G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT++G   ++  +G
Sbjct  874   GSVLGKGSILKMYFFPG-QKTSSHIQIHGAPHVYQVDGYPVYSMATPTIAGAKGMLAYLG  932

Query  723   SSKEG-----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEAR  887
             +  +      + V   ++REE V+YING PFVLRE+  P  + L++ GI    VE ME R
Sbjct  933   AKPDPTGSTPQTVNVTDLREEAVVYINGTPFVLRELNNPV-DTLKHVGITGSVVEHMEVR  991

Query  888   LKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGF  1049
             LK+DI+ E  R+ G  M++H       +    +   WE++ +D ++TP EV+  L+ E +
Sbjct  992   LKEDIITEI-RHSGGRMLLHREEYSPVSNQVSVIGYWENIFADDIKTPAEVYAALKNECY  1050

Query  1050  PIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLR  1229
              I Y RIP+T ++   +SD D  A+         + +F    G G       I C +KL 
Sbjct  1051  NIAYRRIPLTREREALASDID--AIQYCKDDSAGSYLFVSHTGFGGVAYAMAILC-IKLE  1107

Query  1230  ID  1235
              D
Sbjct  1108  AD  1109


 Score = 65.1 bits (157),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 62/114 (54%), Gaps = 6/114 (5%)
 Frame = +2

Query  68   SIGRVSSCGANATDIMPN-----SEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRC  232
            S G  S C A+ +  M       +  A    +  ++  + R+ + GVE +  +D VIDRC
Sbjct  693  SSGDESECHASTSTAMTTKPQRYTSYAFGINDILLLWKITRLFDNGVECRDALDAVIDRC  752

Query  233  ASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            +++QN+R+A+  YR    +Q  E + R  AL+   EYLERY  LI FA YL +E
Sbjct  753  SALQNIRQAVLQYRKLFNQQQVEPRERRVALNRGAEYLERYFRLIAFAAYLGSE  806


 Score = 53.9 bits (128),  Expect(3) = 2e-50, Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 65/136 (48%), Gaps = 11/136 (8%)
 Frame = +2

Query  1337  LKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRR  1516
             L ++   + + + G  D   +  +TR+  +G E +  +D +I+RC+   ++R  +  Y +
Sbjct  1136  LASQTSDEEAQQMG--DYRDILSLTRVLKHGPESKANVDTVIERCAGAGHLRDDIFYYAK  1193

Query  1517  LFNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTT-FKHWL  1690
                +   +  E R  L + G + L RYF LI F +YL        C    +  T F  W+
Sbjct  1194  ELEKLPDDDDENRAYLTDMGTKALRRYFFLITFRSYL-------HCTSATATETRFTAWM  1246

Query  1691  HQRPEVQAMKWSIRLR  1738
               RPE+  +  ++R++
Sbjct  1247  DARPELGHLCNNLRIK  1262


 Score = 85.5 bits (210),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  291   VIRSLIRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-REASLSFF  349

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA YL ++  +    +     +F  W+  RPE+ + ++  +R  P   
Sbjct  350   VEYLERYYFLICFAVYLHTER-EALNAKLPDGCSFTDWMKARPELYSIIRRLLRRDPMGA  408

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P   +           M  +   RNG VLG  +IL    +PG Q +S   ++ 
Sbjct  409   LGHTILKPSLTKIAESADGRPCEMGQVAAMRNGEVLGSQTILKSDHYPGCQDSSLSERVD  468

Query  1916  GAPHVYKV  1939
             GAP+  ++
Sbjct  469   GAPNFREI  476


 Score = 77.0 bits (188),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  1908  KFMVRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             K  V  +  RCAGAGHLR+DI Y+ KEL+K PDDDDE+RAYL DMG +ALR
Sbjct  1168  KANVDTVIERCAGAGHLRDDIFYYAKELEKLPDDDDENRAYLTDMGTKALR  1218


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQP-  295
             + E+A + G+Y  I SL RVL+ G E K  VD VI+RCA   +LR+ I  Y   + + P 
Sbjct  1141  SDEEAQQMGDYRDILSLTRVLKHGPESKANVDTVIERCAGAGHLRDDIFYYAKELEKLPD  1200

Query  296   -DEMKREAALSFFVEYLERY*FLICFAVYLH  385
              D+  R        + L RY FLI F  YLH
Sbjct  1201  DDDENRAYLTDMGTKALRRYFFLITFRSYLH  1231



>gb|KHG05599.1| Paladin [Gossypium arboreum]
Length=866

 Score =   491 bits (1264),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 237/288 (82%), Positives = 257/288 (89%), Gaps = 0/288 (0%)
 Frame = +3

Query  417   RLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGC  596
             RLLRRDPMGALGYASL PS    VES +GRP E+  VAALR+GEVLGSQTVLKSDHCPGC
Sbjct  5     RLLRRDPMGALGYASLNPSLTMVVESADGRPHEVGVVAALRNGEVLGSQTVLKSDHCPGC  64

Query  597   HHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNMREEHV  776
              + SLPER+EGA NFRE+PGFPVYGVANPT+ GI SVIQRIGSSK GRPVFWHNMREE V
Sbjct  65    QNASLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIQRIGSSKGGRPVFWHNMREEPV  124

Query  777   IYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHETA  956
             IYINGKPFVLREVERPYKNMLEYTGID ERVE+MEARLK+DI+REA+RY GAIMVIHET 
Sbjct  125   IYINGKPFVLREVERPYKNMLEYTGIDRERVEKMEARLKEDILREAKRYEGAIMVIHETD  184

Query  957   DGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIAS  1136
             DGQIFD+WEHV+SDSV+TPLEVFKCLE +GFPIKYAR+PITD KAPKSSDFDT+A NIAS
Sbjct  185   DGQIFDAWEHVNSDSVRTPLEVFKCLEDDGFPIKYARVPITDGKAPKSSDFDTVAKNIAS  244

Query  1137  ASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDALHEE  1280
              S+ TA VFNCQMG GRTTTGTVIACLVKLRID GRPI+VL D +  E
Sbjct  245   VSERTAFVFNCQMGRGRTTTGTVIACLVKLRIDNGRPIKVLLDEMRHE  292


 Score =   348 bits (894),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +2

Query  1337  LKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRR  1516
             +K R K +    FGI+DILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR+
Sbjct  316   VKVRTKNEHGRAFGIDDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRK  375

Query  1517  LFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQ  1696
             +FNQQ  EPR RRVALNRGAEYLERYF LIAFAAYLGS+AFDGFCGQGE + TF+ WLHQ
Sbjct  376   VFNQQHVEPRVRRVALNRGAEYLERYFCLIAFAAYLGSEAFDGFCGQGECLMTFEDWLHQ  435

Query  1697  RPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYF  1876
             RPE+ AMK SIRLRPGRFFT+PEELR   E +HGDAVMEAIVK RNGSVLGKGSIL MYF
Sbjct  436   RPEILAMKSSIRLRPGRFFTVPEELRASLESQHGDAVMEAIVKARNGSVLGKGSILKMYF  495

Query  1877  FPGQRTSSHIQIHGAPHVYKV  1939
             FPGQRTSSHIQI GAPHV+KV
Sbjct  496   FPGQRTSSHIQIRGAPHVFKV  516


 Score =   137 bits (344),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 142/263 (54%), Gaps = 17/263 (6%)
 Frame = +3

Query  486   VESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPV  665
             +ES +G  + M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PV
Sbjct  464   LESQHG-DAVMEAIVKARNGSVLGKGSILKMYFFPG-QRTSSHIQIRGAPHVFKVDGYPV  521

Query  666   YGVANPTVSGILSVIQRIGSSKE----GRPVFWHNMREEHVIYINGKPFVLREVERPYKN  833
             Y +A PT+ G   ++  +G+       G+ V   ++REE V+YING PFVLRE+ +P + 
Sbjct  522   YSMATPTIIGAKEMLAYLGAKVNAGFSGQKVVVTDLREEAVVYINGTPFVLRELNKPVET  581

Query  834   MLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSS  995
              L++ GI    VE MEARLK+DI+ E  R  G  M++H       +    +   WE++ +
Sbjct  582   -LKHVGITGLVVEHMEARLKEDILSEV-RQSGGQMLLHREEYNPSSNQSSVVGYWENIFA  639

Query  996   DSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQM  1175
             D V+TP EV+  L+ EG+ I Y RIP+T ++   +SD D +      +S     ++    
Sbjct  640   DDVKTPAEVYATLKDEGYNIVYKRIPLTREREALASDVDEIQSCKDDSS--GCYLYVSHT  697

Query  1176  GIGRTTTG-TVIACLVKLRIDYG  1241
             G G    G  +I C +   ++YG
Sbjct  698   GFGGVAYGMAIICCRLDAEVNYG  720


 Score = 55.5 bits (132),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 71/143 (50%), Gaps = 13/143 (9%)
 Frame = +2

Query  1310  HVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNI  1489
             H PP   + L+T  ++++       DIL L   TR+  +G + +  +D II+RC+   ++
Sbjct  734   HSPPEESMSLQT-SEEEARRMGDYRDILSL---TRVLIDGPKSKADVDIIIERCAGAGHL  789

Query  1490  RQAVLQYRRLFNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGES  1666
             R  +L Y +   Q   +  E +  L + G + L RYF LI F +YL       +C    +
Sbjct  790   RDDILHYSKELEQVPHDDDEHQAYLMDMGIKALRRYFFLITFRSYL-------YC-TSPN  841

Query  1667  MTTFKHWLHQRPEVQAMKWSIRL  1735
              T F  W+  RPE+  +  ++R+
Sbjct  842   ETKFTSWMVARPELGHLCNNLRI  864


 Score = 77.4 bits (189),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGHLR+DI++++KEL++ P DDDEH+AYLMDMGI+ALR
Sbjct  776   VDIIIERCAGAGHLRDDILHYSKELEQVPHDDDEHQAYLMDMGIKALR  823


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  339  ITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYL  398

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI FA YL +E
Sbjct  399  ERYFCLIAFAAYLGSE  414


 Score = 55.1 bits (131),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (54%), Gaps = 2/97 (2%)
 Frame = +2

Query  101  ATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNS  280
            +  +  + E+A R G+Y  I SL RVL  G + K  VD +I+RCA   +LR+ I  Y   
Sbjct  740  SMSLQTSEEEARRMGDYRDILSLTRVLIDGPKSKADVDIIIERCAGAGHLRDDILHYSKE  799

Query  281  ILRQP--DEMKREAALSFFVEYLERY*FLICFAVYLH  385
            + + P  D+  +   +   ++ L RY FLI F  YL+
Sbjct  800  LEQVPHDDDEHQAYLMDMGIKALRRYFFLITFRSYLY  836



>ref|XP_002966937.1| hypothetical protein SELMODRAFT_86711 [Selaginella moellendorffii]
 gb|EFJ31536.1| hypothetical protein SELMODRAFT_86711 [Selaginella moellendorffii]
Length=1241

 Score =   426 bits (1094),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/285 (71%), Positives = 235/285 (82%), Gaps = 5/285 (2%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY S  P     V + NGRPS M+ VAA R+G+VLG QTVLK D
Sbjct  395   YSILRRLLRRDPMGALGYRSKPP-----VAAENGRPSRMEAVAACRTGDVLGKQTVLKGD  449

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGCH+P LPE +EGA NFREIPGFPVYGVANPTVSGI +V++R+G  K GRPV WHNM
Sbjct  450   HYPGCHNPHLPESVEGAPNFREIPGFPVYGVANPTVSGIKAVLERVGGGKGGRPVLWHNM  509

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE V+YING+PFVLREVERPYKNMLEYTGID +RVE+MEARLK+D+++EAERY GAIMV
Sbjct  510   REEPVVYINGQPFVLREVERPYKNMLEYTGIDRDRVEQMEARLKEDVLKEAERYDGAIMV  569

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
              HE+ DG IFDSWE V+ + VQTP EV+  L +EG+ I+Y+R+PITD KAPKSSDFDTL 
Sbjct  570   NHESKDGFIFDSWETVTPEGVQTPFEVYSRLVSEGYSIEYSRMPITDGKAPKSSDFDTLT  629

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV  1256
               I SA K T  VFNCQMG GRTTTGTVIACLVKLR DYG+P R+
Sbjct  630   SKIVSAPKKTVFVFNCQMGRGRTTTGTVIACLVKLRCDYGKPFRL  674


 Score =   223 bits (568),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 148/217 (68%), Gaps = 9/217 (4%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             +G+  D H+  + P  L+   +  S+    ++DI ++ ++TRL ++GV CREALD +IDR
Sbjct  694   NGEAGDEHLT-FKPAKLE---RCKSTSVLVMDDISIVRRLTRLLEDGVACREALDDVIDR  749

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             C+ALQN+RQA+LQYR+ FNQQ  E   RR ALNRG EYLERY  +IAFA+YLGS+AF   
Sbjct  750   CAALQNLRQAILQYRKSFNQQNLESPGRRAALNRGVEYLERYCMMIAFASYLGSEAF---  806

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKD  1828
                      FK WL++RPE++ MKWS+RLRP RFF +P E R   E   GD ++EAIVK 
Sbjct  807   --SETQRLPFKVWLNKRPEIKQMKWSMRLRPARFFAVPVEFRALAENCEGDEILEAIVKS  864

Query  1829  RNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             RNGSVLGK +IL MY FPGQ  +S   I G PH+ K+
Sbjct  865   RNGSVLGKRAILKMYHFPGQSAASCFDIPGVPHMRKI  901


 Score =   168 bits (425),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GI R+ S G V      + D  P+SE+  R+GEYTV+RSL RVLEGGVEGK+QVD VIDR
Sbjct  261  GIRRSRSFGEVLGSAEESIDEFPDSEEGFRQGEYTVVRSLCRVLEGGVEGKRQVDTVIDR  320

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDAL  403
            C++MQNLREAI TYRNSILRQ DE KRE++LS+FVEYLERY FLICFAVY+HT++ AL
Sbjct  321  CSAMQNLREAINTYRNSILRQADEKKRESSLSYFVEYLERYYFLICFAVYIHTDQSAL  378


 Score =   265 bits (678),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 169/241 (70%), Gaps = 3/241 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E + V   R G VLG +T+LKSDH PGC +  L   ++GA N+R++   PV+GVA PT+ 
Sbjct  11    EPEHVIMSRGGSVLGRKTILKSDHFPGCQNKRLQPHVQGAPNYRQVSSLPVFGVAIPTID  70

Query  693   GILSVIQRIGSSKEG--RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             GI  V+  IG+++ G  + V WHN+REE VIYING+PFVLRE+ERP+ N LEYTGI+  R
Sbjct  71    GIRKVLDLIGANRNGGHKRVLWHNLREEPVIYINGRPFVLREIERPFTN-LEYTGINRVR  129

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE MEARLK+D++REA R+   I+V  E  DGQ+ D WE ++  SV TPLEV+  L  E 
Sbjct  130   VEEMEARLKEDVLREAGRFGCKILVCDEMPDGQMIDQWEPITDASVLTPLEVYDSLCNES  189

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + + Y R+PITD+K+PK  DFD L   +A A   TALVFNCQMG GRTTTG VIA LV L
Sbjct  190   YFVDYERLPITDEKSPKERDFDLLVQRVAEADINTALVFNCQMGRGRTTTGMVIATLVYL  249

Query  1227  R  1229
             +
Sbjct  250   K  250


 Score =   139 bits (350),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/241 (35%), Positives = 132/241 (55%), Gaps = 12/241 (5%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             ++ +   R+G VLG + +LK  H PG    S  + + G  + R+I GFPVY +A PT  G
Sbjct  858   LEAIVKSRNGSVLGKRAILKMYHFPGQSAASCFD-IPGVPHMRKIDGFPVYSMATPTAQG  916

Query  696   ILSVIQRIGSS-KEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVE  872
               +    + ++  +G+     ++REE V+YI G PFVLRE+++P  + L++ GI    VE
Sbjct  917   AKAAFACLKTAVDQGKHAVVTDLREEAVVYIRGNPFVLRELDQPV-STLKHVGIKGSAVE  975

Query  873   RMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEVFKCLE  1037
             +ME RLK+DI+ E +R  G +++  E     T    +   WE ++SD V+ P EV+  L 
Sbjct  976   QMEYRLKEDILAEMKRSGGRVVLHREECNPLTNKSDVIGYWEVLTSDDVKIPAEVYTGLA  1035

Query  1038  AEGFPIKYARIPITDDKAPKSSDFDTLALNI-ASASKYTALVFNCQMGIGRTTTGTVIAC  1214
             AEG+ I Y RIP+T ++A  + D D +   +  S S+Y   V+    G G       I C
Sbjct  1036  AEGYKIDYKRIPLTRERAALAMDVDAIQDRLNGSGSEY---VYISHTGYGGVAYAMAITC  1092

Query  1215  L  1217
             +
Sbjct  1093  M  1093


 Score = 64.3 bits (155),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 69/139 (50%), Gaps = 14/139 (10%)
 Frame = +2

Query  1322  YAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAV  1501
             Y P+    RP  D  + F   D   +  + R+  +G  C+  +D IIDRCS   N+R  +
Sbjct  1115  YGPI---QRPA-DDINAFKQGDYRDILSLVRVLPSGPFCKAEVDTIIDRCSEAGNLRDDI  1170

Query  1502  LQYRRLFNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTF  1678
             L Y++     + E  E R  + + G + L RY  LIAF ++L S   +         ++F
Sbjct  1171  LYYKQQLECCQQEDEEHRAYIQDMGVKALRRYAFLIAFRSFLTSRTPN---------SSF  1221

Query  1679  KHWLHQRPEVQAMKWSIRL  1735
               W+H RPE+  + ++++L
Sbjct  1222  AAWMHSRPELGHLCYNLKL  1240


 Score = 91.7 bits (226),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 106/201 (53%), Gaps = 19/201 (9%)
 Frame = +2

Query  1358  DSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRT  1537
             DS   F   +  ++  + R+ + GVE +  +D +IDRCSA+QN+R+A+  YR    +Q  
Sbjct  284   DSEEGFRQGEYTVVRSLCRVLEGGVEGKRQVDTVIDRCSAMQNLREAINTYRNSILRQAD  343

Query  1538  EPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTT----FKHWLHQRPE  1705
             E ++R  +L+   EYLERY+ LI FA Y+ +D         +S  T    F+ W+  RPE
Sbjct  344   E-KKRESSLSYFVEYLERYYFLICFAVYIHTD---------QSALTQPGGFQQWMKARPE  393

Query  1706  VQAMKWSIRLRPGRFFTIPEELRTPHELKHG-DAVMEAIVKDRNGSVLGKGSILTMYFFP  1882
             + ++   + LR      +    + P   ++G  + MEA+   R G VLGK ++L    +P
Sbjct  394   LYSILRRL-LRRDPMGALGYRSKPPVAAENGRPSRMEAVAACRTGDVLGKQTVLKGDHYP  452

Query  1883  GQRTSSHI--QIHGAPHVYKV  1939
             G   + H+   + GAP+  ++
Sbjct  453   GCH-NPHLPESVEGAPNFREI  472


 Score = 77.8 bits (190),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +2

Query  146  EYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAAL  322
            + +++R L R+LE GV  ++ +D VIDRCA++QNLR+AI  YR S  +Q  E   R AAL
Sbjct  722  DISIVRRLTRLLEDGVACREALDDVIDRCAALQNLRQAILQYRKSFNQQNLESPGRRAAL  781

Query  323  SFFVEYLERY*FLICFAVYLHTE  391
            +  VEYLERY  +I FA YL +E
Sbjct  782  NRGVEYLERYCMMIAFASYLGSE  804


 Score = 60.1 bits (144),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 54/105 (51%), Gaps = 2/105 (2%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             V SC         +  +A ++G+Y  I SL+RVL  G   K +VD +IDRC+   NLR+ 
Sbjct  1110  VPSCVYGPIQRPADDINAFKQGDYRDILSLVRVLPSGPFCKAEVDTIIDRCSEAGNLRDD  1169

Query  260   IATYRNSI--LRQPDEMKREAALSFFVEYLERY*FLICFAVYLHT  388
             I  Y+  +   +Q DE  R       V+ L RY FLI F  +L +
Sbjct  1170  ILYYKQQLECCQQEDEEHRAYIQDMGVKALRRYAFLIAFRSFLTS  1214


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  1908  KFMVRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             K  V  +  RC+ AG+LR+DI+Y+ ++L+    +D+EHRAY+ DMG++ALR
Sbjct  1150  KAEVDTIIDRCSEAGNLRDDILYYKQQLECCQQEDEEHRAYIQDMGVKALR  1200



>gb|KDO86720.1| hypothetical protein CISIN_1g0008351mg, partial [Citrus sinensis]
Length=1090

 Score =   492 bits (1267),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 238/295 (81%), Positives = 262/295 (89%), Gaps = 1/295 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             ++++RRLLRRDPMGALGYA++KPS     ES +GRP EM  VAALR+G+VLGSQTVLKSD
Sbjct  271   YSIIRRLLRRDPMGALGYANVKPSLMKMAESADGRPHEMGVVAALRNGQVLGSQTVLKSD  330

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + SLPER+EGA NFRE+ GFPVYGVANPT+ GI SVI+RIG  K   PVFWHNM
Sbjct  331   HCPGCQNQSLPERVEGAPNFREVSGFPVYGVANPTIDGIRSVIRRIGHFKGCCPVFWHNM  390

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGID ERVERMEARLK+DI+REAERY GAIMV
Sbjct  391   REEPVIYINGKPFVLREVERPYKNMLEYTGIDRERVERMEARLKEDILREAERYGGAIMV  450

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DGQIFD+WEHVSS+SVQTPLEVFKCLE +GFPIKYAR+PITD KAPK+SDFD LA
Sbjct  451   IHETNDGQIFDAWEHVSSESVQTPLEVFKCLEDDGFPIKYARVPITDGKAPKTSDFDMLA  510

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRVLN-DALHEEL  1283
             +NIASASK TA VFNCQMG GRTTTGTVIACL+KLRIDYGRPIRVL+ D  HEEL
Sbjct  511   VNIASASKDTAFVFNCQMGRGRTTTGTVIACLLKLRIDYGRPIRVLHEDVTHEEL  565


 Score =   206 bits (524),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRTNSIGRV   G++  D +PNSE+AIRRGEY VIRSL RVLEGGVEGK+QVDKVID+
Sbjct  133  GIPRTNSIGRVFDSGSSVADNLPNSEEAIRRGEYAVIRSLTRVLEGGVEGKRQVDKVIDK  192

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            CASMQNLREAIATYRNSILRQPDEMKR+A+LSFFVEYLERY FLICFAVY+HTER AL  
Sbjct  193  CASMQNLREAIATYRNSILRQPDEMKRQASLSFFVEYLERYYFLICFAVYIHTERAALCS  252

Query  410  TS  415
            +S
Sbjct  253  SS  254


 Score =   276 bits (705),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +2

Query  1472  SALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFC  1651
             S  +NIR+AVL YR++FNQQ  EPR R VAL+RGAEYLERYFRLIAFAAYLGS+AFDGFC
Sbjct  585   SISKNIREAVLHYRKVFNQQHVEPRVRMVALSRGAEYLERYFRLIAFAAYLGSEAFDGFC  644

Query  1652  GQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDR  1831
             GQGES  TFK WL QRPEVQAMKWSIR+RPGRF T+PEELR P E +HGDAVMEAIV+ R
Sbjct  645   GQGESRMTFKSWLRQRPEVQAMKWSIRIRPGRFLTVPEELRAPQESQHGDAVMEAIVRAR  704

Query  1832  NGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             NGSVLGKGSIL MYFFPGQRTSSHIQIHGAPHVYKV
Sbjct  705   NGSVLGKGSILKMYFFPGQRTSSHIQIHGAPHVYKV  740


 Score =   139 bits (350),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 130/245 (53%), Gaps = 16/245 (7%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             M+ +   R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT+SG
Sbjct  697   MEAIVRARNGSVLGKGSILKMYFFPG-QRTSSHIQIHGAPHVYKVDGYPVYSMATPTISG  755

Query  696   ILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDC  860
                ++  +G+  +      + V   ++REE V+YING PFVLRE+ +P  + L++ GI  
Sbjct  756   AKEMLAYLGAKTKTEGSFSQKVILTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGITG  814

Query  861   ERVERMEARLKDDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEV  1022
               VE MEARLK+DI+ E  R  G  M++H       +    +   WE++ +D V+TP EV
Sbjct  815   PVVEHMEARLKEDILTEV-RQSGGRMLLHREEYNPASNQSSVVGYWENIFADDVKTPAEV  873

Query  1023  FKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGT  1202
             +  L+ EG+ I Y RIP+T ++   +SD D  A+           +F    G G      
Sbjct  874   YAALQDEGYNITYRRIPLTRERDALASDID--AIQYCKDDSAGCYLFVSHTGFGGVAYAM  931

Query  1203  VIACL  1217
              I CL
Sbjct  932   AIICL  936


 Score = 56.2 bits (134),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 70/146 (48%), Gaps = 15/146 (10%)
 Frame = +2

Query  1313  VPPYAPLI----LKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSAL  1480
             V P+ PL     L +    + +H+ G  D   +  +TR+   G + +  +D II+RC+  
Sbjct  953   VGPHLPLTYEENLPSWASDEEAHKMG--DYRDILNLTRVLVYGPQSKADVDTIIERCAGA  1010

Query  1481  QNIRQAVLQYRRLFNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQ  1657
              ++R  +L Y     +   E  E+R  L + G + L RYF LI F ++L       +C  
Sbjct  1011  GHLRDDILHYSEELKKFSNEYDEQRAYLMDIGIKALRRYFFLITFRSFL-------YC-T  1062

Query  1658  GESMTTFKHWLHQRPEVQAMKWSIRL  1735
               +   FK W+  RPE+  +  +IR+
Sbjct  1063  SPAEINFKSWMDGRPELGHLCNNIRI  1088


 Score =   142 bits (359),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 89/126 (71%), Gaps = 0/126 (0%)
 Frame = +3

Query  849   GIDCERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFK  1028
             GI+  RVE+MEARLK+DI+ EA R+   I+V  E  DGQ+ D WE VS DSV+ PL+V++
Sbjct  1     GINRARVEQMEARLKEDIIMEAARFGNKILVTDELPDGQMVDQWEPVSCDSVKAPLDVYE  60

Query  1029  CLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVI  1208
              L+ EG+ + Y R+P+TD+K+PK  DFD L   I+     T ++FNCQMG GRTTTG VI
Sbjct  61    ELQVEGYLVDYERVPVTDEKSPKEQDFDILVDKISQTDLNTEVIFNCQMGRGRTTTGMVI  120

Query  1209  ACLVKL  1226
             A LV L
Sbjct  121   ATLVYL  126


 Score = 87.4 bits (215),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 97/188 (52%), Gaps = 8/188 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  +TR+ + GVE +  +D +ID+C+++QN+R+A+  YR    +Q  E + R+ +L+  
Sbjct  168   VIRSLTRVLEGGVEGKRQVDKVIDKCASMQNLREAIATYRNSILRQPDEMK-RQASLSFF  226

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ ++     C      ++F  W+  RPE+ + ++  +R  P   
Sbjct  227   VEYLERYYFLICFAVYIHTERA-ALCSSSFGHSSFADWMKARPELYSIIRRLLRRDPMGA  285

Query  1742  -GRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
              G     P  ++           M  +   RNG VLG  ++L     PG Q  S   ++ 
Sbjct  286   LGYANVKPSLMKMAESADGRPHEMGVVAALRNGQVLGSQTVLKSDHCPGCQNQSLPERVE  345

Query  1916  GAPHVYKV  1939
             GAP+  +V
Sbjct  346   GAPNFREV  353


 Score = 70.5 bits (171),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V  +  RCAGAGHLR+DI+++++ELKKF ++ DE RAYLMD+GI+ALR
Sbjct  1000  VDTIIERCAGAGHLRDDILHYSEELKKFSNEYDEQRAYLMDIGIKALR  1047



>ref|XP_002464278.1| hypothetical protein SORBIDRAFT_01g015540 [Sorghum bicolor]
 gb|EER91276.1| hypothetical protein SORBIDRAFT_01g015540 [Sorghum bicolor]
Length=1263

 Score =   461 bits (1185),  Expect(2) = 8e-177, Method: Compositional matrix adjust.
 Identities = 221/285 (78%), Positives = 248/285 (87%), Gaps = 0/285 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+S KP     VES NGRP +MD VAA+R+GEVLG  TVLKSD
Sbjct  397   YSILRRLLRRDPMGALGYSSSKPPLTKIVESANGRPQDMDVVAAMRNGEVLGRLTVLKSD  456

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPG H  +LPER+EGA NFREIPGFPVYGVANPTV GI +VIQ I +SK GRPV WHNM
Sbjct  457   HCPGNHSLNLPERVEGAPNFREIPGFPVYGVANPTVDGIRAVIQCISTSKGGRPVLWHNM  516

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERP KNMLEYTGID  RVERMEARLK+DI+REAERY GAIMV
Sbjct  517   REEPVIYINGKPFVLREVERPCKNMLEYTGIDRARVERMEARLKEDILREAERYGGAIMV  576

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DG+IFD+WE+V +++V TPLEV+K LE+EG PIKYAR+PITD KAPKSSDFDT+A
Sbjct  577   IHETDDGEIFDTWENVDNEAVLTPLEVYKNLESEGLPIKYARVPITDGKAPKSSDFDTIA  636

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV  1256
              N+ SASK TA VFNCQMG GRTTTGTVIACL+KLRID+GRPIR+
Sbjct  637   FNVTSASKSTAFVFNCQMGRGRTTTGTVIACLLKLRIDHGRPIRI  681


 Score =   189 bits (481),  Expect(2) = 8e-177, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT SIG+V   G +  D MP+SE+AI RGEY VIRSL+RVLEGGVEGK+QVDKVID+
Sbjct  259  GIPRTGSIGKVFYAGNDVDDYMPSSEEAILRGEYAVIRSLVRVLEGGVEGKRQVDKVIDK  318

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C SMQNLREAIATYRN+ILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+   A   
Sbjct  319  CDSMQNLREAIATYRNNILRQPDEMKREASLSFFVEYLERYYFLICFAVYVHSVSSAHQT  378

Query  410  TSQV  421
            T  V
Sbjct  379  TLSV  382


 Score =   305 bits (782),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER  1552
             FGINDILLL KITRLFDNG+ECR+ LD +IDRCSALQNIRQAVL+Y R+ NQQ  EPR R
Sbjct  723   FGINDILLLRKITRLFDNGIECRQTLDTVIDRCSALQNIRQAVLKYTRVINQQHVEPRVR  782

Query  1553  RVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIR  1732
             RVALNRGAEYLERY +LIAF+AYLGS+AFDGFCGQGE+  +FK WL QRPE+Q MKWSIR
Sbjct  783   RVALNRGAEYLERYLKLIAFSAYLGSEAFDGFCGQGETKISFKGWLQQRPEIQTMKWSIR  842

Query  1733  LRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQI  1912
             LRPGRFFT+P E +T +    GD  ME IVK R+GSVLGKGSIL MYFFPGQ+ SS +  
Sbjct  843   LRPGRFFTVPHEQKTTYPPPQGDVTMETIVKARSGSVLGKGSILKMYFFPGQKRSSSVNF  902

Query  1913  HGAPHVYKV  1939
              GAPHV+KV
Sbjct  903   RGAPHVFKV  911


 Score =   263 bits (672),  Expect(2) = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 169/236 (72%), Gaps = 3/236 (1%)
 Frame = +3

Query  525   VAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILS  704
             V + R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT+ GI +
Sbjct  18    VISSRGGSVLGKKTILKSDHFPGCQNKRLTPQIDGAPNYRQAGSLRVHGVAMPTMEGIAN  77

Query  705   VIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERM  878
             V+  IG+ K+G+   + WH++REE VIYING+PFVLR+VERP+ N LEYTGI+ ERVE+M
Sbjct  78    VLNHIGAHKKGKQTRILWHSLREEPVIYINGRPFVLRDVERPFSN-LEYTGINRERVEQM  136

Query  879   EARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIK  1058
             E RLK+DI++EA RY   I+V  E   GQ+ D WE V  D+V+TPLEV++ L+ +G+ + 
Sbjct  137   EFRLKEDILQEASRYGNKILVTDELPSGQMVDQWESVEYDTVKTPLEVYEELQQQGYLVD  196

Query  1059  YARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             Y R+PITD+KAPK  DFD L   I+     T +VFNCQMG GRTTTG VIA LV L
Sbjct  197   YERVPITDEKAPKEGDFDNLVRRISQVDIETEIVFNCQMGRGRTTTGMVIATLVYL  252


 Score = 77.8 bits (190),  Expect(2) = 8e-84, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 103/219 (47%), Gaps = 21/219 (10%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             +G++ D ++P     IL+              +  ++  + R+ + GVE +  +D +ID+
Sbjct  272   AGNDVDDYMPSSEEAILR-------------GEYAVIRSLVRVLEGGVEGKRQVDKVIDK  318

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             C ++QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI FA Y+ S      
Sbjct  319   CDSMQNLREAIATYRNNILRQPDEMK-REASLSFFVEYLERYYFLICFAVYVHS-VSSAH  376

Query  1649  CGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEELRTPHELKHGDAVME  1813
                     +F  W+  RPE+ + ++  +R  P    G   + P   +           M+
Sbjct  377   QTTLSVEVSFSDWMRARPELYSILRRLLRRDPMGALGYSSSKPPLTKIVESANGRPQDMD  436

Query  1814  AIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQ-IHGAPH  1927
              +   RNG VLG+ ++L     PG  + +  + + GAP+
Sbjct  437   VVAAMRNGEVLGRLTVLKSDHCPGNHSLNLPERVEGAPN  475


 Score =   136 bits (342),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/260 (33%), Positives = 131/260 (50%), Gaps = 22/260 (8%)
 Frame = +3

Query  468   PSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFRE  647
             P P  DV         M+ +   RSG VLG  ++LK    PG    S      GA +  +
Sbjct  860   PPPQGDVT--------METIVKARSGSVLGKGSILKMYFFPGQKRSS-SVNFRGAPHVFK  910

Query  648   IPGFPVYGVANPTVSGILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGKPFVLRE  812
             + G+PVY +A PT+ G   V+  +GS         + V   ++REE V+YI G PFVLRE
Sbjct  911   VDGYPVYSMATPTIDGASDVLSYLGSKDTTGRSIAQKVVVTDLREEVVVYIKGSPFVLRE  970

Query  813   VERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDS  977
             +++P  + L++ GI    VE +E RLK+DI+ E ++  G +++  E     T    +   
Sbjct  971   LDQPV-DTLKHVGISGPMVENIETRLKEDILSEIKQLGGRLLLHKEEFNAATNQCSVVGY  1029

Query  978   WEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTAL  1157
             WEH+  + V TP EV+  L  +G+ I Y RIP+T ++   ++D D +   I  +++Y   
Sbjct  1030  WEHIDLEDVMTPAEVYSTLRDKGYCIDYKRIPLTREREALAADVDAIQSLIEESARY--Y  1087

Query  1158  VFNCQMGIGRTTTGTVIACL  1217
             +F    G G       I CL
Sbjct  1088  LFISHTGYGGVAYAMAITCL  1107


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + G+E ++ +D VIDRC+++QN+R+A+  Y   I +Q  E + R  AL+  
Sbjct  730  LLRKITRLFDNGIECRQTLDTVIDRCSALQNIRQAVLKYTRVINQQHVEPRVRRVALNRG  789

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI F+ YL +E
Sbjct  790  AEYLERYLKLIAFSAYLGSE  809


 Score = 58.2 bits (139),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 6/126 (5%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             VS+  A    I   ++ A+R+G+Y  I +L RVL  G + K++VD VIDRC+   +LRE 
Sbjct  1126  VSTSLAKNVSIKTKTDIALRQGDYRDILNLTRVLVHGPKSKEEVDTVIDRCSGAGHLRED  1185

Query  260   IATYRNSI--LRQPDEMKREAALSFFVEY----LERY*FLICFAVYLHTERDALHPTSQV  421
             I  YR  +      D+   +   S+  +     L RY FLI F  YL+++R      +  
Sbjct  1186  IMHYRKVLQDCSHDDDDDDDEEHSYLTDMGTKALRRYFFLITFRSYLYSKRSCEATFTSW  1245

Query  422   AEKRPD  439
              + RP+
Sbjct  1246  MKARPE  1251


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 13/118 (11%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQ-----QRTEPRERRVA  1561
             +  +TR+  +G + +E +D +IDRCS   ++R+ ++ YR++           +  E    
Sbjct  1152  ILNLTRVLVHGPKSKEEVDTVIDRCSGAGHLREDIMHYRKVLQDCSHDDDDDDDEEHSYL  1211

Query  1562  LNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + G + L RYF LI F +YL S        +     TF  W+  RPE+  +  +++L
Sbjct  1212  TDMGTKALRRYFFLITFRSYLYS--------KRSCEATFTSWMKARPELGHLCDNLKL  1261



>emb|CDY16323.1| BnaC01g23580D [Brassica napus]
Length=1232

 Score =   422 bits (1086),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 209/300 (70%), Positives = 241/300 (80%), Gaps = 12/300 (4%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             + +LRR LRRDPMG+L  A++KPS     EST+GRP EM +VAALRSG VLGSQTVLKSD
Sbjct  180   YGILRRFLRRDPMGSL--AAMKPSLTKVEESTDGRPHEMSEVAALRSGVVLGSQTVLKSD  237

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             H PGC + SL ER++GA NFRE+PGF VYGVANPTV GI SVI+R+ S +  RPVFWHNM
Sbjct  238   HSPGCRNASLRERVDGAPNFREVPGFAVYGVANPTVDGIRSVIERVWSLRGRRPVFWHNM  297

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYING PFV+REVERPYKNML Y G D + VE +EA LK+DI+REA+RY GAIMV
Sbjct  298   REEPVIYINGIPFVIREVERPYKNMLGYKGTDRDTVEGVEALLKEDILREAKRYDGAIMV  357

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET D  +FD WEHV + SVQTPLEVFK LE EGFP+KYAR+P+TD KAP+SSDFDTL 
Sbjct  358   IHETEDQNVFDCWEHVDAYSVQTPLEVFKNLETEGFPVKYARVPVTDGKAPRSSDFDTLT  417

Query  1122  LNIASASKYTALVFNC----------QMGIGRTTTGTVIACLVKLRIDYGRPIRVLNDAL  1271
              NIASASK TA VFNC          Q+G GRTTTGTVIACLVKLR++YGRPI+VL D++
Sbjct  418   WNIASASKDTAFVFNCQHSVLSLEHTQIGRGRTTTGTVIACLVKLRMNYGRPIKVLTDSI  477


 Score =   228 bits (580),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 139/180 (77%), Gaps = 12/180 (7%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER  1552
             FG++DILLL K T LFDNGVE REALDA+IDRCSA+QNIR+AVL YR++FNQQ  EPR R
Sbjct  493   FGMDDILLLRKFTTLFDNGVESREALDAVIDRCSAVQNIREAVLHYRKVFNQQHVEPRLR  552

Query  1553  RVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIR  1732
               AL R AEYLERYF LI FAAY+GS+  D    +G     +K+WLH++PEVQA+KWS+R
Sbjct  553   NAALKRSAEYLERYFWLITFAAYIGSENLDVAVVKG----GYKNWLHEKPEVQALKWSVR  608

Query  1733  LRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQI  1912
             +RPGRFFTIPEEL++    + GDAVME+I+  R+GSVL KGSIL       QRTSS +QI
Sbjct  609   VRPGRFFTIPEELQS----RQGDAVMESIINKRSGSVLCKGSILK----KCQRTSSRLQI  660


 Score =   101 bits (251),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  65   NSIGRVSSCGANATDIMPNSE-DAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASM  241
            NS GR+ + G N T  +PNSE D IRRGEY VIRSLIRVLEGGV+GK+QVD  IDRCAS+
Sbjct  83   NSFGRIFTTGRNITYDLPNSEEDKIRRGEYAVIRSLIRVLEGGVKGKRQVDNAIDRCASI  142

Query  242  QNLREAIATYRN  277
            QNLREAI TY +
Sbjct  143  QNLREAIPTYSS  154


 Score = 72.0 bits (175),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 50/73 (68%), Gaps = 3/73 (4%)
 Frame = +3

Query  1011  PLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRT  1190
             P+ V++ L+AEG+ ++YAR+P+T+   PK +DFD L   I+ A   T ++F+CQMG G T
Sbjct  7     PVMVYQELQAEGYLVEYARVPVTE---PKDTDFDALIRKISQADINTEIIFSCQMGRGNT  63

Query  1191  TTGTVIACLVKLR  1229
             T G VIA L+  +
Sbjct  64    TAGMVIATLLYFK  76


 Score = 67.0 bits (162),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R    + + GVE ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL   
Sbjct  500  LLRKFTTLFDNGVESREALDAVIDRCSAVQNIREAVLHYRKVFNQQHVEPRLRNAALKRS  559

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY +LI FA Y+ +E
Sbjct  560  AEYLERYFWLITFAAYIGSE  579


 Score = 58.5 bits (140),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 64/129 (50%), Gaps = 12/129 (9%)
 Frame = +3

Query  756   NMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAI  935
              +REE  +YING PFVLRE+ +P   +L + GI    V   E RLK+DI+ E  R  G  
Sbjct  670   TIREEADVYINGIPFVLRELRKPVA-ILTHVGIAGVVV---ETRLKEDILSEV-RETGGR  724

Query  936   MVIHE------TADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARI-PITDDKAP  1094
             M++H       +   Q+   WE++  + V+T  E++   E +        I    DD   
Sbjct  725   MLLHREEYSTASNQSQVIGYWEYIQPEDVKTSAEIYAAQERDALASNVDAIHSCKDDSLG  784

Query  1095  KSSDFDTLA  1121
               ++ DT++
Sbjct  785   FGANVDTIS  793



>tpg|DAA50154.1| TPA: hypothetical protein ZEAMMB73_212285 [Zea mays]
Length=1129

 Score =   457 bits (1175),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 218/285 (76%), Positives = 248/285 (87%), Gaps = 0/285 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+S KP     VES NGRP +MD VAA+R+GEVLG  TVLKSD
Sbjct  262   YSILRRLLRRDPMGALGYSSSKPPLTKIVESANGRPQDMDVVAAMRNGEVLGRLTVLKSD  321

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPG H  +LPER+EGA NFREIPGFPVYGVANPTV GI +VIQ I +SK GRPV WHNM
Sbjct  322   HCPGSHSLNLPERVEGAPNFREIPGFPVYGVANPTVDGIRAVIQCISTSKGGRPVLWHNM  381

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKP+VLREVERP KNMLEYTGID +RVERMEARLK+DI+REAERY GAIMV
Sbjct  382   REEPVIYINGKPYVLREVERPCKNMLEYTGIDRDRVERMEARLKEDILREAERYGGAIMV  441

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DG+IFD+WE+V +++V TPLEV+K L +EG PIKYAR+PITD KAPKSSDFDT+A
Sbjct  442   IHETDDGEIFDTWENVDNEAVLTPLEVYKNLVSEGLPIKYARVPITDGKAPKSSDFDTIA  501

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV  1256
              N+ +ASK TA VFNCQMG GRTTTGTVIACL+KLRID+GRPIR+
Sbjct  502   FNVTAASKGTAFVFNCQMGRGRTTTGTVIACLLKLRIDHGRPIRI  546


 Score =   190 bits (482),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT SIG+V   G +  D MP+SE+AI RGEY VIRSL+RVLEGGVEGK+QVDKVID+
Sbjct  124  GIPRTGSIGKVFYAGNDVDDYMPSSEEAILRGEYAVIRSLVRVLEGGVEGKRQVDKVIDK  183

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C SMQNLREAIATYRN+ILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+   A   
Sbjct  184  CDSMQNLREAIATYRNNILRQPDEMKREASLSFFVEYLERYYFLICFAVYVHSVSSAHQT  243

Query  410  TSQV  421
            T  V
Sbjct  244  TLSV  247


 Score =   300 bits (769),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER  1552
             FGINDILLL KITRLFDNG+ECR+ LD +IDRCSALQNIRQAVL Y R+ NQQ  EPR R
Sbjct  589   FGINDILLLRKITRLFDNGIECRQTLDTVIDRCSALQNIRQAVLNYTRVINQQHVEPRVR  648

Query  1553  RVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIR  1732
             RVALNRGAEYLERY +LIAF+AYLGS+AFDGFCGQG++  +FK WL QRPE+Q MKWSIR
Sbjct  649   RVALNRGAEYLERYLKLIAFSAYLGSEAFDGFCGQGQTKISFKGWLQQRPEIQTMKWSIR  708

Query  1733  LRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQI  1912
             LRPGRFFT+P E +  +    GD  ME IVK R+GSVLGKGSIL MYFFPGQ+ SS +  
Sbjct  709   LRPGRFFTVPHEQKATYPPPQGDVTMETIVKARSGSVLGKGSILKMYFFPGQKRSSSVNF  768

Query  1913  HGAPHVYKV  1939
              GAPHV KV
Sbjct  769   RGAPHVIKV  777


 Score =   134 bits (336),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = +3

Query  876   MEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPI  1055
             ME RLK+DI++EA RY   I+V  E   GQ+ D WE V  D+V+TPLEV++ L+ +G+ +
Sbjct  1     MEFRLKEDILQEASRYGNKILVTDELPSGQMVDQWESVVYDTVKTPLEVYEELQHQGYLV  60

Query  1056  KYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
              Y R+PITD+KAPK  DFD L   I+     T +VFNCQMG GRTTTG VIA LV L
Sbjct  61    DYERVPITDEKAPKEGDFDNLVRRISQVDIETEIVFNCQMGRGRTTTGMVIATLVYL  117


 Score = 77.8 bits (190),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 103/219 (47%), Gaps = 21/219 (10%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             +G++ D ++P     IL+              +  ++  + R+ + GVE +  +D +ID+
Sbjct  137   AGNDVDDYMPSSEEAILR-------------GEYAVIRSLVRVLEGGVEGKRQVDKVIDK  183

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             C ++QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI FA Y+ S      
Sbjct  184   CDSMQNLREAIATYRNNILRQPDEMK-REASLSFFVEYLERYYFLICFAVYVHS-VSSAH  241

Query  1649  CGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEELRTPHELKHGDAVME  1813
                     +F  W+  RPE+ + ++  +R  P    G   + P   +           M+
Sbjct  242   QTTLSVEVSFSDWMRARPELYSILRRLLRRDPMGALGYSSSKPPLTKIVESANGRPQDMD  301

Query  1814  AIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQ-IHGAPH  1927
              +   RNG VLG+ ++L     PG  + +  + + GAP+
Sbjct  302   VVAAMRNGEVLGRLTVLKSDHCPGSHSLNLPERVEGAPN  340


 Score =   138 bits (348),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 85/260 (33%), Positives = 133/260 (51%), Gaps = 22/260 (8%)
 Frame = +3

Query  468   PSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFRE  647
             P P  DV         M+ +   RSG VLG  ++LK    PG    S      GA +  +
Sbjct  726   PPPQGDVT--------METIVKARSGSVLGKGSILKMYFFPGQKRSS-SVNFRGAPHVIK  776

Query  648   IPGFPVYGVANPTVSGILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGKPFVLRE  812
             + G+PVY +A PT+ G   V+  +GS         + V   ++REE V+YI G PFVLRE
Sbjct  777   VDGYPVYSMATPTIDGASDVLSYLGSKDTTGRNIAQKVVVTDLREEVVVYIKGSPFVLRE  836

Query  813   VERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDS  977
             +++P  + L++ GI    VE +E RLK+DI+ E ++  G +++  E     T    +   
Sbjct  837   LDQPV-DTLKHVGISGPMVENIETRLKEDILSEVKQLGGRLLLHQEEFNAATNQCSVVGY  895

Query  978   WEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTAL  1157
             WEH+  + V TP EV+  L  +G+ I+Y RIP+T ++   ++D D +  +I  +++Y   
Sbjct  896   WEHIDLEDVMTPAEVYSTLRDKGYCIEYKRIPLTREREALAADVDAIQSSIDESARY--Y  953

Query  1158  VFNCQMGIGRTTTGTVIACL  1217
             +F    G G       I CL
Sbjct  954   LFISHTGYGGVAYAMAITCL  973


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + G+E ++ +D VIDRC+++QN+R+A+  Y   I +Q  E + R  AL+  
Sbjct  596  LLRKITRLFDNGIECRQTLDTVIDRCSALQNIRQAVLNYTRVINQQHVEPRVRRVALNRG  655

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI F+ YL +E
Sbjct  656  AEYLERYLKLIAFSAYLGSE  675


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 13/118 (11%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVA-----  1561
             +  +TR+  +G + +E +D +IDRCS   ++R+ ++ YR+       +  +         
Sbjct  1018  ILNLTRVLVHGPKSKEEVDTVIDRCSGAGHLREDIMHYRKALQDCSHDDDDDCDEEHSYL  1077

Query  1562  LNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + G + L RYF LI F +YL S             TTF  W+  RPE+  +  +++L
Sbjct  1078  TDMGTKALRRYFFLITFRSYLYSTT--------SCKTTFTSWMKARPELGHLCDNLKL  1127


 Score = 54.7 bits (130),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 6/126 (5%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             VS+  A    I   ++ A+++G+Y  I +L RVL  G + K++VD VIDRC+   +LRE 
Sbjct  992   VSTSLAKNVSIKTKTDIALKQGDYRDILNLTRVLVHGPKSKEEVDTVIDRCSGAGHLRED  1051

Query  260   IATYRNSILRQPDEMKREAA------LSFFVEYLERY*FLICFAVYLHTERDALHPTSQV  421
             I  YR ++     +   +             + L RY FLI F  YL++        +  
Sbjct  1052  IMHYRKALQDCSHDDDDDCDEEHSYLTDMGTKALRRYFFLITFRSYLYSTTSCKTTFTSW  1111

Query  422   AEKRPD  439
              + RP+
Sbjct  1112  MKARPE  1117



>tpg|DAA50155.1| TPA: hypothetical protein ZEAMMB73_212285 [Zea mays]
Length=1264

 Score =   457 bits (1175),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 218/285 (76%), Positives = 248/285 (87%), Gaps = 0/285 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+S KP     VES NGRP +MD VAA+R+GEVLG  TVLKSD
Sbjct  397   YSILRRLLRRDPMGALGYSSSKPPLTKIVESANGRPQDMDVVAAMRNGEVLGRLTVLKSD  456

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPG H  +LPER+EGA NFREIPGFPVYGVANPTV GI +VIQ I +SK GRPV WHNM
Sbjct  457   HCPGSHSLNLPERVEGAPNFREIPGFPVYGVANPTVDGIRAVIQCISTSKGGRPVLWHNM  516

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKP+VLREVERP KNMLEYTGID +RVERMEARLK+DI+REAERY GAIMV
Sbjct  517   REEPVIYINGKPYVLREVERPCKNMLEYTGIDRDRVERMEARLKEDILREAERYGGAIMV  576

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DG+IFD+WE+V +++V TPLEV+K L +EG PIKYAR+PITD KAPKSSDFDT+A
Sbjct  577   IHETDDGEIFDTWENVDNEAVLTPLEVYKNLVSEGLPIKYARVPITDGKAPKSSDFDTIA  636

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV  1256
              N+ +ASK TA VFNCQMG GRTTTGTVIACL+KLRID+GRPIR+
Sbjct  637   FNVTAASKGTAFVFNCQMGRGRTTTGTVIACLLKLRIDHGRPIRI  681


 Score =   190 bits (482),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT SIG+V   G +  D MP+SE+AI RGEY VIRSL+RVLEGGVEGK+QVDKVID+
Sbjct  259  GIPRTGSIGKVFYAGNDVDDYMPSSEEAILRGEYAVIRSLVRVLEGGVEGKRQVDKVIDK  318

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C SMQNLREAIATYRN+ILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+   A   
Sbjct  319  CDSMQNLREAIATYRNNILRQPDEMKREASLSFFVEYLERYYFLICFAVYVHSVSSAHQT  378

Query  410  TSQV  421
            T  V
Sbjct  379  TLSV  382


 Score =   300 bits (769),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER  1552
             FGINDILLL KITRLFDNG+ECR+ LD +IDRCSALQNIRQAVL Y R+ NQQ  EPR R
Sbjct  724   FGINDILLLRKITRLFDNGIECRQTLDTVIDRCSALQNIRQAVLNYTRVINQQHVEPRVR  783

Query  1553  RVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIR  1732
             RVALNRGAEYLERY +LIAF+AYLGS+AFDGFCGQG++  +FK WL QRPE+Q MKWSIR
Sbjct  784   RVALNRGAEYLERYLKLIAFSAYLGSEAFDGFCGQGQTKISFKGWLQQRPEIQTMKWSIR  843

Query  1733  LRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQI  1912
             LRPGRFFT+P E +  +    GD  ME IVK R+GSVLGKGSIL MYFFPGQ+ SS +  
Sbjct  844   LRPGRFFTVPHEQKATYPPPQGDVTMETIVKARSGSVLGKGSILKMYFFPGQKRSSSVNF  903

Query  1913  HGAPHVYKV  1939
              GAPHV KV
Sbjct  904   RGAPHVIKV  912


 Score =   261 bits (667),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 169/236 (72%), Gaps = 3/236 (1%)
 Frame = +3

Query  525   VAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILS  704
             V + R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT+ GI +
Sbjct  18    VISSRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQAGSLRVHGVAMPTMEGIAN  77

Query  705   VIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERM  878
             V+  IG+ K+G+   + WH++REE VIYING+PFVLR+VE+P+ N LEYTGI+ ERVE+M
Sbjct  78    VLNHIGAHKKGKQTRILWHSLREEPVIYINGRPFVLRDVEKPFSN-LEYTGINRERVEQM  136

Query  879   EARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIK  1058
             E RLK+DI++EA RY   I+V  E   GQ+ D WE V  D+V+TPLEV++ L+ +G+ + 
Sbjct  137   EFRLKEDILQEASRYGNKILVTDELPSGQMVDQWESVVYDTVKTPLEVYEELQHQGYLVD  196

Query  1059  YARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             Y R+PITD+KAPK  DFD L   I+     T +VFNCQMG GRTTTG VIA LV L
Sbjct  197   YERVPITDEKAPKEGDFDNLVRRISQVDIETEIVFNCQMGRGRTTTGMVIATLVYL  252


 Score = 77.8 bits (190),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 103/219 (47%), Gaps = 21/219 (10%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             +G++ D ++P     IL+              +  ++  + R+ + GVE +  +D +ID+
Sbjct  272   AGNDVDDYMPSSEEAILR-------------GEYAVIRSLVRVLEGGVEGKRQVDKVIDK  318

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             C ++QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI FA Y+ S      
Sbjct  319   CDSMQNLREAIATYRNNILRQPDEMK-REASLSFFVEYLERYYFLICFAVYVHS-VSSAH  376

Query  1649  CGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEELRTPHELKHGDAVME  1813
                     +F  W+  RPE+ + ++  +R  P    G   + P   +           M+
Sbjct  377   QTTLSVEVSFSDWMRARPELYSILRRLLRRDPMGALGYSSSKPPLTKIVESANGRPQDMD  436

Query  1814  AIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQ-IHGAPH  1927
              +   RNG VLG+ ++L     PG  + +  + + GAP+
Sbjct  437   VVAAMRNGEVLGRLTVLKSDHCPGSHSLNLPERVEGAPN  475


 Score =   139 bits (349),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 135/266 (51%), Gaps = 34/266 (13%)
 Frame = +3

Query  468   PSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFRE  647
             P P  DV         M+ +   RSG VLG  ++LK    PG       ++   ++NFR 
Sbjct  861   PPPQGDVT--------METIVKARSGSVLGKGSILKMYFFPG-------QKRSSSVNFRG  905

Query  648   IP------GFPVYGVANPTVSGILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGK  794
              P      G+PVY +A PT+ G   V+  +GS         + V   ++REE V+YI G 
Sbjct  906   APHVIKVDGYPVYSMATPTIDGASDVLSYLGSKDTTGRNIAQKVVVTDLREEVVVYIKGS  965

Query  795   PFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHE-----TAD  959
             PFVLRE+++P  + L++ GI    VE +E RLK+DI+ E ++  G +++  E     T  
Sbjct  966   PFVLRELDQPV-DTLKHVGISGPMVENIETRLKEDILSEVKQLGGRLLLHQEEFNAATNQ  1024

Query  960   GQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASA  1139
               +   WEH+  + V TP EV+  L  +G+ I+Y RIP+T ++   ++D D +  +I  +
Sbjct  1025  CSVVGYWEHIDLEDVMTPAEVYSTLRDKGYCIEYKRIPLTREREALAADVDAIQSSIDES  1084

Query  1140  SKYTALVFNCQMGIGRTTTGTVIACL  1217
             ++Y   +F    G G       I CL
Sbjct  1085  ARY--YLFISHTGYGGVAYAMAITCL  1108


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + G+E ++ +D VIDRC+++QN+R+A+  Y   I +Q  E + R  AL+  
Sbjct  731  LLRKITRLFDNGIECRQTLDTVIDRCSALQNIRQAVLNYTRVINQQHVEPRVRRVALNRG  790

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI F+ YL +E
Sbjct  791  AEYLERYLKLIAFSAYLGSE  810


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 13/118 (11%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVA-----  1561
             +  +TR+  +G + +E +D +IDRCS   ++R+ ++ YR+       +  +         
Sbjct  1153  ILNLTRVLVHGPKSKEEVDTVIDRCSGAGHLREDIMHYRKALQDCSHDDDDDCDEEHSYL  1212

Query  1562  LNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + G + L RYF LI F +YL S             TTF  W+  RPE+  +  +++L
Sbjct  1213  TDMGTKALRRYFFLITFRSYLYSTT--------SCKTTFTSWMKARPELGHLCDNLKL  1262


 Score = 54.7 bits (130),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 6/126 (5%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             VS+  A    I   ++ A+++G+Y  I +L RVL  G + K++VD VIDRC+   +LRE 
Sbjct  1127  VSTSLAKNVSIKTKTDIALKQGDYRDILNLTRVLVHGPKSKEEVDTVIDRCSGAGHLRED  1186

Query  260   IATYRNSILRQPDEMKREAA------LSFFVEYLERY*FLICFAVYLHTERDALHPTSQV  421
             I  YR ++     +   +             + L RY FLI F  YL++        +  
Sbjct  1187  IMHYRKALQDCSHDDDDDCDEEHSYLTDMGTKALRRYFFLITFRSYLYSTTSCKTTFTSW  1246

Query  422   AEKRPD  439
              + RP+
Sbjct  1247  MKARPE  1252



>ref|XP_002961070.1| hypothetical protein SELMODRAFT_164100 [Selaginella moellendorffii]
 gb|EFJ38609.1| hypothetical protein SELMODRAFT_164100 [Selaginella moellendorffii]
Length=1242

 Score =   425 bits (1093),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 227/422 (54%), Positives = 284/422 (67%), Gaps = 21/422 (5%)
 Frame = +3

Query  6     GEAVGGVEGRADQFPEFQGQIQLAEFPVVVPMLLIL-CPTQRMQFVEENIQLLEA*FEFW  182
             GE +G  E   D+FP+ +   +  E+ VV  +  +L    +  + V+  I    A  +  
Sbjct  269   GEVLGSAEESTDEFPDSEEGFRQGEYTVVRSLCRVLEGGVEGKRQVDTVIDRCSA-MQNL  327

Query  183   RVALKAKNKWIKSLTDVPQCRTYVKLLLLIGTAFYVSLMR*RGKQHFPFLWSIWKDISSL  362
             R A+      I    D  +  + +   +     +Y  +          F   I  D S+L
Sbjct  328   REAINTYRNSILRQADEKKRESSLSYFVEYLERYYFLIC---------FAVYIHTDQSAL  378

Query  363   F----VLLYISTQNEMHFTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVA  530
                     ++  + E+ +++LRRLLRRDPMGALGY +  P     V + NGRPS M+ VA
Sbjct  379   TQPGGFQQWMKARPEL-YSILRRLLRRDPMGALGYRNKPP-----VAAENGRPSRMEAVA  432

Query  531   ALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVI  710
             A R+G+VLG QTVLK DH PGCH+P LPE +EGA NFREIPGFPVYGVANPTVSGI +V+
Sbjct  433   ACRTGDVLGKQTVLKGDHYPGCHNPHLPESVEGAPNFREIPGFPVYGVANPTVSGIKAVL  492

Query  711   QRIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARL  890
             +R+G  K GRPV WHNMREE V+YING+PFVLREVERPYKNMLEYTGID +RVE+MEARL
Sbjct  493   ERVGGGKGGRPVLWHNMREEPVVYINGQPFVLREVERPYKNMLEYTGIDRDRVEQMEARL  552

Query  891   KDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARI  1070
             K+D+++EAERY GAIMV HE+ DG IFDSWE V+ + VQTP EV+  L +EG+ I+Y+R+
Sbjct  553   KEDVLKEAERYDGAIMVNHESKDGFIFDSWESVTPEGVQTPFEVYSRLVSEGYSIEYSRM  612

Query  1071  PITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPI  1250
             PITD KAPKSSDFDTL   I SA K T  VFNCQMG GRTTTGTVIACLVKLR DYG+P 
Sbjct  613   PITDGKAPKSSDFDTLTSKIVSAPKKTVFVFNCQMGRGRTTTGTVIACLVKLRCDYGKPF  672

Query  1251  RV  1256
             R+
Sbjct  673   RL  674


 Score =   219 bits (559),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 149/218 (68%), Gaps = 10/218 (5%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             +G+  D H+  + P  L+   +  S+    +++I ++ ++TRL ++GV CREALD +IDR
Sbjct  694   NGEAGDEHLT-FKPAKLE---RCKSTSVLVMDNISIVRRLTRLLEDGVACREALDDVIDR  749

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             C+ALQN+RQA+LQYR+ FNQQ  E   RR ALNRG EYLERY  +IAFA+YLGS+AF   
Sbjct  750   CAALQNLRQAILQYRKSFNQQNLESPGRRAALNRGVEYLERYCMMIAFASYLGSEAF---  806

Query  1649  CGQGESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPE-ELRTPHELKHGDAVMEAIVK  1825
                      FK WL++RPE++ MKWS+RLRP RFF +PE E R   E   GD ++EAIVK
Sbjct  807   --SETQRLPFKVWLNKRPEIKQMKWSMRLRPARFFAVPEVEFRALAENCEGDEILEAIVK  864

Query  1826  DRNGSVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
              RNGSVLGK +IL MY FPGQ  +S   I G PH+ K+
Sbjct  865   SRNGSVLGKRAILKMYHFPGQSAASCFDIPGVPHMRKI  902


 Score =   265 bits (677),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 169/241 (70%), Gaps = 3/241 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E + V   R G VLG +T+LKSDH PGC +  L   ++GA N+R++   PV+GVA PT+ 
Sbjct  11    EPEHVIMSRGGSVLGRKTILKSDHFPGCQNKRLQPHVQGAPNYRQVGSLPVFGVAIPTID  70

Query  693   GILSVIQRIGSSKEG--RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCER  866
             GI  V+  IG+++ G  + V WHN+REE VIYING+PFVLRE+ERP+ N LEYTGI+  R
Sbjct  71    GIRKVLDLIGANRNGGHKRVLWHNLREEPVIYINGRPFVLREIERPFTN-LEYTGINRVR  129

Query  867   VERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEG  1046
             VE MEARLK+D++REA R+   I+V  E  DGQ+ D WE ++  SV TPLEV+  L  E 
Sbjct  130   VEEMEARLKEDVLREAGRFGCKILVCDEMPDGQMIDQWEPITDASVLTPLEVYDSLCNES  189

Query  1047  FPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + + Y R+PITD+K+PK  DFD L   +A A   TALVFNCQMG GRTTTG VIA LV L
Sbjct  190   YFVDYERLPITDEKSPKERDFDLLVQRVAEADINTALVFNCQMGRGRTTTGMVIATLVYL  249

Query  1227  R  1229
             +
Sbjct  250   K  250


 Score =   142 bits (357),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 134/241 (56%), Gaps = 12/241 (5%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSG  695
             ++ +   R+G VLG + +LK  H PG    S  + + G  + R+I GFPVY +A PT  G
Sbjct  859   LEAIVKSRNGSVLGKRAILKMYHFPGQSAASCFD-IPGVPHMRKIDGFPVYSMATPTAQG  917

Query  696   ILSVIQRIGSS-KEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVE  872
               +    + ++  +G+     ++REE V+YI+G PFVLRE+++P  + L++ GI    VE
Sbjct  918   AKAAFACLNTAVDQGKHAVVTDLREEAVVYIHGNPFVLRELDQPV-STLKHVGIKGSAVE  976

Query  873   RMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQTPLEVFKCLE  1037
             +ME RLK+DI+ E +R  G +++  E     T    +   WE ++SD V+TP EV+  L 
Sbjct  977   QMEYRLKEDILAEMKRSGGRVVLHREECNPLTNKSDVIGYWEVLTSDDVKTPAEVYTGLA  1036

Query  1038  AEGFPIKYARIPITDDKAPKSSDFDTLALNI-ASASKYTALVFNCQMGIGRTTTGTVIAC  1214
             AEG+ I Y RIP+T ++A  + D D +   +  S S+Y   V+    G G       I C
Sbjct  1037  AEGYKIDYKRIPLTRERAALAMDVDAIQDRLNGSGSEY---VYISHTGYGGVAYAMAITC  1093

Query  1215  L  1217
             +
Sbjct  1094  M  1094


 Score = 65.5 bits (158),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 69/139 (50%), Gaps = 14/139 (10%)
 Frame = +2

Query  1322  YAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAV  1501
             Y P+    RP  D S  F   D   +  + R+  +G  C+  +D IIDRCS   N+R  +
Sbjct  1116  YGPI---QRPADDISA-FKQGDYRDILSLVRVLPSGPFCKAEVDTIIDRCSEAGNLRDDI  1171

Query  1502  LQYRRLFNQQRTEPRERRVAL-NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTF  1678
             L Y++     + E  E R  + + G + L RY  LIAF ++L S   +         ++F
Sbjct  1172  LYYKQQLECCQQEDEEHRAYIQDMGVKALRRYAFLIAFRSFLTSRTPN---------SSF  1222

Query  1679  KHWLHQRPEVQAMKWSIRL  1735
               W+H RPE+  + ++++L
Sbjct  1223  AAWMHSRPELGHLCYNLKL  1241


 Score =   170 bits (431),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GI R+ S G V      +TD  P+SE+  R+GEYTV+RSL RVLEGGVEGK+QVD VIDR
Sbjct  261  GIRRSRSFGEVLGSAEESTDEFPDSEEGFRQGEYTVVRSLCRVLEGGVEGKRQVDTVIDR  320

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDAL  403
            C++MQNLREAI TYRNSILRQ DE KRE++LS+FVEYLERY FLICFAVY+HT++ AL
Sbjct  321  CSAMQNLREAINTYRNSILRQADEKKRESSLSYFVEYLERYYFLICFAVYIHTDQSAL  378


 Score = 91.7 bits (226),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 106/201 (53%), Gaps = 19/201 (9%)
 Frame = +2

Query  1358  DSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRT  1537
             DS   F   +  ++  + R+ + GVE +  +D +IDRCSA+QN+R+A+  YR    +Q  
Sbjct  284   DSEEGFRQGEYTVVRSLCRVLEGGVEGKRQVDTVIDRCSAMQNLREAINTYRNSILRQAD  343

Query  1538  EPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTT----FKHWLHQRPE  1705
             E ++R  +L+   EYLERY+ LI FA Y+ +D         +S  T    F+ W+  RPE
Sbjct  344   E-KKRESSLSYFVEYLERYYFLICFAVYIHTD---------QSALTQPGGFQQWMKARPE  393

Query  1706  VQAMKWSIRLRPGRFFTIPEELRTPHELKHG-DAVMEAIVKDRNGSVLGKGSILTMYFFP  1882
             + ++   + LR      +    + P   ++G  + MEA+   R G VLGK ++L    +P
Sbjct  394   LYSILRRL-LRRDPMGALGYRNKPPVAAENGRPSRMEAVAACRTGDVLGKQTVLKGDHYP  452

Query  1883  GQRTSSHI--QIHGAPHVYKV  1939
             G   + H+   + GAP+  ++
Sbjct  453   GCH-NPHLPESVEGAPNFREI  472


 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 64/107 (60%), Gaps = 10/107 (9%)
 Frame = +2

Query  74   GRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLR  253
             ++  C + +  +M N          +++R L R+LE GV  ++ +D VIDRCA++QNLR
Sbjct  707  AKLERCKSTSVLVMDN---------ISIVRRLTRLLEDGVACREALDDVIDRCAALQNLR  757

Query  254  EAIATYRNSILRQPDEMK-REAALSFFVEYLERY*FLICFAVYLHTE  391
            +AI  YR S  +Q  E   R AAL+  VEYLERY  +I FA YL +E
Sbjct  758  QAILQYRKSFNQQNLESPGRRAALNRGVEYLERYCMMIAFASYLGSE  804


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 53/105 (50%), Gaps = 2/105 (2%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             V SC         +   A ++G+Y  I SL+RVL  G   K +VD +IDRC+   NLR+ 
Sbjct  1111  VPSCVYGPIQRPADDISAFKQGDYRDILSLVRVLPSGPFCKAEVDTIIDRCSEAGNLRDD  1170

Query  260   IATYRNSI--LRQPDEMKREAALSFFVEYLERY*FLICFAVYLHT  388
             I  Y+  +   +Q DE  R       V+ L RY FLI F  +L +
Sbjct  1171  ILYYKQQLECCQQEDEEHRAYIQDMGVKALRRYAFLIAFRSFLTS  1215


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  1908  KFMVRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             K  V  +  RC+ AG+LR+DI+Y+ ++L+    +D+EHRAY+ DMG++ALR
Sbjct  1151  KAEVDTIIDRCSEAGNLRDDILYYKQQLECCQQEDEEHRAYIQDMGVKALR  1201



>dbj|BAJ95291.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1261

 Score =   458 bits (1178),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 213/283 (75%), Positives = 252/283 (89%), Gaps = 0/283 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+S K +    +ES +GRP EMD VAA+R+GEVLG QTVLKSD
Sbjct  394   YSILRRLLRRDPMGALGYSSSKLTLPKIIESADGRPHEMDVVAAMRNGEVLGRQTVLKSD  453

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGCH+ +LPER+EGA NFREIPGFPVYGVANPTV GI +VIQR+ +SK  RP+ WHNM
Sbjct  454   HCPGCHNLNLPERVEGAPNFREIPGFPVYGVANPTVDGIRAVIQRVSTSKGNRPILWHNM  513

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYI+GKPFVLREVERPYKNMLEYTGI  +RVERMEARLK+DI+REAERY GAIMV
Sbjct  514   REEPVIYIHGKPFVLREVERPYKNMLEYTGIGRDRVERMEARLKEDILREAERYDGAIMV  573

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET +G+IFD+WE+V++++V TPLEV+KCL++EG PIKYAR+PITD KAPKSSDFDT+A
Sbjct  574   IHETDNGEIFDAWENVNNEAVLTPLEVYKCLDSEGLPIKYARVPITDGKAPKSSDFDTVA  633

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPI  1250
              N+A+A K  ALVFNCQMG GRTTTGTVIACL++LRI++GRPI
Sbjct  634   FNVAAACKDAALVFNCQMGRGRTTTGTVIACLLRLRINHGRPI  676


 Score =   187 bits (474),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT+SIG+V   G +  D  P+SE+AI RGEY VIRSL+RVLEGGVEGK+QVDKVID+
Sbjct  257  GIPRTSSIGKVFYAGNDVDDYSPSSEEAILRGEYAVIRSLVRVLEGGVEGKRQVDKVIDK  316

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C SMQNLREAIATYRNS LRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+   A   
Sbjct  317  CDSMQNLREAIATYRNSTLRQPDEMKREASLSFFVEYLERYYFLICFAVYVHSVSSAHQA  376

Query  410  TS  415
            TS
Sbjct  377  TS  378


 Score =   266 bits (680),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 172/238 (72%), Gaps = 3/238 (1%)
 Frame = +3

Query  519   DQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGI  698
             +QV + R G VLG +T+LKSDH PGC +  L   ++GA N+R+     V+GVA PT+ GI
Sbjct  14    EQVISSRGGSVLGKKTILKSDHFPGCQNKRLTPHIDGAPNYRQAGSLRVHGVAMPTMEGI  73

Query  699   LSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVE  872
             ++V+  IG+ K+G+   V WH++REE VIYING+PFVLR+ ERP+ N LEYTGI+ ERVE
Sbjct  74    VNVLNHIGAQKKGKQTQVLWHSLREEPVIYINGRPFVLRDAERPFSN-LEYTGINRERVE  132

Query  873   RMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFP  1052
             +ME RLK+DI++EA RY   I+V  E  +GQ+ D WE V SD+V+TPLEV++ L+ +G+ 
Sbjct  133   QMEFRLKEDILQEASRYGNKILVTDELPNGQMVDQWESVISDTVKTPLEVYEELQHQGYL  192

Query  1053  IKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + Y R+PITD+KAPK  DFD L   I+     T +VFNCQMG GRTTTG VI+ LV L
Sbjct  193   VDYERVPITDEKAPKEGDFDNLVRRISEVDMETEIVFNCQMGRGRTTTGMVISTLVYL  250


 Score = 81.6 bits (200),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 60/223 (27%), Positives = 107/223 (48%), Gaps = 22/223 (10%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             +G++ D + P     IL+              +  ++  + R+ + GVE +  +D +ID+
Sbjct  270   AGNDVDDYSPSSEEAILR-------------GEYAVIRSLVRVLEGGVEGKRQVDKVIDK  316

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             C ++QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI FA Y+ S      
Sbjct  317   CDSMQNLREAIATYRNSTLRQPDEMK-REASLSFFVEYLERYYFLICFAVYVHS--VSSA  373

Query  1649  CGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP-GRFFTIPEELRTPHELKHGDA---VME  1813
                  S  +F  W+  RPE+ + ++  +R  P G       +L  P  ++  D     M+
Sbjct  374   HQATSSGVSFSDWMRARPELYSILRRLLRRDPMGALGYSSSKLTLPKIIESADGRPHEMD  433

Query  1814  AIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIHGAPHVYKV  1939
              +   RNG VLG+ ++L     PG    +   ++ GAP+  ++
Sbjct  434   VVAAMRNGEVLGRQTVLKSDHCPGCHNLNLPERVEGAPNFREI  476


 Score =   298 bits (763),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER  1552
             F INDILLL KITRLFDNG+ECR+ LD +ID+CSALQNIRQAVLQY ++ NQQ  EPR R
Sbjct  723   FDINDILLLRKITRLFDNGIECRQILDTVIDKCSALQNIRQAVLQYTKVINQQNMEPRVR  782

Query  1553  RVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIR  1732
             RVALNRGAEYLERY +LIAF+AYLGS+AFDGFCGQGE+  +FK+WL QRPE+Q MKWSIR
Sbjct  783   RVALNRGAEYLERYLKLIAFSAYLGSEAFDGFCGQGETKISFKNWLQQRPEIQTMKWSIR  842

Query  1733  LRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQI  1912
             LRPGRFFT+P+E +   +    D  MEAIVK RNGSVLGKGSIL MYFFPGQR SS +  
Sbjct  843   LRPGRFFTVPDEHKATCQPLQSDVTMEAIVKARNGSVLGKGSILKMYFFPGQRRSSSMNF  902

Query  1913  HGAPHVYKV  1939
              G PHV KV
Sbjct  903   RGTPHVIKV  911


 Score =   142 bits (358),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/250 (34%), Positives = 132/250 (53%), Gaps = 26/250 (10%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIP------GFPVYGVA  677
             M+ +   R+G VLG  ++LK    PG       +R   ++NFR  P      G+PVY +A
Sbjct  868   MEAIVKARNGSVLGKGSILKMYFFPG-------QRRSSSMNFRGTPHVIKVDGYPVYSMA  920

Query  678   NPTVSGILSVIQRIG-SSKEGRPVFWH----NMREEHVIYINGKPFVLREVERPYKNMLE  842
              PTV G   V+  +G     GR +       ++REE V+YI G PFVLRE+++P+ + L+
Sbjct  921   TPTVDGAREVLSYLGCKDTTGRDIIQKVVITDLREEVVVYIKGTPFVLRELDQPF-DTLK  979

Query  843   YTGIDCERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQ  1007
             + GI    VE +EARLK+DI+ E +   G +++  E     T    +   WEH+  + V 
Sbjct  980   HVGISGPMVENIEARLKEDILSEVKELEGRLLLHQEEFNAATNQCSVLGYWEHIDLEDVM  1039

Query  1008  TPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGR  1187
             TP EV+  L  +G+ I Y R+P+T ++   ++D D++  +I  +S+Y   +F    G G 
Sbjct  1040  TPAEVYNTLRDQGYCIDYKRVPLTREREALAADVDSIQSSINESSRY--YLFISHTGYGG  1097

Query  1188  TTTGTVIACL  1217
                   I CL
Sbjct  1098  VAYAMAITCL  1107


 Score = 63.9 bits (154),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + G+E ++ +D VID+C+++QN+R+A+  Y   I +Q  E + R  AL+  
Sbjct  730  LLRKITRLFDNGIECRQILDTVIDKCSALQNIRQAVLQYTKVINQQNMEPRVRRVALNRG  789

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI F+ YL +E
Sbjct  790  AEYLERYLKLIAFSAYLGSE  809


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 67/126 (53%), Gaps = 8/126 (6%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             VSS    +  +   ++ A+R+G+Y  I +L R L  G + K++VDKVIDRC    +LRE 
Sbjct  1126  VSSSLTKSVSVKTFTDIALRQGDYRDILNLTRALIHGPKSKEEVDKVIDRCVGAGDLRED  1185

Query  260   IATYRNSILRQPDEMKREAALSFFVEY----LERY*FLICFAVYLHTERDALHPTSQVA-  424
             I  YR ++     +   + A S+ ++     L RY FLI F  Y+H    +LH  +  + 
Sbjct  1186  ILQYRKALRDCSHDDDDDEARSYLMDMGTKALRRYFFLITFRSYVHCT--SLHEVTFASW  1243

Query  425   -EKRPD  439
              E RP+
Sbjct  1244  MEARPE  1249


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/116 (27%), Positives = 57/116 (49%), Gaps = 11/116 (9%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLF---NQQRTEPRERRVALN  1567
             +  +TR   +G + +E +D +IDRC    ++R+ +LQYR+     +    +   R   ++
Sbjct  1152  ILNLTRALIHGPKSKEEVDKVIDRCVGAGDLREDILQYRKALRDCSHDDDDDEARSYLMD  1211

Query  1568  RGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              G + L RYF LI F +Y+   +            TF  W+  RPE+  +  +++L
Sbjct  1212  MGTKALRRYFFLITFRSYVHCTSL--------HEVTFASWMEARPELGHLCDNLKL  1259



>ref|XP_008665018.1| PREDICTED: uncharacterized protein LOC103643638 [Zea mays]
Length=1425

 Score =   455 bits (1171),  Expect(2) = 5e-175, Method: Compositional matrix adjust.
 Identities = 218/285 (76%), Positives = 248/285 (87%), Gaps = 0/285 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+S KP     VES NGRP +MD VAA+R+GEVLG  TVLKSD
Sbjct  558   YSILRRLLRRDPMGALGYSSSKPPLTKIVESANGRPQDMDVVAAMRNGEVLGRLTVLKSD  617

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPG H  +LPER+EGA NFREIPGFPVYGVANPTV GI +VIQ I +SK GRPV WHNM
Sbjct  618   HCPGSHSLNLPERVEGAPNFREIPGFPVYGVANPTVDGIRAVIQCISTSKGGRPVLWHNM  677

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKP+VLREVERP KNMLEYTGID +RVERMEARLK+DI+REAERY GAIMV
Sbjct  678   REEPVIYINGKPYVLREVERPCKNMLEYTGIDRDRVERMEARLKEDILREAERYGGAIMV  737

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET DG+IFD+WE+V +++V TPLEV+K L +EG PIKYAR+PITD KAPKSSDFDT+A
Sbjct  738   IHETDDGEIFDTWENVDNEAVLTPLEVYKNLVSEGLPIKYARVPITDGKAPKSSDFDTIA  797

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV  1256
              N+ +ASK TA VFNCQMG GRTTTGTVIACL+KLRID+GRPIR+
Sbjct  798   FNVTAASKGTAFVFNCQMGRGRTTTGTVIACLLKLRIDHGRPIRI  842


 Score =   189 bits (480),  Expect(2) = 5e-175, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT SIG+V   G +  D MP+SE+AI RGEY VIRSL+RVLEGGVEGK+QVDKVID+
Sbjct  420  GIPRTGSIGKVFYAGNDVDDYMPSSEEAILRGEYAVIRSLVRVLEGGVEGKRQVDKVIDK  479

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C SMQNLREAIATYRN+ILRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+   A   
Sbjct  480  CDSMQNLREAIATYRNNILRQPDEMKREASLSFFVEYLERYYFLICFAVYVHSVSSAHQT  539

Query  410  TSQV  421
            T  V
Sbjct  540  TLSV  543


 Score =   300 bits (767),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER  1552
             FGINDILLL KITRLFDNG+ECR+ LD +IDRCSALQNIRQAVL Y R+ NQQ  EPR R
Sbjct  885   FGINDILLLRKITRLFDNGIECRQTLDTVIDRCSALQNIRQAVLNYTRVINQQHVEPRVR  944

Query  1553  RVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIR  1732
             RVALNRGAEYLERY +LIAF+AYLGS+AFDGFCGQG++  +FK WL QRPE+Q MKWSIR
Sbjct  945   RVALNRGAEYLERYLKLIAFSAYLGSEAFDGFCGQGQTKISFKGWLQQRPEIQTMKWSIR  1004

Query  1733  LRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQI  1912
             LRPGRFFT+P E +  +    GD  ME IVK R+GSVLGKGSIL MYFFPGQ+ SS +  
Sbjct  1005  LRPGRFFTVPHEQKATYPPPQGDVTMETIVKARSGSVLGKGSILKMYFFPGQKRSSSVNF  1064

Query  1913  HGAPHVYKV  1939
              GAPHV KV
Sbjct  1065  RGAPHVIKV  1073


 Score =   260 bits (664),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 169/236 (72%), Gaps = 3/236 (1%)
 Frame = +3

Query  525   VAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILS  704
             V + R G VLG +T+LKSDH PGC +  L  +++GA N+R+     V+GVA PT+ GI +
Sbjct  179   VISSRGGSVLGKKTILKSDHFPGCQNKRLSPQIDGAPNYRQAGSLRVHGVAMPTMEGIAN  238

Query  705   VIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERM  878
             V+  IG+ K+G+   + WH++REE VIYING+PFVLR+VE+P+ N LEYTGI+ ERVE+M
Sbjct  239   VLNHIGAHKKGKQTRILWHSLREEPVIYINGRPFVLRDVEKPFSN-LEYTGINRERVEQM  297

Query  879   EARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIK  1058
             E RLK+DI++EA RY   I+V  E   GQ+ D WE V  D+V+TPLEV++ L+ +G+ + 
Sbjct  298   EFRLKEDILQEASRYGNKILVTDELPSGQMVDQWESVVYDTVKTPLEVYEELQHQGYLVD  357

Query  1059  YARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             Y R+PITD+KAPK  DFD L   I+     T +VFNCQMG GRTTTG VIA LV L
Sbjct  358   YERVPITDEKAPKEGDFDNLVRRISQVDIETEIVFNCQMGRGRTTTGMVIATLVYL  413


 Score = 77.4 bits (189),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 103/219 (47%), Gaps = 21/219 (10%)
 Frame = +2

Query  1289  SGDESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDR  1468
             +G++ D ++P     IL+              +  ++  + R+ + GVE +  +D +ID+
Sbjct  433   AGNDVDDYMPSSEEAILR-------------GEYAVIRSLVRVLEGGVEGKRQVDKVIDK  479

Query  1469  CSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGF  1648
             C ++QN+R+A+  YR    +Q  E  +R  +L+   EYLERY+ LI FA Y+ S      
Sbjct  480   CDSMQNLREAIATYRNNILRQPDE-MKREASLSFFVEYLERYYFLICFAVYVHS-VSSAH  537

Query  1649  CGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP----GRFFTIPEELRTPHELKHGDAVME  1813
                     +F  W+  RPE+ + ++  +R  P    G   + P   +           M+
Sbjct  538   QTTLSVEVSFSDWMRARPELYSILRRLLRRDPMGALGYSSSKPPLTKIVESANGRPQDMD  597

Query  1814  AIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQ-IHGAPH  1927
              +   RNG VLG+ ++L     PG  + +  + + GAP+
Sbjct  598   VVAAMRNGEVLGRLTVLKSDHCPGSHSLNLPERVEGAPN  636


 Score =   138 bits (348),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 135/266 (51%), Gaps = 34/266 (13%)
 Frame = +3

Query  468   PSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFRE  647
             P P  DV         M+ +   RSG VLG  ++LK    PG       ++   ++NFR 
Sbjct  1022  PPPQGDVT--------METIVKARSGSVLGKGSILKMYFFPG-------QKRSSSVNFRG  1066

Query  648   IP------GFPVYGVANPTVSGILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGK  794
              P      G+PVY +A PT+ G   V+  +GS         + V   ++REE V+YI G 
Sbjct  1067  APHVIKVDGYPVYSMATPTIDGASDVLSYLGSKDTTGRNIAQKVVVTDLREEVVVYIKGS  1126

Query  795   PFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHE-----TAD  959
             PFVLRE+++P  + L++ GI    VE +E RLK+DI+ E ++  G +++  E     T  
Sbjct  1127  PFVLRELDQPV-DTLKHVGISGPMVENIETRLKEDILSEVKQLGGRLLLHQEEFNAATNQ  1185

Query  960   GQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASA  1139
               +   WEH+  + V TP EV+  L  +G+ I+Y RIP+T ++   ++D D +  +I  +
Sbjct  1186  CSVVGYWEHIDLEDVMTPAEVYSTLRDKGYCIEYKRIPLTREREALAADVDAIQSSIDES  1245

Query  1140  SKYTALVFNCQMGIGRTTTGTVIACL  1217
             ++Y   +F    G G       I CL
Sbjct  1246  ARY--YLFISHTGYGGVAYAMAITCL  1269


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + G+E ++ +D VIDRC+++QN+R+A+  Y   I +Q  E + R  AL+  
Sbjct  892  LLRKITRLFDNGIECRQTLDTVIDRCSALQNIRQAVLNYTRVINQQHVEPRVRRVALNRG  951

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI F+ YL +E
Sbjct  952  AEYLERYLKLIAFSAYLGSE  971


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 13/118 (11%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVA-----  1561
             +  +TR+  +G + +E +D +IDRCS   ++R+ ++ YR+       +  +         
Sbjct  1314  ILNLTRVLVHGPKSKEEVDTVIDRCSGAGHLREDIMHYRKALQDCSHDDDDDCDEEHSYL  1373

Query  1562  LNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + G + L RYF LI F +YL S             TTF  W+  RPE+  +  +++L
Sbjct  1374  TDMGTKALRRYFFLITFRSYLYSTT--------SCKTTFTSWMKARPELGHLCDNLKL  1423


 Score = 54.7 bits (130),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 6/126 (5%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             VS+  A    I   ++ A+++G+Y  I +L RVL  G + K++VD VIDRC+   +LRE 
Sbjct  1288  VSTSLAKNVSIKTKTDIALKQGDYRDILNLTRVLVHGPKSKEEVDTVIDRCSGAGHLRED  1347

Query  260   IATYRNSILRQPDEMKREAA------LSFFVEYLERY*FLICFAVYLHTERDALHPTSQV  421
             I  YR ++     +   +             + L RY FLI F  YL++        +  
Sbjct  1348  IMHYRKALQDCSHDDDDDCDEEHSYLTDMGTKALRRYFFLITFRSYLYSTTSCKTTFTSW  1407

Query  422   AEKRPD  439
              + RP+
Sbjct  1408  MKARPE  1413



>emb|CDY33295.1| BnaA01g19620D [Brassica napus]
Length=1102

 Score =   418 bits (1074),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 213/329 (65%), Positives = 253/329 (77%), Gaps = 11/329 (3%)
 Frame = +3

Query  312   KQHFPFLWSIWKDISSLFV----LLYISTQNEMH-----FTLLRRLLRRDPMGALGYASL  464
             + +F   +S++ D    F+    L ++S  + M      + +LRR LRRD MGAL  A++
Sbjct  306   RYYFLICFSVYLDSEGAFLQTGSLDHVSFADWMQARPELYGILRRFLRRDHMGAL--AAM  363

Query  465   KPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFR  644
             KPS     EST+GRP EM +VAALRSG VLGSQTVLKSDH  GC + SL ER++GA NFR
Sbjct  364   KPSLTKVEESTDGRPHEMSEVAALRSGLVLGSQTVLKSDHSHGCRNASLRERVDGAPNFR  423

Query  645   EIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERP  824
             E+PGF VYGVANPTV GI SVI+R+ S +  RPVFWHN+REE VIYING PFV+REVERP
Sbjct  424   EVPGFAVYGVANPTVDGIRSVIERVWSLRGRRPVFWHNLREEPVIYINGIPFVIREVERP  483

Query  825   YKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSV  1004
             YKNML Y G D   VE +EA LK+DI+REA RY+GAIMVIHET D  +FD WEHV + SV
Sbjct  484   YKNMLGYKGTDRYTVEGVEALLKEDILREAIRYNGAIMVIHETEDQNVFDCWEHVDAYSV  543

Query  1005  QTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIG  1184
             QTPLEVFK LE EGFP+KY R+P+TD KAP+SSDFDTL  NIASASK TA VFNCQ+G G
Sbjct  544   QTPLEVFKNLETEGFPVKYTRVPVTDGKAPRSSDFDTLTWNIASASKDTAFVFNCQIGRG  603

Query  1185  RTTTGTVIACLVKLRIDYGRPIRVLNDAL  1271
             RTTTGTVIACLVKLR++YGRPI+VL D++
Sbjct  604   RTTTGTVIACLVKLRMNYGRPIKVLTDSI  632


 Score =   224 bits (570),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 138/181 (76%), Gaps = 14/181 (8%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER  1552
             FG++DILLL K T LFDNGVE REALDA+IDRCSA+QNIR+AVL YR++FNQQ  EPR R
Sbjct  648   FGMDDILLLRKFTTLFDNGVESREALDAVIDRCSAVQNIREAVLHYRKVFNQQHVEPRLR  707

Query  1553  RVALNRGAEYLERYFRLIAFAAYLGSDAFD-GFCGQGESMTTFKHWLHQRPEVQAMKWSI  1729
               AL R AEYLERYF LI FAAY+GS+  D  F   G     +K+WLH++PEVQA+KWS+
Sbjct  708   NAALKRSAEYLERYFWLITFAAYIGSENLDVAFVKGG-----YKNWLHEKPEVQALKWSV  762

Query  1730  RLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQ  1909
             R+RPGRFFTIPEEL++    + GDAV E+I+  R+GSVL KGSIL       QRTSS +Q
Sbjct  763   RVRPGRFFTIPEELQS----RQGDAVTESIINKRSGSVLCKGSILK----KCQRTSSRLQ  814

Query  1910  I  1912
             I
Sbjct  815   I  815


 Score =   152 bits (384),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +2

Query  68   SIGRVSSCGANATDIMPNSE-DAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQ  244
            S   + + G N T  +PNSE D IRRGEY VI+SLIRVLEGGV+GK+QVD  IDRCAS+Q
Sbjct  212  STNLIFTTGRNITYDLPNSEEDKIRRGEYAVIKSLIRVLEGGVKGKRQVDNAIDRCASIQ  271

Query  245  NLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTE  391
            NLREAI TY +SIL QPDE KREAA+S FVEYLERY FLICF+VYL +E
Sbjct  272  NLREAIPTYSSSILHQPDEKKREAAVSLFVEYLERYYFLICFSVYLDSE  320


 Score =   125 bits (315),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 103/168 (61%), Gaps = 10/168 (6%)
 Frame = +3

Query  525   VAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILS  704
             +  +R G +LG + +LKSD+ P C + S+  R+E A N+ +     V+GVA PT  GI +
Sbjct  1     MTKVRDGLLLGKKMILKSDYLPACQNKSVNPRIETAPNYHQARSLHVHGVAMPTAVGIRN  60

Query  705   VIQRIGSSKEGR--PVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERM  878
             ++  IG+ K      V W ++REE VIYINGKPFVLR+++ P+ NM    G+    V++M
Sbjct  61    LLDHIGAHKASNQVQVLWISLREEPVIYINGKPFVLRDLDNPFTNM----GMKRLNVDQM  116

Query  879   EARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEV  1022
             E  L+ D    A R+   I+V  E  DG++ D WE VS++S++T LEV
Sbjct  117   EEDLRGD----ASRHGNKILVTDELPDGEMVDQWEPVSNESLKTMLEV  160


 Score = 74.3 bits (181),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 92/187 (49%), Gaps = 8/187 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GV+ +  +D  IDRC+++QN+R+A+  Y      Q  E ++R  A++  
Sbjct  242   VIKSLIRVLEGGVKGKRQVDNAIDRCASIQNLREAIPTYSSSILHQPDE-KKREAAVSLF  300

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGE-SMTTFKHWLHQRPEVQAM--KWSIRLRPG  1744
              EYLERY+ LI F+ YL S+    F   G     +F  W+  RPE+  +  ++  R   G
Sbjct  301   VEYLERYYFLICFSVYLDSEG--AFLQTGSLDHVSFADWMQARPELYGILRRFLRRDHMG  358

Query  1745  RFFTIPEELRTPHELKHGDA-VMEAIVKDRNGSVLGKGSILTMYFFPGQRTSS-HIQIHG  1918
                 +   L    E   G    M  +   R+G VLG  ++L      G R +S   ++ G
Sbjct  359   ALAAMKPSLTKVEESTDGRPHEMSEVAALRSGLVLGSQTVLKSDHSHGCRNASLRERVDG  418

Query  1919  APHVYKV  1939
             AP+  +V
Sbjct  419   APNFREV  425


 Score = 67.4 bits (163),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R    + + GVE ++ +D VIDRC+++QN+REA+  YR    +Q  E + R AAL   
Sbjct  655  LLRKFTTLFDNGVESREALDAVIDRCSAVQNIREAVLHYRKVFNQQHVEPRLRNAALKRS  714

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY +LI FA Y+ +E
Sbjct  715  AEYLERYFWLITFAAYIGSE  734


 Score = 55.1 bits (131),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 60/118 (51%), Gaps = 14/118 (12%)
 Frame = +3

Query  714   RIGSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLK  893
             +I    EG  V    +REE  +YING PFVLRE+ +P  ++L + GI    VE     LK
Sbjct  814   QIDEEGEGSTV---TIREEAHVYINGIPFVLRELHKPV-DILTHVGIAGVVVETW---LK  866

Query  894   DDIMREAERYHGAIMVIHE------TADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGF  1049
             +DI+ E  R  G  M++H       +   Q+   WE++  + V+T  E++   E +  
Sbjct  867   EDILSEV-RETGGRMLLHREEYSTASNQSQVIGYWEYIQPEDVKTSAEIYAAQERDAL  923



>ref|XP_003562330.1| PREDICTED: paladin [Brachypodium distachyon]
Length=1261

 Score =   458 bits (1178),  Expect(2) = 1e-173, Method: Compositional matrix adjust.
 Identities = 216/285 (76%), Positives = 251/285 (88%), Gaps = 0/285 (0%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSD  581
             +++LRRLLRRDPMGALGY+S KPS    +ES +GRP EMD VAA+R+GEVLG QTVLKSD
Sbjct  394   YSILRRLLRRDPMGALGYSSSKPSLPKIIESADGRPHEMDVVAAMRNGEVLGRQTVLKSD  453

Query  582   HCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNM  761
             HCPGC + +LPER+EGA NFREIPGF VYGVANPTV GI +VIQR+ +SK  RP+ WHNM
Sbjct  454   HCPGCQNLNLPERVEGAPNFREIPGFSVYGVANPTVDGIRAVIQRVSTSKGRRPILWHNM  513

Query  762   REEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMV  941
             REE VIYINGKPFVLREVERPYKNMLEYTGI  +RVERMEARLK+DI+REAERY GAIMV
Sbjct  514   REEPVIYINGKPFVLREVERPYKNMLEYTGIGRDRVERMEARLKEDILREAERYDGAIMV  573

Query  942   IHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLA  1121
             IHET +G+IFD+WE+VS+D+V TPLEV+K L++EG PIKYAR+PITD KAPKSSDFDT+A
Sbjct  574   IHETDNGEIFDAWENVSTDAVLTPLEVYKRLDSEGLPIKYARVPITDGKAPKSSDFDTIA  633

Query  1122  LNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV  1256
             LN+A+A K  A VFNCQMG GRTTTGTVIACL++LRID+GR IR+
Sbjct  634   LNVAAACKDAAFVFNCQMGRGRTTTGTVIACLLRLRIDHGRSIRM  678


 Score =   182 bits (462),  Expect(2) = 1e-173, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT+SIG+V     +  D  P+SE+AI RGEY VIRSL+RVLEGGVEGK+QVDKVID+
Sbjct  257  GIPRTSSIGKVFYAVNDVDDFSPSSEEAILRGEYAVIRSLVRVLEGGVEGKRQVDKVIDK  316

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C SMQNLREAIATYR+S LRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+   A   
Sbjct  317  CDSMQNLREAIATYRSSTLRQPDEMKREASLSFFVEYLERYYFLICFAVYVHSVSSAHQA  376

Query  410  TS  415
            TS
Sbjct  377  TS  378


 Score =   303 bits (775),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER  1552
             F INDILLL KITRLFDNGVECR  LD +ID+CSALQNIRQAVLQY ++ NQQ  EPR R
Sbjct  723   FDINDILLLRKITRLFDNGVECRHILDTVIDKCSALQNIRQAVLQYTKVINQQNMEPRVR  782

Query  1553  RVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIR  1732
             RVALNRGAEYLERY +LIAF+AYLGS+AFDGFCGQGE+  +FK+WL QRPE+Q MKWSIR
Sbjct  783   RVALNRGAEYLERYLKLIAFSAYLGSEAFDGFCGQGETKISFKNWLQQRPEIQTMKWSIR  842

Query  1733  LRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQI  1912
             LRPGRFFT+P+E +   +   GD  MEAIVK RNGSVLGKGSIL MYFFPGQR SS +  
Sbjct  843   LRPGRFFTVPDEPKATCQPPQGDVTMEAIVKARNGSVLGKGSILKMYFFPGQRRSSSMNF  902

Query  1913  HGAPHVYKV  1939
              GAPHV KV
Sbjct  903   RGAPHVIKV  911


 Score =   268 bits (685),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 173/238 (73%), Gaps = 3/238 (1%)
 Frame = +3

Query  519   DQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGI  698
             +QV + R G VLG +T+LKSDH PGC +  L   ++GA N+R+     V+GVA PT+ GI
Sbjct  14    EQVISSRGGSVLGKKTILKSDHFPGCQNKRLTPHIDGAPNYRQAGSLRVHGVAMPTMKGI  73

Query  699   LSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVE  872
             ++V+  IG+ K+G+   V WH++REE VIYING+PFVLR+VERP+ N LEYTGI+ ERVE
Sbjct  74    VNVLNHIGAQKKGKQTRVLWHSLREEPVIYINGRPFVLRDVERPFSN-LEYTGINRERVE  132

Query  873   RMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFP  1052
             +ME RLK+DI++EA RY   I+V  E  +GQ+ D WE V SD+V+TPLEV++ L+ +G+ 
Sbjct  133   QMEFRLKEDILQEASRYGNKILVTDELPNGQMVDQWESVMSDTVKTPLEVYEELQHQGYL  192

Query  1053  IKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKL  1226
             + Y R+PITD+KAPK  DFD L   I+     T +VFNCQMG GRTTTG VI+ LV L
Sbjct  193   VDYERVPITDEKAPKEGDFDNLVRRISQVDIETEIVFNCQMGRGRTTTGMVISTLVYL  250


 Score =   143 bits (361),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 133/250 (53%), Gaps = 26/250 (10%)
 Frame = +3

Query  516   MDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIP------GFPVYGVA  677
             M+ +   R+G VLG  ++LK    PG       +R   ++NFR  P      G+PVY +A
Sbjct  868   MEAIVKARNGSVLGKGSILKMYFFPG-------QRRSSSMNFRGAPHVIKVDGYPVYSMA  920

Query  678   NPTVSGILSVIQRIGSSKE-----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLE  842
              PTV G   V+  +GS         + V   ++REE V+YI G PFVLRE+++P  + L+
Sbjct  921   TPTVDGARDVLSYLGSKDTTGRSIAQKVVVTDIREEVVVYIKGTPFVLRELDQPV-DTLK  979

Query  843   YTGIDCERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQ  1007
             + GI    VE +EARLK+DI+ E ++  G +++  E     T    +   WEH+  + V 
Sbjct  980   HVGISGPMVENIEARLKEDILSEVKQLDGRLLLHQEEINTTTNQCSVLGYWEHIDLEDVM  1039

Query  1008  TPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGR  1187
             TP EV+  L A+G+ I Y RIP+T ++   ++D D++  +I  +++Y   +F    G G 
Sbjct  1040  TPAEVYSTLRAQGYCIDYKRIPLTREREALAADVDSIQSSIDESARY--YLFISHTGYGG  1097

Query  1188  TTTGTVIACL  1217
                   I CL
Sbjct  1098  VAYAMAITCL  1107


 Score = 81.3 bits (199),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 97/188 (52%), Gaps = 9/188 (5%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID+C ++QN+R+A+  YR    +Q  E + R  +L+  
Sbjct  292   VIRSLVRVLEGGVEGKRQVDKVIDKCDSMQNLREAIATYRSSTLRQPDEMK-REASLSFF  350

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP-GR  1747
              EYLERY+ LI FA Y+ S +        E   +F  W+  RPE+ + ++  +R  P G 
Sbjct  351   VEYLERYYFLICFAVYVHSVSSAHQATSSE--VSFSDWMRARPELYSILRRLLRRDPMGA  408

Query  1748  FFTIPEELRTPHELKHGDA---VMEAIVKDRNGSVLGKGSILTMYFFPG-QRTSSHIQIH  1915
                   +   P  ++  D     M+ +   RNG VLG+ ++L     PG Q  +   ++ 
Sbjct  409   LGYSSSKPSLPKIIESADGRPHEMDVVAAMRNGEVLGRQTVLKSDHCPGCQNLNLPERVE  468

Query  1916  GAPHVYKV  1939
             GAP+  ++
Sbjct  469   GAPNFREI  476


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + GVE +  +D VID+C+++QN+R+A+  Y   I +Q  E + R  AL+  
Sbjct  730  LLRKITRLFDNGVECRHILDTVIDKCSALQNIRQAVLQYTKVINQQNMEPRVRRVALNRG  789

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI F+ YL +E
Sbjct  790  AEYLERYLKLIAFSAYLGSE  809


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = +2

Query  80    VSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREA  259
             VS+    +  +  +++ A+R+G+Y  I +L R L  G + K++VD+VIDRC    +LRE 
Sbjct  1126  VSTYLTKSVSVKTSTDIALRQGDYRDILNLTRALVHGPKSKEEVDRVIDRCIGAGHLRED  1185

Query  260   IATYRNSILRQPDEMKREAALSFFVEY----LERY*FLICFAVYLH  385
             I  YR ++     +   + A S+ ++     L RY FLI F  YL+
Sbjct  1186  ILQYRKALRDCSHDDDDDEAWSYLMDMGTKALRRYFFLITFRSYLY  1231



>gb|KHG09004.1| Paladin [Gossypium arboreum]
Length=709

 Score =   363 bits (931),  Expect(2) = 3e-160, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +2

Query  1337  LKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRR  1516
             ++ R + +  + FGI+DILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYR+
Sbjct  159   VEVRTRTEQGYAFGIDDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRK  218

Query  1517  LFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQ  1696
             +FNQQ  EPR RRVALNRGAEYLERYFRLIAF+AYLGS+AFDGFCGQGE M TFK WLHQ
Sbjct  219   VFNQQHVEPRVRRVALNRGAEYLERYFRLIAFSAYLGSEAFDGFCGQGECMMTFKSWLHQ  278

Query  1697  RPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYF  1876
             RPEVQAMKWSIRLRPGRFF +PEELR PHE +HGDAVMEAIVK RNGSVLGKGSIL MYF
Sbjct  279   RPEVQAMKWSIRLRPGRFFNVPEELRAPHESQHGDAVMEAIVKARNGSVLGKGSILKMYF  338

Query  1877  FPGQRTSSHIQIHGAPHVYKV  1939
             FPGQ TSS IQIHGAPHV+KV
Sbjct  339   FPGQITSSRIQIHGAPHVFKV  359


 Score =   233 bits (593),  Expect(2) = 3e-160, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  876   MEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPI  1055
             MEARLK+DI+REAERY GAIMVIHET DGQIFD+WEHV+SDS+QTPLEVFKCLE +GFPI
Sbjct  1     MEARLKEDILREAERYDGAIMVIHETDDGQIFDAWEHVNSDSLQTPLEVFKCLEDDGFPI  60

Query  1056  KYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRID  1235
             KYAR+PITD KAPKSSDFDT+A NIASASK TA VFNCQMG GRTTTG VIACLVKLRI 
Sbjct  61    KYARVPITDGKAPKSSDFDTVAANIASASKDTAFVFNCQMGRGRTTTGAVIACLVKLRIS  120

Query  1236  YGRPIRVLNDALHEE  1280
             YGRPI+VL D +  E
Sbjct  121   YGRPIKVLLDEVKHE  135


 Score =   133 bits (334),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/303 (31%), Positives = 152/303 (50%), Gaps = 22/303 (7%)
 Frame = +3

Query  387   QNEMHFTLLRRLLRRDPMGALGYA-SLKPSPANDVESTNGRPSE-------MDQVAALRS  542
             Q E   T    L +R  + A+ ++  L+P    +V      P E       M+ +   R+
Sbjct  265   QGECMMTFKSWLHQRPEVQAMKWSIRLRPGRFFNVPEELRAPHESQHGDAVMEAIVKARN  324

Query  543   GEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIG  722
             G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PT+ G   ++  +G
Sbjct  325   GSVLGKGSILKMYFFPG-QITSSRIQIHGAPHVFKVNGYPVYSMATPTIIGAKEMLAYLG  383

Query  723   SSKE----GRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARL  890
             +       G+ V   ++REE V+YI+G PFVLRE+ +P  + L++ GI    VE MEARL
Sbjct  384   AKSNARVAGQKVVITDLREEAVVYIHGTPFVLRELNKPV-DTLKHVGITGPVVENMEARL  442

Query  891   KDDIMREAERYHGAIMVIH------ETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFP  1052
             K+DI+ E  R  G  M++H       +    +   WE++  D V+TP EV+  L+ EG+ 
Sbjct  443   KEDILSEV-RQSGGRMLLHREEYCPSSNQSSVVGYWENIFPDDVKTPAEVYAALKDEGYN  501

Query  1053  IKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRI  1232
             I Y RIP+T ++   +SD D +       S     V +   G G   T  +I C +   +
Sbjct  502   IAYGRIPLTREREALASDVDEIQNCRDEPSACYLYVSHTGFG-GVAYTMAIICCRLDAEV  560

Query  1233  DYG  1241
             ++G
Sbjct  561   NFG  563


 Score = 62.8 bits (151),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  167  LIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFFVEYL  343
            + R+ + GVE ++ +D +IDRC+++QN+R+A+  YR    +Q  E + R  AL+   EYL
Sbjct  182  ITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRKVFNQQHVEPRVRRVALNRGAEYL  241

Query  344  ERY*FLICFAVYLHTE  391
            ERY  LI F+ YL +E
Sbjct  242  ERYFRLIAFSAYLGSE  257


 Score = 77.4 bits (189),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             V ++  RCAGAGH+R+DI++++KEL++  DDDDEHRAYLMDMGI+ALR
Sbjct  619   VDIIIERCAGAGHIRDDILHYSKELEEVADDDDEHRAYLMDMGIKALR  666


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 61/118 (52%), Gaps = 12/118 (10%)
 Frame = +2

Query  1385  DILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVAL  1564
             DIL L   TR+  +G + +  +D II+RC+   +IR  +L Y +   +   +  E R  L
Sbjct  601   DILSL---TRVLMHGPKSKADVDIIIERCAGAGHIRDDILHYSKELEEVADDDDEHRAYL  657

Query  1565  -NRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
              + G + L RYF LI F +YL       +C +  + T F  W+  RPE+  +  ++R+
Sbjct  658   MDMGIKALRRYFFLITFRSYL-------YC-KSPTETKFTSWMDARPELGHLCNNLRI  707


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = +2

Query  119  NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSI--LRQ  292
            + E+A R G+Y  I SL RVL  G + K  VD +I+RCA   ++R+ I  Y   +  +  
Sbjct  589  SEEEARRMGDYRDILSLTRVLMHGPKSKADVDIIIERCAGAGHIRDDILHYSKELEEVAD  648

Query  293  PDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPD  439
             D+  R   +   ++ L RY FLI F  YL+ +       +   + RP+
Sbjct  649  DDDEHRAYLMDMGIKALRRYFFLITFRSYLYCKSPTETKFTSWMDARPE  697



>ref|XP_001766909.1| predicted protein [Physcomitrella patens]
 gb|EDQ68311.1| predicted protein [Physcomitrella patens]
Length=1264

 Score =   407 bits (1045),  Expect(2) = 2e-155, Method: Compositional matrix adjust.
 Identities = 196/290 (68%), Positives = 235/290 (81%), Gaps = 9/290 (3%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYAS-----LKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQT  566
             +++LRRLLRRDPMGALGY++     +K SP    ++ +GRPS+M+ V A R+GEVLG +T
Sbjct  389   YSILRRLLRRDPMGALGYSNTPVGVIKMSP----KAADGRPSKMEYVVASRNGEVLGRRT  444

Query  567   VLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPV  746
             +LKSDHCPGC    LPE L+GA NFRE+ GFPVYGVANPT+ GI +V+QR+G     RPV
Sbjct  445   MLKSDHCPGCQSQYLPELLDGAPNFREVGGFPVYGVANPTIDGIRAVLQRVGEGSSERPV  504

Query  747   FWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYH  926
              WHNMREE V+YINGKPFVLREVERPYKNMLEY GI+  RVE+MEARLK+DI+REAERY 
Sbjct  505   LWHNMREEPVVYINGKPFVLREVERPYKNMLEYEGIERARVEQMEARLKEDILREAERYS  564

Query  927   GAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSD  1106
             GAIMV HE  DGQIFDSWE V   +VQTPLEV++CL+AEG+ ++YAR+PITD KAPKSSD
Sbjct  565   GAIMVNHEMDDGQIFDSWEPVGPGAVQTPLEVYECLKAEGYQVEYARVPITDGKAPKSSD  624

Query  1107  FDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPIRV  1256
             F  LA  IA+A++ TA VFNCQMG GRTTTG VIACLV LR +YG P+R+
Sbjct  625   FGALASRIATATRDTAFVFNCQMGRGRTTTGMVIACLVLLRCEYGIPLRM  674


 Score =   172 bits (437),  Expect(2) = 2e-155, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G+PR++S+G +          +P++E+A+RRGEYTVIRSLIRVLEGGVEGK+QVDKVID 
Sbjct  250  GLPRSSSMGTIHEARDEMLHDVPDTEEALRRGEYTVIRSLIRVLEGGVEGKRQVDKVIDS  309

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDAL  403
            C++MQNLREAIA YRNSI+RQ DE KREA LSFFVEYLERY FLICFAVY+HT++ +L
Sbjct  310  CSAMQNLREAIAGYRNSIVRQADEKKREAGLSFFVEYLERYYFLICFAVYIHTDKTSL  367


 Score =   279 bits (714),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 172/240 (72%), Gaps = 2/240 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E + V   R G VLG +T+LKSDH PGC +  L   +EGA N+R++   PVYGVA PTV 
Sbjct  6     EPENVIVSRQGSVLGKKTILKSDHFPGCQNKRLLPHVEGAPNYRQVGNKPVYGVAIPTVD  65

Query  693   GILSVIQRIGSSK-EGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERV  869
             GI  V++ IG+ K E + V WHN+REE VIY+NG+PFVLREVERP+ N LEYTGI+ +RV
Sbjct  66    GIRRVLELIGAGKYESQRVLWHNLREEPVIYVNGRPFVLREVERPFTN-LEYTGINRQRV  124

Query  870   ERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGF  1049
             E+MEARLK D+++EA RY   IMV  E  DGQ+ D WE V  DS+QTP EV+  L+AEG+
Sbjct  125   EQMEARLKVDVLQEAARYSNKIMVSDELPDGQMIDQWEPVGPDSIQTPFEVYVSLQAEGY  184

Query  1050  PIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLR  1229
             P+ Y RIPITD+K+PK  DFD+L    +     T LVFNCQMG GRTTTG VIA L+ L+
Sbjct  185   PVDYERIPITDEKSPKERDFDSLVHRFSQVDVETKLVFNCQMGRGRTTTGMVIATLIHLQ  244


 Score =   249 bits (637),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 145/190 (76%), Gaps = 2/190 (1%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER  1552
             F ++DI ++ KITRL DNG ECREALD++ID C+A+QN+RQAVL YRR FN Q+ E   R
Sbjct  716   FVMDDIPIVRKITRLLDNGAECREALDSVIDHCAAMQNLRQAVLHYRRAFNDQKLEHHAR  775

Query  1553  RVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIR  1732
             R ALNRG EYLERY  LIAFAAYL S +FDG+C QG S TTFK WLH+ PEV+ MKWS+R
Sbjct  776   RAALNRGIEYLERYLMLIAFAAYLNSSSFDGYC-QGGSGTTFKAWLHRHPEVRQMKWSMR  834

Query  1733  LRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSS-HIQ  1909
             LRP R FTI  E +   E    D+VMEA+VK R GS+LGK S+L MYFFPGQ+T+S H+ 
Sbjct  835   LRPTRVFTINIEFKVHGENNQEDSVMEAVVKSRTGSILGKHSLLKMYFFPGQKTTSDHVP  894

Query  1910  IHGAPHVYKV  1939
             I GAPHV KV
Sbjct  895   ITGAPHVCKV  904


 Score =   143 bits (360),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/249 (34%), Positives = 132/249 (53%), Gaps = 9/249 (4%)
 Frame = +3

Query  495   TNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGV  674
              N   S M+ V   R+G +LG  ++LK    PG    S    + GA +  ++ GFPV+ +
Sbjct  853   NNQEDSVMEAVVKSRTGSILGKHSLLKMYFFPGQKTTSDHVPITGAPHVCKVEGFPVHSM  912

Query  675   ANPTVSGILSVIQRIG---SSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEY  845
             A PT+ G  +V+  +    SS   R     ++REE V+Y++  PFVLREV++P  + L++
Sbjct  913   ATPTIEGAKAVLTHLCAGPSSGMQRKAVVTDLREEVVVYVHDNPFVLREVDQP-ASTLKH  971

Query  846   TGIDCERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQT  1010
              G+    VE+ME+RLK+DI+ E ER  G +++  E     T    I   WE +S++ VQT
Sbjct  972   VGVKAHVVEQMESRLKEDILAEVERTGGRMLLHREEYSVITGHSDIIGYWEVISAEDVQT  1031

Query  1011  PLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRT  1190
             P E++  L AEG+ + Y RIP+T ++A  ++D D +   +  A       F    G G  
Sbjct  1032  PAEMYANLRAEGYNLDYQRIPLTRERAAVTADVDAIHRRLDEAGSGVEYCFISHTGFGGV  1091

Query  1191  TTGTVIACL  1217
                  + CL
Sbjct  1092  AYAMAMTCL  1100


 Score = 85.5 bits (210),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 97/189 (51%), Gaps = 8/189 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID CSA+QN+R+A+  YR    +Q  E ++R   L+  
Sbjct  285   VIRSLIRVLEGGVEGKRQVDKVIDSCSAMQNLREAIAGYRNSIVRQADE-KKREAGLSFF  343

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRPG--  1744
              EYLERY+ LI FA Y+ +D              F+ W+  RPE+ + ++  +R  P   
Sbjct  344   VEYLERYYFLICFAVYIHTDKTSLGSSHRSGAGGFEQWMRARPELYSILRRLLRRDPMGA  403

Query  1745  -RFFTIPEEL--RTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQ-I  1912
               +   P  +   +P       + ME +V  RNG VLG+ ++L     PG ++    + +
Sbjct  404   LGYSNTPVGVIKMSPKAADGRPSKMEYVVASRNGEVLGRRTMLKSDHCPGCQSQYLPELL  463

Query  1913  HGAPHVYKV  1939
              GAP+  +V
Sbjct  464   DGAPNFREV  472


 Score = 72.4 bits (176),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDE-MKREAALSFF  331
            ++R + R+L+ G E ++ +D VID CA+MQNLR+A+  YR +   Q  E   R AAL+  
Sbjct  723  IVRKITRLLDNGAECREALDSVIDHCAAMQNLRQAVLHYRRAFNDQKLEHHARRAALNRG  782

Query  332  VEYLERY*FLICFAVYLHT  388
            +EYLERY  LI FA YL++
Sbjct  783  IEYLERYLMLIAFAAYLNS  801


 Score = 64.7 bits (156),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 66/133 (50%), Gaps = 5/133 (4%)
 Frame = +2

Query  1346  RPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFN  1525
             RP  D +  F   D   +  +TR+  +G   ++ +D +IDRC+   ++R  +  Y    N
Sbjct  1135  RPA-DDTEAFRQGDYRDILSLTRVLASGPASKDEVDVVIDRCAVAGHLRDDIFDYMCQLN  1193

Query  1526  QQRTEPRERRV-ALNRGAEYLERYFRLIAFAAYLGSD-AFDGFCGQGESMTTFKHWLHQR  1699
                    ERR   L+ G   L RYF LIAF +YL S  A  G    GE  T+F  W+  R
Sbjct  1194  HFTNLEDERRYNVLDMGVNALRRYFFLIAFRSYLFSRVALHGNACAGE--TSFSDWMKAR  1251

Query  1700  PEVQAMKWSIRLR  1738
             PE+  +  +++L+
Sbjct  1252  PELGHLYDNLKLK  1264


 Score = 60.5 bits (145),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 54/106 (51%), Gaps = 5/106 (5%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYR---NSILR  289
             +  +A R+G+Y  I SL RVL  G   K +VD VIDRCA   +LR+ I  Y    N    
Sbjct  1138  DDTEAFRQGDYRDILSLTRVLASGPASKDEVDVVIDRCAVAGHLRDDIFDYMCQLNHFTN  1197

Query  290   QPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAE  427
               DE +R   L   V  L RY FLI F  YL + R ALH  +   E
Sbjct  1198  LEDE-RRYNVLDMGVNALRRYFFLIAFRSYLFS-RVALHGNACAGE  1241



>gb|EPS73348.1| hypothetical protein M569_01409, partial [Genlisea aurea]
Length=715

 Score =   339 bits (870),  Expect(2) = 1e-152, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 179/214 (84%), Gaps = 0/214 (0%)
 Frame = +2

Query  1298  ESDGHVPPYAPLILKTRPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSA  1477
             ++D   P   PL  K+   +     FGINDILLL KITRLFDNGV CRE LD +IDRCSA
Sbjct  151   DTDKTYPRLLPLPEKSSAVESCDDSFGINDILLLSKITRLFDNGVACREVLDYVIDRCSA  210

Query  1478  LQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQ  1657
             LQNIRQAVLQYR+L+NQQ  EPRERRVALNRGAEYLERY RLIAFAAYLGS+AFD FCGQ
Sbjct  211   LQNIRQAVLQYRQLYNQQHVEPRERRVALNRGAEYLERYSRLIAFAAYLGSEAFDCFCGQ  270

Query  1658  GESMTTFKHWLHQRPEVQAMKWSIRLRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNG  1837
             GES  TFK WLHQ+ EVQ+MKWSIRLRPG+F T+PEELR PHE +HGDAVMEA + +RNG
Sbjct  271   GESRITFKDWLHQKREVQSMKWSIRLRPGQFLTVPEELRAPHESQHGDAVMEAAINNRNG  330

Query  1838  SVLGKGSILTMYFFPGQRTSSHIQIHGAPHVYKV  1939
             SVLGKGSIL MYFFPGQ+TSSH+QI GAPHV+KV
Sbjct  331   SVLGKGSILKMYFFPGQKTSSHVQIPGAPHVHKV  364


 Score =   230 bits (587),  Expect(2) = 1e-152, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = +3

Query  849   GIDCERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFK  1028
             GIDCERVERME+RLKDDI+REAE+Y GAIMVIHET DG+I  +WE VS +SVQTPLEVF+
Sbjct  1     GIDCERVERMESRLKDDILREAEQYQGAIMVIHETEDGKISVAWEQVSLNSVQTPLEVFR  60

Query  1029  CLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVI  1208
             C E  G+PIKYAR+PITD KAPK+SDFDTL  NI SASK TA VFNCQMGIGRTTTGTVI
Sbjct  61    CFETYGYPIKYARVPITDGKAPKASDFDTLVSNILSASKDTAFVFNCQMGIGRTTTGTVI  120

Query  1209  ACLVKLRIDYGRPIRVL-NDALHEELS  1286
             ACL+KLRID GRPI+V+ +D   +ELS
Sbjct  121   ACLLKLRIDCGRPIQVIADDCTPKELS  147


 Score =   125 bits (313),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 132/253 (52%), Gaps = 20/253 (8%)
 Frame = +3

Query  537   RSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQR  716
             R+G VLG  ++LK    PG    S   ++ GA +  ++ G+PVY +A PTV+G   +I  
Sbjct  328   RNGSVLGKGSILKMYFFPG-QKTSSHVQIPGAPHVHKVDGYPVYSMATPTVAGAKEMISF  386

Query  717   IGS--SKEG----RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERM  878
             +G   + EG      V   ++REE V+YING PFVLRE+  P  + L++ G+    VE M
Sbjct  387   LGGMLTSEGGGAAEKVVLTDLREEAVVYINGIPFVLRELSNPV-DTLKHVGVTGPAVEHM  445

Query  879   EARLKDDIMREAERYHGAIMVIHE---TADGQ---IFDSWEHVSSDSVQTPLEVFKCLEA  1040
             EARLK+DI+ E     G I++  E   +A  Q   +   WE+V +D ++TP EV+  L+ 
Sbjct  446   EARLKEDIISEIRHCGGRILLHREEYNSASNQSTTVIGYWENVFADDIRTPAEVYAMLKN  505

Query  1041  -EGFPIKYARIPITDDKAPKSSDFDTLAL-NIASASKYTALVFNCQMGIGRTTTGTVIAC  1214
              EG  I Y RIP+T  +   +SD D++      SA  Y   +F    G G       I C
Sbjct  506   DEGCNISYQRIPLTRGREALASDVDSIQYRKDNSAGSY---LFVSHTGFGGVAYALAIIC  562

Query  1215  LVKLRIDYGRPIR  1253
             L  L  D    IR
Sbjct  563   L-SLEADESLAIR  574


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 58/113 (51%), Gaps = 4/113 (4%)
 Frame = +2

Query  131  AIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD---E  301
            A + G+Y  I SLIRVL  G E K  VD VIDRC+   +LR+ I  YR  + + PD   +
Sbjct  598  ARKMGDYRDILSLIRVLVSGPESKADVDFVIDRCSGAGHLRDDILQYREEVEKLPDNNGD  657

Query  302  MKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAEKRPDGCTRLCK  460
             +R   +   V+ L RY  LI F  YL++        S   E RP+  T LC 
Sbjct  658  ERRAFLIDMGVKALRRYFLLIAFRSYLYSRPGVEFSFSDWMEGRPE-LTHLCS  709


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +3

Query  1917  VRLMFTRCAGAGHLREDIIYFTKELKKFPDDD-DEHRAYLMDMGIRALR  2060
             V  +  RC+GAGHLR+DI+ + +E++K PD++ DE RA+L+DMG++ALR
Sbjct  624   VDFVIDRCSGAGHLRDDILQYREEVEKLPDNNGDERRAFLIDMGVKALR  672


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = +2

Query  119  NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPD  298
            + +D+    +  ++  + R+ + GV  ++ +D VIDRC+++QN+R+A+  YR    +Q  
Sbjct  171  SCDDSFGINDILLLSKITRLFDNGVACREVLDYVIDRCSALQNIRQAVLQYRQLYNQQHV  230

Query  299  E-MKREAALSFFVEYLERY*FLICFAVYLHTE  391
            E  +R  AL+   EYLERY  LI FA YL +E
Sbjct  231  EPRERRVALNRGAEYLERYSRLIAFAAYLGSE  262


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 58/115 (50%), Gaps = 10/115 (9%)
 Frame = +2

Query  1397  LWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVA--LNR  1570
             +  + R+  +G E +  +D +IDRCS   ++R  +LQYR    +      + R A  ++ 
Sbjct  607   ILSLIRVLVSGPESKADVDFVIDRCSGAGHLRDDILQYREEVEKLPDNNGDERRAFLIDM  666

Query  1571  GAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIRL  1735
             G + L RYF LIAF +YL S     F        +F  W+  RPE+  +  +IR+
Sbjct  667   GVKALRRYFLLIAFRSYLYSRPGVEF--------SFSDWMEGRPELTHLCSNIRI  713



>ref|XP_001773894.1| predicted protein [Physcomitrella patens]
 gb|EDQ61242.1| predicted protein [Physcomitrella patens]
Length=1265

 Score =   385 bits (988),  Expect(2) = 3e-147, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 223/284 (79%), Gaps = 7/284 (2%)
 Frame = +3

Query  402   FTLLRRLLRRDPMGALGYASLKPSPANDVES----TNGRPSEMDQVAALRSGEVLGSQTV  569
             +++LRRLLRRDPMGALGY++   +P   ++     T+GRPS M+ V A R+GEVLG QTV
Sbjct  389   YSILRRLLRRDPMGALGYSN---TPVGTIKMPSKVTDGRPSRMENVVASRNGEVLGRQTV  445

Query  570   LKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVF  749
             LKSDHCPGC +  LPE LEGA NFREI  FPVYGVANPTV GI +V++R+      RPV 
Sbjct  446   LKSDHCPGCQNQFLPELLEGAPNFREIDCFPVYGVANPTVQGIHAVLERVSEGSNERPVL  505

Query  750   WHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHG  929
             WHNMREE V+YINGKPFVLREVERPYKNMLEY GID  RVE+MEARLKDDI+REAERY G
Sbjct  506   WHNMREEPVVYINGKPFVLREVERPYKNMLEYEGIDTARVEQMEARLKDDILREAERYSG  565

Query  930   AIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDF  1109
             AIMV HET DG IFD+WE V    VQTPLEVF+CL+AEG  ++Y R+PITD KAPKSSDF
Sbjct  566   AIMVNHETEDGLIFDAWEPVGPGVVQTPLEVFECLKAEGVRVEYGRVPITDGKAPKSSDF  625

Query  1110  DTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYG  1241
               LA  IA+A + TA VFNCQMG GRTTTG V ACLV LR++ G
Sbjct  626   SALAARIAAAPRDTAFVFNCQMGRGRTTTGMVTACLVLLRLEIG  669


 Score =   167 bits (423),  Expect(2) = 3e-147, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            G+PR++S+G +          +P++E+A+RRGEY VIRSLIRVLEGGVEGK+QVDKVID 
Sbjct  250  GLPRSSSMGTIHEARDEMVYDVPDTEEALRRGEYAVIRSLIRVLEGGVEGKRQVDKVIDS  309

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C++MQNLREAIA+YR+SI+RQ DE KR A LSFFVEYLERY FLICFAVY+HT++  L  
Sbjct  310  CSAMQNLREAIASYRSSIVRQADEKKRAAGLSFFVEYLERYYFLICFAVYIHTDKTCLGS  369

Query  410  T  412
            T
Sbjct  370  T  370


 Score =   273 bits (699),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 174/240 (73%), Gaps = 2/240 (1%)
 Frame = +3

Query  513   EMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGVANPTVS  692
             E + V   R+G VLG +T+LKSDH PGC +  L   +EGA N+R++   PVYGVA PTV 
Sbjct  6     EPEDVIISRNGSVLGKKTILKSDHFPGCQNKRLLPHVEGAPNYRQVGNKPVYGVAIPTVD  65

Query  693   GILSVIQRIGSSKEG-RPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGIDCERV  869
             GI  +++ IG+SK G + V WHN+REE VIY+NG+PFVLREVERP+ N LEYTGI+ +RV
Sbjct  66    GIRRILELIGASKYGCQRVLWHNLREEPVIYVNGRPFVLREVERPFSN-LEYTGINRQRV  124

Query  870   ERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCLEAEGF  1049
             E+ME+RLK+D++ EA RY   IMV  E  DGQ+ D WE V  +S+QTP EV++ L+AEG+
Sbjct  125   EQMESRLKEDVLLEAARYANKIMVSDELPDGQMIDQWEPVGPNSIQTPFEVYESLQAEGY  184

Query  1050  PIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIACLVKLR  1229
              + Y RIPITD+K+PK  DFD+L   ++     T LVFNCQMG GRTTTG VIA L+  +
Sbjct  185   LVDYERIPITDEKSPKVRDFDSLVQRLSQVEFGTKLVFNCQMGRGRTTTGMVIATLIHFK  244


 Score =   242 bits (618),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 143/191 (75%), Gaps = 3/191 (2%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER  1552
             F ++DI ++ KITRL DNG  CR ALDA+ID C A+QN+RQAVL YRR FN Q+ E   R
Sbjct  716   FVMDDIPIVRKITRLLDNGAACRAALDAVIDHCDAMQNLRQAVLHYRRAFNDQKLEHYAR  775

Query  1553  RVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIR  1732
             R AL RG EYLERY  LI FAAYL SDA DG+C +G S TTFK WLH+ PEV+ MKWS+R
Sbjct  776   RAALTRGIEYLERYLMLIGFAAYLNSDASDGYC-RGGSGTTFKAWLHRHPEVKQMKWSMR  834

Query  1733  LRPGRFFTIPE-ELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSS-HI  1906
             LRP R FTI E E +T  E    D+VMEA+VK RNGS+LGK SIL MYFFPGQ+T+S H+
Sbjct  835   LRPTRVFTINEMEFKTHGENNLEDSVMEAVVKSRNGSILGKHSILKMYFFPGQKTTSDHV  894

Query  1907  QIHGAPHVYKV  1939
              I GAPHV KV
Sbjct  895   PITGAPHVCKV  905


 Score =   144 bits (362),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/249 (35%), Positives = 131/249 (53%), Gaps = 9/249 (4%)
 Frame = +3

Query  495   TNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPERLEGALNFREIPGFPVYGV  674
              N   S M+ V   R+G +LG  ++LK    PG    S    + GA +  ++ GFPV+ +
Sbjct  854   NNLEDSVMEAVVKSRNGSILGKHSILKMYFFPGQKTTSDHVPITGAPHVCKVEGFPVHSM  913

Query  675   ANPTVSGILSVIQRI---GSSKEGRPVFWHNMREEHVIYINGKPFVLREVERPYKNMLEY  845
             A PT+ G   V+  +    S    R     ++REE V+YI+G PFVLREVE+P  + L++
Sbjct  914   ATPTIEGAKGVLSHLLAEPSCGMQRKAVVTDLREEVVVYIHGNPFVLREVEQP-ASTLKH  972

Query  846   TGIDCERVERMEARLKDDIMREAERYHGAIMVIHE-----TADGQIFDSWEHVSSDSVQT  1010
              G+    VE+ME+RLK+DI+ EAER  G +++  E     T    I   WE +S++ VQT
Sbjct  973   VGVKGHVVEQMESRLKNDIIAEAERTGGRMLLHKEEYNPITGHSDIIGYWEVISAEDVQT  1032

Query  1011  PLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRT  1190
             P EV+  L  EG+ + Y R+P+T ++A  +SD D +   +  A       F    G G  
Sbjct  1033  PAEVYAGLRQEGYNVDYQRVPLTRERAALASDVDVIHQRLDEAGPGVEYCFISHTGFGGI  1092

Query  1191  TTGTVIACL  1217
                  + CL
Sbjct  1093  AYAMSMTCL  1101


 Score = 89.0 bits (219),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 99/189 (52%), Gaps = 8/189 (4%)
 Frame = +2

Query  1394  LLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRG  1573
             ++  + R+ + GVE +  +D +ID CSA+QN+R+A+  YR    +Q  E ++R   L+  
Sbjct  285   VIRSLIRVLEGGVEGKRQVDKVIDSCSAMQNLREAIASYRSSIVRQADE-KKRAAGLSFF  343

Query  1574  AEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQA-MKWSIRLRP---  1741
              EYLERY+ LI FA Y+ +D              F+ W+  RPE+ + ++  +R  P   
Sbjct  344   VEYLERYYFLICFAVYIHTDKTCLGSTHRPGQGGFEQWMRDRPELYSILRRLLRRDPMGA  403

Query  1742  -GRFFTIPEELRTPHELKHG-DAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQ-I  1912
              G   T    ++ P ++  G  + ME +V  RNG VLG+ ++L     PG +     + +
Sbjct  404   LGYSNTPVGTIKMPSKVTDGRPSRMENVVASRNGEVLGRQTVLKSDHCPGCQNQFLPELL  463

Query  1913  HGAPHVYKV  1939
              GAP+  ++
Sbjct  464   EGAPNFREI  472


 Score = 67.4 bits (163),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDE-MKREAALSFF  331
            ++R + R+L+ G   +  +D VID C +MQNLR+A+  YR +   Q  E   R AAL+  
Sbjct  723  IVRKITRLLDNGAACRAALDAVIDHCDAMQNLRQAVLHYRRAFNDQKLEHYARRAALTRG  782

Query  332  VEYLERY*FLICFAVYLHTE  391
            +EYLERY  LI FA YL+++
Sbjct  783  IEYLERYLMLIGFAAYLNSD  802


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 66/133 (50%), Gaps = 5/133 (4%)
 Frame = +2

Query  1346  RPKKDSSHEFGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFN  1525
             RP  D+   F   D   +  +TR+  +G   +  +D +IDRC    ++R  + +Y+   +
Sbjct  1136  RPANDT-EAFRQGDYRDISSLTRVLASGPASKTEVDVVIDRCGGAGHLRDDIFEYKVQLD  1194

Query  1526  QQRTEPRERR-VALNRGAEYLERYFRLIAFAAYL-GSDAFDGFCGQGESMTTFKHWLHQR  1699
                    ERR   L+ G   L RYF LIAF +YL    AF G    GE  T+F  W+  R
Sbjct  1195  SFSNAEDERRDFVLDMGINALRRYFFLIAFRSYLFNRVAFHGNACAGE--TSFSAWMKAR  1252

Query  1700  PEVQAMKWSIRLR  1738
             PE+  +  +++L+
Sbjct  1253  PELGHLCDNLKLK  1265


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 54/106 (51%), Gaps = 5/106 (5%)
 Frame = +2

Query  119   NSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYR---NSILR  289
             N  +A R+G+Y  I SL RVL  G   K +VD VIDRC    +LR+ I  Y+   +S   
Sbjct  1139  NDTEAFRQGDYRDISSLTRVLASGPASKTEVDVVIDRCGGAGHLRDDIFEYKVQLDSFSN  1198

Query  290   QPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHPTSQVAE  427
               DE +R+  L   +  L RY FLI F  YL   R A H  +   E
Sbjct  1199  AEDE-RRDFVLDMGINALRRYFFLIAFRSYLFN-RVAFHGNACAGE  1242


 Score = 55.1 bits (131),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  1908  KFMVRLMFTRCAGAGHLREDIIYFTKELKKFPDDDDEHRAYLMDMGIRALR  2060
             K  V ++  RC GAGHLR+DI  +  +L  F + +DE R +++DMGI ALR
Sbjct  1166  KTEVDVVIDRCGGAGHLRDDIFEYKVQLDSFSNAEDERRDFVLDMGINALR  1216



>gb|EMT06697.1| hypothetical protein F775_21513 [Aegilops tauschii]
Length=913

 Score =   452 bits (1162),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 211/278 (76%), Positives = 247/278 (89%), Gaps = 0/278 (0%)
 Frame = +3

Query  417   RLLRRDPMGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGC  596
             RLLRRDPMGALGY+S KP+    +ES +GRP EMD VAA+R+GEVLG QTVLKSDHCPGC
Sbjct  372   RLLRRDPMGALGYSSSKPTLPKIIESADGRPHEMDVVAAMRNGEVLGRQTVLKSDHCPGC  431

Query  597   HHPSLPERLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNMREEHV  776
             H+ +LPER+EGA NFREIPGF VYGVANPTV GI +VIQR+ +SK  RP+ WHNMREE V
Sbjct  432   HNLNLPERVEGAPNFREIPGFSVYGVANPTVDGIRAVIQRVSTSKGNRPILWHNMREEPV  491

Query  777   IYINGKPFVLREVERPYKNMLEYTGIDCERVERMEARLKDDIMREAERYHGAIMVIHETA  956
             IYI+GKPFVLREVERPYKNMLEYTGI  +RVERMEARLK+DI+REAERY GAIMVIHET 
Sbjct  492   IYIHGKPFVLREVERPYKNMLEYTGIGRDRVERMEARLKEDILREAERYDGAIMVIHETD  551

Query  957   DGQIFDSWEHVSSDSVQTPLEVFKCLEAEGFPIKYARIPITDDKAPKSSDFDTLALNIAS  1136
             +G+IFD+WE+V++++V TPLEV+KCL++EG PIKYAR+PITD KAPKSSDFDT+A N+A+
Sbjct  552   NGEIFDAWENVNNEAVLTPLEVYKCLDSEGLPIKYARVPITDGKAPKSSDFDTVAFNVAA  611

Query  1137  ASKYTALVFNCQMGIGRTTTGTVIACLVKLRIDYGRPI  1250
             A K  ALVFNCQMG GRTTTGTVIACL++LRI++GRPI
Sbjct  612   ACKDAALVFNCQMGRGRTTTGTVIACLLRLRINHGRPI  649


 Score =   294 bits (752),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 155/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  1373  FGINDILLLWKITRLFDNGVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRER  1552
             F INDILLL KITRLFDNG+ECR+ LD +ID+CSALQNIRQAVLQY ++ +QQ  EPR R
Sbjct  696   FDINDILLLRKITRLFDNGIECRQILDTVIDKCSALQNIRQAVLQYTKVISQQNMEPRVR  755

Query  1553  RVALNRGAEYLERYFRLIAFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAMKWSIR  1732
             RVALNRGAEYLERY +LIAF+AYLGS+AFDGFCGQGE+  +FK+WL QRPE+Q MKWSIR
Sbjct  756   RVALNRGAEYLERYLKLIAFSAYLGSEAFDGFCGQGETKISFKNWLQQRPEIQTMKWSIR  815

Query  1733  LRPGRFFTIPEELRTPHELKHGDAVMEAIVKDRNGSVLGKGSILTMYFFPGQRTSSHIQI  1912
             LRPGRFFT+P+E +   +    D  MEAIVK RNGSVLGKGSIL MYFFPGQR SS +  
Sbjct  816   LRPGRFFTVPDEHKATCQPLQSDVTMEAIVKARNGSVLGKGSILKMYFFPGQRRSSSMNF  875

Query  1913  HGAPHVYK  1936
              G PHV K
Sbjct  876   RGTPHVIK  883


 Score =   216 bits (550),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 137/184 (74%), Gaps = 3/184 (2%)
 Frame = +3

Query  681   PTVSGILSVIQRIGSSKEGRP--VFWHNMREEHVIYINGKPFVLREVERPYKNMLEYTGI  854
             PT+ GI++V+  IG+ K+G+   V WH++REE VIYING+PFVLR+ ERP+ N LEYTGI
Sbjct  2     PTMEGIVNVLNHIGAQKKGKQTRVLWHSLREEPVIYINGRPFVLRDAERPFSN-LEYTGI  60

Query  855   DCERVERMEARLKDDIMREAERYHGAIMVIHETADGQIFDSWEHVSSDSVQTPLEVFKCL  1034
             + ERVE+ME RLK+DI++EA RY   I+V  E  +GQ+ D WE V SD+V+TPLEV++ L
Sbjct  61    NRERVEQMEFRLKEDILQEASRYGNKILVTDELPNGQMVDQWESVISDTVKTPLEVYEEL  120

Query  1035  EAEGFPIKYARIPITDDKAPKSSDFDTLALNIASASKYTALVFNCQMGIGRTTTGTVIAC  1214
             + +G+ + Y R+PITD+KAPK  DFD L   I+     T +VFNCQMG GRTTTG VI+ 
Sbjct  121   QHQGYLVDYERVPITDEKAPKEGDFDNLVHRISQVDMETEIVFNCQMGRGRTTTGMVIST  180

Query  1215  LVKL  1226
             LV L
Sbjct  181   LVYL  184


 Score =   172 bits (437),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 98/122 (80%), Gaps = 5/122 (4%)
 Frame = +2

Query  50   GIPRTNSIGRVSSCGANATDIMPNSEDAIRRGEYTVIRSLIRVLEGGVEGKKQVDKVIDR  229
            GIPRT+SIG+V   G +  D  P+SE+AI RGEY VIRSL     GGVEGK+QVDKVID+
Sbjct  191  GIPRTSSIGKVFYAGNDVDDYSPSSEEAILRGEYAVIRSL-----GGVEGKRQVDKVIDK  245

Query  230  CASMQNLREAIATYRNSILRQPDEMKREAALSFFVEYLERY*FLICFAVYLHTERDALHP  409
            C SMQNLREAIATYRNS LRQPDEMKREA+LSFFVEYLERY FLICFAVY+H+   A   
Sbjct  246  CDSMQNLREAIATYRNSTLRQPDEMKREASLSFFVEYLERYYFLICFAVYVHSVSSAHQA  305

Query  410  TS  415
            TS
Sbjct  306  TS  307


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  155  VIRSLIRVLEGGVEGKKQVDKVIDRCASMQNLREAIATYRNSILRQPDEMK-REAALSFF  331
            ++R + R+ + G+E ++ +D VID+C+++QN+R+A+  Y   I +Q  E + R  AL+  
Sbjct  703  LLRKITRLFDNGIECRQILDTVIDKCSALQNIRQAVLQYTKVISQQNMEPRVRRVALNRG  762

Query  332  VEYLERY*FLICFAVYLHTE  391
             EYLERY  LI F+ YL +E
Sbjct  763  AEYLERYLKLIAFSAYLGSE  782


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 54/97 (56%), Gaps = 3/97 (3%)
 Frame = +2

Query  1427  GVECREALDAIIDRCSALQNIRQAVLQYRRLFNQQRTEPRERRVALNRGAEYLERYFRLI  1606
             GVE +  +D +ID+C ++QN+R+A+  YR    +Q  E + R  +L+   EYLERY+ LI
Sbjct  232   GVEGKRQVDKVIDKCDSMQNLREAIATYRNSTLRQPDEMK-REASLSFFVEYLERYYFLI  290

Query  1607  AFAAYLGSDAFDGFCGQGESMTTFKHWLHQRPEVQAM  1717
              FA Y+ S           S   F  W+  RPE+ ++
Sbjct  291   CFAVYVHS--VSSAHQATSSGVNFSDWMRARPELYSI  325



>gb|EMS46929.1| hypothetical protein TRIUR3_15351 [Triticum urartu]
Length=539

 Score =   434 bits (1117),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 204/271 (75%), Positives = 239/271 (88%), Gaps = 0/271 (0%)
 Frame = +3

Query  438   MGALGYASLKPSPANDVESTNGRPSEMDQVAALRSGEVLGSQTVLKSDHCPGCHHPSLPE  617
             MGALGY+S KP+    +ES +GRP EMD VAA+R+GEVLG QTVLKSDHCPGCH+ +LPE
Sbjct  1     MGALGYSSSKPTLPKIIESADGRPHEMDVVAAMRNGEVLGRQTVLKSDHCPGCHNLNLPE  60

Query  618   RLEGALNFREIPGFPVYGVANPTVSGILSVIQRIGSSKEGRPVFWHNMREEHVIYINGKP  797